WO2014184528A1 - Bacteriophage - Google Patents

Bacteriophage Download PDF

Info

Publication number
WO2014184528A1
WO2014184528A1 PCT/GB2014/051446 GB2014051446W WO2014184528A1 WO 2014184528 A1 WO2014184528 A1 WO 2014184528A1 GB 2014051446 W GB2014051446 W GB 2014051446W WO 2014184528 A1 WO2014184528 A1 WO 2014184528A1
Authority
WO
WIPO (PCT)
Prior art keywords
bacteriophage
phage
peptide
coat protein
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2014/051446
Other languages
French (fr)
Inventor
Amin Hajitou
Teerapong YATA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ip2ipo Innovations Ltd
Original Assignee
Imperial Innovations Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Imperial Innovations Ltd filed Critical Imperial Innovations Ltd
Priority to US14/889,805 priority Critical patent/US10799542B2/en
Priority to AU2014267044A priority patent/AU2014267044A1/en
Priority to EP14723873.7A priority patent/EP2997148B1/en
Publication of WO2014184528A1 publication Critical patent/WO2014184528A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66Microorganisms or materials therefrom
    • A61K35/76Viruses; Subviral particles; Bacteriophages
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/09Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2795/00Bacteriophages
    • C12N2795/00011Details
    • C12N2795/10011Details dsDNA Bacteriophages
    • C12N2795/10041Use of virus, viral particle or viral elements as a vector
    • C12N2795/10043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2795/00Bacteriophages
    • C12N2795/00011Details
    • C12N2795/10011Details dsDNA Bacteriophages
    • C12N2795/10041Use of virus, viral particle or viral elements as a vector
    • C12N2795/10045Special targeting system for viral vectors

