WO2014160508A1 - Methods and compositions for treating cancer and inflammatory diseases - Google Patents

Methods and compositions for treating cancer and inflammatory diseases Download PDF

Info

Publication number
WO2014160508A1
WO2014160508A1 PCT/US2014/026874 US2014026874W WO2014160508A1 WO 2014160508 A1 WO2014160508 A1 WO 2014160508A1 US 2014026874 W US2014026874 W US 2014026874W WO 2014160508 A1 WO2014160508 A1 WO 2014160508A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
construct
inhibitory
cell penetrating
ctbp
Prior art date
Application number
PCT/US2014/026874
Other languages
French (fr)
Other versions
WO2014160508A8 (en
Inventor
Qinghong Zhang
Rui Zhao
Xiao-Jing Wang
Melanie BLEVINS
Original Assignee
The Regents Of The University Of Colorado, A Body Corporate
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by The Regents Of The University Of Colorado, A Body Corporate filed Critical The Regents Of The University Of Colorado, A Body Corporate
Priority to US14/775,643 priority Critical patent/US9683025B2/en
Priority to EP14772587.3A priority patent/EP2970510A4/en
Publication of WO2014160508A1 publication Critical patent/WO2014160508A1/en
Publication of WO2014160508A8 publication Critical patent/WO2014160508A8/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22

Definitions

  • the present invention relates to peptide constructs effective for inhibiting C- terminal Binding Protein (CtBP) activity, to pharmaceutical formulations of these peptide conjugates, to processes for their preparation, and to methods for their use in the treatment of proliferative diseases.
  • the present invention also relates to therapeutic agents effective for inhibiting C-terminal Binding Protein (CtBP) activity, and methods for their use in the treatment of inflammatory diseases.
  • CtBP Carboxyl-terminal binding protein
  • Cancer cells typically have more NADH due to both hypoxia and pseudo- hypoxia (NADH production when oxygen concentration is not limited) (Sattler et al., 2007; Yeng et al., 2008; Zhang et al., 2007).
  • NADH binds to CtBP with high affinity (Kd - 100 nM), which, without being tied to any particular theory, presumably causes a conformational change in CtBP that favors its binding to transcriptional factors (e.g., transcriptional repressors) (Zhang et al., 2002).
  • the inventors have elucidated the major pathways controlled by CtBP in cancer cells and found CtBP directly represses epithelial genes and pro-apoptotic genes independently of p53, thus increasing cancer cell survival and migration.
  • CtBP interacts with E1A and many of its transcriptional factor partners through a conserved sequence motif, Pro-X-Asp-Leu-Ser (PXDLS) (Schaeper et al., 1995).
  • PXDLS Pro-X-Asp-Leu-Ser
  • a 14mer E1A peptide inhibited the CtBP/ElA interaction in vitro with an IC 50 of approximately 7 ⁇ (Zhang et al. 2000).
  • the present invention provides a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the peptide construct is a fusion peptide.
  • the inhibitory peptide comprises PXiDLS (SEQ ID NO:2).
  • the inhibitory peptide comprises PX 1 DLSX 2 K (SEQ ID NO:6).
  • the inhibitory peptide comprises SEQ ID NO: l.
  • the binding affinity of the inhibitory peptide to CtBP is the same or higher than that of SEQ ID NO: l.
  • the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In certain embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In certain embodiments, the inhibitory peptide comprises no more than about 25 amino acids. In certain embodiments, the inhibitory peptide comprises no more than about 15 amino acids. In certain embodiments, the peptide construct is modified for conjugation to a carrier molecule. In certain embodiments, the cell penetrating peptide is an amphipathic peptide or anionic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, pAntp, Arg9, plsl, and Pepl.
  • the cell penetrating peptide is directly fused to the inhibitory peptide.
  • the cell penetrating peptide is fused to the inhibitory peptide via a peptide linker.
  • the cell penetrating peptide is fused to the N-terminus of the inhibitory peptide.
  • the invention also provides a pharmaceutical composition comprising a peptide described herein.
  • the invention also provides a conjugate comprising the peptide construct described herein and a carrier molecule.
  • the carrier molecule is PEG.
  • the invention also provides a pharmaceutical composition comprising a conjugate described above.
  • the invention provides a method of inhibiting cell proliferation in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described herein.
  • the invention also provides a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described herein.
  • the cancer is cancer having a p53 mutation.
  • the pharmaceutical composition is administered intravenously, intratumorally, subcutaneously, orally, and topically.
  • the present invention in some embodiments provides a method of treating an inflammatory disease in an individual, comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between EIA and CtBP.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between EIA and CtBP.
  • the therapeutic agent may or may not further comprise a cell penetrating peptide such as any of the cell penetrating peptides described herein.
  • the present invention in some embodiments provides a method of inhibiting inflammation in an individual having an inflammatory disease, comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between EIA and CtBP.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between EIA and CtBP.
  • the therapeutic agent may or may not further comprise a cell penetrating peptide such as any of the cell penetrating peptides described herein.
  • the therapeutic agent is a peptide construct comprising a cell penetrating peptide and the inhibitory peptide.
  • the peptide construct is a fusion peptide.
  • the cell penetrating peptide is an amphipathic peptide or anionic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, pAntp, Arg9, plsl, and Pepl.
  • the cell penetrating peptide is directly fused to the inhibitory peptide.
  • the cell penetrating peptide is fused to the inhibitory peptide via a peptide linker.
  • the cell penetrating peptide is fused to the N-terminus of the inhibitory peptide.
  • the cell penetrating peptide is fused to the C-terminus of the inhibitory peptide.
  • the therapeutic agent comprises an inhibitory peptide not linked to a cell penetration peptide.
  • the inhibitory peptide comprises PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
  • the inhibitory peptide comprise P XiDLSX 2 K (SEQ ID NO:6), wherein Xi and X 2 are any amino acids.
  • the inhibitory peptide comprises EPGQPLDLSCKRPR (SEQ ID NO: l).
  • the inhibitory peptide comprises EQTVPVDLSVARPR (SEQ ID NO:132).
  • the inhibitory peptide comprises GGDGPLDLCCRKRP (SEQ ID NO:133).
  • the inhibitory peptide comprises PTDEPLNLSLKRPR (SEQ ID NO: 134).
  • the binding affinity of the inhibitory peptide to CtBP is the same or higher than that of EPGQPLDLSCKRPR (SEQ ID NO:l).
  • the inhibitory peptide comprises no more than about 25 amino acids.
  • the inhibitory peptide comprises no more than about 15 amino acids.
  • the therapeutic agent is administered intravenously, intratumorally, subcutaneously, orally, and topically.
  • the inflammatory diseases is selected from the group consisting of psoriasis, mucositis, chronic wound, and trauma.
  • the therapeutic agent has one or more biological activities in an individual selected from the group consisting of: reducing cancer cell proliferation, reducing EMT(epithelial-mesenchymal transition), increasing cancer cell apoptosis, reducing or eliminating TGF- ⁇ signaling, reducing or eliminating NF- ⁇ signaling, reducing radiation- induced DNA damage, reducing inflammation, reducing angiogenesis, promoting healing in oral mucositis, promoting wound healing, and treating autoimmune disease when administered to an individual.
  • a method provided herein for treating or preventing an inflammatory condition in an individual comprises administering to the individual a therapeutically effective amount of the pharmaceutical composition described herein.
  • the inflammatory condition may be one or more of a chronic wound, skin inflammation, psoriasis, or an autoimmune disease.
  • the composition may reduce inflammation through inhibition of TGF- ⁇ signaling and/or NF- ⁇ signaling.
  • a method provided herein for preventing or treating a disease or disorder in an individual comprises administering to the individual an effective amount of therapeutic agent described herein or a composition thereof.
  • the therapeutic agent increases cancer cell apoptosis, reduces cancer cell proliferation, reduces EMT, reduces or eliminates TGF- ⁇ signaling, reduces or eliminates NF- ⁇ signaling, reduces radiation-induced DNA damage, reduces inflammation, and/or reduces angiogenesis in the individual.
  • the disease or disorder may include one or more of psoriasis, a chronic wound, an acute wound, or mucositis.
  • the chronic wound may include one or more of diabetic ulcers, pressure ulcers, venous ulcers, or oral ulcers.
  • the acute wound may include one or more of trauma-induced wounds, surgical wounds, or scarring.
  • the mucositis may include one or more of radiation-induced mucositis, chemotherapy-induced mucositis, oral mucositis, or gut mucositis.
  • FIG. 1A-G shows CtBP expression in human carcinomas.
  • FIG. 1A-C CtBP expression in hyperplasic and predominantly malignant human head and neck squamous cell carcinoma is depicted in A - C. The dotted line indicates the epithelial/stromal junction; the scale bar is 20 ⁇ .
  • FIG. 1D-G CtBP expression is shown in human poorly differentiated colon adenocarcinoma (D), moderately differentiated lung adenocarcinoma (E), ductal invasive breast carcinoma (F), and renal cell carcinoma (G).
  • FIG. 2A Western blot analysis of CtBP in HI 299 cells containing a tet- inducible siRNA-CtBP with or without Doxylcycline treatment for 3 days.
  • FIG. 2B Graph showing tumor growth of xenografts of HI 299 cells containing a tet-inducible siRNA-CtBP with or without
  • FIG. 2C Representative image of the tumor xenografts from the untreated (-) and Doxylcycline treated (+) mice.
  • Figure 3 shows a graph indicating that the Tat-ElA-flag peptide inhibits the CtBP/ElA interaction with an IC 50 of 7.7 ⁇ .
  • Figure 4 shows a Western blot analysis of Pepl-El A-flag treated cells revealing that Pepl-El A-flag protein can enter the cytoplasm and the nucleus of H1299 cells. The same membrane was probed for a-tubulin, which is mainly localized in the cytoplasm.
  • Figure 5 shows a series of graphs revealing that the Tat-EIA peptide reduces the viability of CtBP overexpressing cancer cells A375 and H1299, but does not affect normal fibroblast 3T3 cells. Tat alone has no effect on these cells.
  • Figure 6 shows a graph indicating that the Tat-EIA peptide relieves the suppression of CtBP target genes in H1299 cells.
  • FIG. 7A-B shows the effect of Pepl-El A on an IMQ-based psoriasis model.
  • FIG. 7A H&E staining showing Pepl-EIA decreases the IMQ-induced epithelial hyperplasia and inflammatory cell infiltration in the stroma (bottom) compared to the PBS- treated skin (top). The scale bar is 100 ⁇ .
  • FIG. 7B Immunostaining showing decreased BrdU (left panels) and CD45 (right panels) after Pep 1 -El A treatment. Sections were counterstained with K14.
  • Figure 8 shows a graph revealing that CtBPl knockdown downregulates the TGF- ⁇ signaling pathway. Dark grey blocks represent the presence of CtBP target genes in the indicated pathways; components of the TGF- ⁇ pathway are indicated with a bullet point.