Definitions

  • the present invention relates to bacteriophages, and, in particular to novel
  • multifunctional bacteriophages and their uses for the delivery of transgenes in a variety of gene therapy applications, vaccine delivery and imaging techniques, as well as the simultaneous expression of functional foreign proteins, peptides, antigens or antibodies displayed on the capsid of the multifunctional bacteriophage.
  • bacteriophage viruses are still considered to be poor vectors for gene transfer limiting their application in a broad range of disciplines including gene therapy and DNA vaccine delivery. It is clear that phage has evolved to infect bacteria only and has no optimized strategies to transfer and express transgenes in mammalian cells. Previous work has shown that phage gene transfer efficacy is amenable to evolve and that one efficient strategy is to combine bacteriophage with the attributes of animal viruses. For example, incorporating the genetic cis-elements ITR from the animal virus AAV-2 into the phage genome resulted in altered transgene cassette and subsequent enhanced gene delivery efficacy of bacteriophage.
  • the ideal bacteriophage vector would be a phage that is capable of combining multiple strategies for resolving the mammalian cell barriers into a single viral particle, in addition to effecting transgene expression.
  • the inventors have therefore developed a novel multifunctional bacteriophage based on the targeted M13 filamentous bacteriophage, which exhibits a number of novel functionalities.
  • a recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the bacteriophage to a target cell, a second nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display a foreign peptide thereon, and a transgene which encodes a protein which exerts a biological effect on the target cell.
  • bacteriophages are viruses that infect and replicate within bacteria.
  • the advantage of using bacteriophages as gene delivery vectors, as opposed to other regular viruses, is that they do not naturally infect nonbacterial cells, such as mammalian cells, unless they are genetically modified to specifically do so.
  • the inventors have designed a highly effective and novel multifunctional bacteriophage in accordance with the first aspect, which is based on a targeted M13 RGD4C-phage, and which simultaneously carries out multiple functions.
  • the bacteriophage of the invention comprises a pill minor coat protein which displays the cell-targeting ligand (e.g. RGD4C), which enables highly targeted delivery to the target cell, for example a tumour cell.
  • the bacteriophage of the invention enables the display of large foreign functional peptides on its surface via the pVIII major coat protein.
  • the phage also enables expression, in the target cell (or tissue) that has been transduced with the phage, of the transgene, which is preferably inserted in an intergenomic region of the bacteriophage's genome.
  • a targeted bacteriophage to deliver a transgene to a target cell, in which the phage comprises one or more pVIII capsid major coat proteins for display foreign peptides thereon.
  • the advantage of constructing a targeted bacteriophage with more than one pVIII major coat protein is that (i) it provides the choice to use one pVIII major coat protein for the display of large foreign peptide or proteins while keeping the wild type pVIII intact, which is important to achieve efficient phage assembly and subsequently high titers of the phage vector, (ii) it allows the display of a considerable copy number of the peptide in order to yield a phage which displays hundreds or even thousands of functional foreign peptides, and (iii) it offers the possibility of the simultaneous display of two different functional peptides on the capsid of a single bacteriophage particle.
  • a foreign peptide or protein is one that is not normally or naturally expressed by the phage, i.e. it can be heterologous.
  • This new class of targeted multifunctional phage will advance targeted gene and peptide delivery in a broad range of applications, including gene therapy, DNA vaccines and imaging techniques.
  • Examples of the bacteriophage preferably include any negatively charged
  • bacteriophage and more preferably one of the filamentous phages, such as Fi, Fd or M13.
  • filamentous phages such as Fi, Fd or M13.
  • a most preferred bacteriophage according to the invention is M13.
  • the inventors have developed a novel Mi3-based phage based on (i) the fUSEs phage, the sequence of which is found at GenBank Accession Number AF218364, and (ii) the f88.4 phage, the sequence of which is found at
  • the fUSEs phage comprises a single gene encoding a major coat protein pVIII, whereas the f88.4 phage comprises two genes encoding two different embodiments of the pVIII protein, namely wild-type and recombinant pVIII.
  • the second nucleic acid sequence encodes a wild-type pVIII capsid major coat protein.
  • the DNA sequence encoding one embodiment of a wild-type pVIII capsid major coat protein is represented herein as SEQ ID No: 1, as follows: atgaaaaagtctttagtcctcaaagcctccgtagccgttgctaccctcgttccgatgctg
  • the second nucleic acid sequence encoding a wild-type pVIII capsid major coat protein comprises a nucleotide sequence substantially as set out in SEQ ID No: l, or a functional variant or fragment thereof.
  • SEQ ID No: 2 One embodiment of the polypeptide sequence of a wild-type pVIII capsid major coat protein is provided herein as SEQ ID No: 2, as follows:
  • the wild-type pVIII capsid major coat protein comprises an amino acid sequence substantially as set out in SEQ ID No: 2, or a functional variant or fragment thereof.
  • the second nucleic acid sequence encodes a recombinant pVIII capsid major coat protein.
  • the DNA sequence encoding one embodiment of a recombinant pVIII capsid major coat protein is represented herein as SEQ ID No: 3, as follows: atgaaaaagtctttagttcttaaagcatctgttgctgttgcgactcttgttcctatgcta
  • the second nucleic acid sequence encoding a recombinant pVIII capsid major coat protein comprises a nucleic acid sequence substantially as set out in SEQ ID No:3, or a functional variant or fragment thereof
  • polypeptide sequence of a recombinant pVIII capsid major coat protein is provided herein as SEQ ID No: 4, as follows:
  • the recombinant pVIII capsid major coat protein comprises an amino acid sequence substantially as set out in SEQ ID No:4, or a functional variant or fragment thereof.
  • the recombinant gene VIII is synthetic and differs in nucleotide sequence from the wild-type gene (though it largely encodes the wild-type amino acid sequence).
  • a solution to overcome this is to construct a phage in which the genome bears two VIII genes, encoding two different types of pVIII molecule.
  • the recombinant gene VIII is synthetic and differs in nucleotide sequence from the wild-type gene (though it largely encodes the wild-type amino acid sequence).
  • This allows hybrid pVIII proteins with quite large foreign peptides to be displayed on the virion surface.
  • one pVIII i.e. recombinant pVIII
  • the other one i.e. wild type pVIII
  • the bacteriophage of the invention comprises a second nucleic acid sequence which encodes the wild-type pVIII capsid major coat protein and third nucleic acid sequence which encodes a recombinant pVIII capsid major coat protein, or vice versa.
  • the bacteriophage preferably comprises a nucleic acid sequence substantially as set out in SEQ ID No: 1 and 3, or a functional variant or fragment thereof.
  • the bacteriophage comprises a wild- type and a recombinant pVIII capsid major coat protein which comprise an amino acid sequence substantially as set out in SEQ ID No: 2 and 4, or a functional variant or fragment thereof.
  • the wild-type pVIII capsid major coat protein and/or the recombinant pVIII capsid major coat protein is configured to display a foreign peptide thereon.
  • a nucleic acid encoding the foreign peptide is fused in frame with the pVIII coding gene.
  • the inventors have constructed a phage displaying the two well-characterized peptides, i.e. a streptavidin- binding peptide and a gold-binding peptide, as illustrated in Figures 1 and 2.
  • the pVIII capsid major coat protein is preferably configured to display a streptavidin-binding peptide.
  • the amino acid sequence of the streptavidin-binding peptide may comprise ANRLCHPQFPCTSHE [SEQ ID No: 5], or a functional fragment or variant thereof. Since this peptide comprises over ten amino acids, it is preferred that the coding sequence of the streptavidin-binding peptide is fused in frame with the recombinant pVIII coding gene.
  • the pVIII capsid major coat protein is preferably configured to display a gold-binding peptide.
  • the amino acid sequence of the gold- binding peptide may comprise VSGSSPDS [SEQ ID No: 6], or a functional fragment or variant thereof. Since this peptide comprises less than ten amino acids, the coding sequence of the gold-binding peptide is preferably fused in frame with the wild-type pVIII coding gene. However, this peptide may be displayed on the recombinant pVIII capsid major coat protein, where two short peptides (i.e. less than ten amino acids) are displayed.
  • the fUSEs phage also comprises a gene which encodes a pill capsid minor coat protein on which the cell- targeting ligand may be displayed.
  • the choice of cell -targeting ligand depends on the target cell, which will depend on the specification application of the phage, be it therapeutic, in vaccine delivery or in imaging.
  • the cell-targeting ligand may be a tumour-targeting ligand.
  • the ligand may comprise the RGD4C ligand (see the Examples), which will be known to the skilled person.
  • a phage displaying the cyclic RGD4C (CDCRGDCFC) peptide ligand targets overexpressed oc v integrin receptors found in tumours.
  • the RGD4C ligand is a suitable cell-targeting ligand for targeting cancer cells and tumours in general.
  • the bacteriophage cell-targeting ligand displayed on the pill capsid minor coat protein is specific for a protein (e.g. a receptor) expressed on the target cell/tissue, so as to enable targeted delivery of the phage thereto.
  • the DNA sequence encoding one embodiment of a pill capsid minor coat protein is represented herein as SEQ ID No: 7, as follows: gtgaaaaattattattcgcaattcctttagttgttcctttctattctcactcggccgtg
  • the first nucleic acid sequence encoding the pill capsid minor coat protein comprises a nucleic acid sequence substantially as set out in SEQ ID No: 7, or a functional variant or fragment thereof.
  • polypeptide sequence of a pill capsid minor coat protein is provided herein as SEQ ID No:8, as follows:
  • the pill capsid minor coat protein comprises an amino acid sequence substantially as set out in SEQ ID No: 8, or a functional variant or fragment thereof.
  • the bacteriophage of the first aspect comprises a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the phage to a target cell, a second nucleic acid sequence encoding a wild type pVIII capsid major coat protein, a third nucleic acid sequence encoding a recombinant pVIII capsid major coat protein, wherein either or both of the major coat proteins is configured to display a foreign peptide thereon, and a transgene which encodes a protein which exerts a biological effect on the target cell.
  • the transgene may be any gene encoding a protein, which may have therapeutic or industrial utility in the target cell.
  • the transgene may encode the Herpes simplex virus tyrosine kinase gene, which may subsequently exert a therapeutic effect on the target cell.
  • the inventors have demonstrated that the bacteriophage of the invention can be efficiently targeted to, and transduce tumor cells, which are subsequently killed.
  • the type of cell, which is targeted by the phage depends on the type of cell-targeting ligand expressed on the surface of the bacteriophage.
  • tumor cells are used illustratively to show that the complex of the invention exhibit a significantly improved transduction.
  • Recombinant bacteriophages may include a variety of other functional elements in addition to the promoter, and the coding sequence encoding protein responsible for producing the therapeutic effect.
  • the recombinant phage may be designed such that it integrates into the genome of a host cell.
  • DNA sequences which favour targeted integration (e.g. by homologous recombination) are envisaged.
  • the bacteriophage may be used as a recombinant vector for the delivery of the transgene to a tissue specific target, irrespective of whether the vector is administered systemically or locally to a subject in vivo, applied to a mixture of cells in vitro, or applied to an organ ex vivo.
  • the nucleic acid may be DNA, which may be genomic DNA or cDNA. Non-naturally occurring cDNA may be preferred in some embodiments.
  • the nucleic acid may be RNA, such as antisense RNA or shRNA.
  • the inventors investigated whether the multifunctional bacteriophage of the first aspect could be modified to further improve its gene transfer efficiency.
  • the inventors realized that the major intracellular obstacle to a
  • bacteriophage and transgene expression is its sequestration in the lysosomes of the host target cell, and so they developed a phage which displays a peptide on its pVIII major coat protein, which assists the phage to escape from endosomes in order to avoid its degradation in the lysosomes.
  • EEP endosome escape peptide
  • the foreign peptide which is displayed on the pVIII capsid major coat protein comprises an endosome escape peptide (EEP).
  • EEP endosome escape peptide
  • the bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display an endosome escape peptide (EEP) thereon, and a transgene which encodes a protein which exerts a biological effect on a target cell transduced by the bacteriophage.
  • EEP endosome escape peptide
  • the bacteriophage of the second aspect comprises a nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the bacteriophage to the target cell.
  • Endosome escape peptides are known for their potential to promote escape of vectors from endosomes by inducing disruption of endosomes (endosmolytic peptides) or by fusion with the endosomal membranes (fusogenic peptides). Accordingly, in one embodiment, the EEP is an endosmolytic peptide. In another embodiment, the EEP is a fusogenic peptide.
  • An embodiment of the sequence of the H5WYG peptide is:
  • GLFHAIAHFIHGGWHGLIHGWYG GLFHAIAHFIHGGWHGLIHGWYG [SEQ ID NO: 9].
  • An embodiment of the sequence of the INF7 peptide is: GLFEAIEGFIENGWEGMID GWYG [SEQ ID NO: 10].
  • An embodiment of the sequence of the PCi peptide is: H WYD SFVPWGH Q [SEQ ID NO: 11].
  • the endosome escape peptide maybe selected from a group consisting of: the H5WYG peptide (SEQ ID No: 9), the INF7 peptide (SEQ ID No: 10), and the PCi (SEQ ID No: 11) peptide, or a functional fragment or variant thereof.
  • the EEP is the H5WYG peptide or the PCi peptide, or a functional fragment or variant thereof.
  • the EEP is displayed on the recombinant pVIII capsid major coat protein.
  • the coding sequence of the EEP is fused in frame with the
  • the bacteriophage of the first or second aspect comprises a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the phage to a target cell, a second nucleic acid sequence encoding a wild type pVIII capsid major coat protein, a third nucleic acid sequence encoding a recombinant pVIII capsid major coat protein, wherein either or both of the major coat proteins is configured to display an EEP, and a transgene which encodes a protein which exerts a biological effect on the target cell.
  • the inventors also looked at the rate of transport of the bacteriophage of the invention to the nucleus, as they believed that this represents another rate-limiting step to transgene expression. As described in the Examples, the inventors found that when the bacteriophage displays a nuclear localization signal (NLS) peptide, it also surprisingly improved the levels of transgene expression. Accordingly, preferably the foreign peptide which is displayed on the pVIII capsid major coat protein comprises a nuclear localization signal (NLS) peptide. The inventors believe that this is another important feature of the invention.
  • NLS nuclear localization signal
  • a recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display a nuclear localization signal (NLS) peptide thereon, and a transgene which encodes a protein which exerts a biological effect on a target cell transduced by the bacteriophage.
  • NLS nuclear localization signal
  • the bacteriophage of the third aspect comprises a nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the bacteriophage to the target cell.
  • Nuclear localization signal peptides are known to the skilled person, and the inventors tested several of these, including the NLS peptide from the large tumour antigen of simian virus 40 (SV40 T antigen), optimized SV40 NLS, the optimized short M9 (0SM9), and a heptamer NLS peptide.
  • An embodiment of the sequence of the SV40 NLS is: (PKKKRKV - [SEQ ID No: 12]).
  • An embodiment of the sequence of optimized SV40 NLS is:
  • SSDDEATADAQHAAPPKKKRKV [SEQ ID N0H3]
  • An embodiment of the sequence of a non-classical NLS, optimized short M9 (0SM9) is: YNNQSSNRGPYK - [SEQ ID No: 14].
  • An embodiment of the sequence of the heptamer NLS peptide is: QPSPSPT - [SEQ ID No:l5].
  • the NLS peptide may be selected from a group consisting of: the large tumour antigen of simian virus 40 (SV40 T antigen - SEQ ID No: 12); optimized SV40 NLS (SEQ ID No: 13); the optimized short M9 (0SM9) (SEQ ID No: 14); and a heptamer NLS peptide (SEQ ID No: 15), or a functional fragment or variant thereof.
  • the NLS peptide is the large tumour antigen of simian virus 40 (SV40 T antigen), the optimized SV40 NLS or the optimized short M9 (0SM9), or a functional fragment or variant thereof.
  • the NLS peptide is displayed on the recombinant pVIII capsid major coat protein.
  • the coding sequence of the NLS peptide is fused in frame with the recombinant pVIII coding gene.
  • the bacteriophage of the first, second or third aspect comprises a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the phage to a target cell, a second nucleic acid sequence encoding a wild type pVIII capsid major coat protein, a third nucleic acid sequence encoding a recombinant pVIII capsid major coat protein, wherein one of the major coat proteins is configured to display an EEP and the other major coat protein is configured to display an NLS peptide, and a transgene which encodes a protein which exerts a biological effect on the target cell.
  • the inventors have appreciated that the negative charge of the M13 bacteriophage surface plays a crucial role in the extracellular barriers to phage due to the generation of high non-specific binding to positively charged molecules (around 35% of proteins in the human proteome).
  • the inventors have therefore used a genetic approach to change the negative N-term of the major wild type (wt) pVIII coat protein into a mixture of anionic and cationic terminal groups by introducing a short charged neutralizing peptide termed AKAS (Ala-Lys-Ala-Ser). They have found that the incorporation of the AKAS peptide into the coat protein resulted in neutralisation of the negative charge, and even resulted in a net positive charge on the phage.
  • AKAS Al-Lys-Ala-Ser
  • the wild type pVIII major coat protein of the bacteriophage of the first aspect comprises an N-terminal modification which neutralises the negative charge of the surface of the phage, and preferably results in a net positive charge at physiological pH.
  • the modification preferably comprises a tetrapeptide comprising the amino acid sequence AKAS located in the N-terminal of the major coat wt pVIII protein, and preferably between residues Gly3 and Asp4 of the protein.
  • the targeted bacteriophage according to the first, second or third aspect, for use in therapy or diagnosis.
  • the invention may be used for the treatment of a wide variety of diseases due to the target-specific nature and the improved transduction efficiency of the recombinant bacteriophage of the invention. Consequently, the therapeutic opportunities of recombinant bacteriophages used in gene therapy may be significantly increased by the invention due to (i) minimisation of any side-effects, which may occur due to off-target effects of the recombinant bacteriophage, and (ii) significantly improved target-specific cellular transduction.
  • the invention may be used prophylactically to prevent disease, or after the development of a disease, to ameliorate/treat it.
  • the targeted bacteriophage according to the first, second or third aspect for use in a gene therapy technique.
  • a method of treating, preventing or ameliorating a disease in a subject using a gene therapy technique comprising
  • the invention may also be used to create a variety of different bacteriophages that can be used for the treatment and/ or diagnosis of a variety of diseases depending on the nature of the recombinant bacteriophage and the displayed foreign proteins.
  • the bacteriophage comprises a tumor-targeting ligand and/ or which comprises a transgene expressing an anti-tumor protein (e.g. the HSVtk gene)
  • the target cell in the gene therapy technique is preferably eukaryotic, and preferably mammalian.
  • the inventors have clearly demonstrated that the multifunctional bacteriophage of the invention exhibits elevated transgene expression in a transduced target cell. Hence, they believe that the phage will have a significant commercial value in the delivery of vaccines.
  • a vaccine comprising the bacteriophage according to the first, second or third aspect.
  • the bacteriophage for vaccine delivery.
  • the vaccine is preferably a DNA vaccine.
  • the vaccine preferably comprises a suitable adjuvant.
  • the bacteriophage vector maybe used to carry a transgene or DNA cassette encoding an antigen to stimulate the body's immune system.
  • the multifunctional phage may also be used to directly display and express the antigen of interest on the major pVIII coat proteins, thus providing a unique platform for the simultaneous delivery, by a single phage particle, of numerous antigens as vaccine DNA vaccines or proteins readily expressed on the phage surface.
  • the inventors also believe that the bacteriophage of the invention can be used in a variety of different genetic-molecular imaging techniques, such as positron emission tomography (PET) or SPECT imaging.
  • PET positron emission tomography
  • SPECT positron emission tomography
  • a ninth aspect there is provided use of the bacteriophage according to the first, second or third aspect, in a genetic-molecular imaging technique.
  • the transgene harboured by the phage may encode HSVtk and/ or the sodium/iodide symporter (NIS), and the phage is preferably used in combination with a radiolabelled substrate.
  • NIS sodium/iodide symporter
  • the human sodium/iodide symporter ⁇ NIS) imaging gene is preferably used in combination with I 12 4 for clinically applicable positron emission tomography (PET) imaging, or with I 12 5/" m Tc-pertechnetate for clinically applicable SPECT imaging.
  • the HSVtk gene is preferably used in combination with radiolabeled nucleoside analogues such as the 20-[i8F]-fluoro-20-deoxy-i-b-D-arabino-furanosyl- 5-ethyluracil ([i8F]FEAU).
  • radiolabeled nucleoside analogues such as the 20-[i8F]-fluoro-20-deoxy-i-b-D-arabino-furanosyl- 5-ethyluracil ([i8F]FEAU).
  • the recombinant bacteriophages according to the invention i.e. referred to hereinafter as "agent" maybe used in a medicament which maybe used in a monotherapy, or as an adjunct to, or in combination with, known therapies for treating, ameliorating, or preventing disease, such as cancer.
  • compositions having a number of different forms depending, in particular, on the manner in which the composition is to be used.
  • the composition may be in the form of a powder, tablet, capsule, liquid etc. or any other suitable form that maybe administered to a person or animal in need of treatment.
  • vehicle of medicaments according to the invention should be one which is well -tolerated by the subject to whom it is given.
  • Medicaments comprising the agents according to the invention may be used in a number of ways.
  • oral administration may be required, in which case the agents may be contained within a composition that may, for example, be ingested orally in the form of a tablet, capsule or liquid.
  • Compositions comprising agents of the invention may be administered by inhalation (e.g. intranasally).
  • Compositions may also be formulated for topical use. For instance, creams or ointments may be applied to the skin.
  • Agents according to the invention may also be incorporated within a slow- or delayed-release device.
  • Such devices may, for example, be inserted on or under the skin, and the medicament may be released over weeks or even months.
  • the device maybe located at least adjacent the treatment site. Such devices may be particularly advantageous when long-term treatment with agents used according to the invention is required and which would normally require frequent
  • administration e.g. at least daily injection.
  • agents and compositions according to the invention may be administered to a subject by injection into the blood stream or directly into a site requiring treatment. Injections maybe intravenous (bolus or infusion) or subcutaneous (bolus or infusion), or intradermal (bolus or infusion).
  • the amount of the agent that is required is determined by its biological activity and bioavailability, which in turn depends on the mode of administration, the physiochemical properties of the agent (i.e. bacteriophage), and whether it is being used as a monotherapy, or in a combined therapy.
  • the frequency of administration will also be influenced by the half-life of the agent within the subject being treated.
  • Optimal dosages to be administered maybe determined by those skilled in the art, and will vary with the particular agent in use, the strength of the pharmaceutical composition, the mode of administration, and the advancement of the disease. Additional factors depending on the particular subject being treated will result in a need to adjust dosages, including subject age, weight, gender, diet, and time of administration.
  • a daily dose of between o.o ⁇ g/kg of body weight and 500mg/kg of body weight of the agent according to the invention may be used. More preferably, the daily dose is between o.oimg/kg of body weight and 400mg/kg of body weight, and more preferably between o.img/kg and 200mg/kg body weight.
  • the agent may be administered before, during the or after the onset of disease.
  • the agent may be administered immediately after a subject has developed a disease.
  • Daily doses may be given systemically as a single administration (e.g. a single daily injection).
  • the agent may require administration twice or more times during a day.
  • the agent may be administered as two (or more depending upon the severity of the disease being treated) daily doses of between 25mg and 7000 mg (i.e. assuming a body weight of 70 kg).
  • a patient receiving treatment may take a first dose upon waking and then a second dose in the evening (if on a two dose regime) or at 3- or 4-hourly intervals thereafter.
  • a slow release device may be used to provide optimal doses of agents according to the invention to a patient without the need to administer repeated doses.
  • Known procedures such as those conventionally employed by the pharmaceutical industry (e.g. in vivo experimentation, clinical trials, etc.), may be used to form specific formulations comprising the bacteriophage according to the invention and precise therapeutic regimes (such as daily doses of the agent and the frequency of
  • a pharmaceutical composition comprising the bacteriophage according to the first, second or third aspect, and a pharmaceutically acceptable vehicle.
  • composition can be used in the therapeutic amelioration, prevention or treatment of any disease in a subject that is treatable with gene therapy, such as cancer.
  • the invention also provides, in an eleventh aspect, a process for making the
  • composition according to the tenth aspect, the process comprising contacting a therapeutically effective amount of the bacteriophage according to the first, second or third aspect, and a pharmaceutically acceptable vehicle.
  • a "subject” maybe a vertebrate, mammal, or domestic animal.
  • agents, compositions and medicaments according to the invention may be used to treat any mammal, for example livestock (e.g. a horse), pets, or may be used in other mammals.
  • the subject is a human being.
  • a “therapeutically effective amount” of agent is any amount which, when administered to a subject, is the amount of drug that is needed to treat the target disease, or produce the desired effect, e.g. result in tumor killing.
  • the therapeutically effective amount of agent used may be from about o.oi mg to about 8oo mg, and preferably from about o.oi mg to about 500 mg.
  • a "pharmaceutically acceptable vehicle” as referred to herein, is any known
  • the pharmaceutically acceptable vehicle may be a solid, and the composition may be in the form of a powder or tablet.
  • a solid pharmaceutically acceptable vehicle may include one or more substances which may also act as flavouring agents, lubricants, solubilisers, suspending agents, dyes, fillers, glidants, compression aids, inert binders, sweeteners, preservatives, dyes, coatings, or tablet- disintegrating agents.
  • the vehicle may also be an encapsulating material.
  • the vehicle is a finely divided solid that is in admixture with the finely divided active agents according to the invention.
  • the active agent e.g.
  • the recombinant bacteriophage may be mixed with a vehicle having the necessary compression properties in suitable proportions and compacted in the shape and size desired.
  • the powders and tablets preferably contain up to 99% of the active agents.
  • Suitable solid vehicles include, for example calcium phosphate, magnesium stearate, talc, sugars, lactose, dextrin, starch, gelatin, cellulose, polyvinylpyrrolidine, low melting waxes and ion exchange resins.
  • the pharmaceutical vehicle may be a gel and the composition may be in the form of a cream or the like.
  • the pharmaceutical vehicle may be a liquid, and the pharmaceutical composition is in the form of a solution.
  • Liquid vehicles are used in preparing solutions, suspensions, emulsions, syrups, elixirs and pressurized compositions.
  • the recombinant bacteriophage according to the invention may be dissolved or suspended in a pharmaceutically acceptable liquid vehicle such as water, an organic solvent, a mixture of both or pharmaceutically acceptable oils or fats.
  • the liquid vehicle can contain other suitable pharmaceutical additives such as solubilisers, emulsifiers, buffers,
  • liquid vehicles for oral and parenteral administration include water (partially containing additives as above, e.g. cellulose derivatives, preferably sodium carboxymethyl cellulose solution), alcohols (including monohydric alcohols and polyhydric alcohols, e.g.
  • the vehicle can also be an oily ester such as ethyl oleate and isopropyl myristate.
  • Sterile liquid vehicles are useful in sterile liquid form compositions for parenteral administration.
  • the liquid vehicle for pressurized compositions can be a halogenated hydrocarbon or other pharmaceutically acceptable propellant.
  • Liquid pharmaceutical compositions which are sterile solutions or suspensions, can be utilized by, for example, intramuscular, intrathecal, epidural, intraperitoneal, intravenous and particularly subcutaneous injection.
  • the recombinant bacteriophage- polymer (hybrid) vector maybe prepared as a sterile solid composition that maybe dissolved or suspended at the time of administration using sterile water, saline, or other appropriate sterile injectable medium.
  • the recombinant bacteriophage and pharmaceutical compositions of the invention may be administered orally in the form of a sterile solution or suspension containing other solutes or suspending agents (for example, enough saline or glucose to make the solution isotonic), bile salts, acacia, gelatin, sorbitan monoleate, polysorbate 8o (oleate esters of sorbitol and its anhydrides copolymerized with ethylene oxide) and the like.
  • the recombinant bacteriophage according to the invention can also be administered orally either in liquid or solid composition form.
  • compositions suitable for oral administration include solid forms, such as pills, capsules, granules, tablets, and powders, and liquid forms, such as solutions, syrups, elixirs, and suspensions.
  • forms useful for parenteral administration include sterile solutions, emulsions, and suspensions.
  • nucleic acid or peptide or variant, derivative or analogue thereof which comprises substantially the amino acid or nucleic acid sequences of any of the sequences referred to herein, including functional variants or functional fragments thereof.
  • substantially the amino acid/polynucleotide/polypeptide sequence can be a sequence that has at least 40% sequence identity with the amino acid/polynucleotide/polypeptide sequences of any one of the sequences referred to herein, for example 40% identity with the gene identified as SEQ ID No.i, 3 or 7 (which encode one embodiment of wild-type pVTII, recombinant pVIII and pill, respectively), or 40% identity with the polypeptide identified as SEQ ID No.2, 4 or 8 (i.e. one embodiment of wild-type pVIII, recombinant pVIII and pill, respectively).
  • amino acid/polynucleotide/polypeptide sequences with a sequence identity which is greater than 65%, more preferably greater than 70%, even more preferably greater than 75%, and still more preferably greater than 80% sequence identity to any of the sequences referred to is also envisaged.
  • sequence identity which is greater than 65%, more preferably greater than 70%, even more preferably greater than 75%, and still more preferably greater than 80% sequence identity to any of the sequences referred to is also envisaged.
  • amino acids referred to amino acids
  • acid/polynucleotide/polypeptide sequence has at least 85% identity with any of the sequences referred to, more preferably at least 90% identity, even more preferably at least 92% identity, even more preferably at least 95% identity, even more preferably at least 97% identity, even more preferably at least 98% identity and, most preferably at least 99% identity with any of the sequences referred to herein.
  • the skilled technician will appreciate how to calculate the percentage identity between two amino acid/polynucleotide/polypeptide sequences.
  • an alignment of the two sequences must first be prepared, followed by calculation of the sequence identity value.
  • the percentage identity for two sequences may take different values depending on:- (i) the method used to align the sequences, for example, ClustalW, BLAST, FASTA, Smith-Waterman (implemented in different programs), or structural alignment from 3D comparison; and (ii) the parameters used by the alignment method, for example, local vs global alignment, the pair-score matrix used (e.g.
  • a substantially similar nucleotide sequence will be encoded by a sequence which hybridizes to the sequences shown in SEQ ID Nos. 1, 3 or 7, or their complements under stringent conditions.
  • stringent conditions we mean the nucleotide hybridises to filter-bound DNA or RNA in 3x sodium chloride/sodium citrate (SSC) at approximately 45°C followed by at least one wash in o.2x SSC/ 0.1% SDS at approximately 20-65°C.
  • a substantially similar polypeptide may differ by at least 1, but less than 5, 10, 20, 50 or 100 amino acids from the sequences shown in SEQ ID No's. 2, 4, 8-15.
  • nucleic acid sequence could be varied or changed without substantially affecting the sequence of the protein encoded thereby, to provide a functional variant thereof.
  • Suitable nucleotide variants are those having a sequence altered by the substitution of different codons that encode the same amino acid within the sequence, thus producing a silent change.
  • Other suitable variants are those having homologous nucleotide sequences but comprising all, or portions of, sequence, which are altered by the substitution of different codons that encode an amino acid with a side chain of similar biophysical properties to the amino acid it substitutes, to produce a conservative change.
  • small non-polar, hydrophobic amino acids include glycine, alanine, leucine, isoleucine, valine, proline, and methionine.