  • Figure 9 shows the control protein E1A 243R [Human adenovirus C] NCBI Reference Sequence: NP_040508.1. Amino acid sequence is SEQ ID NO: 136.
  • FIG. 10A Graph showing that CtBPl knockdown downregulates the TGF- ⁇ signaling pathway.
  • FIG. 10B Graph showing that CtBPl regulates TGF- ⁇ via the distal AP-1 site at the TGF- ⁇ promoter.
  • FIG. IOC ChIP analysis showing that CtBPl is recruited by c-Jun to the promoter of TGF- ⁇ .
  • Top panel shows the single ChIP assay using control IgG (IgG) or an anti-CtBPl (CtBPl) antibody.
  • Middle panel shows the single ChIP using an anti-Spl antibody (Spl) and the sequential ChIP using an anti-CtBPl antibody following the first ChIP with an anti-Spl antibody (Spl/CtBPl).
  • Bottom panel shows the single ChIP using an anti-c-Jun antibody (c-Jun) and the sequential ChIP using an anti-CtBPl antibody following the first ChIP with an anti-c-Jun antibody (c-Jun/CtBPl).
  • FIG. 11A-E shows increased inflammation and angiogenesis in K5.QBP1 transgenic skin.
  • FIG. 11A Generation of K5. CtBPl mice.
  • FIG. 11B Graph showing elevated TGF- ⁇ mRNA in K5. CtBPl transgenic mice skin.
  • FIG. 11C Immunofluorescence imaging of leukocyte subtypes (counterstained with a K14 (red) antibody).
  • FIG. 11D shows a K14 (red) antibody.
  • FIG. HE Immunofluorescence imaging of CD31 (green) and ALK1 (red). K5. CtBPl skin contained more ALK1 -positive vessels (yellow) compared to WT tissue.
  • FIG. 12A-C shows pathogenesis associated with CtBPl overexpression.
  • FIG. 12A Immunohistochemistry pictures of CtBPl in psoriasis lesions (bottom) and normal human skin (top). Sections were counterstained with hematoxylin.
  • FIG. 12B Western blot analysis showing the expression of CtBPl in skins of nontransgenic mice (WT), K5. CtBPl expressors (Tg), and wounded nontransgenic skin (Wound). Tubulin was used as a loading control.
  • FIG. 12C Immunofluorescence imaging of CtBPl in wound (bottom) and non- wounded normal mouse skin (top). Sections were counterstained with K14.
  • Figure 13 shows increased TGF- ⁇ signaling in K5.QBP1 skin.
  • Figure 14A-C shows TGF- ⁇ -mediated inflammation and angiogenesis in K5.QBP1 transgenic mice.
  • Immunofluorescence images of CD45 green, FIG. 14A
  • CD31 green, FIG. 14B
  • ALK1 red, FIG. 14C
  • Sections in FIG. 14A and FIG. 14B were counterstained with a K14 (red) antibody.
  • Sections in FIG. 14C were counterstained with a CD31 (green) antibody.
  • FIG. 15A-B shows treatment of psoriasis with a Pepl-EIA peptide and a Tat- EIA peptide.
  • FIG. 15A Purification of synthesized Tat-EIA
  • FIG. 15B Reduction of erythema, thickening and scaling (cumulative score) with Pepl-EIA (squares) or Tat-EIA (triangles) treatment in a psoriasis model.
  • PBS diamonds indicates treatment with phosphate buffered saline.
  • the present application in some aspects provides peptide constructs and uses thereof for treating cancer.
  • the peptide constructs comprise a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP. It was shown that peptide constructs comprising a cell-penetrating peptide and an inhibitory peptide that disrupts CtBP interactions with EIA, i.e., a fusion peptide containing a cell penetration peptide (CPP) and a 14-amino acid peptide derived from EIA (Tat-EIA), can enter the cytoplasm and nuclei of target cancer cells, e.g., A375 melanoma cells or H1299 non-small cell lung cancer cells, and reduce their viability.
  • CPP cell penetration peptide
  • Tat-EIA 14-amino acid peptide derived from EIA
  • peptide constructs comprising a cell-penetrating peptide and an inhibitory peptide that disrupts CtBP interactions with EIA, i.e., a fusion peptide containing a cell penetration peptide (CPP) and a 14-amino acid peptide derived from EIA (Pepl-EIA or Tat-EIA), reduces over-proliferation and inflammation in a mouse model of psoriasis.
  • CCPP cell penetration peptide
  • Tat-EIA 14-amino acid peptide derived from EIA
  • the present application in one aspect provides peptide constructs comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the present application also provides therapeutic agents and uses thereof for treating inflammatory diseases.
  • the therapeutic agents comprises an inhibitory peptide that disrupts CtBP interaction with El A, and in some embodiments comprises a peptide constructs comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • This aspect of the present invention is based on the unexpected finding of transactivation of TGF- ⁇ by CtBP and its functional impact on inflammation. Specifically, it was found that CtBP is a transcriptional activator of TGF- ⁇ , and CtBPl overexpression in transgenic mice causes inflammation and increases angiogenesis associated with enhanced TGF- ⁇ signaling. It was further found that CtBPl is overexpressed in human psoriasis lesions and in the inflammatory phase of wound healing, in addition to oral mucositis.
  • a peptide construct comprising a cell-penetrating peptide and an inhibitory peptide that disrupts CtBP interactions with E1A, i.e., a fusion peptide containing a cell penetration peptide (CPP) and a 14- amino acid peptide derived from El A (Pep 1 -El A or Tat-EIA)
  • CPP cell penetration peptide
  • El A El A
  • targeting CtBP reduces over-proliferation and inflammation in a mouse model of psoriasis.
  • targeting CtBPl can be useful as a therapeutic strategy against inflammatory diseases.
  • the present application in one aspect provides a method of treating an inflammatory disease comprising administering to the individual a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the therapeutic agent is a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • a method of inhibiting inflammation in an individual having an inflammatory disease comprising administering to the individual a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the therapeutic agent is a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the therapeutic agent does not comprise a cell penetrating peptide.
  • kits, unit doses, pharmaceutical compositions, and articles of manufacture comprising the peptide constructs that are suitable for uses in methods described herein.
  • the present application in one aspect provides peptide constructs comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the cell penetrating peptide is linked to the N-terminus of the inhibitory peptide via its C-terminus.
  • the cell penetrating peptide is linked to the C-terminus of the inhibitory peptide via its N-terminus.
  • the therapeutic agents useful for methods described herein comprises peptide constructs comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the cell penetrating peptide is linked to the N-terminus of the inhibitory peptide via its C-terminus.
  • the cell penetrating peptide is linked to the C-terminus of the inhibitory peptide via its N-terminus.
  • the cell penetrating peptide and the inhibitory peptide are directly linked.
  • the cell penetrating peptide and the inhibitory peptide are linked via a linker.
  • the linker that links the cell penetrating peptide and the inhibitory peptide can be of different nature, so long as it does not interfere with the functions and/or binding properties of the cell penetrating peptide and the inhibitory peptide.
  • the cell penetrating peptide and the inhibitory peptide are linked via a peptide linker.
  • the peptide linker is no more than about 20 amino acids (for example no more than about any of 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid long). In some embodiments, the peptide linker is no more than about 10 amino acids (for example, the peptide linker can be about any of 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid long). In some embodiments, the peptide linker is no more than about 5 amino acids (for example, about 2 amino acids). In some embodiments, the linker is a two-amino acid peptide linked having the sequence of LE (SEQ ID NO: 106).
  • the cell penetrating peptide and the inhibitory peptide are linked via a non-peptide linker, e.g. a chemical coupling agent such gluter aldehyde.
  • the chemical coupling agent is a carbodiimide, e.g. EDC.
  • the chemical crosslinking agent is m-maleimidobenzoyl-n-hydroxysuccinimide ester or MBS.
  • heterobifunctional reagents that cross-link by a different coupling moiety on each protein can also be used.
  • Other useful cross-linkers include, without limitation, reagents which link two amino groups (e.g.
  • N-5-azido-2- nitrobenzoyloxysuccinimide N-5-azido-2- nitrobenzoyloxysuccinimide
  • two sulfhydryl groups e.g. , 1 ,4-bis-maleimidobutane
  • an amino group and a sulfhydryl group e.g. , m-maleimidobenzoyl-N-hydroxysuccinimide ester
  • an amino group and a carboxyl group e.g. , 4-[pazidosalicylamido]butylamine
  • an amino group and a guanidinium group that is present in the side chain of arginine e.g. , p- azidophenyl glyoxal monohydrate.
  • the cell penetration peptide is between about 5 to about 30 amino acids long, including for example about 10 to about 25 amino acids long. In some embodiments, the cell penetration peptide is no more than about 30 amino acids long (for example, no more than about any of 21 , 20, 19, 18, 17, 16, 15, 14, 13, 12, 11 , 10, 9, 8, 7, 6, 5, or 4 amino acids long).
  • the inhibitory peptide is about 5 to about 70 amino acids long, including for example about 5 to about 10, about 10 to about 20, about 20 to about 30, about 30 to about 40, about 40 to about 50, about 50 to about 60, or about 60 to about70 amino acids long. In some embodiments, the inhibitory peptide is about 10 to about 20 amino acids long, such as about 14 amino acids long. In some embodiments, the inhibitory peptide is no more than about 30, no more than about 25, or more than about 20, no more than about 15, or no more than about 10 amino acids long.
  • the peptide construct is a fusion peptide.
  • the fusion peptide is about 10 to about 100 amino acids long, including for example about 10 to about 20, about 20 to about 30, about 30 to about 40, about 40 to about 50, about 50 to about 60, about 60 to about70 amino acids long, about 70 to about 80, about 80 to about 90, or about 90 to about 100 amino acids long.
  • the inhibitory peptide is no more than about 50, no more than about 40, no more than about 30, no more than about 25, no more than about 20 amino acids, or no more than about 15 amino acids long.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide has an IC50 that is no more than the IC50 of the EPGQPLDLSCKRPR (SEQ ID NO: l).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide competitively inhibits the binding of EPGQPLDLSCKRPR (SEQ ID NO: l) to CtBP.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 138), wherein N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PXiX 2 X 3 X (SEQ ID NO: 139), wherein N 4 is Q, V, E or G, and wherein X ! is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence N3N 4 PX1X 2 X3X 4 (SEQ ID NO: 140), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence ⁇ 3 ⁇ 4 ⁇ 2 ⁇ 3 ⁇ ⁇ (SEQ ID NO:141), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence N 2 N 3 N PXiX 2 X 3 X 4 (SEQ ID NO:142), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO:143), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A.