  • Large non-polar, hydrophobic amino acids include phenylalanine, tryptophan and tyrosine.
  • the polar neutral amino acids include serine, threonine, cysteine, asparagine and glutamine.
  • the positively charged (basic) amino acids include lysine, arginine and histidine.
  • the negatively charged (acidic) amino acids include aspartic acid and glutamic acid. It will therefore be appreciated which amino acids may be replaced with an amino acid having similar biophysical properties, and the skilled technician will know the nucleotide sequences encoding these amino acids.
  • FIG. l is a schematic representation of an embodiment of a multifunctional phage particle model system according to the invention.
  • the phage is tetrafunctional displaying a targeting RGD4C ligand on the pill minor coat protein and multiple copies of gold binding peptide and streptavidin-binding peptide on the surface.
  • CMV cytomegalovirus promoter
  • FIG 2 is a schematic representation of four phage vectors used in this study, a) Insertless phage, without any ligand. b) bifunctional phage, displaying the RGD4C ligand and carrying a mammalian transgene cassette, c) Trifunctional phage, simultaneously carrying RGD4C, a streptavidin-binding peptide and a transgene cassette, d) Tetrafunctional phage, simultaneously displaying RGD4C, streptavidin- binding peptide, gold-binding peptide and transgene cassette; Figure 3 shows immunofluorescence-based phage binding and internalization assay with cultured human M21 melanoma cells.
  • the red colour represents fluorescence related to phage staining, and the blue colour shows fluorescence of DAPI-stained cell nuclei.
  • Cells were incubated with different phage preparations, all carrying a phage input of 1.0 x 10 6 transducing units (TU/ cell);
  • Figure 4 shows confocal microscopy images. Shown are M21 melanoma cells incubated with phage preparations (input of 1 x 10 6 TU/cell) and labelled with anti- bacteriophage antibody (red) and DAPI nucleus stain (blue), a) free phage, b) internalizing phage, c) control insertless phage, d) bifunctional phage, e) trifunctional phage, f) tetrafunctional phage (Scale bar, 10 ⁇ );
  • Figure 5 shows that the tetrafunctional phage of the invention binds to streptavidin.
  • Different phage constructs were incubated with immobilised streptavidin and washed prior to infection of K91. Binding of the trifunctional and tetrafunctional phage, both of which display streptavidin-binding peptides, were proved by the greater number of bacterial transducing units. Shown are the mean ⁇ SEM from triplicate wells;
  • Figure 6 shows binding of the tetrafunctional phage to gold nanoparticles.
  • Figure 7 shows GFP expression by the multifunctional phage in HEK293 cells. GFP expression, analyzed by three independent observers, was detected at all time-points post cell treatment. Shown are representative images of cells at days 4 and 5 following transduction with the multifunctional phage;
  • Figures 8a and 8b show multifunctional phage carrying endosome-escape-peptides boosts transgene expression from phage.
  • Human M2imelanoma cells or rat 9L glioma cells were treated with 3x104 TU/cell of targeted RGD4C multifunctional phage expressing the reporter Luciferase gene and displaying the endosome-escape-peptides H5WYG, INF or PCi.
  • Luciferase transgene expression by vectors in cells was evaluated by measurement of the luciferase activity at day 3 post vector transduction. Luciferase activity was expressed as the mean relative luminescence units (RLU) normalized to protein amount;
  • RLU mean relative luminescence units
  • Figures 9a and 9b show multifunctional phage carrying endosome-escape-peptides and cationic polymers remarkably boosts transgene expression from phage.
  • Human M2imelanoma cells or rat 9L glioma cells were treated with 3x1 ⁇ 4 TU/cell of targeted RGD4C multifunctional phage expressing the reporter Luciferase gene, displaying the endosome-escape-peptides H5WYG, INF or PCi and complexed with cationic polymers.
  • Luciferase transgene expression by vectors in cells was evaluated by measurement of the luciferase activity at day 3 post vector transduction. Luciferase activity was expressed as the mean relative luminescence units (RLU) normalized to protein amount;
  • RLU mean relative luminescence units
  • Figure 10 shows GFP expression in HEK293 cells at days 2 and 3 post-transduction. Analysis of GFP expression in HEK293 cells showed that transgene expression from phage vectors simultaneously displaying RGD4C and SV40-NLS ligands was detectable at 48 hours, whereas GFP expression from the phage displaying RGD4C ligand only started at 72 hours post vector transduction;
  • Figure 11 shows time course of phage-mediated Luc transgene expression.
  • HEK293 cells were seeded in 48-well plates and grown until 70-80% confluence. The cells were then incubated for 4 hours with lxio 6 TU/ cell of different phage displaying RGD4C and different nuclear localization signal compared to cells treated with non-targeted vectors. The luciferase assay was performed over a time course of 5 days after vector transduction. The results represent the average RLU of targeted per lOO g protein of triplicate wells +/- the standard error of the mean (S.E.M);
  • Figure 12 shows AKAS display does not affect the phage titre and results in new physical characteristics
  • FIG. 13 shows 9L rat glioblastoma cells are transduced by parental and the two new AKAS phages carrying the GFP or Luc reporter genes.
  • the 9L cells 60-80% confluent in 48-well plates) were incubated with 3xio 4 TU/cell (containing the GFP or Luc reporter gene) for 4h in serum-free medium. After 4h, complete medium was added. GFP expression was monitored at day 5 post phage transduction with a) RGD4C-phage and (b and c) the two clones of the new phage RGD4C-phage-AKASi/ 2. As negative control we used d) cells without phage treatment.
  • Figure 14 shows Luciferase expression after incubation of phage with fibrinogen.
  • the 9L cells 60-80% confluent in 48-well plates) were transduced with 3xio 4 TU/cell containing the Luc reporter gene for 4h in serum free media. Two conditions were assessed: cells treated directly with the phages (left bars) or cells treated with phage after 60 minutes incubation with fibrinogen (right bars). After 4h, complete medium was added. Results represent the average iSFAf relative luminescence units (RLU)/ 100 ⁇ g of protein from triplicates at day 3 post-transduction. The experiment was repeated twice. **p ⁇ o.oi; and
  • Figure 15 shows the effect of anti-phage antibody on luciferase expression in cells transduced with RGD4C-phage or RGD4C-phage-AKAS.
  • the 9L cells 60-80% confluent in 48-well plates) were incubated with 3x1 ⁇ 4 TU/ cell solution containing complete media and several anti-phage antibody concentrations.
  • Results represent the average iST relative luminescence units (RLU)/ 100 ⁇ g of protein from triplicates at day 3 post-transduction and the same experiment was repeated twice.
  • the inventors investigated the barriers to gene transfer by bacteriophage in eukaryotic cells. First they searched for the existence of extracellular barriers to phage and found that one of the limitations in phage is its surface negative charge which hinders phage accessibility to the negatively charged eukaryotic cell membranes and subsequent binding to the target cell receptor. In addition, the inventors assessed the intracellular trafficking of phage in mammalian cells and found that, after internalization, the major intracellular obstacle to bacteriophage gene transfer efficiency is phage sequestration in acidic endosomal vesicles, and its subsequent degradation in the lysosomal
  • the inventors developed strategies to overcome both of these extracellular and intracellular barriers to phage-mediated transgene expression. Compared with eukaryotic viral vectors, bacteriophage requires additional commands to by-pass these extracellular and intracellular obstacles.
  • One strategy adopted was to transfer, into the phage capsid, the efficient mechanisms developed and used by many eukaryotic viruses. For example, to attain endosomal release, one strategy was to integrate, into the phage capsid, histidine-rich peptides to buffer against the ATP- dependent proton pump located in the membrane of endosomes resulting in endosomal disruption and subsequent viral escape.
  • the inventors used the known RGD4C-phage displaying the targeting ligand, for mammalian receptor binding, on the pill minor coat protein because it is well-characterized.
  • the pill has the advantage of displaying large targeting ligands since chimeric pill molecules which contain large inserts appear to package into phage well.
  • the pill minor coat protein displays the targeting ligand CDCRGDCFC (RGD4C)
  • the inventors aimed at displaying the peptides for overcoming mammalian cell barriers on the pVIII major coat protein.
  • the inventor created a RGD4C-phage genome that bears two genes which encode different types of pVIII molecule.
  • the first pVIII protein is the initial integral wild-type protein, which is used to display of a second functional peptide, and the other pVIII protein is the recombinant pVIII that served to display large sized peptides.
  • the recombinant pVIII was removed from the f88-4 phage and inserted into the targeted RGD4C-phage, and then expressed from an IPTG-inducible tac promoter.
  • the coat of the new multifunctional phage (bearing the two pVIII coat proteins) was composed of both wild-type and recombinant pVIII subunits; the latter typically comprises at least -150 of the 3900 subunits of the wild-type, which can vary depending on the concentration of the IPTG (at least 1 mM) used to induce the tac promoter and subsequently the expression of the recombinant pVIII.
  • Targeted multifunctional phage particles were made in a multiple-step process.
  • a targeting ligand peptide of choice e.g. RGD4C
  • RGD4C a targeting ligand peptide of choice
  • a DNA fragment containing a recombinant rpVIII gene was inserted in the genome of the targeted phage, followed by display of the peptide ligand of interest.
  • a peptide of interest was displayed on the wild-type pVIII major coat protein by site-directed mutagenesis.
  • a mammalian transgene cassette was inserted in an intergenomic region of the phage genome.
  • Targeting peptides were displayed on the pill minor coat protein of the fUSEs phage as previously described in the detailed protocol (Hajitou, A. et al. Design and construction of targeted AAVP vectors for mammalian cell transduction. NatProtoc 2, 523-531 (2007)) by cloning the corresponding oligonucleotide sequences flanked by Bgll restrictions sites into the Sfil site of the pill coat gene of a targeted RGD4C-fUSE5 phage. Design and construction of the RGD4C-phage containing two major coat proteins
  • the f88-4 phage (GenBank Accession AF218363) whose total genome length is 9234 base-pairs harbours two genes encoding two different types of the major coat protein, pVIII.
  • One pVIII is recombinant (rpVIII) and the other is wild-type (wt pVIII).
  • rpVIII recombinant
  • wt pVIII wild-type
  • the inventors used the BamHI and Xbal restriction enzymes to digest the plasmid DNA of the two existing phage RGD4C-fUSE5 and f88-4, because they have unique restriction sites present at similar locations in the DNA backbone of the two phages.
  • fragments with the corresponding cassettes (3925 bp fragment containing RGD4C from RGD4C-fUSE5 plasmid and a 5360 bp fragment containing the recombinant pVIII from f88-4 plasmid) were ligated to create a chimeric RGD4C-phage construct in which pill and recombinant pVIII were mapped to their locations.
  • a control non-targeted chimera phage (fUSE5/f88-4) without a targeting ligand RGD4C was also constructed.
  • oligo Oligonucleotide sequences for peptide display on the recombinant rpVIII coat protein.
  • the sense and anti-sense oligos are F,' phosphorylated and the nucleotides X correspond to the sequence encoding for the peptide ligand of interest
  • Peptides of short length were inserted into the major pVIII coat protein by using the Phusion Site-Directed Mutagenesis Kit (Thermo SCIENTIFIC). Briefly, synthetic oligonucleotide primers for mutagenic PCR were designed (see Table 2). Table 2 - Primer sequences used in site-directed mutagenesis. Both primers are 5' phosphorylated to avoid a spontaneous recircularization of the vector. Nucleotides in red (X) correspond to the peptide of interest.
  • coli bacteria plated on Luria-Bertani broth (LB) - tetracycline (Tet) agar plates and incubated for 24h at 37°C. Single colonies were picked and grown overnight in 5 mL LB-Tet. DNA was isolated by using a QIAprep Spin Miniprep kit (QIAGEN) and sent to sequence (Macrogen).
  • QIAGEN QIAprep Spin Miniprep kit
  • a eukaryotic transgene cassette was inserted into the Sad site located at 5650 bp in an intergenomic region of the phage genome.
  • both the transgene cassette flanked by Sad restriction sites and the phage genome were digested with the Sac I restriction enzyme, then ligated.
  • the phage DNA was subjected to Sad
  • the vector band (9.8 kb) was purified by agarose gel electrophoresis (QIAgen gel extraction kit) and ligated with the transgene cassette expressing a transgene.
  • Quick T4 DNA Ligase was used for a 5 minute ligation reaction. Following transformation of bacteria with the ligation product, colonies were picked and DNA isolation was performed.
  • the phage vector RGD4C-fUSE5/f88.4 (GenBank Accession for fUSEs is AF218364, for f88-4 AF218363) is composed of recombinant gene III containing RGD4C-encoding inserts and recombinant gene WHthat was used as the scaffold for nuclear targeting ligand (NLS) display. Oligonucleotides encoding the desired NLS were then inserted. Next, the mammalian transgene cassette was inserted in the genome of this chimeric phage.
  • NLS peptides that were used included: -
  • the sequence of the sense oligonucleotide used to produce the Classical SV40 NLS peptide is:
  • the sequence of the antisense oligonucleotide used to produce the Classical SV40 NLS peptide is: 5' GGCACTTTGCGITTTTTTTT'CGGGACGTTGGCAA 3' [SEQ ID No.17]
  • the sequence of the sense oligonucleotide used to produce the optimized SV40 NLS peptide is:
  • the sequence of the antisense oligonucleotide used to produce the optimized SV40 NLS peptide is:
  • sequence of the sense oligonucleotide used to produce the optimized short M9 (0SM9) NLS peptide is: 5'
  • the sequence of the antisense oligonucleotide used to produce the optimized short M9 (0SM9) NLS peptide is:
  • sequence of the sense oligonucleotide used to produce the heptamer peptide NLS peptide is:
  • sequence of the antisense oligonucleotide used to produce the heptamer peptide NLS peptide is: 5' GGGGTCGGGCTCGGGCTCGGCTGGACGTTGGCAA 3 ' [SEQ ID No.23]
  • the phage vector RGD4C-fUSE5/f88.4 (GenBank Accession for fUSEs is AF218364, for f88-4 AF218363) plasmid is composed of recombinant gene III containing RGD4C- encoding inserts and recombinant gene Mil and was used as the scaffold for endosome escape peptide (EEP) display. Oligonucleotides encoding the desired EEP were then inserted. Next, the mammalian transgene cassette was inserted in the genome of this chimeric phage. Three different EEP's were used: -
  • H5WYG peptide which is a synthetic histidylated fusogenic peptide with endosomal buffering capacity, derived from the N-terminal sequence of the HA2 sunbunit of the influenza virus hemagglutinin (Midoux, P., Kichler, A., Boutin, V., Maurizot, J.C. & Monsigny, M. Membrane permeabilization and efficient gene transfer by a peptide containing several histidines. Bioconjug Chem 9, 260-267 (1998).
  • the sequence of the H5WYG peptide is: GLFHAIAHFIHGGWHGLIHGWYG [SEQ ID NO:
  • the sequence of the sense oligonucleotide used to produce the H5WYG peptide is: 5'AGCTTTGCCAACGTCGGCCTGTTCCATGCGATCGCGCATTTCATCCATGGCGGCTGGCATGG CCTG ATCCATGGCTGGTATGGCCCTGCA 3' [SEQ ID NO 124]
  • the sequence of the antisense oligonucleotide used to produce the H5WYG peptide is: 5'GGGCCATACCAGCCATGGATCAGGCCATGCCAGCCGCCATGGATGAAATGCGCGATCGCATG GAACAGGCCGACGTTGGCA 3' [SEQ ID NO: 25]
  • the INF7 peptide is a pH-dependent fusogenic peptide derived from the N- terminal of influenza HA2.
  • INF7 (a 23-mer acidic derivative) in particular was shown to have high specificity for low pH (5.5), and yielded higher membrane lytic activity (Plank, C, Oberhauser, B., Mechtler, K., Koch, C. & Wagner, E. The influence of endosome-disruptive peptides on gene transfer using synthetic virus-like gene transfer systems. J Biol Chem 269, 12918-12924 (1994).
  • the sequence of the INF7 peptide is: GLFEAIEGFIENGWEGMIDGWYG [SEQ ID NO:io].
  • the sequence of the sense oligonucleotide used to produce the INF7 peptide is:
  • sequence of the antisense oligonucleotide used to produce the INF7 peptide is: 5' GGGCCATACCAGCCATCGATCATGCCT CCCAGCCGTTTTCGATGAAGCCTTCGATCG CTTCGAACAGGCCGACGTTGGCAA 3' [SEQ ID NO:27]
  • the PCi peptide is a pH-dependent endosomolytic peptide identified by phage display. Due to its tryptophan content, it was alleged that the peptide could cause endosomal membrane lysis by insertion into lipidic bilayers Hirosue, S. and Weber, T. (2006). pH-Dependent lytic peptides discovered by phage display. Biochemistry. 45 (20): 6476-6487.
  • the sequence of the PCi peptide is: HWYDSFVPWGHQ [SEQ ID NO:ii].
  • the sequence of the sense oligonucleotide used to produce the PCi peptide is: 5' AGCTTTGCCAACGTCCATTGGTATGATAGCTTCGTGCCGTGGGGCCATCAGCCTGCA
  • sequence of the antisense oligonucleotide used to produce the PCi peptide is: 5' GGCTGATGGCCCCACGGCACGAAGCTATCATACCAATGGACGTTGGCAA 3 ' [SEQ ID NO:29]
  • Targeted and control phage vectors are amplified, isolated and purified from the culture supernatant of host bacteria (E. coli K jiKan) as the inventors recently reported in detail in Hajitou, A. et al. Design and construction of targeted AAVP vectors for mammalian cell transduction. Nat Protoc 2, 523-531 (2007). Vector particles in suspension are sterile-filtered through 0.45- ⁇ filters.
  • the inventors added 1 mM of IPTG (Isopropyl ⁇ -D-i-thiogalactopyranoside) during phage production to display the peptide inserts.
  • E.coli K9iKan was used to produce the phages because they are pilus-positive F+ bacteria and can therefore be infected by the newly produced phage particles during the overnight growth. This phenomenon resulted in higher titers. Briefly, E.coli K jiKan were grown in a 7 ml Terrific Broth (TB), containing 100 ⁇ g/mL Kanamycin at 37°C by shaking at 250 rpm until a log-phase growth was obtained (1 hour). One ml of the mixture was then incubated 1 hour at room temperature with 50 ⁇ , of E.coli DH50 culture carrying the desired phage vector.
  • TB 7 ml Terrific Broth
  • the next step was to mix the previously incubated 1 mL with 15 mL of LB containing 40 ⁇ g/ ml tetracycline and 100 ⁇ g/ ml Kanamycin and incubated for 4 hours at 37°C. This was then transferred to 500 mL LB broth (40 ⁇ g/ml tetracycline and 100 ⁇ g/ml kanamycin) and incubated overnight at 37°C.
  • Bacterial growth cultures were centrifuged for 30 min at 6000 g and 4°C to pellet the bacteria. The supernatant was collected and incubated with 15% Polyethylene- glycol/Sodium chloride (PEG/NaCl, Sigma) and kept on ice for 2 hours to allow precipitation of the phage viral particles. The suspension was centrifuged for 30 min at loooo g and 4°C to get the white phage pellet. The supernatant was discarded and centrifuged for an additional 5 min. The pellet was suspended in 7 ml lX Phosphate- Buffered Saline (PBS, sigma) with shaking during 1 hour at 37°C.
  • PBS Polyethylene- glycol/Sodium chloride
  • phage viral particles in suspension were sterile-filtered through 0.45- ⁇ filters, then titrated by infection of host E.coli K jiKan bacteria for colony counting and expressed as bacterial transducing units (TU) as reported in the detailed protocol (Hajitou, A. et al. NatProtoc 2, 523-531 (2007).
  • the inventors performed an infectivity assay.
  • the parental multifunctional phage and the newly produced AKAS multifunctional phage were adjusted to the identical titre and submitted to serial dilutions, then 5 ⁇ , of each dilution were incubated with 1 ml of E.coli K jiKan for 20 min at room temperature.
  • a subconfluent monolayer culture of cells was seeded in 48-well plates and incubated at 37 °C for 24 hours, until 80% confluent.
  • Phage/serum-free medium mixture was incubated with cells at 37°C with a ratio of lxio 6 TU phage per cell or otherwise, as stated in the text.
  • phage was used at 3x104 TU/ cell, while the cationic polymers poly-D-lysine (PDL), or diethylaminoethyl-dextran DEAE.DEX) were applied at 7 ⁇ g/ml and 15 ⁇ g/ml, respectively.
  • PDL poly-D-lysine
  • DEAE.DEX diethylaminoethyl-dextran
  • Luciferase assay the Promega Steady-glo ® luciferase assay kit was used to evaluate the expression of Luciferase reporter transgene in phage-transduced cells. Luciferase expression was quantified using a Turner Biosystems microplate luminometer.
  • Luciferase assays were performed in triplicate and normalized to loc ⁇ g cell protein, as determined by the Bradford assay.
  • Cells were treated as described above and transduced with a mixture of phage and an anti-phage polyclonal antibody (Sigma).
  • the Antibody was used at 1:8000 dilution and cell transduction was determined and evaluated by the Luciferase assay.
  • the RGD4C-phage is an Mi3-derived fUSEs phage (GenBank Accession number:
  • the inventors constructed phage displaying the two well characterized peptides, i.e. (i) a streptavidin- binding peptide, and (ii) a gold-binding peptide ( Figures 1 and 2).
  • the coding sequences of the streptavidin-binding peptide (ANRLCHPQFPCTSHE - [SEQ ID No:5]) were fused in frame with recombinant pVIII coding gene (Chen, L. et al. Design and validation of a bifunctional ligand display system for receptor targeting.
  • Example 2 Cell-surface integrin binding characteristics of the multifunctional phage After demonstrating that all peptides are correctly displayed on the pill minor coat protein as well as on the recombinant and wild type pVIII major coat proteins of the multifunctional phage, the inventors sought to confirm that the moieties carried by the multifunctional phage remain intact and functional. Firstly, to validate the function of the RGD4C targeting ligand, displayed on the pill minor coat protein, the inventors assessed binding and receptor-mediated entry of the multifunctional phage to cells expressing the ⁇ ⁇ ⁇ 3 integrin receptors for RGD4C.
  • Example 3 Testing the streptavidin binding capacity of the multifunctional phage
  • the inventors assessed the ability of this phage to bind to streptavidin in in vitro phage binding assays. Bound phages were recovered from streptavidin-coated plates by infection of host bacteria E.coli K91. Interestingly, the tetrafunctional and trifunctional phage, displaying a streptavidin-binding peptide, showed high and similar levels of binding to immobilized streptavidin. While, insertless phage (no RGD4C) and bifunctional RGD4C phage did not show any binding (Figure 5).
  • the inventors carried out a precipitation test.
  • the phage solutions were mixed with a gold colloidal suspension (Figure 6).
  • Figure 6 the mixtures of the insertless, bifunctional and trifunctional phage with the gold colloidal suspension remained clear ( Figure 6), whereas a visible precipitate was observed in the mixture with the tetrafunctional phage, indicating that gold colloids formed aggregates ( Figure 6).
  • Figure 6 the inventors carried out a dot blot-diffusion assay. Different phages were directly added onto the
  • the inventors conducted cell transduction experiments on the normal immortalized Human Embryonic Kidney HEK293 cell line.
  • HEK293 cells have previously been used as a standard in vitro model for transduction by the RGD4C-phage as they express high levels of ⁇ ⁇ ⁇ 3 integrin receptor.
  • the inventors used vectors carrying the green fluorescent protein (GFP) reporter transgene. This reporter gene provides a convenient way to visualize expression of the transgene. Analysis of GFP expression showed GFP expression in cells by the multifunctional phage ( Figure 7).
  • Example 6 Application of the multifunctional phage in promoting gene transfer to mammalian cells by phage
  • the inventors Since the inventors reported that the major intracellular obstacle to phage is its sequestration in the lysosomes, the inventors constructed as proof of concept, multifunctional phage displaying peptides to assist the phage to escape from
  • the inventors displayed on the recombinant pVIII coat protein of the multifunctional phage a panel of endosome-escape-peptides (EEPs) known for their potential to promote escape of vectors from endosomes by inducing disruption of endosomes (endosmolytic peptides) or by fusion with the endosomal membranes (fusogenic peptides).
  • EEPs endosome-escape-peptides
  • One approach tested was to transfer to the capsid on the multifunctional phage strategies already used by eukaryotic viruses to escape the endosomes.
  • Three different EEPs were tested, the H5WYG peptide, the INF7 peptide, and the PCi peptide.
  • the inventors performed experiments in the M21 human melanoma cells and used phage carrying the Luciferase reporter gene.
  • the results show that the targeted multifunctional phage displaying the H5WYG peptide (RGD4C H5WYG) achieved substantial increase of gene transfer by phage compared to the original RGD4C-phage.
  • the multifunctional phage displaying the PCi peptide also showed significant increase of the phage gene transfer efficacy, while INF7 peptide had little effect as compared to the wild type RGD4C-phage (Figure 8).
  • Example 7 Overcoming both extracellular and intracellular major obstacles to phage, by a single multifunctional bacteriophage, promotes gene transfer by phage
  • the inventors sought to use a multifunctional phage which overcomes both extracellular (cell accessibility) and intracellular (lysosomal degradation) major limitations of phage in one single particle.
  • the multifunctional phage displaying the EEPs was mixed with cationic polymers (poly-D-lysine [PDL], or diethylaminoethyl-dextran
  • Example 8 Overcoming the nuclear transport obstacle to bacteriophage by the multifunctional phage promotes its gene transfer efficacy.
  • Transport to the nucleus represents another rate-limiting step to phage.
  • Several eukaryotic viruses have developed successful strategies to target their genetic material to the nucleus.
  • the inventors displayed on the phage capsid the nuclear localization signal (NLS) from animal viruses.
  • NLS nuclear localization signal
  • multifunctional phage that displays the targeting RGD4C ligand on the pill minor coat protein and the NLS peptide, from the large tumour antigen of simian virus 40 (SV40 T antigen), on the recombinant major pVIII coat protein.
  • the inventors inserted the mammalian transgene cassette in the genome of this multifunctional phage.
  • the inventors compared the multifunctional phage displaying RGD4C ligand and SV40-NLS peptides to phage displaying RGD4C without the SV40-NLS peptide.
  • the non-targeted phage displaying SV40-NLS only and phage without any ligands served as negative controls for mammalian cell transduction.
  • the inventors used the normal immortalized HEK293 cell line.
  • HEK293 cells have previously been used as a standard in vitro model for transduction by RGD4C-phage as they express high levels of ⁇ ⁇ ⁇ 3 integrin receptor of the RGD4C ligand.
  • the inventors used phage vectors carrying the GFP reporter transgene.
  • the inventors sought to opt for the most suitable NLS that can achieve superior mammalian cell transduction by phage.
  • the inventors screened a number of optimized NLS peptides, including the optimized OSSV40-NLS from SV40 (SSDDEATADAQHAAPPKKKRKV - [SEQ ID No:i3]) and the optimized short M9 (0SM9, YNNQSSNRGPYK - [SEQ ID No: 14]).
  • the classical SV40NLS QPSPSPT - [SEQ ID NO: 12] was also included in these experiments.
  • the inventors displayed all these NLS on the rpVIII of
  • multifunctional phage vector carrying the Luc reporter transgene Expression in HEK293 cells was monitored over a time course of 5 days after vector transduction. Transgene expression from each construct was evaluated in triplicates and luciferase activity was determined as the average relative luminescent units (RLU) per loc ⁇ g protein as shown in Figure 11. The inventors found that luciferase expression was significantly higher at all time-points post vector treatment (days 1 to 5) with all multifunctional phage simultaneously displaying either classical SV40-NLS, optimized OSSV40-NLS or 0SM9 and RGD4C ligand compared to the multifunctional phage displaying RGD4C ligand only ( Figure 11).
  • Example Q Construction of a novel multifunctional RGD4.C-phage vector containing a wild type major coat pVIII protein with an altered charge.
  • the negative charge of the M13 bacteriophage surface plays a crucial role in the extracellular barriers to phage due to the generation of high non-specific binding to positively charged molecules (around 35% of proteins in the human proteome).
  • the inventors have previously attempted to reduce this non-specific binding by using cationic polymers such as the DEAE-dextran to neutralize or convert to positive the negative surface of the virus.
  • the inventors used the multifunctional phage to apply a genetic approach consisting of changing the negative N-term of the major wild type (wt) pVIH coat protein into a mixture of anionic and cationic terminal groups by introducing a short charged neutralizing peptide termed AKAS (Ala-Lys-Ala-Ser).
  • the inventors generated a novel targeted multifunctional phage vector, termed RGD4C- phage-AKAS, with a new wt pVIII that has a modification at the N-terminal to neutralize the negative charge of the phage surface.
  • the first genetic engineering step was to introduce the tetrapeptide AKAS between residues Gly3 and Asp4 of the N-term of the major coat wt pVIII protein using the strategy of site-directed mutagenesis.
  • the inventors After the successful PCR amplification of the vector the inventors analyzed 10 DH50 E.coli transformed colonies and all of them were RGD4C-phage-AKAS construct positive. The correct insertion of the AKAS nucleotide sequence was checked by sequencing.
  • the inventors inserted a transgene cassette into the Sac-I site of the multifunctional phage as reported above.
  • Example 10 Display of the neutralizing peptide AKAS alters the surface of the multifunctional phage, but does not affect the phage titre and phage infectivity.
  • the inventors wanted to determine whether display of the neutralizing peptide AKAS has an effect on the titre of the produced multifunctional phage particles, and the inventors assessed two RGD4C-phage-AKAS clones (RGD4C-phage-AKASi and RGD4C-phage-AKAS2).
  • the inventors infected E.coli K jiKan with several dilutions and the inventors counted the number of colonies after overnight incubation on LB agar plates containing tetracycline.
  • Both multifunctional phage clones (RGD4C-phage- AKASi and RGD4C-phage-AKAS2) yielded similar amount of colonies compared to the parental multifunctional phage ( Figure 12a).
  • multifunctional phage is produced at normal and workable levels.
  • the inventors carried out an experiment to demonstrate that the new multifunctional phage surface has different physical properties compared to the parental one.
  • the inventors incubated the RGD4C-phage-AKASi and RGD4C- phage-AKAS2 with the DEAE-dextran cationic polymer that associates with negatively charged nucleic acids and proteins. Therefore, less binding was expected with the AKAS phages.
  • Example 11 The AKAS-phages have the ability to transduce cells
  • the inventors first transduced rat glioblastoma cells 9L with the parental and the new multifunctional phage carrying the GFP reporter gene.
  • the fluorescence started at day 3 after transduction and pictures were taken day 5 after treatment ( Figure 13 a-d).
  • GFP expression was observed in all the treated cells at overall similar levels. The pictures only show a portion of one well of 9L cells treated with RGD4C-phage ( Figure 13a); RGD4C-phage-AKASi ( Figure 13b); and RGD4C-phage-AKAS2 ( Figure 13c).
  • Example 12 Phage incubation with fibrinogen decreases the transduction levels of RGD4.C-phage while RGD4.C-phage-AKAS efficacy remains intact
  • the inventors explored the phage behaviour in the presence of fibrinogen, a plasma glycoprotein that participates in the blood coagulation, in order to investigate whether the new multifunctional RGD4C-phage-AKAS can avoid non-specific binding to fibrinogen resulting in its sequestration.
  • fibrinogen plays an important role in the early innate immune response by neutralizing invading pathogens.
  • it is deposited with other pro-coagulant molecules into the extracellular matrix of tumour cells serving as a scaffold to support proliferation, migration and tumour cell growth. Thereby, this glycoprotein constitutes an additional obstacle to reach the target tumour cells.
  • the inventors transduced the 9L tumour cells with the RGD4C-phage and RGD4C-phage-AKAS under the normal conditions or after 60 minutes of phage incubation with fibrinogen.
  • Example 13 The RGD4.C-phage-AKAS phage can avoid the anti-phage antibody
  • the inventors evaluated the effect of an anti-phage polyclonal antibody to neutralize the multifunctional phage and affect the gene transfer efficacy.
  • the inventors treated the 9L tumour cells with the RGD4C-phage and RGD4C-phage-AKAS in the presence of anti-phage antibody (1:8000, Sigma) and the inventors determined the Luc expression after 3 days.
  • the results revealed a significant transduction difference in the presence of the anti-phage antibody, where the RGD4C-phage-AKAS-transduced cells showed an increaseTM 2.5-fold compared with RGD4C-phage-transduced cells ( Figure 15).
  • the inventors have designed a multifunctional filamentous phage (see Figure 1) based on the targeted M13 RGD4C-phage that has the potential to simultaneously carry multiple functions into a single particle, i.e. (i) it displays the targeting ligand on the pill minor coat protein of the phage for binding to a mammalian protein or receptor; (ii) it serves as a genetic carrier for foreign functional peptides to be displayed on the wild-type pVIII major coat protein in order to operate as a nanoparticle (e.g.
  • the inventors conducted experiments to assess the effect on gene transfer applications of phage. Thus, they developed the first highly efficient strategy that combines multiple solutions to overcome extracellular and intracellular hurdles to phage gene transfer in one singe phage particle.
  • they have generated a multifunctional M13 phage, that carries the targeting ligand on the pill minor coat protein, displays the H5WYG histidine rich endosome-escape-peptide on the recombinant pVIII major coat protein and expresses a transgene through a mammalian transgene cassette inserted in a non-essential region of the phage genome.
  • hybrid complexes between the multifunctional phage and cationic polymers were generated.
  • the inventors compared the efficacy of the multifunctional phage/polymer to a comprehensive panel of controls including the wild type RGD4C-phage alone, as well as each individual phage either displaying H5WYG peptide or mixed to cationic polymers.
  • the inventors showed that the multifunctional phage/polymer nano-complexes provide substantial transgene expression over all control phage versions while retaining cell targeting and nontoxicity, and that incorporation of cationic polymers generates positively charged phage with enhanced cell surface attachment.
  • multifunctional phage/polymer complexes carrying a therapeutic gene produced greater targeted cancer cell killing compared to phage.
  • This new class of targeted hybrid multifunctional platform will advance targeted gene delivery by phage for a broad range of applications, including gene therapy and DNA vaccine.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Virology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Physics & Mathematics (AREA)
  • Mycology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The invention provides a recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage. The bacteriophage comprises a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the bacteriophage to a target cell, a second nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display a foreign peptide thereon, and a transgene which encodes a protein which exerts a biological effect on the target cell.

Description

BACTERIOPHAGE
The present invention relates to bacteriophages, and, in particular to novel
multifunctional bacteriophages, and their uses for the delivery of transgenes in a variety of gene therapy applications, vaccine delivery and imaging techniques, as well as the simultaneous expression of functional foreign proteins, peptides, antigens or antibodies displayed on the capsid of the multifunctional bacteriophage.
Despite their attractive features and advanced knowledge of their molecular biology, bacteriophage viruses are still considered to be poor vectors for gene transfer limiting their application in a broad range of disciplines including gene therapy and DNA vaccine delivery. It is clear that phage has evolved to infect bacteria only and has no optimized strategies to transfer and express transgenes in mammalian cells. Previous work has shown that phage gene transfer efficacy is amenable to evolve and that one efficient strategy is to combine bacteriophage with the attributes of animal viruses. For example, incorporating the genetic cis-elements ITR from the animal virus AAV-2 into the phage genome resulted in altered transgene cassette and subsequent enhanced gene delivery efficacy of bacteriophage.
However, to date most progress in advancing bacteriophage as a vector has been made at the genome level, which is one last step of a series of phases involved in a gene transfer process. Indeed, it is well-established that gene delivery efficiency depends on the efficacy of the vector to complete a succession of steps. Firstly, the vector needs to access the cell surface to bind to its receptor to allow internalization in cells. Secondly, the vector has to escape from endosomes and be released into the cytoplasm. Thirdly, the vector must then be transported to the nucleus for gene expression to occur. To date, current bacteriophage-based vectors are unable to efficiently overcome these obstacles in transgene expression.
Accordingly, there is therefore a need to provide an improved bacteriophage-driven gene delivery vector system, which efficiently and specifically delivers transgenes to target cells of interest in vivo. The inventors postulated that the ideal bacteriophage vector would be a phage that is capable of combining multiple strategies for resolving the mammalian cell barriers into a single viral particle, in addition to effecting transgene expression. The inventors have therefore developed a novel multifunctional bacteriophage based on the targeted M13 filamentous bacteriophage, which exhibits a number of novel functionalities. Hence, according to a first aspect of the invention, there is provided a recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the bacteriophage to a target cell, a second nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display a foreign peptide thereon, and a transgene which encodes a protein which exerts a biological effect on the target cell.
It will be appreciated that bacteriophages (i.e. phages) are viruses that infect and replicate within bacteria. The advantage of using bacteriophages as gene delivery vectors, as opposed to other regular viruses, is that they do not naturally infect nonbacterial cells, such as mammalian cells, unless they are genetically modified to specifically do so. As described in the Examples, the inventors have designed a highly effective and novel multifunctional bacteriophage in accordance with the first aspect, which is based on a targeted M13 RGD4C-phage, and which simultaneously carries out multiple functions. Advantageously, the bacteriophage of the invention comprises a pill minor coat protein which displays the cell-targeting ligand (e.g. RGD4C), which enables highly targeted delivery to the target cell, for example a tumour cell.
Furthermore, the bacteriophage of the invention enables the display of large foreign functional peptides on its surface via the pVIII major coat protein. In addition, the phage also enables expression, in the target cell (or tissue) that has been transduced with the phage, of the transgene, which is preferably inserted in an intergenomic region of the bacteriophage's genome.
To date, there have been no reports of using a bacteriophage to deliver a transgene to a target cell, in which the phage comprises one or more pVIII capsid major coat proteins for display foreign peptides thereon. The advantage of constructing a targeted bacteriophage with more than one pVIII major coat protein is that (i) it provides the choice to use one pVIII major coat protein for the display of large foreign peptide or proteins while keeping the wild type pVIII intact, which is important to achieve efficient phage assembly and subsequently high titers of the phage vector, (ii) it allows the display of a considerable copy number of the peptide in order to yield a phage which displays hundreds or even thousands of functional foreign peptides, and (iii) it offers the possibility of the simultaneous display of two different functional peptides on the capsid of a single bacteriophage particle. It will be appreciated that a foreign peptide or protein is one that is not normally or naturally expressed by the phage, i.e. it can be heterologous. This new class of targeted multifunctional phage will advance targeted gene and peptide delivery in a broad range of applications, including gene therapy, DNA vaccines and imaging techniques.
Examples of the bacteriophage preferably include any negatively charged
bacteriophage, and more preferably one of the filamentous phages, such as Fi, Fd or M13. However, a most preferred bacteriophage according to the invention is M13.
As described in the Examples, the inventors have developed a novel Mi3-based phage based on (i) the fUSEs phage, the sequence of which is found at GenBank Accession Number AF218364, and (ii) the f88.4 phage, the sequence of which is found at
GenBank Accession Number: AF218363. The fUSEs phage comprises a single gene encoding a major coat protein pVIII, whereas the f88.4 phage comprises two genes encoding two different embodiments of the pVIII protein, namely wild-type and recombinant pVIII. A fragment containing the recombinant pVIII gene, preferably under the control of a tac promoter, was removed from the f88.4 phage and inserted into an intergenomic region of the fUSEs phage to generate a bacteriophage harbouring two pVIII genes.
Therefore, in one embodiment, the second nucleic acid sequence encodes a wild-type pVIII capsid major coat protein. The DNA sequence encoding one embodiment of a wild-type pVIII capsid major coat protein is represented herein as SEQ ID No: 1, as follows: atgaaaaagtctttagtcctcaaagcctccgtagccgttgctaccctcgttccgatgctg
tctttcgctgctgagggtgacgatcccgcaaaagcggcctttgactccctgcaagcctca
gcgaccgaatatatcggttatgcgtgggcgatggttgttgtcattgtcggcgcaactatc
ggtatcaagctgtttaagaaattcacctcgaaagcaagctga
[SEQ ID NO:l]
Accordingly, preferably the second nucleic acid sequence encoding a wild-type pVIII capsid major coat protein comprises a nucleotide sequence substantially as set out in SEQ ID No: l, or a functional variant or fragment thereof. One embodiment of the polypeptide sequence of a wild-type pVIII capsid major coat protein is provided herein as SEQ ID No: 2, as follows:
Figure imgf000005_0001
[SEQ ID NO: 2]
Accordingly, preferably the wild-type pVIII capsid major coat protein comprises an amino acid sequence substantially as set out in SEQ ID No: 2, or a functional variant or fragment thereof.
In another embodiment, the second nucleic acid sequence encodes a recombinant pVIII capsid major coat protein. The DNA sequence encoding one embodiment of a recombinant pVIII capsid major coat protein is represented herein as SEQ ID No: 3, as follows: atgaaaaagtctttagttcttaaagcatctgttgctgttgcgactcttgttcctatgcta
agctttgccaacgtccctgcagaaggtgatgacccggctaaagctgcttttgactctctt
caggcttctgctactgaatacatcggctacgcttgggctatggtggttgttatcgttggt
gctactattggcatcaaacttttcaaaaaattcacttctaaagcgtcttaa
[SEQ ID NO: 3]
Accordingly, in one embodiment, the second nucleic acid sequence encoding a recombinant pVIII capsid major coat protein comprises a nucleic acid sequence substantially as set out in SEQ ID No:3, or a functional variant or fragment thereof
One embodiment of the polypeptide sequence of a recombinant pVIII capsid major coat protein is provided herein as SEQ ID No: 4, as follows:
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
[SEQ ID NO: 4]
Accordingly, preferably the recombinant pVIII capsid major coat protein comprises an amino acid sequence substantially as set out in SEQ ID No:4, or a functional variant or fragment thereof. The recombinant gene VIII is synthetic and differs in nucleotide sequence from the wild-type gene (though it largely encodes the wild-type amino acid sequence).
The only difference between the two proteins of SEQ ID No. 2 and 4 is an additional three amino acid sequence (NVP) in the recombinant pVIII (SEQ ID No.4). The inventors have found that, advantageously, having both the wild-type and the recombinant pVIII capsid major coat protein gives the ability to display a wide range of different foreign proteins each of differing sizes. Indeed, both recombinant and wild type pVIII should allow the display of large peptides, but display of more than 10 amino acid long peptides can have a tendency to affect the ability of the pVIII to support phage assembly and production. Therefore, one solution to overcome this is to construct a phage in which the genome bears two VIII genes, encoding two different types of pVIII molecule. The recombinant gene VIII is synthetic and differs in nucleotide sequence from the wild-type gene (though it largely encodes the wild-type amino acid sequence). This allows hybrid pVIII proteins with quite large foreign peptides to be displayed on the virion surface. Thus, one pVIII (i.e. recombinant pVIII) is used to display large peptide inserts, and the other one (i.e. wild type pVIII) is used to support phage assembly or for the display of small peptide inserts. Therefore, it is possible to design different bacteriophages of the invention, depending on which foreign proteins need to be displayed on the outer capsid.
Therefore, in a preferred embodiment, the bacteriophage of the invention comprises a second nucleic acid sequence which encodes the wild-type pVIII capsid major coat protein and third nucleic acid sequence which encodes a recombinant pVIII capsid major coat protein, or vice versa. Hence, the bacteriophage preferably comprises a nucleic acid sequence substantially as set out in SEQ ID No: 1 and 3, or a functional variant or fragment thereof. In addition, preferably the bacteriophage comprises a wild- type and a recombinant pVIII capsid major coat protein which comprise an amino acid sequence substantially as set out in SEQ ID No: 2 and 4, or a functional variant or fragment thereof.
Preferably, the wild-type pVIII capsid major coat protein and/or the recombinant pVIII capsid major coat protein is configured to display a foreign peptide thereon. Preferably, a nucleic acid encoding the foreign peptide is fused in frame with the pVIII coding gene. To show that the display of foreign peptides on the pVIII major coat proteins remains intact and functional in the context of the multifunctional phage, the inventors have constructed a phage displaying the two well-characterized peptides, i.e. a streptavidin- binding peptide and a gold-binding peptide, as illustrated in Figures 1 and 2.
Accordingly, in one embodiment, the pVIII capsid major coat protein is preferably configured to display a streptavidin-binding peptide. For example, the amino acid sequence of the streptavidin-binding peptide may comprise ANRLCHPQFPCTSHE [SEQ ID No: 5], or a functional fragment or variant thereof. Since this peptide comprises over ten amino acids, it is preferred that the coding sequence of the streptavidin-binding peptide is fused in frame with the recombinant pVIII coding gene. In another embodiment, the pVIII capsid major coat protein is preferably configured to display a gold-binding peptide. For example, the amino acid sequence of the gold- binding peptide may comprise VSGSSPDS [SEQ ID No: 6], or a functional fragment or variant thereof. Since this peptide comprises less than ten amino acids, the coding sequence of the gold-binding peptide is preferably fused in frame with the wild-type pVIII coding gene. However, this peptide may be displayed on the recombinant pVIII capsid major coat protein, where two short peptides (i.e. less than ten amino acids) are displayed.
In addition to providing the wild-type pVIII major coat protein, the fUSEs phage also comprises a gene which encodes a pill capsid minor coat protein on which the cell- targeting ligand may be displayed. The choice of cell -targeting ligand depends on the target cell, which will depend on the specification application of the phage, be it therapeutic, in vaccine delivery or in imaging. By way of example only, in embodiments where the bacteriophage is used to treat cancer, the cell-targeting ligand may be a tumour-targeting ligand. By way of example, in one embodiment, the ligand may comprise the RGD4C ligand (see the Examples), which will be known to the skilled person. It will be appreciated that a phage displaying the cyclic RGD4C (CDCRGDCFC) peptide ligand targets overexpressed ocv integrin receptors found in tumours. Hence, the RGD4C ligand is a suitable cell-targeting ligand for targeting cancer cells and tumours in general.
Accordingly, the bacteriophage cell-targeting ligand displayed on the pill capsid minor coat protein is specific for a protein (e.g. a receptor) expressed on the target cell/tissue, so as to enable targeted delivery of the phage thereto. The DNA sequence encoding one embodiment of a pill capsid minor coat protein is represented herein as SEQ ID No: 7, as follows: gtgaaaaaattattattcgcaattcctttagttgttcctttctattctcactcggccgtg
gcgtgcgattgccgcggcgattgcttctgcggcgcgggggccgaaactgttgaaagttgt
ttagcaaaacctcatacagaaaattcatttactaacgtctggaaagacgacaaaacttta
gatcgttacgctaactatgagggctgtctgtggaatgctacaggcgttgtggtttgtact
ggtgacgaaactcagtgttacggtacatgggttcctattgggcttgctatccctgaaaat
gagggtggtggctctgagggtggcggttctgagggtggcggttctgagggtggcggtact
aaacctcctgagtacggtgatacacctattccgggctatacttatatcaaccctctcgac
ggcacttatccgcctggtactgagcaaaaccccgctaatcctaatccttctcttgaggag
tctcagcctcttaatactttcatgtttcagaataataggttccgaaataggcagggtgca
ttaactgtttatacgggcactgttactcaaggcactgaccccgttaaaacttattaccag
tacactcctgtatcatcaaaagccatgtatgacgcttactggaacggtaaattcagagac
tgcgctttccattctggctttaatgaggatccattcgtttgtgaatatcaaggccaatcg
tctgacctgcctcaacctcctgtcaatgctggcggcggctctggtggtggttctggtggc
ggctctgagggtggcggctctgagggtggcggttctgagggtggcggctctgagggtggc
ggttccggtggcggctccggttccggtgattttgattatgaaaaaatggcaaacgctaat
aagggggctatgaccgaaaatgccgatgaaaacgcgctacagtctgacgctaaaggcaaa
cttgattctgtcgctactgattacggtgctgctatcgatggtttcattggtgacgtttcc
ggccttgctaatggtaatggtgctactggtgattttgctggctctaattcccaaatggct
caagtcggtgacggtgataattcacctttaatgaataatttccgtcaatatttaccttct
ttgcctcagtcggttgaatgtcgcccttatgtctttggcgctggtaaaccatatgaattt
tctattgattgtgacaaaataaacttattccgtggtgtctttgcgtttcttttatatgtt
gccacctttatgtatgtattttcgacgtttgctaacatactgcgtaataaggagtcttaa
[SEQ ID NO:7]
Accordingly, preferably the first nucleic acid sequence encoding the pill capsid minor coat protein comprises a nucleic acid sequence substantially as set out in SEQ ID No: 7, or a functional variant or fragment thereof.
One embodiment of the polypeptide sequence of a pill capsid minor coat protein is provided herein as SEQ ID No:8, as follows:
VKKLLFAIPLVVPFYSHSVACDCRGDCFCGAGAETVESCLAKPHTENSFTNVWKDDKTLDR
Figure imgf000008_0001
lliilllliilliilll-
[SEQ ID NO: 8]
Accordingly, preferably the pill capsid minor coat protein comprises an amino acid sequence substantially as set out in SEQ ID No: 8, or a functional variant or fragment thereof. Hence, in a preferred embodiment, the bacteriophage of the first aspect comprises a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the phage to a target cell, a second nucleic acid sequence encoding a wild type pVIII capsid major coat protein, a third nucleic acid sequence encoding a recombinant pVIII capsid major coat protein, wherein either or both of the major coat proteins is configured to display a foreign peptide thereon, and a transgene which encodes a protein which exerts a biological effect on the target cell. Advantageously, it will be appreciated therefore that the bacteriophage of the invention can be described as being multifunctional, because it: (i) displays the targeting ligand on the pill minor coat protein of the phage for binding to a target cell, e.g. a protein or a receptor; (ii) serves as a genetic carrier for (shorter) foreign functional peptides to be displayed on the wild-type pVIII major coat protein in order to operate as a
nanoparticle decorated by hundreds of peptides; (iii) allows the display of (larger) foreign peptides on the virion surface by the recombinant pVIII protein; and finally (iv) harbours a transgene cassette inserted in an intergenomic region of the bacteriophage genome for gene expression in target cells. The transgene may be any gene encoding a protein, which may have therapeutic or industrial utility in the target cell. For example, in embodiments where the phage is used to treat cancer, the transgene may encode the Herpes simplex virus tyrosine kinase gene, which may subsequently exert a therapeutic effect on the target cell. The inventors have demonstrated that the bacteriophage of the invention can be efficiently targeted to, and transduce tumor cells, which are subsequently killed. However, it will be appreciated that the type of cell, which is targeted by the phage depends on the type of cell-targeting ligand expressed on the surface of the bacteriophage. In the Examples, tumor cells are used illustratively to show that the complex of the invention exhibit a significantly improved transduction.
Recombinant bacteriophages may include a variety of other functional elements in addition to the promoter, and the coding sequence encoding protein responsible for producing the therapeutic effect. Alternatively, the recombinant phage may be designed such that it integrates into the genome of a host cell. In this case, DNA sequences, which favour targeted integration (e.g. by homologous recombination) are envisaged. The bacteriophage may be used as a recombinant vector for the delivery of the transgene to a tissue specific target, irrespective of whether the vector is administered systemically or locally to a subject in vivo, applied to a mixture of cells in vitro, or applied to an organ ex vivo. In one embodiment of the invention, the nucleic acid may be DNA, which may be genomic DNA or cDNA. Non-naturally occurring cDNA may be preferred in some embodiments. In another embodiment, the nucleic acid may be RNA, such as antisense RNA or shRNA.
As described in the Examples, the inventors investigated whether the multifunctional bacteriophage of the first aspect could be modified to further improve its gene transfer efficiency. The inventors realized that the major intracellular obstacle to a
bacteriophage and transgene expression is its sequestration in the lysosomes of the host target cell, and so they developed a phage which displays a peptide on its pVIII major coat protein, which assists the phage to escape from endosomes in order to avoid its degradation in the lysosomes. They observed that when the bacteriophage displays an endosome escape peptide (EEP), it significantly improved the levels of transgene expression.
Therefore, preferably the foreign peptide which is displayed on the pVIII capsid major coat protein comprises an endosome escape peptide (EEP). The inventors believe that this is an important feature of the invention.
Therefore, according to a second aspect of the invention, there is provided a
recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display an endosome escape peptide (EEP) thereon, and a transgene which encodes a protein which exerts a biological effect on a target cell transduced by the bacteriophage.
Preferably, the bacteriophage of the second aspect comprises a nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the bacteriophage to the target cell.
Endosome escape peptides (EEPs) are known for their potential to promote escape of vectors from endosomes by inducing disruption of endosomes (endosmolytic peptides) or by fusion with the endosomal membranes (fusogenic peptides). Accordingly, in one embodiment, the EEP is an endosmolytic peptide. In another embodiment, the EEP is a fusogenic peptide.
The inventors tested three different EEPs, the H5WYG peptide, the INF7 peptide, and the PCi peptide. An embodiment of the sequence of the H5WYG peptide is:
GLFHAIAHFIHGGWHGLIHGWYG [SEQ ID NO: 9]. An embodiment of the sequence of the INF7 peptide is: GLFEAIEGFIENGWEGMID GWYG [SEQ ID NO: 10]. An embodiment of the sequence of the PCi peptide is: H WYD SFVPWGH Q [SEQ ID NO: 11].
Hence, the endosome escape peptide maybe selected from a group consisting of: the H5WYG peptide (SEQ ID No: 9), the INF7 peptide (SEQ ID No: 10), and the PCi (SEQ ID No: 11) peptide, or a functional fragment or variant thereof. Preferably, the EEP is the H5WYG peptide or the PCi peptide, or a functional fragment or variant thereof.
Preferably, the EEP is displayed on the recombinant pVIII capsid major coat protein. Hence, preferably the coding sequence of the EEP is fused in frame with the
recombinant pVIII coding gene. Hence, in a preferred embodiment, the bacteriophage of the first or second aspect comprises a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the phage to a target cell, a second nucleic acid sequence encoding a wild type pVIII capsid major coat protein, a third nucleic acid sequence encoding a recombinant pVIII capsid major coat protein, wherein either or both of the major coat proteins is configured to display an EEP, and a transgene which encodes a protein which exerts a biological effect on the target cell.
The inventors also looked at the rate of transport of the bacteriophage of the invention to the nucleus, as they believed that this represents another rate-limiting step to transgene expression. As described in the Examples, the inventors found that when the bacteriophage displays a nuclear localization signal (NLS) peptide, it also surprisingly improved the levels of transgene expression. Accordingly, preferably the foreign peptide which is displayed on the pVIII capsid major coat protein comprises a nuclear localization signal (NLS) peptide. The inventors believe that this is another important feature of the invention. Hence, according to a third aspect of the invention, there is provided a recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display a nuclear localization signal (NLS) peptide thereon, and a transgene which encodes a protein which exerts a biological effect on a target cell transduced by the bacteriophage.
Preferably, the bacteriophage of the third aspect comprises a nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the bacteriophage to the target cell.
Nuclear localization signal peptides are known to the skilled person, and the inventors tested several of these, including the NLS peptide from the large tumour antigen of simian virus 40 (SV40 T antigen), optimized SV40 NLS, the optimized short M9 (0SM9), and a heptamer NLS peptide.
An embodiment of the sequence of the SV40 NLS is: (PKKKRKV - [SEQ ID No: 12]). An embodiment of the sequence of optimized SV40 NLS is:
(SSDDEATADAQHAAPPKKKRKV - [SEQ ID N0H3]). An embodiment of the sequence of a non-classical NLS, optimized short M9 (0SM9) is: YNNQSSNRGPYK - [SEQ ID No: 14]. An embodiment of the sequence of the heptamer NLS peptide is: QPSPSPT - [SEQ ID No:l5].
Hence, the NLS peptide may be selected from a group consisting of: the large tumour antigen of simian virus 40 (SV40 T antigen - SEQ ID No: 12); optimized SV40 NLS (SEQ ID No: 13); the optimized short M9 (0SM9) (SEQ ID No: 14); and a heptamer NLS peptide (SEQ ID No: 15), or a functional fragment or variant thereof. Preferably, the NLS peptide is the large tumour antigen of simian virus 40 (SV40 T antigen), the optimized SV40 NLS or the optimized short M9 (0SM9), or a functional fragment or variant thereof. Preferably, the NLS peptide is displayed on the recombinant pVIII capsid major coat protein. Hence, preferably the coding sequence of the NLS peptide is fused in frame with the recombinant pVIII coding gene. Hence, in another preferred embodiment, the bacteriophage of the first, second or third aspect comprises a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell-targeting ligand for enabling delivery of the phage to a target cell, a second nucleic acid sequence encoding a wild type pVIII capsid major coat protein, a third nucleic acid sequence encoding a recombinant pVIII capsid major coat protein, wherein one of the major coat proteins is configured to display an EEP and the other major coat protein is configured to display an NLS peptide, and a transgene which encodes a protein which exerts a biological effect on the target cell.
As described in the Examples, the inventors have appreciated that the negative charge of the M13 bacteriophage surface plays a crucial role in the extracellular barriers to phage due to the generation of high non-specific binding to positively charged molecules (around 35% of proteins in the human proteome). The inventors have therefore used a genetic approach to change the negative N-term of the major wild type (wt) pVIII coat protein into a mixture of anionic and cationic terminal groups by introducing a short charged neutralizing peptide termed AKAS (Ala-Lys-Ala-Ser). They have found that the incorporation of the AKAS peptide into the coat protein resulted in neutralisation of the negative charge, and even resulted in a net positive charge on the phage. Accordingly, preferably the wild type pVIII major coat protein of the bacteriophage of the first aspect comprises an N-terminal modification which neutralises the negative charge of the surface of the phage, and preferably results in a net positive charge at physiological pH. The modification preferably comprises a tetrapeptide comprising the amino acid sequence AKAS located in the N-terminal of the major coat wt pVIII protein, and preferably between residues Gly3 and Asp4 of the protein.