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO:143), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 144), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N1N 2 N3N 4 PX1X 2 X3X 4 (SEQ ID NO:145), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the inhibitory peptide comprises the sequence N1N 2 N3N 4 PX1X 2 X3X 4 (SEQ ID NO:145), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1 (SEQ ID NO: 146), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 Ci (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C 2 is K, A or R.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1X 2 X 3 X ⁇ 2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C 2 is K, A or R.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 (SEQ ID NO:151), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 (SEQ ID NO:151), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 C 4 (SEQ ID NO:152), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX 2 X 3 X CiC 2 C 3 C 4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X CiC 2 C 3 C 4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO:154), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 C1 (SEQ ID NO: 156), wherein N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 C1 (SEQ ID NO: 157), wherein N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence N 3 N 4 PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO:158), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X3X 4 CiC 2 (SEQ ID NO:159), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C 2 is K, A or R.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO:160), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO:161), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence
  • NiN 2 N 3 N 4 PXiX 2 X 3 X CiC 2 C 3 C 4 (SEQ ID NO: 162), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the
  • NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 (SEQ ID NO: 163), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PX i X 2 X 3 X , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC ⁇ C
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP
  • the inhibitory peptide comprises PXiX 2 X X , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N is Q, V, E or G, and/or further comprises one of Ci, CiC 2 , CiC 2 C , CiC 2 C 3 C 4 , or CiC
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 Cs (SEQ ID NO:130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, SEQ ID NO:130), wherein
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C4 is P, S, G, R or L,
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132).
  • the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO:133).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO: 4), wherein Xi and X 2 are any amino acids, and X 3 is an amino acid having a bulky side chain.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:5), wherein Xi and X 2 are any amino acids, and X 3 is R or K.
  • the inhibitory peptide comprises the sequence PX 1 DLSX 2 K (SEQ ID NO:6), wherein Xi and X 2 are any amino acids.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1 DLSX 2 Q (SEQ ID NO: 7), wherein Xi and X 2 are any amino acids.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSX 1 X 2 (SEQ ID NO:8), wherein Xi is any amino acids, and X 2 is an amino acid having a bulky side chain.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSX 1 X 2 (SEQ ID NO:9), wherein Xi is any amino acids, and X 2 is R or K.
  • the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSXiQ (SEQ ID NO: 11), wherein Xi is any amino acid.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12).
  • the inhibitory peptide comprises the sequence PLDLSCR (SEQ ID NO: 13).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCQ (SEQ ID NO: 14).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15).
  • the inhibitory peptide comprises the sequence PLDLSCRPR (SEQ ID NO: 16).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCQRPR (SEQ ID NO: 17).
  • the inhibitory peptide comprises the sequence PLDLSCRRPR (SEQ ID NO: 122).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence
  • EPGQPLDLSCKRPR (SEQ ID NO:l).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCRPRP (SEQ ID NO: 18).
  • the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCQRPR (SEQ ID NO: 19).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCRRPR (SEQ ID NO:123).
  • the inhibitory peptide comprises (e.g., is) the sequence EQTVPVDLSVARPR (SEQ ID NO: 132).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20.
  • Table 1 provides the amino acid sequences for these and several peptide constructs referred to throughout the specification.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26.
  • a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
  • Pepl-EIA 30 GS HMKETWWETWWTEWS QPKKKRK VLEEPGQPLDELCKRPR
  • the peptide constructs described herein are modified for increased in vivo stability, bioavailability, and/or biological activity.
  • modifications include, but are not limited to, amidation of the N or C-termini or acetylation of one or more of peptide residues, so long as such modification does not interfere with the functionalities of the peptide constructs (Cho et al., Science 261 : 1303-1305 (1993).
  • the peptide constructs described herein are modified for the purpose of conjugating to a larger carrier molecule (such as PEG).
  • the peptide constructs are modified for conjugation through the addition of one or more cysteine residues to the peptide construct for use in PEGylating the peptide construct.
  • the one or more cysteine residues are added to the N-terminus of the peptide construct.
  • the one or more cysteine residues are added to the C-terminus of the peptide construct.
  • the one or more cysteine residues are added to the N-terminus of the inhibitory peptide.
  • a 3xGly linker i.e., Gly-Gly-Gly; SEQ ID NO: 1057 is added in addition to the cysteine residue.
  • the peptide construct further comprises a serine or threonine at the N-terminus of the cell penetrating peptide, for example, for use in placing a single PEG chain at a defined site on the cell penetrating peptide.
  • the serine or threonine is added at the C-terminus of the cell penetrating peptide.
  • the serine or threonine is added at the N-terminus of the inhibitory peptide.
  • the serine or threonine is added at the C-terminus of the inhibitory peptide.
  • the peptide constructs described herein are modified for the purpose of conjugating to a larger carrier molecule (such as PEG).
  • a larger carrier molecule such as PEG
  • the peptide constructs are modified for conjugation through the addition of one or more cysteine residues to the peptide construct for use in PEGylating the peptide construct.
  • a 3XGly linker i.e., Gly-Gly-Gly; SEQ ID NO: 107
  • the one or more cysteine residues are added to the N-terminus of the peptide construct.
  • the one or more cysteine residues are added to the C-terminus of the peptide construct. In some embodiments, the one or more cysteine residues are added to the N-terminus of the inhibitory peptide. In some embodiments, a 3xGly linker (i.e., Gly-Gly-Gly; SEQ ID NO: 107) is added in addition to the cysteine residue. In some embodiments, the peptide construct further comprises a serine or threonine at the N-terminus of the cell penetrating peptide, for example, for use in placing a single PEG chain at a defined site on the cell penetrating peptide.
  • the serine or threonine is added at the C-terminus of the cell penetrating peptide. In some embodiments, the serine or threonine is added at the N-terminus of the inhibitory peptide. In some embodiments, the serine or threonine is added at the C-terminus of the inhibitory peptide.
  • the present application thus encompasses any of the modified peptide constructs described herein.
  • the present application in some embodiments also provides conjugates comprising any of the peptide constructs described herein and a carrier molecule.
  • Suitable carrier molecules include, but are not limited to: polyethylene glycols, lipids, carbohydrates, immunoglobulins, and albumin.
  • the carrier molecule is a
  • the peptide construct described herein can be PEGylated as described in, e.g., Lee et al. (1999) Bioconjug. Chem. 10(6): 973-8; Kinstler et al. (2002) Advanced Drug Deliveries Reviews 54:477-485; and Roberts et al. (2002) Advanced Drug Delivery Reviews 54:459-476.
  • the PEG carrier can improve the stability, or retention of, said peptide construct by at least 50 (e.g., at least 2, 5, 10, 15, 20, 25, 30, 40, or 50 or more) fold.
  • the carrier molecule is selected from the group consisting of PEG-malemimide, PEG-vinylsulfone, PEG- iodoacetamide, PEG orthopyridyl disulfide, and thiol-reactive PEG created to PEGylate free cysteine residues (Liu, 2011 : http://www.pharmtech.com/pharmtech/Drug+Delivery/Peptide- PEGylation-The-Next-Generation/ArticleStandard/Article/detail/718859, accessed on 03/07/2013).
  • the modified peptide constructs described herein are PEGylated with branched PEGs, thus enabling a larger and purer PEG to be linked with only one reactive group; consequently, this bulkier branched PEG assists in repelling approaching macromolecules from a peptide's active site and protecting the peptide construct and/or conjugate from proteases.
  • the modified peptide constructs described herein are PEGylated in a number of different ways and tested for in vitro and in vivo activity to determine which method of PEGylation is most effective (e.g., by comparing the number of chains attached to the peptide construct, the molecular weight and structure of the chains, and the specific attachment site/s of the PEG).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • the therapeutic agents useful for methods described herein comprise a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 138), wherein N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PX1X 2 X3X 4 (SEQ ID NO: 139), wherein N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 140), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 141), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 141), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4 (SEQ ID NO: 142), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein XI is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4 (SEQ ID NO: 143), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein XI is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A.
  • N2 is P, Q, G, S, T, V or M
  • N3 is G, T, D, E or N
  • N4 is Q, V, E or G
  • XI is L, V, I, M, Q or E
  • X2
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl , pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl . In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 144), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 144),
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1 (SEQ ID NO: 146), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1 (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X3X 4 C1C 2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C 2 is K, A or R.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX iX 2 X 3 X 4 C 1C 2 C 3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 (SEQ ID NO: 152), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 (SEQ ID NO: 152), where
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX iX 2 X 3 X 4 C 1C 2 C 3 C 1 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the inhibitory peptide comprises the sequence PX iX 2 X 3 X 4 C 1C 2 C 3 C 1 (SEQ ID NO: 153), wherein Xi is L, V, I,
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C5 (SEQ ID NO: 154), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1X 2 X 3 X 4 C 1 C 2 C 3 C 4 C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence PX 1X 2 X 3 X 4 C 1 C 2 C 3 C 4 C5 (SEQ
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PXiX 2 X 3 X 4 Ci (SEQ ID NO: 156), wherein N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PXiX 2 X 3 X 4 Ci (SEQ ID NO: 157), wherein N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl .
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 3 N 4 PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 158), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C 2 is K, A or R.
  • the inhibitory peptide comprises the sequence N 3 N 4 PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 158), wherein N
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X 3 X 4 CiC 2 (SEQ ID NO:159), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C 2 is K, A or R.
  • the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X 3 X 4 CiC 2 (SEQ ID NO:159), wherein N 3 is G, T, D, E or N, and N 4 is
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl , pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X CiC 2 C 3 (SEQ ID NO: 160), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 (SEQ ID NO: 161), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C (SEQ ID NO:
  • Ni is E, G, P, A or V
  • N 2 is P, Q, G, S, T, V or M
  • N 3 is G, T, D, E or N
  • N 4 is Q, V, E or G
  • Xi is a hydrophobic residue
  • X 2 is a residue that preserves hydrogen bonding with CtBP
  • X 3 is a hydrophobic residue
  • X4 is a residue that preserves hydrogen bonding with CtBP
  • Ci is C, M, L, K, V or T
  • C 2 is K
  • C 3 is R, T, H, P, K or C
  • C is P, S, G, R or L.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 (SEQ ID NO:163), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or N1N 2 N 3 N 4 at the N-terminus of PX1X 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is
  • PX1X 2 X 3 X 4 wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and further comprises one of N 4 , N3N 4 , N 2 N3N 4 , or N1N 2 N3N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, C1C 2 , C1C 2 C 3 , C1C 2 C 3 C 4 , or C1C 2 C 3 C 4 C5 at the C-terminus of PX !
  • the inhibitory peptide comprises the sequence
  • N 1 N 2 N 3 N 4 PX 1X 2 X 3 X 4 C 1C 2 C 3 C 4 C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1
  • the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:4), wherein Xi and X 2 are any amino acids, and X 3 is an amino acid having a bulky side chain (such as R or K).
  • the inhibitory peptide comprises the sequence PX1DLSX 2 K (SEQ ID NO: 6), wherein Xi and X 2 are any amino acids.
  • the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO: l).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
  • the peptide constructs of the present application comprises cell penetrating peptides.
  • Cell penetrating peptides also called cell-permeable peptides, protein-transduction domains (PTD) or membrane-translocation sequences (MTS)
  • PTD protein-transduction domains
  • MTS membrane-translocation sequences
  • CPPs are capable of directing a conjugated compound of interest to a desired cellular destination, e.g. into the cytoplasm or the nucleus. Accordingly, CPPs can direct or facilitate penetration of a compound of interest across a phospholipid, mitochondrial, endosomal or nuclear membrane.
  • a CPP can also direct a compound of interest from outside the cell through the plasma membrane, and into the cytoplasm or to a desired location within the cell, e.g., the nucleus, the ribosome, the mitochondria, the endoplasmic reticulum, a lysosome, or a peroxisome.
  • the CPP can direct a compound of interest across the blood-brain, trans-mucosal, hematoretinal, skin, gastrointestinal and/or pulmonary barriers.
  • CPPs are typically short peptides (for example about 10 to 30 amino acids in length). They can efficiently penetrate the cell membrane and enter almost all cell types together with its covalently conjugated molecular cargo. Sebbage, 2009, Cell Penetrating Pepetides and Their Therapeutic Applications. Biosciene Horizons, 2, 64-72.
  • the CPP is a amphipathic peptide. In some embodiments, the CPP is a cationic peptide. For example, in some embodiments, at least about 30% (including for example at least about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or 100%) of amino acids in the CPP are positively charged. In some embodiments, at least about 30% (including for example at least about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or 100%) of amino acids in the CPP are positively charged. In some
  • the CPP comprises a nuclear localization signal.
  • the CPP is derived from a naturally occurring protein, including for example HIV-1, Antennapedia protein (e.g., its homeodomain), VP22, Herpes Simplex Virus, Calcitonin, antimicrobial to toxin peptides.
  • the CPP is a chimeric peptide.
  • the CPP is a chimeric peptide composed of a portion from galanin and a portion from the wasp venom peptide mastoparan.
  • the CPP is a non-naturally occurring peptide (for example a peptide that has been altered from a naturally occurring peptide). Heitz et al., British J. of
  • the CPP is selected from the group consisting of Tat, Pepl, Pep7, pAntp, MPG, DPV, Buforin II, Haptotactic peptides, C , preCy, CaE, hCT(9-32), HN- 1, Influenza virus nucleoprotein, KALA, K-FGF, Ku70, MAP, MPM (IP/K-FGF), N50 (NLS of NF- ⁇ P50), Penetratin, Poly Arginine, pISL, Prion mouse PrPcl-28, pVEC, SAP, SV-40 (NLS), SynB, Tat, Transportan, VP22, VT5, and functionally equivalent variants thereof.
  • the CPP is selected from the group consisting of Tat, Pepl, pAntp, Arge9, pIsL, and functionally equivalent variants thereof.
  • the CPP comprises (e.g., is) Tat.
  • the CPP comprises (e.g., is) Pepl.
  • the CPP comprises (e.g., is) pAntp.
  • the CPP is any one of the cell penetration peptides listed in Table 2 (SEQ ID Nos: 33-83). In some
  • the CPP is a functional variant of any one of the cell penetration peptides listed in Table 2 (SEQ ID Nos: 33-83 ).
  • NLS nucleoprotein
  • a "variant" of a CPP described herein refers to a peptide that is at least about 50%, preferably at least about 70%, more preferably at least about 80%-85%, preferably at least about 90%, and most preferably at least about 95%-99% identical to the original CPP upon which it is based.
  • CPPs can have substitutions at 1, 2, 3, 4 or more residues.
  • the CPP can be used in a monomeric form or in a polymeric form such as a dimer or a trimer.
  • a "functionally equivalent variant of a CPP" refers to a variant that has a similar cell penetration property as the original CPP. In some embodiments, the functionally equivalent variant of the CPP has an enhanced function than the original CPP. In some embodiments, the functional equivalent variant of the CPP has a diminished function as compared to the original CPP. Methods of making functionally equivalent variants are known in the art.
  • Additional CPP can be obtained or identified, for example, by using the mRNA display technology.
  • a DNA library encoding random peptides is transcribed in vitro and linked to puromycin through a DNA linker, which enables the generation of an mRNA-puromycin-peptide fusion upon in vitro translation.
  • This mRNA- peptide fusion can incubate with specific cell lines, extensively washed, and cell-penetrating peptides are recovered through RT-PCR and sequencing of the mRNAs. Multiple rounds of selection generate cell penetrating peptides that enter cells with high efficiency.
  • the therapeutic agents used in the methods described herein comprises an inhibitory peptide that interferes with the interaction between EIA and CtBP.
  • the present application in some embodiments also provides inhibitory peptides described herein.
  • compositions comprising any of the peptide constructs and/or conjugates described herein.
  • Also provided are methods of treating cancer and/or inflammatory disease comprising administering a therapeutic agent comprising an inhibitory peptide.
  • inhibitory peptides described in the section above are all encompassed in the scope of the present application, regardless of whether they are linked or associated with a cell penetrating peptide. Solely for the sake of brevity, the paragraphs below provide a non-exclusive list of these inhibitory peptides.
  • the peptide constructs and/or conjugates described herein are used to interfere with the interaction between EIA and CtBP such that their binding is reduced, and in some cases, inhibited.
  • the reduction of EIA and CtBP binding can be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% from the amount of binding that would have occurred had the peptide constructs and/or conjugates of the present invention not been used.
  • Assays to measure protein-protein interactions are routine and well-known in the art.
  • the peptide constructs described herein comprise an inhibitory peptide that interferes with the interaction between EIA and CtBP.
  • the inhibitory peptide has an IC50 of no more than about 30 ⁇ (such as no more than about any of 20 ⁇ , 15 ⁇ , or 10 ⁇ ) in an in vitro binding assay.
  • the inhibitory peptide has an IC50 that is no more than the IC50 of the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO: l).
  • the inhibitor peptide binds to the same binding site on CtBP as the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO: l).
  • the inhibitor peptide competitively inhibits the binding of the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO:l) to CtBP.
  • the inhibitory peptide comprises (e.g., is) the sequence EQTVPVDLSVARPR (SEQ ID NO: 132).
  • the inhibitory peptide comprises (e.g., is) the sequence GGDGPLDLCCRKRP (SEQ ID NO: 132).
  • the inhibitory peptide comprises (e.g., is) the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
  • the peptide constructs described herein comprise an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide has a Kd of no more than about 20 ⁇ (such as no more than about any of 15 ⁇ , 10 ⁇ , 7.5 ⁇ , 5.0 ⁇ , or 2.5 ⁇ ) in an in vitro binding assay.
  • the inhibitory peptide has a Kd that is no more than the Kd of the El A 14mer
  • the inhibitor peptide binds to the same binding site on CtBP as the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, the inhibitor peptide competitively inhibits the binding of the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO:l) to CtBP.
  • the inhibitory peptide comprises (e.g., is) the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X4 is S, C, T, V or A.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:84), wherein Xi is selected from the group consisting of L, M, Q, or I.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC 2 , CiC 2 C 3 , CiC 2 C 3 C 4 , or CiC 2 C 3 C 4 C 5 at the C-terminus of PXiX 2 X 3
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PX i X 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC 2 , CiC 2 C3, CiC 2 C 3 C 4 , or CiC 2 C 3 C 4 Cs at the C-terminus of PXiX 2 X 3 X , wherein Q is C, M, L, K, V or T
  • the inhibitory peptide comprises the sequence NiN 2 N3N 4 PXiX 2 X 3 X CiC 2 C 3 C 4 C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • Ni is E, G, P, A or V
  • N 2 is P, Q, G, S, T, V or M
  • the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
  • the inhibitory peptide comprises the sequence PXiDLSX 2 X 3 (SEQ ID NO:4), wherein Xi and X 2 are any amino acids, and X 3 is an amino acid having a bulky side chain.
  • Amino acids having a bulky side chain include, e.g., F, W, Y, M, K, R, H and Q.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:5), wherein Xi and X 2 are any amino acids, and X 3 is R or K.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 K (SEQ ID NO:6), wherein Xi and X 2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX 2 Q (SEQ ID NO:7), wherein Xi and X 2 are any amino acids.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:85), wherein Xi is selected from the group consisting of L, M, Q, or I, X 2 is any amino acid, and X 3 is an amino acid having a bulky side chain.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:86), wherein Xi is selected from the group consisting of L, M, Q or I, X 2 is any amino acid, and X 3 is R or K.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 K (SEQ ID NO:87), wherein Xi is selected from the group consisting of L, M, Q, or I, and X 2 is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence
  • PX1DLSX 2 Q (SEQ ID NO:88), wherein Xi is selected from the group consisting of L, M, Q, or I, and X 2 is any amino acid.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:89), wherein Xi is any amino acids, X 2 is selected from the group consisting of C, M, L, or K, and X 3 is an amino acid having a bulky side chain.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:90), wherein Xi is any amino acids, X 2 is selected from the group consisting of C, M, L, or K, and X 3 is R or K.
  • the inhibitory peptide comprises the sequence PXiDLSX 2 K (SEQ ID NO:91), wherein Xi is any amino acids, X 2 is selected from the group consisting of C, M, L, or K.
  • the inhibitory peptide comprises the sequence PX1DLSX2Q (SEQ ID NO:92), wherein Xi is any amino acids, X 2 is selected from the group consisting of C, M, L, or K.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:93), wherein Xi is selected from the group consisting of L, M, Q, or I, X 2 is selected from the group consisting of C, M, L, or K, and X 3 is an amino acid having a bulky side chain.
  • the inhibitory peptide comprises the sequence
  • PX1DLSX 2 X 3 (SEQ ID NO:94), wherein Xi is selected from the group consisting of L, M, Q, or I, X 2 is selected from the group consisting of C, M, L, or K, and X 3 is R or K.
  • the inhibitory peptide comprises the sequence PX1DLSX 2 K (SEQ ID NO:95), wherein Xi is selected from the group consisting of L, M, Q, or I, X 2 is selected from the group consisting of C, M, L, or K.
  • the inhibitory peptide comprises the sequence PX1DLSX2Q (SEQ ID NO:96), wherein Xi is selected from the group consisting of L, M, Q, or I, X 2 is selected from the group consisting of C, M, L, or K.
  • the inhibitory peptide comprises the sequence PLDLSX 1 X 2 (SEQ ID NO:97), wherein Xi is any amino acids, and X 2 is an amino acid having a bulky side chain.
  • the inhibitory peptide comprises the sequence PLDLSX 1 X 2 (SEQ ID NO:98), wherein Xi is any amino acids, and X 2 is R or K.