In a fourth aspect, there is provided the targeted bacteriophage according to the first, second or third aspect, for use in therapy or diagnosis. The invention may be used for the treatment of a wide variety of diseases due to the target-specific nature and the improved transduction efficiency of the recombinant bacteriophage of the invention. Consequently, the therapeutic opportunities of recombinant bacteriophages used in gene therapy may be significantly increased by the invention due to (i) minimisation of any side-effects, which may occur due to off-target effects of the recombinant bacteriophage, and (ii) significantly improved target-specific cellular transduction. The invention may be used prophylactically to prevent disease, or after the development of a disease, to ameliorate/treat it.
Hence, in a fifth aspect, there is provided the targeted bacteriophage according to the first, second or third aspect, for use in a gene therapy technique.
In a sixth aspect, there is provided a method of treating, preventing or ameliorating a disease in a subject using a gene therapy technique, the method comprising
administering, to a subject in need of such treatment, a therapeutically effective amount of the targeted bacteriophage according to the first aspect.
It will be appreciated that the invention may also be used to create a variety of different bacteriophages that can be used for the treatment and/ or diagnosis of a variety of diseases depending on the nature of the recombinant bacteriophage and the displayed foreign proteins. For example, in an embodiment where the bacteriophage comprises a tumor-targeting ligand and/ or which comprises a transgene expressing an anti-tumor protein (e.g. the HSVtk gene), then it may be used to treat cancer. Hence, the target cell in the gene therapy technique is preferably eukaryotic, and preferably mammalian.
The inventors have clearly demonstrated that the multifunctional bacteriophage of the invention exhibits elevated transgene expression in a transduced target cell. Hence, they believe that the phage will have a significant commercial value in the delivery of vaccines.
Thus, in a seventh aspect, there is provided a vaccine comprising the bacteriophage according to the first, second or third aspect.
In an eighth aspect, there is provided use of the bacteriophage according to the first, second or third aspect, for vaccine delivery. The vaccine is preferably a DNA vaccine. The vaccine preferably comprises a suitable adjuvant. In an embodiment, the bacteriophage vector maybe used to carry a transgene or DNA cassette encoding an antigen to stimulate the body's immune system. The multifunctional phage may also be used to directly display and express the antigen of interest on the major pVIII coat proteins, thus providing a unique platform for the simultaneous delivery, by a single phage particle, of numerous antigens as vaccine DNA vaccines or proteins readily expressed on the phage surface.
The inventors also believe that the bacteriophage of the invention can be used in a variety of different genetic-molecular imaging techniques, such as positron emission tomography (PET) or SPECT imaging.
Hence, in a ninth aspect there is provided use of the bacteriophage according to the first, second or third aspect, in a genetic-molecular imaging technique.
The transgene harboured by the phage may encode HSVtk and/ or the sodium/iodide symporter (NIS), and the phage is preferably used in combination with a radiolabelled substrate. For example, the human sodium/iodide symporter {NIS) imaging gene is preferably used in combination with I124 for clinically applicable positron emission tomography (PET) imaging, or with I125/"mTc-pertechnetate for clinically applicable SPECT imaging.
Alternatively, the HSVtk gene is preferably used in combination with radiolabeled nucleoside analogues such as the 20-[i8F]-fluoro-20-deoxy-i-b-D-arabino-furanosyl- 5-ethyluracil ([i8F]FEAU). It will be appreciated that the recombinant bacteriophages according to the invention (i.e. referred to hereinafter as "agent") maybe used in a medicament which maybe used in a monotherapy, or as an adjunct to, or in combination with, known therapies for treating, ameliorating, or preventing disease, such as cancer. The agents according to the invention may be combined in compositions having a number of different forms depending, in particular, on the manner in which the composition is to be used. Thus, for example, the composition may be in the form of a powder, tablet, capsule, liquid etc. or any other suitable form that maybe administered to a person or animal in need of treatment. It will be appreciated that the vehicle of medicaments according to the invention should be one which is well -tolerated by the subject to whom it is given. Medicaments comprising the agents according to the invention may be used in a number of ways. For instance, oral administration may be required, in which case the agents may be contained within a composition that may, for example, be ingested orally in the form of a tablet, capsule or liquid. Compositions comprising agents of the invention may be administered by inhalation (e.g. intranasally). Compositions may also be formulated for topical use. For instance, creams or ointments may be applied to the skin.
Agents according to the invention may also be incorporated within a slow- or delayed-release device. Such devices may, for example, be inserted on or under the skin, and the medicament may be released over weeks or even months. The device maybe located at least adjacent the treatment site. Such devices may be particularly advantageous when long-term treatment with agents used according to the invention is required and which would normally require frequent
administration (e.g. at least daily injection).
In a preferred embodiment, agents and compositions according to the invention may be administered to a subject by injection into the blood stream or directly into a site requiring treatment. Injections maybe intravenous (bolus or infusion) or subcutaneous (bolus or infusion), or intradermal (bolus or infusion).
It will be appreciated that the amount of the agent that is required is determined by its biological activity and bioavailability, which in turn depends on the mode of administration, the physiochemical properties of the agent (i.e. bacteriophage), and whether it is being used as a monotherapy, or in a combined therapy. The frequency of administration will also be influenced by the half-life of the agent within the subject being treated. Optimal dosages to be administered maybe determined by those skilled in the art, and will vary with the particular agent in use, the strength of the pharmaceutical composition, the mode of administration, and the advancement of the disease. Additional factors depending on the particular subject being treated will result in a need to adjust dosages, including subject age, weight, gender, diet, and time of administration.
Generally, a daily dose of between o.o^g/kg of body weight and 500mg/kg of body weight of the agent according to the invention may be used. More preferably, the daily dose is between o.oimg/kg of body weight and 400mg/kg of body weight, and more preferably between o.img/kg and 200mg/kg body weight.
As discussed in the Examples, the agent may be administered before, during the or after the onset of disease. For example, the agent may be administered immediately after a subject has developed a disease. Daily doses may be given systemically as a single administration (e.g. a single daily injection). Alternatively, the agent may require administration twice or more times during a day. As an example, the agent may be administered as two (or more depending upon the severity of the disease being treated) daily doses of between 25mg and 7000 mg (i.e. assuming a body weight of 70 kg). A patient receiving treatment may take a first dose upon waking and then a second dose in the evening (if on a two dose regime) or at 3- or 4-hourly intervals thereafter.
Alternatively, a slow release device may be used to provide optimal doses of agents according to the invention to a patient without the need to administer repeated doses.
Known procedures, such as those conventionally employed by the pharmaceutical industry (e.g. in vivo experimentation, clinical trials, etc.), may be used to form specific formulations comprising the bacteriophage according to the invention and precise therapeutic regimes (such as daily doses of the agent and the frequency of
administration).
Hence, in a tenth aspect of the invention, there is provided a pharmaceutical composition, comprising the bacteriophage according to the first, second or third aspect, and a pharmaceutically acceptable vehicle.
The composition can be used in the therapeutic amelioration, prevention or treatment of any disease in a subject that is treatable with gene therapy, such as cancer.
The invention also provides, in an eleventh aspect, a process for making the
pharmaceutical composition according to the tenth aspect, the process comprising contacting a therapeutically effective amount of the bacteriophage according to the first, second or third aspect, and a pharmaceutically acceptable vehicle.
A "subject" maybe a vertebrate, mammal, or domestic animal. Hence, agents, compositions and medicaments according to the invention may be used to treat any mammal, for example livestock (e.g. a horse), pets, or may be used in other
veterinary applications. Most preferably, however, the subject is a human being.
A "therapeutically effective amount" of agent (i.e. bacteriophage) is any amount which, when administered to a subject, is the amount of drug that is needed to treat the target disease, or produce the desired effect, e.g. result in tumor killing.
For example, the therapeutically effective amount of agent used may be from about o.oi mg to about 8oo mg, and preferably from about o.oi mg to about 500 mg.
A "pharmaceutically acceptable vehicle" as referred to herein, is any known
compound or combination of known compounds that are known to those skilled in the art to be useful in formulating pharmaceutical compositions. In one embodiment, the pharmaceutically acceptable vehicle may be a solid, and the composition may be in the form of a powder or tablet. A solid pharmaceutically acceptable vehicle may include one or more substances which may also act as flavouring agents, lubricants, solubilisers, suspending agents, dyes, fillers, glidants, compression aids, inert binders, sweeteners, preservatives, dyes, coatings, or tablet- disintegrating agents. The vehicle may also be an encapsulating material. In powders, the vehicle is a finely divided solid that is in admixture with the finely divided active agents according to the invention. In tablets, the active agent (e.g. the recombinant bacteriophage) may be mixed with a vehicle having the necessary compression properties in suitable proportions and compacted in the shape and size desired. The powders and tablets preferably contain up to 99% of the active agents. Suitable solid vehicles include, for example calcium phosphate, magnesium stearate, talc, sugars, lactose, dextrin, starch, gelatin, cellulose, polyvinylpyrrolidine, low melting waxes and ion exchange resins. In another embodiment, the pharmaceutical vehicle may be a gel and the composition may be in the form of a cream or the like.
However, the pharmaceutical vehicle may be a liquid, and the pharmaceutical composition is in the form of a solution. Liquid vehicles are used in preparing solutions, suspensions, emulsions, syrups, elixirs and pressurized compositions. The recombinant bacteriophage according to the invention may be dissolved or suspended in a pharmaceutically acceptable liquid vehicle such as water, an organic solvent, a mixture of both or pharmaceutically acceptable oils or fats. The liquid vehicle can contain other suitable pharmaceutical additives such as solubilisers, emulsifiers, buffers,
preservatives, sweeteners, flavouring agents, suspending agents, thickening agents, colours, viscosity regulators, stabilizers or osmo-regulators. Suitable examples of liquid vehicles for oral and parenteral administration include water (partially containing additives as above, e.g. cellulose derivatives, preferably sodium carboxymethyl cellulose solution), alcohols (including monohydric alcohols and polyhydric alcohols, e.g.
glycols) and their derivatives, and oils (e.g. fractionated coconut oil and arachis oil). For parenteral administration, the vehicle can also be an oily ester such as ethyl oleate and isopropyl myristate. Sterile liquid vehicles are useful in sterile liquid form compositions for parenteral administration. The liquid vehicle for pressurized compositions can be a halogenated hydrocarbon or other pharmaceutically acceptable propellant.
Liquid pharmaceutical compositions, which are sterile solutions or suspensions, can be utilized by, for example, intramuscular, intrathecal, epidural, intraperitoneal, intravenous and particularly subcutaneous injection. The recombinant bacteriophage- polymer (hybrid) vector maybe prepared as a sterile solid composition that maybe dissolved or suspended at the time of administration using sterile water, saline, or other appropriate sterile injectable medium. The recombinant bacteriophage and pharmaceutical compositions of the invention may be administered orally in the form of a sterile solution or suspension containing other solutes or suspending agents (for example, enough saline or glucose to make the solution isotonic), bile salts, acacia, gelatin, sorbitan monoleate, polysorbate 8o (oleate esters of sorbitol and its anhydrides copolymerized with ethylene oxide) and the like. The recombinant bacteriophage according to the invention can also be administered orally either in liquid or solid composition form. Compositions suitable for oral administration include solid forms, such as pills, capsules, granules, tablets, and powders, and liquid forms, such as solutions, syrups, elixirs, and suspensions. Forms useful for parenteral administration include sterile solutions, emulsions, and suspensions.
It will be appreciated that the invention extends to any nucleic acid or peptide or variant, derivative or analogue thereof, which comprises substantially the amino acid or nucleic acid sequences of any of the sequences referred to herein, including functional variants or functional fragments thereof. The terms "substantially the amino acid/polynucleotide/polypeptide sequence", "functional variant" and "functional fragment", can be a sequence that has at least 40% sequence identity with the amino acid/polynucleotide/polypeptide sequences of any one of the sequences referred to herein, for example 40% identity with the gene identified as SEQ ID No.i, 3 or 7 (which encode one embodiment of wild-type pVTII, recombinant pVIII and pill, respectively), or 40% identity with the polypeptide identified as SEQ ID No.2, 4 or 8 (i.e. one embodiment of wild-type pVIII, recombinant pVIII and pill, respectively).
Amino acid/polynucleotide/polypeptide sequences with a sequence identity which is greater than 65%, more preferably greater than 70%, even more preferably greater than 75%, and still more preferably greater than 80% sequence identity to any of the sequences referred to is also envisaged. Preferably, the amino
acid/polynucleotide/polypeptide sequence has at least 85% identity with any of the sequences referred to, more preferably at least 90% identity, even more preferably at least 92% identity, even more preferably at least 95% identity, even more preferably at least 97% identity, even more preferably at least 98% identity and, most preferably at least 99% identity with any of the sequences referred to herein.
The skilled technician will appreciate how to calculate the percentage identity between two amino acid/polynucleotide/polypeptide sequences. In order to calculate the percentage identity between two amino acid/polynucleotide/polypeptide sequences, an alignment of the two sequences must first be prepared, followed by calculation of the sequence identity value. The percentage identity for two sequences may take different values depending on:- (i) the method used to align the sequences, for example, ClustalW, BLAST, FASTA, Smith-Waterman (implemented in different programs), or structural alignment from 3D comparison; and (ii) the parameters used by the alignment method, for example, local vs global alignment, the pair-score matrix used (e.g. BLOSUM62, PAM250, Gonnet etc.), and gap-penalty, e.g. functional form and constants. Having made the alignment, there are many different ways of calculating percentage identity between the two sequences. For example, one may divide the number of identities by: (i) the length of shortest sequence; (ii) the length of alignment; (iii) the mean length of sequence; (iv) the number of non-gap positions; or (iv) the number of equivalenced positions excluding overhangs. Furthermore, it will be appreciated that percentage identity is also strongly length dependent. Therefore, the shorter a pair of sequences is, the higher the sequence identity one may expect to occur by chance. Hence, it will be appreciated that the accurate alignment of protein or DNA sequences is a complex process. The popular multiple alignment program ClustalW (Thompson et al., 1994, Nucleic Acids Research, 22, 4673-4680; Thompson et al., 1997, Nucleic Acids Research, 24, 4876-4882) is a preferred way for generating multiple alignments of proteins or DNA in accordance with the invention. Suitable parameters for ClustalW may be as follows: For DNA alignments: Gap Open Penalty = 15.0, Gap Extension Penalty = 6.66, and Matrix = Identity. For protein alignments: Gap Open Penalty = 10.0, Gap Extension Penalty = 0.2, and Matrix = Gonnet. For DNA and Protein alignments: ENDGAP = -1, and GAPDIST = 4. Those skilled in the art will be aware that it may be necessary to vary these and other parameters for optimal sequence alignment.
Preferably, calculation of percentage identities between two amino
acid/ polynucleotide/ polypeptide sequences is then calculated from such an alignment as (N/T)*ioo, where N is the number of positions at which the sequences share an identical residue, and T is the total number of positions compared including gaps but excluding overhangs. Hence, a most preferred method for calculating percentage identity between two sequences comprises (i) preparing a sequence alignment using the ClustalW program using a suitable set of parameters, for example, as set out above; and (ii) inserting the values of N and T into the following formula:- Sequence Identity =
Figure imgf000021_0001
Alternative methods for identifying similar sequences will be known to those skilled in the art. For example, a substantially similar nucleotide sequence will be encoded by a sequence which hybridizes to the sequences shown in SEQ ID Nos. 1, 3 or 7, or their complements under stringent conditions. By stringent conditions, we mean the nucleotide hybridises to filter-bound DNA or RNA in 3x sodium chloride/sodium citrate (SSC) at approximately 45°C followed by at least one wash in o.2x SSC/ 0.1% SDS at approximately 20-65°C. Alternatively, a substantially similar polypeptide may differ by at least 1, but less than 5, 10, 20, 50 or 100 amino acids from the sequences shown in SEQ ID No's. 2, 4, 8-15.
Due to the degeneracy of the genetic code, it is clear that any nucleic acid sequence could be varied or changed without substantially affecting the sequence of the protein encoded thereby, to provide a functional variant thereof. Suitable nucleotide variants are those having a sequence altered by the substitution of different codons that encode the same amino acid within the sequence, thus producing a silent change. Other suitable variants are those having homologous nucleotide sequences but comprising all, or portions of, sequence, which are altered by the substitution of different codons that encode an amino acid with a side chain of similar biophysical properties to the amino acid it substitutes, to produce a conservative change. For example small non-polar, hydrophobic amino acids include glycine, alanine, leucine, isoleucine, valine, proline, and methionine. Large non-polar, hydrophobic amino acids include phenylalanine, tryptophan and tyrosine. The polar neutral amino acids include serine, threonine, cysteine, asparagine and glutamine. The positively charged (basic) amino acids include lysine, arginine and histidine. The negatively charged (acidic) amino acids include aspartic acid and glutamic acid. It will therefore be appreciated which amino acids may be replaced with an amino acid having similar biophysical properties, and the skilled technician will know the nucleotide sequences encoding these amino acids.
All of the features described herein (including any accompanying claims, abstract and drawings), and/ or all of the steps of any method or process so disclosed, may be combined with any of the above aspects in any combination, except combinations where at least some of such features and/ or steps are mutually exclusive.
For a better understanding of the invention, and to show how embodiments of the same may be carried into effect, reference will now be made, by way of example, to the accompanying Figures, in which: -
Figure l is a schematic representation of an embodiment of a multifunctional phage particle model system according to the invention. In the embodiment shown the phage is tetrafunctional displaying a targeting RGD4C ligand on the pill minor coat protein and multiple copies of gold binding peptide and streptavidin-binding peptide on the surface. A mammalian transgene cassette, driven by the cytomegalovirus promoter (CMV), was also inserted in the bacteriophage genome to allow transgene expression by the multifunctional phage;
Figure 2 is a schematic representation of four phage vectors used in this study, a) Insertless phage, without any ligand. b) bifunctional phage, displaying the RGD4C ligand and carrying a mammalian transgene cassette, c) Trifunctional phage, simultaneously carrying RGD4C, a streptavidin-binding peptide and a transgene cassette, d) Tetrafunctional phage, simultaneously displaying RGD4C, streptavidin- binding peptide, gold-binding peptide and transgene cassette; Figure 3 shows immunofluorescence-based phage binding and internalization assay with cultured human M21 melanoma cells. The red colour represents fluorescence related to phage staining, and the blue colour shows fluorescence of DAPI-stained cell nuclei. Cells were incubated with different phage preparations, all carrying a phage input of 1.0 x 106 transducing units (TU/ cell);
Figure 4 shows confocal microscopy images. Shown are M21 melanoma cells incubated with phage preparations (input of 1 x 106 TU/cell) and labelled with anti- bacteriophage antibody (red) and DAPI nucleus stain (blue), a) free phage, b) internalizing phage, c) control insertless phage, d) bifunctional phage, e) trifunctional phage, f) tetrafunctional phage (Scale bar, 10 μπι);
Figure 5 shows that the tetrafunctional phage of the invention binds to streptavidin. Different phage constructs were incubated with immobilised streptavidin and washed prior to infection of K91. Binding of the trifunctional and tetrafunctional phage, both of which display streptavidin-binding peptides, were proved by the greater number of bacterial transducing units. Shown are the mean ± SEM from triplicate wells;
Figure 6 shows binding of the tetrafunctional phage to gold nanoparticles. a)
Precipitation assay showing precipitate formation upon mixing a gold colloidal solution with the tetrafunctional phage, b) Dots A, B, and C represent insertless phage, bifunctional and trifunctional phage, respectively. Significant staining was observed in dots D and E representing the tetrafunctional phage;
Figure 7 shows GFP expression by the multifunctional phage in HEK293 cells. GFP expression, analyzed by three independent observers, was detected at all time-points post cell treatment. Shown are representative images of cells at days 4 and 5 following transduction with the multifunctional phage;
Figures 8a and 8b show multifunctional phage carrying endosome-escape-peptides boosts transgene expression from phage. Human M2imelanoma cells or rat 9L glioma cells were treated with 3x104 TU/cell of targeted RGD4C multifunctional phage expressing the reporter Luciferase gene and displaying the endosome-escape-peptides H5WYG, INF or PCi. Luciferase transgene expression by vectors in cells was evaluated by measurement of the luciferase activity at day 3 post vector transduction. Luciferase activity was expressed as the mean relative luminescence units (RLU) normalized to protein amount;
Figures 9a and 9b show multifunctional phage carrying endosome-escape-peptides and cationic polymers remarkably boosts transgene expression from phage. Human M2imelanoma cells or rat 9L glioma cells were treated with 3x1ο4 TU/cell of targeted RGD4C multifunctional phage expressing the reporter Luciferase gene, displaying the endosome-escape-peptides H5WYG, INF or PCi and complexed with cationic polymers. Luciferase transgene expression by vectors in cells was evaluated by measurement of the luciferase activity at day 3 post vector transduction. Luciferase activity was expressed as the mean relative luminescence units (RLU) normalized to protein amount;