  • the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO:99), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLSXiQ (SEQ ID NO: 100), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLSX 1 X 2 (SEQ ID NO: 101), wherein Xi is selected from the group consisting of C, M, L, or K, and X 2 is an amino acid having a bulky side chain.
  • the inhibitory peptide comprises the sequence PLDLSX 1 X 2 (SEQ ID NO: 102), wherein Xi is selected from the group consisting of C, M, L, or K, and X 2 is R or K.
  • the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 103), wherein Xi is selected from the group consisting of C, M, L, or K.
  • the inhibitory peptide comprises the sequence PLDLSXiQ (SEQ ID NO: 104), wherein Xi is selected from the group consisting of C, M, L, or K.
  • the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCR (SEQ ID NO: 13). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCQ (SEQ ID NO: 14).
  • the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises the sequence PLDLSCRPR (SEQ ID NO: 16). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCQRPR (SEQ ID NO: 17). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCRRPR (SEQ ID NO: 122).
  • the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCRPR (SEQ ID NO:105). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCQRPR (SEQ ID NO: 19). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCRRPR (SEQ ID NO: 123).
  • the inhibitory peptide comprises at least 5 contiguous (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65) amino acids of the El A N-terminal domain (amino acids 1-67 of El A). In some embodiments, the inhibitory peptide is at least about 80%, 85%, 90%, 95%, 98%, or 99% homologous to a portion of the El A N-terminal domain (such as a peptides sequence having at least 5 contiguous (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65) amino acids of the El A N- terminal domain.
  • the inhibitory peptide is a functionally equivalent variant of a portion of the El A N-terminal domain (such as a peptides sequence having at least 5 contiguous (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65) amino acids of the E1A N-terminal domain (also referred to as the "E1A inhibitory peptides").
  • the inhibitory peptide comprises at least 5 contiguous amino acids (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65 amino acids) of the El A C-terminal domain (e.g. , amino acids 177-243 of El A amino acid sequence in Figure 9). In some embodiments, the inhibitory peptide comprises an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 98%, or 99% homologous to an amino acid sequence of the E1A C-terminal domain.
  • the inhibitory peptide comprises an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 98%, or 99% homologous to an amino acid sequence of the El A C-terminal domain and has at least 5 contiguous amino acids (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65 amino acids) of the E1A C-terminal domain.
  • the inhibitory peptide is a functionally equivalent variant of a portion of the El A C-terminal domain such as a peptide sequence having at least 5 contiguous amino acids (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65 amino acids of the El A C-terminal domain) of the El A C-terminal domain.
  • Inhibitory peptides of the embodiments herein are also referred to as "E1A inhibitory peptides”.
  • a "variant" of an inhibitory peptide described herein refers to a peptide that is at least about 50%, preferably at least about 70%, more preferably at least about 80%-85%, preferably at least about 90%, and most preferably at least about 95%-99% identical to the original El A inhibitory peptide upon which it is based.
  • the variant can have substitutions at 1 , 2, 3, 4 or more residues.
  • a “functionally equivalent variant” of an inhibitory peptide refers to a variant that has a similar inhibitory activity as the original inhibitory peptide.
  • the functionally equivalent variant of the inhibitory peptide has lower IC50 in inhibiting the ElA/CtBP binding than the inhibitory peptide.
  • the functionally equivalent variant of the inhibitory peptide has higher IC50 in inhibiting the ElA/CtBP binding than the inhibitory peptide.
  • Methods of making functionally equivalent variants are described further herein.
  • the present application thus also encompasses methods of screening for inhibitory peptides that are functionally equivalent to any one of the inhibitory peptides described herein.
  • peptide constructs and conjugates described herein can be produced using a variety of techniques known in the art of molecular biology and protein chemistry.
  • a nucleic acid encoding a peptide construct described herein can be inserted into an expression vector that contains transcriptional and translational regulatory sequences, which include, e.g., promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, transcription terminator signals, polyadenylation signals, and enhancer or activator sequences.
  • the regulatory sequences include a promoter and transcriptional start and stop sequences.
  • the expression vector can include more than one replication system such that it can be maintained in two different organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification.
  • Several possible vector systems are available for the expression of peptide constructs from nucleic acids in mammalian cells.
  • One class of vectors relies upon the integration of the desired gene sequences into the host cell genome.
  • Cells which have stably integrated DNA can be selected by simultaneously introducing drug resistance genes such as E. coli gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or Tn5 neo (Southern and Berg (1982) Mol Appl Genet 1 :327).
  • the selectable marker gene can be either linked to the DNA gene sequences to be expressed, or introduced into the same cell by co- transfection (Wigler et al. (1979) Celll6:77).
  • a second class of vectors utilizes DNA elements which confer autonomously replicating capabilities to an extrachromosomal plasmid.
  • These vectors can be derived from animal viruses, such as bovine papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA, 79: 7147), polyoma virus (Deans et al. (1984) Proc Natl A cad Sci USA 81: 1292), or SV 40 virus (Lusky and Botchan (1981) Nature 293:79).
  • the expression vectors can be introduced into cells in a manner suitable for subsequent expression of the nucleic acid.
  • the method of introduction is largely dictated by the targeted cell type, discussed below. Exemplary methods include CaP0 4 precipitation, liposome fusion, lipofectin, electroporation, viral infection, dextran-mediated transfection, polybrene-mediated transfection, protoplast fusion, and direct microinjection.
  • Appropriate host cells for the expression of the peptide constructs include yeast, bacteria, insect, plant, and, as described above, mammalian cells. Of interest are bacteria such as E. coli, fungi such as Saccharomyces cerevisiae and Pichia pastoris, insect cells such as SF9, mammalian cell lines (e.g. , human cell lines), as well as primary cell lines (e.g. , primary mammalian cells).
  • the peptide constructs can be expressed in Chinese hamster ovary (CHO) cells or in a suitable myeloma cell line such as (NSO).
  • Suitable cell lines also include, for example, BHK-21 (baby hamster kidney) cells; 293 (human embryonic kidney) cells; HMEpC (Human Mammary Epithelial cells; 3T3 (mouse embryonic fibroblast) cells.
  • the inhibitory peptide and the cell penetrating peptide may optionally be directly joined to each other, or may optionally be joined via a linker.
  • the hybrid vector is made where the DNA encoding the inhibitory peptide and the cell penetrating peptide are themselves directly ligated to each other using known scientific methods.
  • the hybrid vector is made where the DNA encoding the inhibitory peptide is ligated to DNA encoding one end of the linker; and the DNA encoding the cell penetrating peptide is ligated to the other end of the linker. Methods are known for performing such ligations in proper orientation.
  • Such ligation may be performed either in series, or as a three way ligation.
  • sequences which may serve as the linker sequence in the present invention include short peptides of about 2 to about 16 amino acids in length.
  • the hybrid vectors of the present invention may include one or more DNA sequences encoding such signal or leader peptides and/or one or more DNA sequences encoding such propeptide sequence, depending upon whether such secretion and/or processing is desired.
  • the hybrid vectors of the present disclosure may include DNA sequences encoding a different signal or leader peptide and/or pro-peptide sequence chosen to optimize the expression and localization of the peptide construct.
  • the signal peptide may be omitted, as the targeting moiety will supply sufficient information for targeting of the active moiety to the desired tissue and cells within the subject's body.
  • a peptide construct described herein can be expressed in, and purified from, transgenic animals (e.g., transgenic mammals).
  • transgenic animals e.g., transgenic mammals
  • a peptide construct described herein can be produced in transgenic non-human mammals (e.g. , rodents, sheep or goats) and isolated from milk as described in, e.g., Houdebine (2002) Curr Opin Biotechnol 13(6):625-629; van Kuik-Romeijn et al. (2000) Transgenic Res 9(2): 155-159; and Pollock et al. (1999) 1 Immunol Methods 231(1 -2): 147- 157. Additional methods for producing proteins in mammalian milk products are described in, e.g. , U.S. patent application publication nos. 200600105347 and 20040006776 and U.S. patent no. 7,045,676.
  • the peptide constructs described herein can be produced from cells by culturing a host cell transformed with the expression vector containing nucleic acid encoding the peptide construct, under conditions, and for an amount of time, sufficient to allow expression of the peptide construct.
  • Such conditions for protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation.
  • polypeptides expressed in E. coli can be refolded from inclusion bodies (see, e.g. , Hou et al. (1998) Cytokine 10:319-30).
  • a peptide construct described herein can be expressed in mammalian cells or in other expression systems including but not limited to yeast, baculo virus, and in vitro expression systems (see, e.g. , Kaszubska et al. (2000) Protein Expression and Purification 18:213-220).
  • the peptide construct can be isolated.
  • purified or isolated as applied to any of the proteins described herein (e.g., a peptide construct, a targeting moiety, and/or an active moiety) refers to a polypeptide that has been separated or purified from components (e.g., proteins or other naturally-occurring biological or organic molecules) which naturally accompany it, e.g., other proteins, lipids, and nucleic acid in a prokaryote expressing the proteins.
  • a peptide construct described herein can be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample.
  • Standard purification methods include electrophoretic, molecular, immunological, and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse- phase HPLC chromatography.
  • Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. See, e.g., Scopes (1994) "Protein Purification, 3rd edition," Springer- Verlag, New York City, New York. The degree of purification necessary will vary depending on the desired use. In some instances, no purification of the expressed polypeptide thereof will be necessary.
  • Methods for determining the yield or purity of a purified peptide construct include, e.g. , Bradford assay, UV spectroscopy, Biuret protein assay, Lowry protein assay, amido black protein assay, high pressure liquid chromatography (HPLC), mass spectrometry (MS), and gel electrophoretic methods (e.g. , using a protein stain such as Coomassie Blue or colloidal silver stain).
  • a peptide construct described herein can be synthesized de novo in whole or in part, using chemical methods well known in the art.
  • the component amino acid sequences can be synthesized by solid phase techniques, cleaved from the resin, and purified by preparative high performance liquid chromatography followed by chemical linkage to form a desired peptide construct.
  • the composition of the synthetic peptide construct may be confirmed by amino acid analysis or sequences.
  • the peptides used in the invention can be prepared by chemical or biological methods known in the art, including solid phase peptide synthesis, solution phase peptide synthesis, and fragment condensation (either in solution phase or on solid phase).
  • the peptides are synthesized by solid phase peptide synthesis (see Stewart and Young, Solid-Phase Peptide Synthesis, 2 nd Ed., Pierce Chemical Co.
  • the peptide is synthesized with an L-amino acid(s) and/or a D-amino acid(s).
  • the peptide can be synthesized and purified separately, and the peptide can be associated after synthesis and purification of both peptides have been completed.
  • the peptides are synthesized either sequentially or simultaneously by synthesis on a linker which aids in maintaining the association of the peptide.
  • a branched molecule of the form H2Np-(CH2)-CH(N a H 2 )-COOH can be attached via its carboxyl group to a solid-phase synthesis resin, such as a crosslinked benzhydrylamine or methylbenzhydrylamine resin.
  • the a and ⁇ nitrogens can be orthogonally protected (such as with a Mtt group and an Fmoc group, an ivDde group and an Fmoc group, or with an Alloc group and Fmoc group), and one chain is synthesized to the desired length, followed by synthesis of the other chain to its desired length.
  • the covalently linked peptide construct is then cleaved from the solid phase resin and purified.
  • the peptides can have routine modifications, such as acetylation of the N-terminal residue, amidation of the C-terminal residue, or both acetylation of the N-terminal residue and amidation of the C-terminal residue.
  • a peptide construct described herein can be assayed for any one of a numbered of desired properties using in vitro or in vivo assays such as any of those described herein.
  • a peptide construct described herein can be assayed for its ability to inhibit EIA binding as described in Zhang et al., 2000, Acetylation of adenovirus EIA regulates binding of the transcriptional corepressor CtBP, PNAS vol. 97, no. 26: 14323- 14328.
  • endotoxin can be removed from the peptide construct preparations.
  • Methods for removing endotoxin from a protein sample are known in the art.
  • endotoxin can be removed from a protein sample using a variety of commercially available reagents including, without limitation, the ProteoSpinTM Endotoxin Removal Kits (Norgen Biotek Corporation), Detoxi-Gel Endotoxin Removal Gel (Thermo Scientific; Pierce Protein Research Products), MiraCLEAN® Endotoxin Removal Kit (Minis), or AcrodiscTM- Mustang® E membrane (Pall Corporation).
  • the concentration of endotoxin in a protein sample can be determined using the QCL-1000 Chromogenic kit (BioWhittaker), the limulus amebocyte lysate (LAL)- based kits such as the Pyrotell®, Pyrotell®-T, Pyrochrome®, Chromo-LAL, and CSE kits available from the Associates of Cape Cod Incorporated.
  • the peptide constructs described herein can be modified. The modifications can be covalent or non-covalent modifications.
  • modifications can be introduced into the peptide constructs by, e.g., reacting targeted amino acid residues in the targeting moiety and/or the active moiety with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues.
  • Suitable sites for modification can be chosen using any of a variety of criteria including, e.g., structural analysis or amino acid sequence analysis of the peptide constructs described herein.
  • the peptide constructs described herein can be modified. Following expression and purification, the peptide constructs described herein can be modified.
  • the modifications can be covalent or non-covalent modifications.
  • Such modifications can be introduced into the peptide constructs by, e.g., reacting targeted amino acid residues in the targeting moiety and/or the active moiety with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues.
  • Suitable sites for modification can be chosen using any of a variety of criteria including, e.g., structural analysis or amino acid sequence analysis of the peptide constructs described herein.
  • the peptide construct is conjugated to a carrier molecule.
  • the carrier and the peptide construct may optionally be directly joined to each other, or may optionally be joined via a linker.
  • the hybrid vector is made where the DNA encoding the carrier and peptide construct are themselves directly ligated to each other using known scientific methods.
  • the hybrid vector is made where the DNA encoding the carrier is ligated to DNA encoding one end of the linker; and the DNA encoding the peptide construct is ligated to the other end of the linker. Methods are known for performing such ligations in proper orientation. Such ligation may be performed either in series, or as a three way ligation.
  • the therapeutic agents useful for methods described herein can be provided in pharmaceutical compositions.
  • the therapeutic agent may or may not further comprise a cell penetrating peptide such as any of the cell penetrating peptides described herein.
  • compositions comprising any of the peptide constructs and/or conjugates described herein.
  • Peptide-based therapeutics such as the peptide constructs and/or conjugates described herein, are usually challenging to formulate. Selection of a suitable surfactant for preparing sufficiently stable emulsions for a particular application is not a predictable or routine exercise. For peptide- based therapeutics, the reduction of drug crystallization and precipitation need to be considered.
  • Lipid-based compositions such as emulsions appear as a promising vehicle system for delivering poorly water-soluble drugs.
  • Emulsions are an intimate mixture of two incompletely miscible liquids, such as oil and water, in which one of the liquids in the form of fine droplets is dispersed in the other liquid, usually with the aid of an emulsifier or surfactant.
  • pharmaceutically acceptable carriers may include sterile aqueous of non-aqueous solutions, suspensions, and emulsions.
  • non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's or fixed oils.
  • Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Suitable agents which are known to enhance absorption of drugs through skin are described in Sloan, Use of Solubility Parameters from-Regular Solution Theory to Describe Partitioning-Driven Processes, Ch. 5, "Prodrugs: Topical and Ocular Drug Delivery” (Marcel Dekker, 1992), and at places elsewhere in the text. In addition, preservatives and other additives may also be present such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
  • the peptide construct and/or conjugate may also be lyophilized using means well known in the art, for subsequent reconstitution and use according to the invention.
  • a composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PX 1X 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 138), wherein N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence ⁇ 4 ⁇ 2 ⁇ 3 ⁇ 4 (SEQ ID NO: 139), wherein N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 140), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence ⁇ 3 ⁇ 4 ⁇ 2 ⁇ 3 ⁇ 4 (SEQ ID NO: 141), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 142), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO:
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 144), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1 (SEQ ID NO: 1
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1 (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C 2 is K, A or R.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C 2 is K, A or R.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the inhibitory peptide comprises the sequence
  • PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 (SEQ ID NO: 152), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the inhibitory peptide comprises the sequence PX 1X 2 X 3 X 4 C 1 C 2 C 3 C 4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 154), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X 4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 C1 (SEQ ID NO: 156), wherein N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T.
  • the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 C1 (SEQ ID NO: 157), wherein N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 3 N 4 PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 158), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C 2 is K, A or R.
  • the inhibitory peptide comprises the sequence N 3 N 4 PX 1X 2 X 3 X 4 C 1 C 2 (SEQ ID NO: 159), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C 2 is K, A or R.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 (SEQ ID NO:160), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the inhibitory peptide comprises the sequence N 2 N3N 4 PX1X 2 X3X 4 C1C 2 C3 (SEQ ID NO: 161), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C3 is R, T, H, P, K or C.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 (SEQ ID NO:162), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 (SEQ ID NO: 163), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PX i X 2 X 3 X , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC ⁇ C1C 2 C 3 , C C 2 3 C 4 , o C C 2 C 3 C 4 C5 at the C-terminus of PXiX 2 X 3 X 4 ,
  • the inhibitory peptide comprises PXiX 2 X X , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, C1C 2 , CiC 2 C 3 , CiC 2 C 3 C 4 , or CiC 2 C 3 C 4 C 5 at the C-terminus of PXiX 2 X 3 X4, wherein Ci is C, M, L, K, V or T, C
  • the inhibitory peptide comprises the sequence N 1 N 2 N N PX iX 2 X X C iC 2 C C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein X !
  • X 2 is a residue that preserves hydrogen bonding with CtBP
  • X is a hydrophobic residue
  • X 4 is a residue that preserves hydrogen bonding with CtBP
  • d is C, M, L, K, V or T
  • C 2 is K
  • C 3 is R, T, H, P, K or C
  • C 4 is P, S, G, R or L
  • C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C 5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3
  • the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition (such as a
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1 DLSX 2 X 3 (SEQ ID NO:4), wherein Xi and X 2 are any amino acids, and X 3 is an amino acid having a bulky side chain (such as R or K).
  • the inhibitory peptide comprises the sequence PX 1 DLSX 2 K (SEQ ID NO:6), wherein Xi and X 2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO: l).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20.
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22.
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26.
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
  • excipients usually utilized in the pharmaceutical arts can be added to the pharmaceutical compositions of the invention.
  • These pharmaceutically acceptable excipients may be preserving agents, emollients, antifoaming agents, antioxidants, buffers, pigments, coloring agents, sweetening agents, flavoring agents, coating agents, granulating agents, disintegrants, glidants, lubricants, conventional matrix materials, complexing agents, absorbents, and fillers.
  • Suitable excipients include, but are not limited to metilparaben, propilparaben, cyclodextrin, liquid paraffin, dimethicone, Abil EM 90 (silicone).
  • the excipient is any of: liquid paraffin, methylparaben, propylparaben, cetrimide and cetostearyl alcohol.
  • the peptide constructs, conjugates, and compositions (such as pharmaceutical compositions) described herein are useful for treatment of diseases such as cancer.
  • the peptide constructs can be delivered to an individual via a variety of routes, including, but not limited to, intravenous, intratumoral, subcutaneously, oral, transmucosal, transdermal, and topical administrations.
  • the present application thus also encompasses methods of delivering any of the peptide constructs or conjugates described herein to an individual (such as an individual having cancer).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PX 1X 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 (SEQ ID
  • the inhibitory peptide comprises the sequence N 4 PXiX 2 XsX 4 (SEQ ID NO: 139), wherein N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 140), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 141), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 142), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP.
  • a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO:
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 144), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • Ni is E, G, P, A or V
  • N 2 is P, Q, G, S, T, V or M
  • N 3 is G, T, D, E or N
  • N 4 is Q, V, E or G
  • Xi is L, V, I, M, Q or E
  • X 2 is D or N
  • X 3 is L or I
  • X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl , pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl . In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1 (SEQ ID
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1 (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C 2 is K, A or R.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X CiC 2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the inhibitory peptide comprises the sequence
  • PX1X 2 X 3 X 4 C1C 2 C 3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 (SEQ ID NO: 152), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the inhibitory peptide comprises the sequence PX 1X 2 X 3 X 4 C 1 C 2 C 3 C 4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 154), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 C1 (SEQ ID NO: 156), wherein N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T.
  • the inhibitory peptide comprises the sequence N 4 PXiX 2 X 3 X 4 Ci (SEQ ID NO: 157), wherein N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X 3 X 4 CiC 2 (SEQ ID NO: 158), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R.
  • the inhibitory peptide comprises the sequence N 3 N 4 PXiX 2 X3X 4 CiC 2 (SEQ ID NO: 159), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C 2 is K, A or R.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO:160), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO:160), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D
  • N 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 (SEQ ID NO: 161), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 C 4 (SEQ ID NO:162), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the inhibitory peptide comprises the sequence N 1 N 2 N 3 N 4 PX 1X 2 X 3 X 4 C 1 C 2 C 3 C 4 (SEQ ID NO: 163), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X 4 is S, C, T, V or A, and wherein Q is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PX i X 2 X 3 X , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC ⁇ C1C 2 C 3 , C C 2 3 C 4 , o C C 2 C 3 C 4 C5 at the C-terminus of PXiX 2 X 3 X 4 ,
  • the inhibitory peptide comprises the sequence PXiX 2 X X , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC 2 , CiC 2 C 3 , CiC 2 C 3 C 4 , or CiC 2 C 3 C 4 C 5 at the C-terminus of PXiX 2 X 3 X4, wherein d is C, M, L, K, V or T,
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C 5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C 5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein X !