Figure 10 shows GFP expression in HEK293 cells at days 2 and 3 post-transduction. Analysis of GFP expression in HEK293 cells showed that transgene expression from phage vectors simultaneously displaying RGD4C and SV40-NLS ligands was detectable at 48 hours, whereas GFP expression from the phage displaying RGD4C ligand only started at 72 hours post vector transduction;
Figure 11 shows time course of phage-mediated Luc transgene expression. HEK293 cells were seeded in 48-well plates and grown until 70-80% confluence. The cells were then incubated for 4 hours with lxio6 TU/ cell of different phage displaying RGD4C and different nuclear localization signal compared to cells treated with non-targeted vectors. The luciferase assay was performed over a time course of 5 days after vector transduction. The results represent the average RLU of targeted per lOO g protein of triplicate wells +/- the standard error of the mean (S.E.M);
Figure 12 shows AKAS display does not affect the phage titre and results in new physical characteristics, a) Bacterial colonies after infection of E.coli K9iKan with 2.10 7 dilution of the parental multifunctional RGD4C-phage and the two new phages (RGD4C-phage-AKASi and RGD4C-phage-AKAS2). b, c) Phages were incubated overnight with the cationic DEAE-dextran polymer. The suspension containing the phage particles not attached to the polymer was recuperated and used to infect E.coli K9iKan. b) LB-agar plates (containing 40 μg/ml Tet and 100 μg/ml Kan) showing differential colony formation between the RGD4C and the two AKAS phages. One representative plate of each phage and each dilution is shown, c) Phage recovery in terms of percentage of input. These assays were repeated twice in triplicate and the results shown are representative of one experiment. Statistical analysis: One way ANOVA (a and c). * p<0.05; n.s = no significant;
Figure 13 shows 9L rat glioblastoma cells are transduced by parental and the two new AKAS phages carrying the GFP or Luc reporter genes. The 9L cells (60-80% confluent in 48-well plates) were incubated with 3xio4TU/cell (containing the GFP or Luc reporter gene) for 4h in serum-free medium. After 4h, complete medium was added. GFP expression was monitored at day 5 post phage transduction with a) RGD4C-phage and (b and c) the two clones of the new phage RGD4C-phage-AKASi/ 2. As negative control we used d) cells without phage treatment. All pictures represent a portion of one of the triplicate wells, e) The quantitative Luc measurement assay was performed at day 3 post phage transduction and normalized to protein concentration determined by the Bradford assay. Results represent the average ISEM relative luminescence units (RLU)/ 100 μg of protein from triplicate wells. All assays were repeated twice;
Figure 14 shows Luciferase expression after incubation of phage with fibrinogen. The 9L cells (60-80% confluent in 48-well plates) were transduced with 3xio4TU/cell containing the Luc reporter gene for 4h in serum free media. Two conditions were assessed: cells treated directly with the phages (left bars) or cells treated with phage after 60 minutes incubation with fibrinogen (right bars). After 4h, complete medium was added. Results represent the average iSFAf relative luminescence units (RLU)/ 100 μg of protein from triplicates at day 3 post-transduction. The experiment was repeated twice. **p<o.oi; and
Figure 15 shows the effect of anti-phage antibody on luciferase expression in cells transduced with RGD4C-phage or RGD4C-phage-AKAS. The 9L cells (60-80% confluent in 48-well plates) were incubated with 3x1ο4 TU/ cell solution containing complete media and several anti-phage antibody concentrations. Results represent the average iST relative luminescence units (RLU)/ 100 μg of protein from triplicates at day 3 post-transduction and the same experiment was repeated twice. Statistical analysis: T-student test. ** p < 0.01; n.s = no significant.
Examples
Summary
The inventors investigated the barriers to gene transfer by bacteriophage in eukaryotic cells. First they searched for the existence of extracellular barriers to phage and found that one of the limitations in phage is its surface negative charge which hinders phage accessibility to the negatively charged eukaryotic cell membranes and subsequent binding to the target cell receptor. In addition, the inventors assessed the intracellular trafficking of phage in mammalian cells and found that, after internalization, the major intracellular obstacle to bacteriophage gene transfer efficiency is phage sequestration in acidic endosomal vesicles, and its subsequent degradation in the lysosomal
compartment. Accordingly, the inventors developed strategies to overcome both of these extracellular and intracellular barriers to phage-mediated transgene expression. Compared with eukaryotic viral vectors, bacteriophage requires additional commands to by-pass these extracellular and intracellular obstacles. One strategy adopted was to transfer, into the phage capsid, the efficient mechanisms developed and used by many eukaryotic viruses. For example, to attain endosomal release, one strategy was to integrate, into the phage capsid, histidine-rich peptides to buffer against the ATP- dependent proton pump located in the membrane of endosomes resulting in endosomal disruption and subsequent viral escape.
As shown in Figures l and 2, as a proof-of-concept, the inventors used the known RGD4C-phage displaying the targeting ligand, for mammalian receptor binding, on the pill minor coat protein because it is well-characterized. The pill has the advantage of displaying large targeting ligands since chimeric pill molecules which contain large inserts appear to package into phage well. As the pill minor coat protein displays the targeting ligand CDCRGDCFC (RGD4C), the inventors aimed at displaying the peptides for overcoming mammalian cell barriers on the pVIII major coat protein. Since insertion of large peptides inserts on the major coat protein by itself cannot support phage assembly, the inventor created a RGD4C-phage genome that bears two genes which encode different types of pVIII molecule. The first pVIII protein is the initial integral wild-type protein, which is used to display of a second functional peptide, and the other pVIII protein is the recombinant pVIII that served to display large sized peptides. The recombinant pVIII was removed from the f88-4 phage and inserted into the targeted RGD4C-phage, and then expressed from an IPTG-inducible tac promoter. Thus, the coat of the new multifunctional phage (bearing the two pVIII coat proteins) was composed of both wild-type and recombinant pVIII subunits; the latter typically comprises at least -150 of the 3900 subunits of the wild-type, which can vary depending on the concentration of the IPTG (at least 1 mM) used to induce the tac promoter and subsequently the expression of the recombinant pVIII.
Materials and Methods
Construction of the multifunctional bacteriophage
Targeted multifunctional phage particles were made in a multiple-step process. First, a targeting ligand peptide of choice (e.g. RGD4C) was displayed on the pill minor coat protein to generate a targeted backbone phage vector for binding to a mammalian cell receptor. Second, a DNA fragment containing a recombinant rpVIII gene was inserted in the genome of the targeted phage, followed by display of the peptide ligand of interest. Third, a peptide of interest was displayed on the wild-type pVIII major coat protein by site-directed mutagenesis. Finally, a mammalian transgene cassette was inserted in an intergenomic region of the phage genome. Expression of the targeting ligand on the phage's capsid was performed by using the Mi3-derived fUSEs phage plasmid (accession number AF218364). Targeting peptides were displayed on the pill minor coat protein of the fUSEs phage as previously described in the detailed protocol (Hajitou, A. et al. Design and construction of targeted AAVP vectors for mammalian cell transduction. NatProtoc 2, 523-531 (2007)) by cloning the corresponding oligonucleotide sequences flanked by Bgll restrictions sites into the Sfil site of the pill coat gene of a targeted RGD4C-fUSE5 phage. Design and construction of the RGD4C-phage containing two major coat proteins
The f88-4 phage (GenBank Accession AF218363) whose total genome length is 9234 base-pairs harbours two genes encoding two different types of the major coat protein, pVIII. One pVIII is recombinant (rpVIII) and the other is wild-type (wt pVIII). Hence, the f88-4 coat is composed of both wild-type and recombinant pVIII subunits. To create a targeted RGD4C-phage bearing an additional recombinant pVIII coat protein, the inventors used the BamHI and Xbal restriction enzymes to digest the plasmid DNA of the two existing phage RGD4C-fUSE5 and f88-4, because they have unique restriction sites present at similar locations in the DNA backbone of the two phages. Then, fragments with the corresponding cassettes (3925 bp fragment containing RGD4C from RGD4C-fUSE5 plasmid and a 5360 bp fragment containing the recombinant pVIII from f88-4 plasmid) were ligated to create a chimeric RGD4C-phage construct in which pill and recombinant pVIII were mapped to their locations. A control non-targeted chimera phage (fUSE5/f88-4) without a targeting ligand RGD4C was also constructed.
Insert preparation and cloning of peptides in the recombinant pVIII of RGD4C- fUSEfi/f88 phage
To display a peptide on the recombinant rpVIII coat protein, the corresponding oligonucleotide sequence and its complementary oligonucleotide were designed (see Table 1).
Table 1 - Oligonucleotide (oligo) sequences for peptide display on the recombinant rpVIII coat protein. The sense and anti-sense oligos are F,' phosphorylated and the nucleotides X correspond to the sequence encoding for the peptide ligand of interest
Primer Sequence (5'— 3') Sense oligo
5'AGCTTTGCCAACGTCXXXXXXXXXXXXXXXXXXXCCTGCA-3'
[SEQ ID No.16]
Antisense oligo 5'-
GGXXXXXXXXXXXXXXXXXXXXXXXXXGACGTTGGCAA-3'
[SEQ ID N0.17] The phosphorylated primers were mixed (20pmol/primer), heated to 95 °C for 5 min and gradually cooled at room temperature to allow annealing. Annealing of sense and anti-sense oligonucleotides generated the Hindlll and Pstl sticky ends ready to ligate into the Hindlll and Pstl of the digested RGD4C-phage chimera plasmid. All general procedures employed for construction, production and analysis of recombinant phage, DNA sequencing, are detailed in previously published protocols (Petrenko VA and Brigati JR. In Emon JMV (ed.). 2007. Immunoassay and other Bioanalytical
Techniques. CRC press, Taylor & Francis Group, Boca Raton, FL.).
Display of peptides on the wild type (wt) pVIII major coat protein
Peptides of short length (up to 10 amino acid residues) were inserted into the major pVIII coat protein by using the Phusion Site-Directed Mutagenesis Kit (Thermo SCIENTIFIC). Briefly, synthetic oligonucleotide primers for mutagenic PCR were designed (see Table 2). Table 2 - Primer sequences used in site-directed mutagenesis. Both primers are 5' phosphorylated to avoid a spontaneous recircularization of the vector. Nucleotides in red (X) correspond to the peptide of interest.
Primer Sequence (5'— 3')
Forward P.XXXXXXXXXGATCCCGCAAAAGCGGCCTTTG
[SEQ ID N0.18]
Reverse P.AGCAGCGAAAGACAGCATCG
[SEQ ID N0.19] A PCR (50 μί, reaction) with Phusion Hot Start II DNA polymerase using double- stranded RGD-phage vector DNA as template and the forward/ reverse primer pair was prepared and thermocycled using the following setup: 98 °C for 30 s, followed by 25 cycles at 98°C for 15 s, 6i°C for 30 s and 72°C for 5 min (approximately 30 s elongation per 500 bp). The linear PCR product was circularized by ligation using the Quick T4 DNA Ligase in a 5 minute reaction. Ligated DNA was transformed by heat shock into chemically competent DHsa . coli bacteria, plated on Luria-Bertani broth (LB) - tetracycline (Tet) agar plates and incubated for 24h at 37°C. Single colonies were picked and grown overnight in 5 mL LB-Tet. DNA was isolated by using a QIAprep Spin Miniprep kit (QIAGEN) and sent to sequence (Macrogen).
Insertion of a mammalian transgene cassette into the RGD4C-fUSEfi/f88-4 expression vector
To generate a targeted multifunctional phage particle for gene expression in
mammalian cells, a eukaryotic transgene cassette was inserted into the Sad site located at 5650 bp in an intergenomic region of the phage genome. In brief, both the transgene cassette flanked by Sad restriction sites and the phage genome were digested with the Sac I restriction enzyme, then ligated. The phage DNA was subjected to Sad
endonuclease digestion (3h at 37°C), dephosphorylation (lhr at 37°C) and Sad inactivation (30 min at 70°C). The vector band (9.8 kb) was purified by agarose gel electrophoresis (QIAgen gel extraction kit) and ligated with the transgene cassette expressing a transgene. Quick T4 DNA Ligase was used for a 5 minute ligation reaction. Following transformation of bacteria with the ligation product, colonies were picked and DNA isolation was performed. To check which plasmids contained the insert, isolated DNA was run at 1% ethidium bromide containing agarose gel (in lX TAE [40 mM Tris (sigma), 20 mM acetic acid (Sigma) and imM Ethylenediaminetetraacetic acid (EDTA, Sigma)] at 90 V for 1 hour. Ladder (Fermentas) was used as an indicator of molecular weight). Midiprep (QIAGEN) instead of miniprep (QIAGEN) was performed because of the low copy plasmid obtained with vectors that contained the transgene cassette.
Expression of nuclear localisation signal (NLS)
The phage vector RGD4C-fUSE5/f88.4 (GenBank Accession for fUSEs is AF218364, for f88-4 AF218363) is composed of recombinant gene III containing RGD4C-encoding inserts and recombinant gene WHthat was used as the scaffold for nuclear targeting ligand (NLS) display. Oligonucleotides encoding the desired NLS were then inserted. Next, the mammalian transgene cassette was inserted in the genome of this chimeric phage.
Foreign inserts encoding NLS peptide were spliced between the Hindlll and Pstl cloning sites after removing the stuffer that lies between them in the vector. Productive inserts had the following general structure:
5 ' -AGC I TTT I GCC | NNN | ... | NNT | GCA-3 '
3' -AA|CGG|NNN| ... |NN-5'
NLS peptides that were used included: -
1. The Classical SV40 NLS (PKKKRKV - [SEQ ID No:i2])
2. The optimized SV40 NLS (SSDDEATADAQHAAPPKKKRKV - [SEQ ID No:i3]),
3. A nonclassical NLS, the optimized short M9 (0SM9); YNNQSSNRGPYK - [SEQ ID No: 14]
4. A heptamer peptide (QPSPSPT - [SEQ ID No:i5]).
The sequence of the sense oligonucleotide used to produce the Classical SV40 NLS peptide is:
5' AGCTTTGCCAACGTCCCGAAAAAAAAACGCAAAGTGCCTGCA 3' [SEQ ID No.16]
The sequence of the antisense oligonucleotide used to produce the Classical SV40 NLS peptide is: 5' GGCACTTTGCGITTTTTTTT'CGGGACGTTGGCAA 3' [SEQ ID No.17] The sequence of the sense oligonucleotide used to produce the optimized SV40 NLS peptide is:
5'AGCTTTGCCAACGTCAGCAGCGATGATGAAGCGACCGCGGATAGCCAGCACGCGGC GCCGCCGAAAAAAAAACGCAAAGTGCCTGCA 3' [SEQ ID No.18] The sequence of the antisense oligonucleotide used to produce the optimized SV40 NLS peptide is:
5'GGCACTTTGCGl'l'ri'l'ri'lTCGGCGGCGCCGCGTGCTGGCTATCCGCGGTCGCTTCA TCATCGCTGCTGACGTTGGCAA 3' [SEQ ID No.19]
The sequence of the sense oligonucleotide used to produce the optimized short M9 (0SM9) NLS peptide is: 5'
AGCTTTGCCAACGTCTATAACAACCAGAGCAGCAACCGCGGCCCGTATAAACCTGCA
3' [SEQ ID No.2o]
The sequence of the antisense oligonucleotide used to produce the optimized short M9 (0SM9) NLS peptide is:
5' GGTTTATACGGGCCGCGGTTGCTGCTCTGGTTGTTATAGACGTTGGCAA 3' [SEQ ID N0.21]
The sequence of the sense oligonucleotide used to produce the heptamer peptide NLS peptide is:
5' AGCTTTGCCAACGTCCAGCCGAGCCCGAGCCCGACCCCTGCA 3' [SEQ ID No.22]
The sequence of the antisense oligonucleotide used to produce the heptamer peptide NLS peptide is: 5' GGGGTCGGGCTCGGGCTCGGCTGGACGTTGGCAA 3 ' [SEQ ID No.23]
Expression of endosome-escape peptide (EEP)
The phage vector RGD4C-fUSE5/f88.4 (GenBank Accession for fUSEs is AF218364, for f88-4 AF218363) plasmid is composed of recombinant gene III containing RGD4C- encoding inserts and recombinant gene Mil and was used as the scaffold for endosome escape peptide (EEP) display. Oligonucleotides encoding the desired EEP were then inserted. Next, the mammalian transgene cassette was inserted in the genome of this chimeric phage. Three different EEP's were used: -
1. The H5WYG peptide which is a synthetic histidylated fusogenic peptide with endosomal buffering capacity, derived from the N-terminal sequence of the HA2 sunbunit of the influenza virus hemagglutinin (Midoux, P., Kichler, A., Boutin, V., Maurizot, J.C. & Monsigny, M. Membrane permeabilization and efficient gene transfer by a peptide containing several histidines. Bioconjug Chem 9, 260-267 (1998).
The sequence of the H5WYG peptide is: GLFHAIAHFIHGGWHGLIHGWYG [SEQ ID
NO:9]. The sequence of the sense oligonucleotide used to produce the H5WYG peptide is: 5'AGCTTTGCCAACGTCGGCCTGTTCCATGCGATCGCGCATTTCATCCATGGCGGCTGGCATGG CCTG ATCCATGGCTGGTATGGCCCTGCA 3' [SEQ ID NO 124] The sequence of the antisense oligonucleotide used to produce the H5WYG peptide is: 5'GGGCCATACCAGCCATGGATCAGGCCATGCCAGCCGCCATGGATGAAATGCGCGATCGCATG GAACAGGCCGACGTTGGCA 3' [SEQ ID NO: 25]
2. The INF7 peptide is a pH-dependent fusogenic peptide derived from the N- terminal of influenza HA2. INF7 (a 23-mer acidic derivative) in particular was shown to have high specificity for low pH (5.5), and yielded higher membrane lytic activity (Plank, C, Oberhauser, B., Mechtler, K., Koch, C. & Wagner, E. The influence of endosome-disruptive peptides on gene transfer using synthetic virus-like gene transfer systems. J Biol Chem 269, 12918-12924 (1994).
The sequence of the INF7 peptide is: GLFEAIEGFIENGWEGMIDGWYG [SEQ ID NO:io].
The sequence of the sense oligonucleotide used to produce the INF7 peptide is:
5'AGCTTTGCCAACGTCGGCCTGTTCGAAGCGATCGAAGGCTTCATCGAAAACGGCTG GGAAGGCATGATCGATGGCTGGTATGGCCCTGCA 3 ' [SEQ ID NO:26]
The sequence of the antisense oligonucleotide used to produce the INF7 peptide is: 5' GGGCCATACCAGCCATCGATCATGCCT CCCAGCCGTTTTCGATGAAGCCTTCGATCG CTTCGAACAGGCCGACGTTGGCAA 3' [SEQ ID NO:27]
3. The PCi peptide is a pH-dependent endosomolytic peptide identified by phage display. Due to its tryptophan content, it was alleged that the peptide could cause endosomal membrane lysis by insertion into lipidic bilayers Hirosue, S. and Weber, T. (2006). pH-Dependent lytic peptides discovered by phage display. Biochemistry. 45 (20): 6476-6487.
The sequence of the PCi peptide is: HWYDSFVPWGHQ [SEQ ID NO:ii]. The sequence of the sense oligonucleotide used to produce the PCi peptide is: 5' AGCTTTGCCAACGTCCATTGGTATGATAGCTTCGTGCCGTGGGGCCATCAGCCTGCA
3' [SEQ ID NO:28] The sequence of the antisense oligonucleotide used to produce the PCi peptide is: 5' GGCTGATGGCCCCACGGCACGAAGCTATCATACCAATGGACGTTGGCAA 3 ' [SEQ ID NO:29]
Phage production, purification and titration
Targeted and control phage vectors are amplified, isolated and purified from the culture supernatant of host bacteria (E. coli K jiKan) as the inventors recently reported in detail in Hajitou, A. et al. Design and construction of targeted AAVP vectors for mammalian cell transduction. Nat Protoc 2, 523-531 (2007). Vector particles in suspension are sterile-filtered through 0.45-μπι filters. Because the recombinant gene pVIII in the chimera RGD4C-phage was transcribed from an IPTG-inducible tac promoter, the inventors added 1 mM of IPTG (Isopropyl β-D-i-thiogalactopyranoside) during phage production to display the peptide inserts.
(i) Phage production
E.coli K9iKan was used to produce the phages because they are pilus-positive F+ bacteria and can therefore be infected by the newly produced phage particles during the overnight growth. This phenomenon resulted in higher titers. Briefly, E.coli K jiKan were grown in a 7 ml Terrific Broth (TB), containing 100 μg/mL Kanamycin at 37°C by shaking at 250 rpm until a log-phase growth was obtained (1 hour). One ml of the mixture was then incubated 1 hour at room temperature with 50 μΐ, of E.coli DH50 culture carrying the desired phage vector. The next step was to mix the previously incubated 1 mL with 15 mL of LB containing 40 μg/ ml tetracycline and 100 μg/ ml Kanamycin and incubated for 4 hours at 37°C. This was then transferred to 500 mL LB broth (40 μg/ml tetracycline and 100 μg/ml kanamycin) and incubated overnight at 37°C.
(ii) Phage purification
Bacterial growth cultures were centrifuged for 30 min at 6000 g and 4°C to pellet the bacteria. The supernatant was collected and incubated with 15% Polyethylene- glycol/Sodium chloride (PEG/NaCl, Sigma) and kept on ice for 2 hours to allow precipitation of the phage viral particles. The suspension was centrifuged for 30 min at loooo g and 4°C to get the white phage pellet. The supernatant was discarded and centrifuged for an additional 5 min. The pellet was suspended in 7 ml lX Phosphate- Buffered Saline (PBS, sigma) with shaking during 1 hour at 37°C. Again, PEG/NaCl (15% of the mixture volume) was added and kept on ice for 2 hours. After incubation, centrifugation for 30 min at i4000g and 4°C was carried out and, afterwards, the supernatant was discarded. The pellet was then re-suspended in 500 μΐ of lX PBS and agitated at 37°C until a homogeneous suspension was obtained (approximately lh and 30 min). The mixture was transferred to an eppendorf tube and centrifuge using a benchtop centrifuge for 10 min at 13000 rpm for 10 min (repeated 2-3 times) to remove any residual bacteria debris and finally sterile-filtered through a 0.45 μπι filter.
(iii) Phage titration
The amount of phage viral particles in suspension were sterile-filtered through 0.45-μπι filters, then titrated by infection of host E.coli K jiKan bacteria for colony counting and expressed as bacterial transducing units (TU) as reported in the detailed protocol (Hajitou, A. et al. NatProtoc 2, 523-531 (2007).
Infectivity assay
To check whether the display of the tetrapeptide AKAS on the wt pVIII affects the phage ability to infect bacteria, the inventors performed an infectivity assay. The parental multifunctional phage and the newly produced AKAS multifunctional phage were adjusted to the identical titre and submitted to serial dilutions, then 5 μΐ, of each dilution were incubated with 1 ml of E.coli K jiKan for 20 min at room temperature.
After incubation, 200 μΐ, of the dilutions 5x1ο 6, 5xio~7 and 5x1ο 8 were spread in triplicates on LB agar plates containing 40 μg/ml tetracycline and 100 μg/ml kanamycin and incubated overnight at 37°C. Finally, the colonies at 5.10 7 and 5.10 8 dilutions were counted.
Cell targeting and fluorescent imaging
Cells were seeded on 18 mm2 coverslips in 12-well plates. The next day, cells at approximately 50-60% confluence were incubated with phage for 4 hours at 37 °C. Cells were washed and fixed with phosphate buffered saline (PBS) containing 4% paraformaldehyde. Cells were then incubated for 5 minutes somM Ammonium
Chloride to quench free aldehyde groups from fixation, permeabilized with 0.2% Triton X-ioo, washed, and blocked with PBS containing 2% BSA, and the cells were incubated with rabbit anti-Mi3 bacteriophage antibody for 1 hr at room temperature followed by a l hr incubation with Cy3-labeled anti-rabbit IgG antibody. Finally, cells were mounted in the presence of DAPI. Images were acquired with either an Olympus fluorescence microscope and a Zeiss LSM510 laser scanning confocal microscope. Mammalian cell transduction by phage
A subconfluent monolayer culture of cells was seeded in 48-well plates and incubated at 37 °C for 24 hours, until 80% confluent. Phage/serum-free medium mixture was incubated with cells at 37°C with a ratio of lxio6 TU phage per cell or otherwise, as stated in the text. When mixed with cationic polymers, phage was used at 3x104 TU/ cell, while the cationic polymers poly-D-lysine (PDL), or diethylaminoethyl-dextran DEAE.DEX) were applied at 7 μg/ml and 15 μg/ml, respectively. After 4 hours of incubation, complete medium was added to each well. The plate was incubated in C02 incubator at 37°C and the medium was renewed every day. Transgene expression was assessed at various time points depending on the experiment carried out. For
Luciferase assay, the Promega Steady-glo® luciferase assay kit was used to evaluate the expression of Luciferase reporter transgene in phage-transduced cells. Luciferase expression was quantified using a Turner Biosystems microplate luminometer.
Luciferase assays were performed in triplicate and normalized to loc^g cell protein, as determined by the Bradford assay.
DEAE-dextran polymer assay
To coat the plate surface, lml of DEAE-dextran 2mg/ ml (sigma) was incubated overnight at 37°C. The excess of polymer was removed and washed once with lml lX PBS before addition of 5 of phage in lml PBS and incubated overnight at 37°C. The phage suspension was recovered and used to infect E.coli K jiKan following the same steps described in the infectivity assay.
Anti-phage antibody assay
Cells were treated as described above and transduced with a mixture of phage and an anti-phage polyclonal antibody (Sigma). The Antibody was used at 1:8000 dilution and cell transduction was determined and evaluated by the Luciferase assay.
Fibrinogen assay
Wells of the 48 wells-plate were coated with fibrinogen 2mg/ ml (Sigma) during 2 hours at 37°C. The excess of fibrinogen was removed and 5μί, of phage in 110 μί, serum free media were added. After 1 hour incubation at 37°C cell transduction was performed as described in the cell transduction section. The levels of transduction were determined by Luciferase assay.