  • the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1 DLSX 2 X 3 (SEQ ID NO:4), wherein Xi and X 2 are any amino acids, and X 3 is an amino acid having a bulky side chain (such as R or K).
  • the inhibitory peptide comprises the sequence PX 1 DLSX 2 K (SEQ ID NO: 6), wherein Xi and X 2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO: l).
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct
  • composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26.
  • a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
  • a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N- terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G,
  • the inhibitory peptide comprises the sequence PXiX 2 X X , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and further comprises one of N 4 , N3N4, N2N3N4, or N1N2N3N4 at the N-terminus of PX1X2X3X4, wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, C1C 2 , C1C 2 C3, C1C 2 C3C 4 , or C1C 2 C3C 4 C5 at the C- terminus of PX 1X 2 X 3 X 4 , wherein Ci is C, M, L, K, V or T, C 2 is
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX 2 X3 (SEQ ID NO:4), wherein Xi and X 2 are any amino acids, and X3 is an amino acid having a bulky side chain (such as R or K).
  • the inhibitory peptide comprises the sequence PX1DLSX 2 K (SEQ ID NO:6), wherein Xi and X 2 are any amino acids.
  • the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20.
  • a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22.
  • a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26.
  • a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X3X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID N0:2), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N , or NiN 2 N 3 N at the N- terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2
  • d is C, M, L, K, V or T
  • C 2 is K
  • C 3 is R, T, H
  • C 4 is P, S, G, R or L
  • C 5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC 2 , CiC 2 C 3 , CiC 2 C 3 C 4 , or CiC 2 C 3 C 4 Cs at the C- terminus of PXiX 2 X 3 X 4 , wherein d is C, M, L, K
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C 5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX 2 X 3 (SEQ ID NO:4), wherein Xi and X 2 are any amino acids, and X 3 is an amino acid having a bulky side chain (such as R or K).
  • the inhibitory peptide comprises the sequence PX1DLSX 2 K (SEQ ID NO:6), wherein Xi and X 2 are any amino acids.
  • the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20.
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22.
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26.
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
  • a method of decreasing resistance to radiation and chemotherapy in an individual having cancer comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO: 26.
  • the cancer is breast cancer. In some embodiments, the cancer is ovarian cancer. In some embodiments, the cancer is gastric cancer. In some embodiments, the cancer is glioma. In some embodiments, the cancer is skin cancer. In some embodiments, the cancer is melanoma. In some embodiments, the cancer is colon cancer. In some embodiments, the cancer is poorly differentiated colon adenocarcinoma. In some embodiments, the cancer is lung cancer. In some embodiments, the cancer is non-small cell lung cancer. In some embodiments, the lung cancer is moderately differentiated lung adenocarcinoma. In some embodiments, the cancer is ductal invasive breast carcinoma. In some embodiments, the cancer is renal cell carcinoma.
  • the present application in some embodiments provide methods of treating inflammatory diseases in an individual by administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the therapeutic agents can be delivered to an individual via a variery of routes, including, but not limited to, intravenous, intratumoral, subcutaneously, oral, transmucosal, transdermal, and topical administrations.
  • the present application thus also encompasses methods of delivering any of the therapeutic agents described herein to an individual (such as an individual having an inflammatory disease).
  • the therapeutic agent in some embodiments comprisings a peptide construct comprising a cell penetration peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the therapeutic agent comprises an inhibitory peptide not linked to a cell penetration peptide.
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence P XiDLS (SEQ ID NO:2), wherien Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 138), wherein N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 139), wherein N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 3 N 4 PX 1X 2 X 3 X 4 (SEQ ID NO: 140), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP
  • the inhibitory peptide comprises the sequence N 3 N 4 PX 1X 2 X 3 X 4 (SEQ ID NO: 140), wherein N 3 is G, T, D, E or N, and N 4
  • the inhibitory peptide comprises the sequence N3N 4 PX1X 2 X3X 4 (SEQ ID NO: 141), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID NO: 142), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PX1X 2 X 3 X 4 (SEQ ID
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PXiX 2 X 3 X (SEQ ID NO: 143), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X3X 4 (SEQ ID NO:144), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 1 PX 1X 2 X 3 X ⁇ 1 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, N 4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 Ci (SEQ ID NO: 146), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 Ci (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X3X 4 C1C 2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C 2 is K, A or R.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP
  • the inhibitory peptide comprises the sequence PX1X 2 X3X 4 C1C 2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X 2 is a residue
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C 2 is K, A or R.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 1 C1C 2 C 3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 1 C1C 2 C 3 (SEQ ID NO: 150), where
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X CiC 2 C 3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R, T, H, P, K or C.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 C1C 2 C 3 C 4 (SEQ ID NO: 152), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP
  • the inhibitory peptide comprises the sequence PX1X 2 X 3
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 C 4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein Q is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, and C 4 is P, S, G, R or L.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C5 (SEQ ID NO: 154), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C5 (S
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 4 PX1X 2 X3X 4 C1 (SEQ ID NO: 156), wherein N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T.
  • the inhibitory peptide comprises the sequence N 4 PX1X 2 X 3 X 4 C1 (SEQ ID NO: 157), wherein N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Q is C, M, L, K, V or T.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 3 N 4 PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 158), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C 2 is K, A or R.
  • a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP
  • the inhibitory peptide comprises the sequence N 3 N 4 PX1X 2
  • the inhibitory peptide comprises the sequence N 3 N 4 PX1X 2 X 3 X 4 C1C 2 (SEQ ID NO: 159), wherein N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C 2 is K, A or R.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 (SEQ ID NO: 160), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C 3 is R
  • the inhibitory peptide comprises the sequence N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 (SEQ ID NO: 161), wherein N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, and C3 is R, T, H, P, K or C.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence NiN 2 N3N 4 PXiX2X3X 4 CiC 2 C 3 C 4 (SEQ ID NO: 162), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C
  • NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 (SEQ ID NO: 163), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein X !
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or N1N 2 N 3 N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N3 is G, T, D, E
  • the inhibitory peptide comprises PX1X 2 X 3 X 4 , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PX1X 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, C1C 2 , C1C 2 C 3 , C1C 2 C 3 C 4 , or C1C 2 C 3 C 4 C5 at the C-terminus of PX1X 2 X3X 4 , wherein Q is C, M, L, K
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence N1N 2 N 3 N 4 PX1X 2 X 3 X 4 C1C 2 C 3 C 4 C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1 DLSX 2 X 3 (SEQ ID NO:4), wherien Xi and X 2 are any amino acids, and X 3 is an amino acid having a bulky side chain.
  • the inhibitory peptide comprises the sequence PX 1 DLSX 2 K (SEQ ID NO:6), wherien Xi and X 2 are any amino acids.
  • the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12).
  • the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15).
  • the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l).
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 20.
  • a method of treating an inflammatory disease comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 20.
  • a inflammatory disease such as psoriasis
  • administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 22.
  • a method of treating an inflammatory disease such as psoriasis in an individual comprising
  • a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 26.
  • a method of treating an inflammatory disease such as psoriasis in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 28.
  • a method of inhibiting inflammation in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the inhibitory peptide comprises the sequence PX 1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PXiX 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X4 is S, C, T, V or A.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of inhibiting inflammation in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherien Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of inhibiting inflammation in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between El A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N is Q, V, E or
  • the inhibitory peptide comprises PXiX 2 X 3 X , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and further comprises one of N 4 , N3N4, N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC 2 , dC 2 C 3 , dC 2 C 3 C 4 , or CiC 2 C 3 C 4 C 5 at the C-terminus of PXiX 2 X 3 X 4 , wherein d is C, M, L, K, V or T
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence NiN 2 N3N 4 PXiX 2 X3X 4 CiC 2 C 3 C 4 C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence NiN 2 N3N 4 PXiX 2 X3X 4 CiC 2 C 3 C 4
  • the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl , pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl . In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of inhibiting inflammation in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiDLSX 2 X 3 (SEQ ID NO:4), wherien Xi and X 2 are any amino acids, and X is an amino acid having a bulky side chain.
  • the inhibitory peptide comprises the sequence PXiDLSX 2 K (SEQ ID NO: 6), wherien Xi and X 2 are any amino acids.
  • the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO: l).
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • a method of inhibiting inflammation in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO: 20.
  • a method of inhibiting inflammation in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO: 22.
  • a method of inhibiting inflammation in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO: 26.
  • a method of inhibiting inflammation in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO:28.
  • the inflammatory disease is selected from the group consisting of psoriasis, mucositis, chronic wound and trauma. In some embodiments, the inflammatory disease is selected from the group consisting of psoriatic arthritis,
  • osteoarthritis rheumatoid arthritis
  • inflammatory bowel disease e.g., Crohn's disease and ulcerative colitis
  • sepsis atopic dermatitis
  • contact dermatitis e.g., chronic obstructive pulmonary disease
  • chronic inflammatory pulmonary disease e.g., chronic obstructive pulmonary disease
  • the inflammatory disease is psoriasis.
  • Psoriasis is a common inflammatory skin disease seen in dermatology clinics. The most frequently seen form of psoriasis is psoriasis vulgaris, occurring in 90% of all cases and characterized by scaly papulosquemous plaque lesions. Less common types of psoriasis, including psoriatic erythroderma, pustular psoriasis, and psoriatic arthritis, are usually thought to be more severe entities of psoriasis. Griffiths et al., 2007. Lancet, vol. 370: 263-271.
  • a method of treating psoriasis comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • the therapeutic agent is administered topically.
  • a method of treating psoriasis comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherien Xi is any amino acid.
  • the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
  • the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide.
  • the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • the therapeutic agent is administered topically.
  • a method of treating psoriasis comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X 2 X 3 X 4 , wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N- terminus of PXiX 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G,
  • the inhibitory peptide comprises PXiX 2 X X , wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A, and further comprises one of N 4 , N 3 N 4 , N 2 N 3 N 4 , or NiN 2 N 3 N 4 at the N-terminus of PX i X 2 X 3 X 4 , wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, and/or further comprises one of Ci, CiC 2 , CiC 2 C 3 , CiC 2 C 3 C 4 , or CiC 2 C 3 C 4 Cs at the C-terminus of PXiX 2 X 3 X 4 , wherein Q is C, M, L, K, V or
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C 5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C5 is R, K, P, T, L or S.
  • the inhibitory peptide comprises the sequence NiN 2 N 3 N 4 PXiX 2 X 3 X 4 CiC 2 C 3 C 4 C 5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N 2 is P, Q, G, S, T, V or M, N 3 is G, T, D, E or N, and N 4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X 2 is D or N, X 3 is L or I, and X is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C 2 is K, A or R, C 3 is R, T, H, P, K or C, C 4 is P, S, G, R or L, and C 5 is R, K, P, T, L or S.