Results
Example ι - Construction and characterization of the multifunctional phage display model system
The RGD4C-phage is an Mi3-derived fUSEs phage (GenBank Accession number:
AF218364) that bears a single gene pVIII; while the Mi3-derived f88.4 phage
(GenBank Accession number: AF218363) bears two genes pVIII, encoding two different types of pVIII molecules namely wild-type and the recombinant pVIII. Thus, a fragment containing the recombinant pVIII gene under a tac promoter, was removed from the f88.4 phage and inserted into an intergenomic region of the RGD4C-phage to generate an RGD4C-phage bearing the two pVIII genes. Next, the inventors inserted a mammalian transgene cassette in the genome of this multifunctional phage. To show that display of peptides, on the pVIII major coat proteins, remain intact and functional in the context of the multifunctional phage, and as proof of principle, the inventors constructed phage displaying the two well characterized peptides, i.e. (i) a streptavidin- binding peptide, and (ii) a gold-binding peptide (Figures 1 and 2). The coding sequences of the streptavidin-binding peptide (ANRLCHPQFPCTSHE - [SEQ ID No:5]) were fused in frame with recombinant pVIII coding gene (Chen, L. et al. Design and validation of a bifunctional ligand display system for receptor targeting. Chem Biol 11, 1081-1091 (2004). The coding sequence of a gold-binding peptide (VSGSSPDS - [SEQ ID No:6]) (Huang, Y. et al. Programmable assembly of nanoarchitectures using genetically engineered viruses. Nano Lett5, 1429-1434 (2005)), was displayed on the wild-type major coat protein wt pVIII. Thus, the resulting phage particle
simultaneously displayed RGD4C ligand at the phage end and multiple copies of gold binding peptide and streptavidin-binding peptide on the surface, in addition to harbouring the mammalian transgene cassette in its genome. Sequencing analyses were carried out to confirm the presence of the correct sequences and orientation of inserts and the mammalian transgene cassette, and to determine if any mutations occurred during cloning. Example 2 - Cell-surface integrin binding characteristics of the multifunctional phage After demonstrating that all peptides are correctly displayed on the pill minor coat protein as well as on the recombinant and wild type pVIII major coat proteins of the multifunctional phage, the inventors sought to confirm that the moieties carried by the multifunctional phage remain intact and functional. Firstly, to validate the function of the RGD4C targeting ligand, displayed on the pill minor coat protein, the inventors assessed binding and receptor-mediated entry of the multifunctional phage to cells expressing the ανβ3 integrin receptors for RGD4C. Immunofluorescence-staining assays and confocal microscopy with antibodies against the phage capsid were carried out on the M21 human melanoma cells because they express high levels of ανβ3 integrin (Albelda, S.M. et al. Integrin distribution in malignant melanoma: association of the beta 3 subunit with tumor progression. Cancer Res 50, 6757-6764 (1990). The inventors showed that the targeting and receptor-mediated internalization capabilities of the RGD4C peptide remained intact within the tetrafunctional phage relative to those observed for the trifunctional and bifunctional phages. Negative controls showed only background signal (Figures 3 and 4).
Example 3 - Testing the streptavidin binding capacity of the multifunctional phage To test that the streptavidin-binding peptide was functional when displayed on the capsid of the multifunctional phage, the inventors assessed the ability of this phage to bind to streptavidin in in vitro phage binding assays. Bound phages were recovered from streptavidin-coated plates by infection of host bacteria E.coli K91. Interestingly, the tetrafunctional and trifunctional phage, displaying a streptavidin-binding peptide, showed high and similar levels of binding to immobilized streptavidin. While, insertless phage (no RGD4C) and bifunctional RGD4C phage did not show any binding (Figure 5).
Example 4 - Testing the gold nanoparticles binding capacity of the tetrafunctional phage
First, the inventors carried out a precipitation test. The phage solutions were mixed with a gold colloidal suspension (Figure 6). After incubation, the mixtures of the insertless, bifunctional and trifunctional phage with the gold colloidal suspension remained clear (Figure 6), whereas a visible precipitate was observed in the mixture with the tetrafunctional phage, indicating that gold colloids formed aggregates (Figure 6). Finally, to show functionality of the gold binding peptide displayed on the surface of multifunctional phage and its ability to bind to gold nanoparticles, the inventors carried out a dot blot-diffusion assay. Different phages were directly added onto the
nitrocellulose membrane (Figure 6). Subsequently, gold nanoparticles were added on top of phages dotted on the membrane. The gold binding capacity of phage can be determined by the diffusion pattern formation of gold nanoparticle on the membrane. Significant staining was observed in dots D and E, indicating that the tetrafunctional phage displaying gold-binding peptide could effectively bind gold nanoparticles (Figure 6). In contrast, no staining was observed in control dots A (insertless phage), B
(bifunctional) and C (trifunctional), where gold nanoparticles tend to move from the region of high concentration of phage to the surrounding regions of lower
concentration of gold nanoparticles (Figure 6), indicating that gold did not bind the insertless, bifunctional, and trifunctional, all of which lack the gold-binding peptide on the surface.
Example 5 - Evaluation of gene expression by the multifunctional phage
To examine that the multifunctional phage can express transgenes in mammalian cells, the inventors conducted cell transduction experiments on the normal immortalized Human Embryonic Kidney HEK293 cell line. HEK293 cells have previously been used as a standard in vitro model for transduction by the RGD4C-phage as they express high levels of ανβ3 integrin receptor. In their first set of experiments, the inventors used vectors carrying the green fluorescent protein (GFP) reporter transgene. This reporter gene provides a convenient way to visualize expression of the transgene. Analysis of GFP expression showed GFP expression in cells by the multifunctional phage (Figure 7). These data prove that the multifunctional phage mediates transgene expression in mammalian cells.
Example 6 - Application of the multifunctional phage in promoting gene transfer to mammalian cells by phage
Next, to investigate whether the multifunctional phage can be used to enhance phage applications, the inventors assessed the effect on gene transfer efficiency of phage.
Since the inventors reported that the major intracellular obstacle to phage is its sequestration in the lysosomes, the inventors constructed as proof of concept, multifunctional phage displaying peptides to assist the phage to escape from
endosomes in order to avoid its degradation in the lysosomes. Therefore, the inventors displayed on the recombinant pVIII coat protein of the multifunctional phage a panel of endosome-escape-peptides (EEPs) known for their potential to promote escape of vectors from endosomes by inducing disruption of endosomes (endosmolytic peptides) or by fusion with the endosomal membranes (fusogenic peptides). One approach tested was to transfer to the capsid on the multifunctional phage strategies already used by eukaryotic viruses to escape the endosomes. Three different EEPs were tested, the H5WYG peptide, the INF7 peptide, and the PCi peptide. As initial cellular model to assess gene transfer efficacy, the inventors performed experiments in the M21 human melanoma cells and used phage carrying the Luciferase reporter gene. The results show that the targeted multifunctional phage displaying the H5WYG peptide (RGD4C H5WYG) achieved substantial increase of gene transfer by phage compared to the original RGD4C-phage. The multifunctional phage displaying the PCi peptide also showed significant increase of the phage gene transfer efficacy, while INF7 peptide had little effect as compared to the wild type RGD4C-phage (Figure 8). To rule out the possibility that the observed effects are cell or species specific, the inventors repeated these experiments on the rat 9L glioma cells, known to express the ανβ3 receptor, and found a pattern of gene transfer efficacy by the multifunctional similar to that on the M21 cells. These data confirm that gene transfer efficacy of phage is markedly improved in the context of a multifunctional phage able to overcome the maj or mammalian intracellular barrier to gene transfer by phage.
Example 7 - Overcoming both extracellular and intracellular major obstacles to phage, by a single multifunctional bacteriophage, promotes gene transfer by phage
remarkably.
After demonstrating that gene transfer efficacy by phage can be dramatically increased by overcoming the major intracellular obstacle of phage degradation in the lysosomes, the inventors sought to use a multifunctional phage which overcomes both extracellular (cell accessibility) and intracellular (lysosomal degradation) major limitations of phage in one single particle. Thus, the multifunctional phage displaying the EEPs was mixed with cationic polymers (poly-D-lysine [PDL], or diethylaminoethyl-dextran
[DEAE.DEX]), to form multifunctional phage/polymer complexes. Here again, the inventors used phage carrying the luciferase reporter gene to assess gene transfer efficacy on both M21 and 9L cells. Firstly, the complexes of RGD4C-phage and cationic polymers showed significant enhancement of transgene expression by the phage compared to the uncomplexed phage (Figure 9). Surprisingly, combination of both cationic polymer and the PCi endosome-escape-peptide has further improved gene transfer by phage compared to phage/polymer (Figure 9). However, and remarkably, combination of cationic polymer and the H5WYG peptide resulted in an exceptional increase of the gene transfer efficacy by phage in both M21 and 9L cells compared to all other combinations (Figure 9). Indeed, the multifunctional phage combining the cationic polymer PDL and the H5WYG peptide showed ~ioo-fold increase of the reporter Luciferase expression in both M21 and 9L cells compared to the original RGD4C-phage that eradicated aggressive natural and sizeable (13 cm) tumours in a phage gene therapy trial in pet dogs (Paoloni M, Tandle A, Mazcko C, Hanna E, Kachala S, LeBlanc A, Newman S, Vail D, Henry C, Thamm D, Sorenmo K, Hajitou A, Pasqualini R, Arap W, Khanna C and Libutti S. 2009. Launching a novel preclinical infrasturcture: comparative oncology trials consortium directed therapeutic targeting of TNF-ato cancer vasculature. PLoS One 4, 64972).
Example 8 - Overcoming the nuclear transport obstacle to bacteriophage by the multifunctional phage promotes its gene transfer efficacy.
Transport to the nucleus represents another rate-limiting step to phage. Several eukaryotic viruses have developed successful strategies to target their genetic material to the nucleus. The inventors displayed on the phage capsid the nuclear localization signal (NLS) from animal viruses. Thus, to increase phage transport to the nucleus and subsequently the efficacy of transgene expression, the inventors generated a
multifunctional phage that displays the targeting RGD4C ligand on the pill minor coat protein and the NLS peptide, from the large tumour antigen of simian virus 40 (SV40 T antigen), on the recombinant major pVIII coat protein. Next, the inventors inserted the mammalian transgene cassette in the genome of this multifunctional phage. To examine transduction efficiency of the newly generated phage vector, the inventors compared the multifunctional phage displaying RGD4C ligand and SV40-NLS peptides to phage displaying RGD4C without the SV40-NLS peptide. The non-targeted phage displaying SV40-NLS only and phage without any ligands served as negative controls for mammalian cell transduction. As an in vitro model, the inventors used the normal immortalized HEK293 cell line. HEK293 cells have previously been used as a standard in vitro model for transduction by RGD4C-phage as they express high levels of ανβ3 integrin receptor of the RGD4C ligand. In their first set of experiments, the inventors used phage vectors carrying the GFP reporter transgene. Analysis of GFP expression in HEK293 cells showed that transgene expression from phage vector simultaneously displaying the NLS peptide and the targeting RGD4C ligand was detectable at 48 hours (Figure 10), whereas GFP expression from the phage displaying only RGD4C ligand started later on at 72 hours post vector transduction consistently with previous reports. These data indicate that display of the NLS peptide on the pVIII coat protein of vector resulted in an early initiation of transgene expression. Also, GFP analyses overtime by three independent observers revealed a more pronounced GFP expression overtime in cells transduced with the targeted phage vector displaying the SV40-NLS (Figure 10).
Next, after demonstrating the proof of efficacy with the SV40-NLS, the inventors sought to opt for the most suitable NLS that can achieve superior mammalian cell transduction by phage. The inventors screened a number of optimized NLS peptides, including the optimized OSSV40-NLS from SV40 (SSDDEATADAQHAAPPKKKRKV - [SEQ ID No:i3]) and the optimized short M9 (0SM9, YNNQSSNRGPYK - [SEQ ID No: 14]). The classical SV40NLS (QPSPSPT - [SEQ ID NO: 12]) was also included in these experiments. The inventors displayed all these NLS on the rpVIII of
multifunctional phage vector carrying the Luc reporter transgene. Expression in HEK293 cells was monitored over a time course of 5 days after vector transduction. Transgene expression from each construct was evaluated in triplicates and luciferase activity was determined as the average relative luminescent units (RLU) per loc^g protein as shown in Figure 11. The inventors found that luciferase expression was significantly higher at all time-points post vector treatment (days 1 to 5) with all multifunctional phage simultaneously displaying either classical SV40-NLS, optimized OSSV40-NLS or 0SM9 and RGD4C ligand compared to the multifunctional phage displaying RGD4C ligand only (Figure 11).
Example Q - Construction of a novel multifunctional RGD4.C-phage vector containing a wild type major coat pVIII protein with an altered charge.
The negative charge of the M13 bacteriophage surface plays a crucial role in the extracellular barriers to phage due to the generation of high non-specific binding to positively charged molecules (around 35% of proteins in the human proteome). The inventors have previously attempted to reduce this non-specific binding by using cationic polymers such as the DEAE-dextran to neutralize or convert to positive the negative surface of the virus. Herein, the inventors used the multifunctional phage to apply a genetic approach consisting of changing the negative N-term of the major wild type (wt) pVIH coat protein into a mixture of anionic and cationic terminal groups by introducing a short charged neutralizing peptide termed AKAS (Ala-Lys-Ala-Ser). Thus, the inventors generated a novel targeted multifunctional phage vector, termed RGD4C- phage-AKAS, with a new wt pVIII that has a modification at the N-terminal to neutralize the negative charge of the phage surface.
To engineer this new multifunctional phage, the first genetic engineering step was to introduce the tetrapeptide AKAS between residues Gly3 and Asp4 of the N-term of the major coat wt pVIII protein using the strategy of site-directed mutagenesis. After the successful PCR amplification of the vector the inventors analyzed 10 DH50 E.coli transformed colonies and all of them were RGD4C-phage-AKAS construct positive. The correct insertion of the AKAS nucleotide sequence was checked by sequencing. Second the inventors inserted a transgene cassette into the Sac-I site of the multifunctional phage as reported above. Finally, two positive multifunctional phage clones displaying the AKAS peptide were selected for the phage production and purification (see materials and methods section). Example 10 - Display of the neutralizing peptide AKAS alters the surface of the multifunctional phage, but does not affect the phage titre and phage infectivity.
Next, the inventors wanted to determine whether display of the neutralizing peptide AKAS has an effect on the titre of the produced multifunctional phage particles, and the inventors assessed two RGD4C-phage-AKAS clones (RGD4C-phage-AKASi and RGD4C-phage-AKAS2). The inventors infected E.coli K jiKan with several dilutions and the inventors counted the number of colonies after overnight incubation on LB agar plates containing tetracycline. Both multifunctional phage clones (RGD4C-phage- AKASi and RGD4C-phage-AKAS2) yielded similar amount of colonies compared to the parental multifunctional phage (Figure 12a). These data prove that the new
multifunctional phage is produced at normal and workable levels. Following the hypothesis that the AKAS peptide should neutralize the negatively-charged phage surface, the inventors carried out an experiment to demonstrate that the new multifunctional phage surface has different physical properties compared to the parental one. Thus, the inventors incubated the RGD4C-phage-AKASi and RGD4C- phage-AKAS2 with the DEAE-dextran cationic polymer that associates with negatively charged nucleic acids and proteins. Therefore, less binding was expected with the AKAS phages. After an overnight incubation, the inventors collected the suspension containing the phage particles that didn't attach to the polymer to infect E.coli K jiKan following the same infection assay steps (see materials and methods). As shown in Figure 12b the number of recovered multifunctional phage RGD4C-phage-AKAS phage was significantly higher than the parental multifunctional phage. After counting the colonies, the inventors determined the phage recovery in terms of percentage of input (Figure 12c). While the parental RGD4C-phage was almost completely sequestered by the DEAE-dextran polymer, the inventors could recover 30% of the AKAS phages (Figure 12c). These results clearly show that the surface of the new phage is modified resulting in significant decrease of binding to positively charged molecules.
Example 11 - The AKAS-phages have the ability to transduce cells
As an initial analysis of the phage capacity to transfer genes into mammalian cells, the inventors first transduced rat glioblastoma cells 9L with the parental and the new multifunctional phage carrying the GFP reporter gene. The fluorescence started at day 3 after transduction and pictures were taken day 5 after treatment (Figure 13 a-d). GFP expression was observed in all the treated cells at overall similar levels. The pictures only show a portion of one well of 9L cells treated with RGD4C-phage (Figure 13a); RGD4C-phage-AKASi (Figure 13b); and RGD4C-phage-AKAS2 (Figure 13c).
Importantly, there was no GFP expression in cells without phage treatment (Figure 13d). These qualitative data indicate that the new phages have the intact ability to target and transduce cells. In order to quantify the levels of transgene expression and compare them with the previous RGD4C-phage, the inventors next used phages expressing the firefly Luc reporter gene to transduce the 9L cells. Luc assay was performed at day 3 post- transduction and the inventors observed similar levels of Luc expression between the 3 phages (Figure 13ε). These results confirm that all phages (parental and new ones) have similar ability to transduce the target cells and that display of the neutralizing AKAS does not affect transgene expression efficiency of the multifunctional phage. Next, the inventors decided to carry out future experiments by testing one AKAS phage only (the RGD4C-phage-AKASi, termed RGD-phage-AKAS), as both AKAS phages showed similar behaviour in all previous experiments.
Example 12 - Phage incubation with fibrinogen decreases the transduction levels of RGD4.C-phage while RGD4.C-phage-AKAS efficacy remains intact
Furthermore, the inventors explored the phage behaviour in the presence of fibrinogen, a plasma glycoprotein that participates in the blood coagulation, in order to investigate whether the new multifunctional RGD4C-phage-AKAS can avoid non-specific binding to fibrinogen resulting in its sequestration. Recently, it has been shown that fibrinogen plays an important role in the early innate immune response by neutralizing invading pathogens. Moreover, it is deposited with other pro-coagulant molecules into the extracellular matrix of tumour cells serving as a scaffold to support proliferation, migration and tumour cell growth. Thereby, this glycoprotein constitutes an additional obstacle to reach the target tumour cells. As shown from Figure 14, the inventors transduced the 9L tumour cells with the RGD4C-phage and RGD4C-phage-AKAS under the normal conditions or after 60 minutes of phage incubation with fibrinogen.
Consistent with the previous experiments, the data showed no difference in Luc expression in normal transduction conditions (Figure 14, left bars). However, after incubating the phages with fibrinogen the inventors observed a™ 2.2 fold decrease in Luc activity (day 3 post-transduction) in RGD4C-phage-transduced cells compared with RGD4C-phage-AKAS-transduced cells (Figure 14, right bars). These data show that the multifunctional phage with altered surface is able to avoid non-specific binding to fibrinogen.
Example 13 - The RGD4.C-phage-AKAS phage can avoid the anti-phage antibody
To uncover further improvement of the features of the novel multifunctional RGD4C- phage-AKAS, the inventors evaluated the effect of an anti-phage polyclonal antibody to neutralize the multifunctional phage and affect the gene transfer efficacy. The inventors treated the 9L tumour cells with the RGD4C-phage and RGD4C-phage-AKAS in the presence of anti-phage antibody (1:8000, Sigma) and the inventors determined the Luc expression after 3 days. The results revealed a significant transduction difference in the presence of the anti-phage antibody, where the RGD4C-phage-AKAS-transduced cells showed an increase™ 2.5-fold compared with RGD4C-phage-transduced cells (Figure 15). These data suggest that the novel phage can skip the neutralizing antibodies against the capsid of the parental multifunctional phage.
Summary
The inventors have designed a multifunctional filamentous phage (see Figure 1) based on the targeted M13 RGD4C-phage that has the potential to simultaneously carry multiple functions into a single particle, i.e. (i) it displays the targeting ligand on the pill minor coat protein of the phage for binding to a mammalian protein or receptor; (ii) it serves as a genetic carrier for foreign functional peptides to be displayed on the wild-type pVIII major coat protein in order to operate as a nanoparticle (e.g. nanotube) decorated by hundreds of peptides; (iii) it allows the display of large foreign peptides on the virion surface by the recombinant pVIII protein; and finally (iv) it bears a mammalian transgene cassette inserted in an intergenomic region of the bacteriophage genome for gene expression in mammalian cells. The inventors showed that all moieties displayed on the RGD4C-phage remain intact and functional in the context of the multifunctional phage by using phage displaying the RGD4C ligand, gold-binding peptide, streptavi din-binding peptide and carrying a mammalian transgene cassette expressing the GFP or Luciferase reporter transgene. In order to assess the potential of the multifunctional phage to promote phage
applications, the inventors conducted experiments to assess the effect on gene transfer applications of phage. Thus, they developed the first highly efficient strategy that combines multiple solutions to overcome extracellular and intracellular hurdles to phage gene transfer in one singe phage particle. To show the proof of efficacy of the multifunctional phage in promoting gene transfer by phage, they have generated a multifunctional M13 phage, that carries the targeting ligand on the pill minor coat protein, displays the H5WYG histidine rich endosome-escape-peptide on the recombinant pVIII major coat protein and expresses a transgene through a mammalian transgene cassette inserted in a non-essential region of the phage genome. Moreover, to overcome the first-rate limiting step of extracellular barrier to phage accessibility to the surface of mammalian cells, hybrid complexes between the multifunctional phage and cationic polymers were generated. The inventors compared the efficacy of the multifunctional phage/polymer to a comprehensive panel of controls including the wild type RGD4C-phage alone, as well as each individual phage either displaying H5WYG peptide or mixed to cationic polymers. The inventors showed that the multifunctional phage/polymer nano-complexes provide substantial transgene expression over all control phage versions while retaining cell targeting and nontoxicity, and that incorporation of cationic polymers generates positively charged phage with enhanced cell surface attachment. Moreover, multifunctional phage/polymer complexes carrying a therapeutic gene produced greater targeted cancer cell killing compared to phage. This new class of targeted hybrid multifunctional platform will advance targeted gene delivery by phage for a broad range of applications, including gene therapy and DNA vaccine.

Claims

Claims
l. A recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a first nucleic acid sequence encoding a pill capsid minor coat protein that is configured to display a cell- targeting ligand for enabling delivery of the bacteriophage to a target cell, a second nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display a foreign peptide thereon, and a transgene which encodes a protein which exerts a biological effect on the target cell.
2. A bacteriophage according to claim l, wherein the bacteriophage is a
filamentous phage.
3. A bacteriophage according to either claim 1 or claim 2, wherein the
bacteriophage is Fi, Fd or M13.
4. A bacteriophage according to any preceding claim, wherein the bacteriophage is M13.
5. A bacteriophage according to any preceding claim, wherein the second nucleic acid sequence encodes a wild-type pVIII capsid major coat protein.
6. A bacteriophage according to claim 5, wherein the second nucleic acid sequence encoding a wild-type pVIII capsid major coat protein comprises a nucleotide sequence substantially as set out in SEQ ID No: 1, or a functional variant or fragment thereof, or wherein the wild-type pVIII capsid major coat protein comprises an amino acid sequence substantially as set out in SEQ ID No: 2, or a functional variant or fragment thereof.
7. A bacteriophage according to any preceding claim, wherein the second nucleic acid sequence encodes a recombinant pVIII capsid major coat protein.
8. A bacteriophage according to claim 7, wherein the second nucleic acid sequence encoding a recombinant pVIII capsid major coat protein comprises a nucleic acid sequence substantially as set out in SEQ ID No:3, or a functional variant or fragment thereof, or the recombinant pVIII capsid major coat protein comprises an amino acid sequence substantially as set out in SEQ ID No:4, or a functional variant or fragment thereof.
9. A bacteriophage according to any preceding claim, wherein the bacteriophage comprises a second nucleic acid sequence which encodes the wild-type pVIII capsid major coat protein and third nucleic acid sequence which encodes a recombinant pVIII capsid major coat protein.
10. A bacteriophage according to claim 9, wherein the bacteriophage comprises a nucleic acid sequence substantially as set out in SEQ ID No: 1 and 3, or a functional variant or fragment thereof, or wherein the bacteriophage comprises a wild-type and a recombinant pVIII capsid major coat protein which comprise an amino acid sequence substantially as set out in SEQ ID No: 2 and 4, or a functional variant or fragment thereof.
11. A bacteriophage according to any preceding claim, wherein a nucleic acid encoding the foreign peptide is fused in frame with the pVIII coding gene.
12. A bacteriophage according to any preceding claim, wherein the pVIII capsid major coat protein is configured to display a streptavi din-binding peptide, optionally wherein the amino acid sequence of the streptavidin-binding peptide comprises ANRLCHPQFPCTSHE [SEQ ID No: 5], or a functional fragment or variant thereof.
13. A bacteriophage according to any preceding claim, wherein the pVIII capsid major coat protein is configured to display a gold-binding peptide, optionally wherein the amino acid sequence of the gold-binding peptide comprises VSGSSPDS [SEQ ID No: 6], or a functional fragment or variant thereof.
14. A bacteriophage according to any preceding claim, wherein the cell-targeting ligand is a tumour-targeting ligand.
15. A bacteriophage according to claim 14, wherein the ligand comprises the RGD4C ligand.
16. A bacteriophage according to any preceding claim, wherein the first nucleic acid sequence encoding the pill capsid minor coat protein comprises a nucleic acid sequence substantially as set out in SEQ ID No: 7, or a functional variant or fragment thereof, or wherein the pill capsid minor coat protein comprises an amino acid sequence substantially as set out in SEQ ID No: 8, or a functional variant or fragment thereof.
17. A bacteriophage according to any preceding claim, wherein the transgene encodes the Herpes simplex virus tyrosine kinase gene.
18. A bacteriophage according to any preceding claim, wherein the foreign peptide which is displayed on the pVIII capsid major coat protein comprises an endosome escape peptide (EEP).
19. A bacteriophage according to claim 18, wherein the EEP is an endosmolytic peptide.
20. A bacteriophage according to claim 18, wherein the EEP is a fusogenic peptide.
21. A bacteriophage according to any one of claims 18-20, wherein the endosome escape peptide is selected from a group consisting of: the H5WYG peptide (SEQ ID No: 9), the INF7 peptide (SEQ ID No: 10), and the PCi peptide (SEQ ID No: 11), or a functional fragment or variant thereof.
22. A bacteriophage according to any one of claims 18-21, wherein the EEP is displayed on the recombinant pVIII capsid major coat protein.
23. A bacteriophage according to any preceding claim, wherein the foreign peptide which is displayed on the pVIII capsid major coat protein comprises a nuclear localization signal (NLS) peptide.
24. A bacteriophage according to claim 23, wherein the NLS peptide is selected from a group consisting of: the large tumour antigen of simian virus 40 (SV40 T antigen - SEQ ID No: 12); optimized SV40 NLS (SEQ ID No: 13); the optimized short M9 (0SM9) (SEQ ID No: 14); and a heptamer NLS peptide (SEQ ID No: 15), or a functional fragment or variant thereof.
25. A bacteriophage according to either claim 25 or 26, wherein the NLS peptide is displayed on the recombinant pVIII capsid major coat protein.
26. A bacteriophage according to any preceding claim, wherein the wild type pVIII major coat protein of the bacteriophage comprises an N-terminal modification which neutralises the negative charge of the surface of the phage, and results in a net positive charge at physiological pH.
27. A bacteriophage according to claim 26, wherein the modification comprises a tetrapeptide comprising the amino acid sequence AKAS located in the N-terminal of the major coat wt pVIII protein, and preferably between residues Gly3 and Asp4 of the protein.
28. A recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display an endosome escape peptide (EEP) thereon, and a transgene which encodes a protein which exerts a biological effect on a target cell transduced by the bacteriophage.
29. A recombinant targeted bacteriophage for expressing a transgene in a target cell transduced with the bacteriophage, the bacteriophage comprising a nucleic acid sequence encoding at least one pVIII capsid major coat protein that is configured to display a nuclear localization signal (NLS) peptide thereon, and a transgene which encodes a protein which exerts a biological effect on a target cell transduced by the bacteriophage.
30. A bacteriophage according to either claim 28 or 29, as defined in any one of claims 1-27.
31. The targeted bacteriophage according to any one of claims 1-30, for use in therapy or diagnosis.
32. The targeted bacteriophage according to any one of claims 1-30, for use in a gene therapy technique.
33. A vaccine comprising the bacteriophage according to any one of claims 1-30.
34. Use of the bacteriophage according to any one of claims 1-30, for vaccine delivery.
35. A vaccine of claim 33 or a use of claim 34, wherein the transgene encodes an antigen to stimulate the body's immune system.
36. Use of the bacteriophage according to any one of claims 1-30, in a genetic- molecular imaging technique.
37. Use according to claim 36, wherein the transgene encodes HSVtk and/ or the sodium/iodide symporter (NIS), preferably wherein the complex or aggregate is used in combination with a radiolabelled substrate.
38. A pharmaceutical composition comprising the bacteriophage according to any one of claims 1-30, and a pharmaceutically acceptable vehicle.
39. A process for making the pharmaceutical composition according to claim 38, the process comprising contacting a therapeutically effective amount of the
bacteriophage according to any one of claims 1-30, and a pharmaceutically acceptable vehicle.
PCT/GB2014/051446 2013-05-15 2014-05-12 Bacteriophage Ceased WO2014184528A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US14/889,805 US10799542B2 (en) 2013-05-15 2014-05-12 Tetrafunctional bacteriophage
AU2014267044A AU2014267044A1 (en) 2013-05-15 2014-05-12 Bacteriophage
EP14723873.7A EP2997148B1 (en) 2013-05-15 2014-05-12 Bacteriophage

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1308742.4 2013-05-15
GBGB1308742.4A GB201308742D0 (en) 2013-05-15 2013-05-15 Bacteriophage

Publications (1)

Publication Number Publication Date
WO2014184528A1 true WO2014184528A1 (en) 2014-11-20

Family

ID=48700830

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2014/051446 Ceased WO2014184528A1 (en) 2013-05-15 2014-05-12 Bacteriophage

Country Status (5)

Country Link
US (1) US10799542B2 (en)
EP (1) EP2997148B1 (en)
AU (1) AU2014267044A1 (en)
GB (1) GB201308742D0 (en)
WO (1) WO2014184528A1 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017077275A1 (en) * 2015-11-02 2017-05-11 Imperial Innovations Limited Phagemid vector
US10471138B2 (en) 2013-05-15 2019-11-12 Imperial College Innovations Limited Bacteriophage-polymer hybrid
WO2020043148A1 (en) 2018-08-29 2020-03-05 Shanghaitech University Composition and use of cas protein inhibitors
US10799542B2 (en) 2013-05-15 2020-10-13 Imperial College Innovations Limited Tetrafunctional bacteriophage
US11820792B2 (en) 2017-04-24 2023-11-21 Imperial College Innovations Limited Cancer treatment
US11998579B2 (en) 2016-01-03 2024-06-04 Glaxosmithkline Biologicals Sa Immunogenic composition
WO2024149989A1 (en) 2023-01-10 2024-07-18 Imperial College Innovations Limited Phage vector

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11666624B2 (en) 2019-09-24 2023-06-06 Auburn University Phage-peptide constructs for stimulating an immune response against CD47
CN119916014B (en) * 2025-04-01 2025-07-29 东北大学 Preparation method and application of universal renewable immunoaffinity magnetic beads

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999010014A2 (en) * 1997-08-29 1999-03-04 Selective Genetics, Inc. Receptor-mediated gene delivery using bacteriophage vectors
WO2002081635A2 (en) * 2001-04-05 2002-10-17 Ramot At Tel Aviv University Phage display vector, phages encoded thereby, and methods of use thereof
WO2006095345A2 (en) * 2005-03-08 2006-09-14 Ramot At Tel-Aviv University Ltd. Targeted drug-carrying bacteriophages
WO2009024591A1 (en) * 2007-08-20 2009-02-26 Bio-Medisinsk Innovasjon As Pvii phage display

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001014579A2 (en) * 1999-08-26 2001-03-01 Vion Pharmaceuticals, Inc. Compositions and methods for delivery of an agent using attenuated salmonella containing phage
US20040048243A1 (en) 2001-09-07 2004-03-11 Wadih Arap Methods and compositions for in vitro targeting
GB0205786D0 (en) 2002-03-12 2002-04-24 Regma Bio Technologies Ltd Novel Composition
US20060105387A1 (en) * 2002-08-30 2006-05-18 Prior Christopher P Transferrin fusion proteins libraries
GB201308745D0 (en) 2013-05-15 2013-06-26 Imp Innovations Bacteriophage
GB201308742D0 (en) 2013-05-15 2013-06-26 Imp Innovations Bacteriophage

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999010014A2 (en) * 1997-08-29 1999-03-04 Selective Genetics, Inc. Receptor-mediated gene delivery using bacteriophage vectors
WO2002081635A2 (en) * 2001-04-05 2002-10-17 Ramot At Tel Aviv University Phage display vector, phages encoded thereby, and methods of use thereof
WO2006095345A2 (en) * 2005-03-08 2006-09-14 Ramot At Tel-Aviv University Ltd. Targeted drug-carrying bacteriophages
WO2009024591A1 (en) * 2007-08-20 2009-02-26 Bio-Medisinsk Innovasjon As Pvii phage display

Non-Patent Citations (9)

* Cited by examiner, † Cited by third party
Title
A. KIA ET AL: "Dual Systemic Tumor Targeting with Ligand-Directed Phage and Grp78 Promoter Induces Tumor Regression", MOLECULAR CANCER THERAPEUTICS, vol. 11, no. 12, 10 October 2012 (2012-10-10), pages 2566 - 2577, XP055128150, ISSN: 1535-7163, DOI: 10.1158/1535-7163.MCT-12-0587 *
ANTONELLA PRISCO ET AL: "Filamentous Bacteriophage Fd as an Antigen Delivery System in Vaccination", INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, vol. 13, no. 12, 24 December 2012 (2012-12-24), pages 5179 - 5194, XP055128270, ISSN: 1661-6596, DOI: 10.3390/ijms13045179 *
DATABASE EMBL [online] 3 July 2000 (2000-07-03), "Filamentous phage display vector f88-4 recombinant major coat protein precursor", XP002726983, retrieved from EBI accession no. EMBL:AAF78530 *
GUO Y ET AL: "Construction of bifunctional phage display for biological analysis and immunoassay", ANALYTICAL BIOCHEMISTRY, ACADEMIC PRESS INC, NEW YORK, vol. 396, no. 1, 2010, pages 155 - 157, XP026771212, ISSN: 0003-2697, [retrieved on 20090821], DOI: 10.1016/J.AB.2009.08.026 *
ROBERTO RANGEL ET AL: "Combinatorial targeting and discovery of ligand-receptors in organelles of mammalian cells", NATURE COMMUNICATIONS, vol. 3, 17 April 2012 (2012-04-17), pages 788, XP055128106, DOI: 10.1038/ncomms1773 *
SACHIKO HIROSUE ET AL: "pH-Dependent Lytic Peptides Discovered by Phage Display +", BIOCHEMISTRY, vol. 45, no. 20, May 2006 (2006-05-01), pages 6476 - 6487, XP055128153, ISSN: 0006-2960, DOI: 10.1021/bi052488s *
SCOTT J K ET AL: "SEARCHING FOR PEPTIDE LIGANDS WITH AN EPITOPE LIBRARY", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 249, 27 July 1990 (1990-07-27), pages 386 - 390, XP000571645, ISSN: 0036-8075, DOI: 10.1126/SCIENCE.1696028 *
T GROOT-WASSINK: "Quantitative Imaging of Na/I Symporter Transgene Expression Using Positron Emission Tomography in the Living Animal", MOLECULAR THERAPY, vol. 9, no. 3, March 2004 (2004-03-01), pages 436 - 442, XP055128224, ISSN: 1525-0016, DOI: 10.1016/j.ymthe.2003.12.001 *
VAN HOUTEN N E ET AL: "Filamentous phage as an immunogenic carrier to elicit focused antibody responses against a synthetic peptide", VACCINE, ELSEVIER LTD, GB, vol. 24, no. 19, 8 May 2006 (2006-05-08), pages 4188 - 4200, XP028010820, ISSN: 0264-410X, [retrieved on 20060508], DOI: 10.1016/J.VACCINE.2006.01.001 *

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10799542B2 (en) 2013-05-15 2020-10-13 Imperial College Innovations Limited Tetrafunctional bacteriophage
US10471138B2 (en) 2013-05-15 2019-11-12 Imperial College Innovations Limited Bacteriophage-polymer hybrid
US11603540B2 (en) 2015-11-02 2023-03-14 Imperial College Innovations Limited Phagemid vector
WO2017077275A1 (en) * 2015-11-02 2017-05-11 Imperial Innovations Limited Phagemid vector
EP4163382A1 (en) 2015-11-02 2023-04-12 Imperial College Innovations Limited Phagemid vector
US12331308B2 (en) 2015-11-02 2025-06-17 Imperial College Innovations Limited Phagemid vector
US11998579B2 (en) 2016-01-03 2024-06-04 Glaxosmithkline Biologicals Sa Immunogenic composition
EP3397277B1 (en) * 2016-01-03 2024-10-16 GlaxoSmithKline Biologicals S.A. Immunogenic composition
US11820792B2 (en) 2017-04-24 2023-11-21 Imperial College Innovations Limited Cancer treatment
WO2020043148A1 (en) 2018-08-29 2020-03-05 Shanghaitech University Composition and use of cas protein inhibitors
CN112654711A (en) * 2018-08-29 2021-04-13 上海科技大学 Cas protein inhibitor composition and application
US11492645B2 (en) 2018-08-29 2022-11-08 Shanghaitech University Composition and use of Cas protein inhibitors
CN112654711B (en) * 2018-08-29 2024-03-26 上海科技大学 Composition of Cas protein inhibitor and application
WO2024149989A1 (en) 2023-01-10 2024-07-18 Imperial College Innovations Limited Phage vector

Also Published As

Publication number Publication date
AU2014267044A1 (en) 2015-11-19
US10799542B2 (en) 2020-10-13
GB201308742D0 (en) 2013-06-26
EP2997148A1 (en) 2016-03-23
US20170340684A1 (en) 2017-11-30
EP2997148B1 (en) 2018-11-21

Similar Documents

Publication Publication Date Title
EP2997148B1 (en) Bacteriophage
JP7854334B2 (en) Phagemide vector
US10471138B2 (en) Bacteriophage-polymer hybrid
JP2022529784A (en) Peptides and nanoparticles for intracellular delivery of molecules
CA3119814A1 (en) Anellosomes for delivering protein replacement therapeutic modalities
CA3186872A1 (en) Baculovirus expression systems
Kao et al. Improvement of gene delivery by minimal bacteriophage particles
US12037597B2 (en) Prokaryotic-eukaryotic hybrid viral vector for delivery of large cargos of genes and proteins into human cells
KR100563942B1 (en) Modular delivery system of molecular material and method and use of preparation thereof
WO2023205907A1 (en) Nucleic acid delivery system
CA3040230C (en) Phagemid vector
JP2026504839A (en) phage vector
TW202529819A (en) Tissue specific anellovector delivery
Wang et al. Bacteriophage-Targeted Nanomedicine and Molecular Imaging

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14723873

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 14889805

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2014267044

Country of ref document: AU

Date of ref document: 20140512

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014723873

Country of ref document: EP