  • Ni is E, G, P, A or V
  • N 2 is P, Q, G, S, T, V or M
  • the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • the therapeutic agent is administered topically.
  • a method of treating psoriasis comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1 DLSX 2 X 3 (SEQ ID NO:4), wherien Xi and X 2 are any amino acids, and X 3 is an amino acid having a bulky side chain (such as R or K).
  • the inhibitory peptide comprises the sequence PX 1 DLSX 2 K (SEQ ID NO:6), wherien Xi and X 2 are any amino acids.
  • the inhibitory peptide comprises the sequence
  • the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof.
  • the cell penetration peptide comprises Tat.
  • the cell penetration peptide comprises Pepl.
  • the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long.
  • the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
  • the therapeutic agent is administered topically.
  • a method of treating psoriasis comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 20.
  • a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 22.
  • a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 26.
  • a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 28.
  • the therapeutic agent is administered topically.
  • the compounds described for use in the present invention can be administered to an individual via any route known in the art, including, but not limited to, those disclosed herein.
  • the peptide constructs and/or conjugates of the present invention may be administered: intravenously, subcutaneously, topically, transdermally, intraperitoneally, orally, via intramuscular injection, intra-arterially, via inhalation (e.g. as mists or sprays), via nasal mucosa, gastrointestinally, and directly to a specific or affected organ.
  • administration is a preferred route of administration.
  • the compounds described for use herein can be administered in the form of injectables, creams, solutions, emulsions, dispersions, suppositories, food premixes, tablets, pills, powder mixtures, capsules, granules, and in other suitable forms.
  • the peptide constructs and/or conjugates may be formulated to extend their half-lives in vivo, such as by forming conjugates with a biocompatible polymer (e.g., polyethylene glycol (PEG)).
  • a biocompatible polymer e.g., polyethylene glycol (PEG)
  • the peptide constructs and/or conjugates provided herein may be delivered using liposomes, microparticles, and nanoparticles for peptide drug delivery, as is known in the art. See, e.g., Tan, M.L. et al., 2010. Peptides, vol. 31 : 184-193, incorporated herein in its entirety.
  • the amount of the peptide construct and/or conjugate administered to an individual in need thereof can be determined by various factors, such as the type of cancer, the biological and/or physiological response from the individual receiving the peptide therapeutic and other factors known to one of skill in the art. As such, the amount of the peptide construct and/or conjugate to be administered can be adjusted accordingly to achieve the desired beneficial effects.
  • the amount of the peptide construct and/or conjugate to be used is at least about 1 ⁇ g peptide construct and/or conjugate/kg of the individual. In other aspects, the amount of the peptide construct and/or conjugate to be used is at least about
  • the amount of the peptide construct and/or conjugate to be used is at least about 35 ⁇ g kg, 40 ⁇ g/kg, 45 ⁇ g/kg, 50 ⁇ g/kg, 55 ⁇ g/kg, 60 ⁇ g/kg, 65 ⁇ g kg, 70 ⁇ g/kg, 75 ⁇ g/kg, 80 ⁇ g kg, 85 ⁇ g/kg, 90 ⁇ g/kg, 95 ⁇ g kg or 100 ⁇ g/kg.
  • the amount of the peptide construct and/or conjugate to be used is about 1 ⁇ g kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg,
  • the amount of the conjugate to be used is at most about 1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg, 28 ⁇ g/kg, 29 ⁇ g/kg, 30 ⁇ g/kg, 35 ⁇ g/kg, 40 ⁇ g/kg, 45 ⁇ g/kg, 50 ⁇ g/kg,
  • Exemplary dosing frequencies for the administration of the peptide constructs include, but are not limited to, daily, every two days, every three days, every four days, every five days, every six days, weekly without break, weekly for three out of four weeks, once every three weeks, once every two weeks, or two out of three weeks.
  • the composition is administered about once every 2 weeks, once every 3 weeks, once every 4 weeks, once every 6 weeks, or once every 8 weeks.
  • the composition is administered at least about any of lx, 2x, 3x, 4x, 5x, 6x, or 7x (i.e., daily) a week.
  • the intervals between each administration are less than about any of 6 months, 3 months, 1 month, 20 days, 15, days, 14 days, 13 days, 12 days, 11 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days, or 1 day. In some embodiments, the intervals between each administration are more than about any of 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, or 12 months. In some embodiments, there is no break in the dosing schedule. In some embodiments, the interval between each administration is no more than about a week.
  • the amount of the peptide construct and/or conjugate administered to an individual in need thereof can be determined by various factors, such as the type of cancer, the biological and/or physiological response from the individual receiving the peptide therapeutic and other factors known to one of skill in the art. As such, the amount of the peptide construct and/or conjugate to be administered can be adjusted accordingly to achieve the desired beneficial effects. In one aspect, the amount of the peptide construct and/or conjugate to be used is at least about 1 ⁇ g peptide construct and/or conjugate/kg of the individual.
  • the amount of the peptide construct and/or conjugate to be used is at least about 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g kg, 27 ⁇ g/kg, 28 ⁇ g/kg, 29 ⁇ g/kg, or 30 ⁇ g/kg.
  • the amount of the peptide construct and/or conjugate to be used is at least about 35 ⁇ g kg, 40 ⁇ g/kg, 45 ⁇ g/kg, 50 ⁇ g/kg, 55 ⁇ g/kg, 60 ⁇ g/kg, 65 ⁇ g kg, 70 ⁇ g/kg, 75 ⁇ g/kg, 80 ⁇ g kg, 85 ⁇ g/kg, 90 ⁇ g/kg, 95 ⁇ g kg or 100 ⁇ g/kg.
  • the amount of the peptide construct and/or conjugate to be used is about 1 ⁇ g kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg,
  • the amount of the conjugate to be used is at most about 1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg, 28 ⁇ g/kg, 29 ⁇ g/kg, 30 ⁇ g/kg, 35 ⁇ g/kg, 40 ⁇ g/kg, 45 ⁇ g/kg, 50 ⁇ g/kg, 35 ⁇
  • the invention provides for a dosage of range of any of the values given above.
  • the lower limit of the dosage range can be about 1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg,
  • Exemplary dosing frequencies for the administration of the peptide constructs include, but are not limited to, daily, every two days, every three days, every four days, every five days, every six days, weekly without break, weekly for three out of four weeks, once every three weeks, once every two weeks, or two out of three weeks.
  • the composition is administered about once every 2 weeks, once every 3 weeks, once every 4 weeks, once every 6 weeks, or once every 8 weeks.
  • the composition is administered at least about any of lx, 2x, 3x, 4x, 5x, 6x, or 7x (i.e., daily) a week.
  • the intervals between each administration are less than about any of 6 months, 3 months, 1 month, 20 days, 15, days, 14 days, 13 days, 12 days, 11 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days, or 1 day. In some embodiments, the intervals between each administration are more than about any of 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, or 12 months. In some embodiments, there is no break in the dosing schedule. In some embodiments, the interval between each administration is no more than about a week.
  • the dosing frequency is once every two days for one time, two times, three times, four times, five times, six times, seven times, eight times, nine times, ten times, and eleven times. In some embodiments, the dosing frequency is once every two days for five times.
  • the administration of the composition can be extended over an extended period of time, such as from about a month up to about seven years. In some embodiments, the composition is administered over a period of at least about any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 18, 24, 30, 36, 48, 60, 72, or 84 months.
  • the dosing frequency of the composition may be adjusted over the course of the treatment based on the judgment of the administering physician.
  • the present application in some embodiments provides a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
  • the peptide construct is a fusion peptide.
  • the inhibitory peptide comprises PX1X 2 X 3 X 4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X 2 is a residue that preserves hydrogen bonding with CtBP, X 3 is a hydrophobic residue, and X 4 is a residue that preserves hydrogen bonding with CtBP.
  • the inhibitory peptide comprises PX1X 2 X 3 X 4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X 2 is D or N, X 3 is L or I, and X 4 is S, C, T, V or A.
  • the inhibitory peptide comprises PXiDLS (SEQ ID NO:2).
  • the inhibitory peptide comprises PXiDLSX 2 K (SEQ ID NO:6).
  • inhibitory peptide comprises SEQ ID NO: l.
  • inhibitory peptide comprises SEQ ID NO: 132.
  • inhibitory peptide comprises SEQ ID NO: 133.
  • inhibitory peptide comprises SEQ ID NO: 134.
  • the binding affinity of the inhibitory peptide to CtBP is the same or higher than that of SEQ ID NO:l.
  • the inhibitory peptide comprises no more than about 25 amino acids.
  • the inhibitory peptide comprises no more than about 15 amino acids.
  • the peptide construct comprises SEQ ID NO: 127.
  • the peptide construct comprises SEQ ID NO: 137.
  • the peptide construct is modified for conjugation to a carrier molecule.
  • the cell penetrating peptide is an amphipathic peptide or anionic peptide.
  • the cell penetrating peptide is a cationic peptide.
  • the cell penetrating peptide is selected from the group consisting of Tat, pAntp, Arg9, plsl, and Pepl.
  • the cell penetrating peptide is directly fused to the inhibitory peptide.
  • the cell penetrating peptide is fused to the inhibitory peptide via a peptide linker.
  • the cell penetrating peptide is fused to the N-terminus of the inhibitory peptide.
  • the cell penetrating peptide is fused to the C-terminus of the inhibitory peptide.
  • the present application in some embodiments provides a pharmaceutical composition comprising a peptide construct described above.
  • the present application in some embodiments provides a conjugate comprising a peptide construct described above and a carrier molecule.
  • the carrier molecule is PEG.
  • the present application in some embodiments provides a pharmaceutical composition comprising a conjugate described above.
  • the present application in some embodiments provides a method of inhibiting cell proliferation in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
  • the present application in some embodiments provides a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
  • the cancer is cancer having a p53 mutation.
  • the present application in some embodiments provides a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
  • an inflammatory disease such as psoriasis
  • the present application in some embodiments provides a method of inhibiting inflammation in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
  • the present application in some embodiments provides a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
  • psoriasis such as psoriasis volgaris
  • the pharmaceutical composition is administered intravenously, intratumorally, subcutaneously, orally, and topically.
  • the ability of peptides to inhibit CtBP binding can be monitored by two biochemical assays.
  • An AlphaScreen assay (Perkin-Elmer) was developed that is capable of detecting the CtBP-ElA interaction.
  • Purified GST-E1A and 6xHis-CtBP are incubated with glutathione-conjugated donor beads and nickel-chelated acceptor beads respectively.
  • the interaction between CtBP and E1A brings the donor and acceptor beads in close proximity, which produces a fluorescence signal after laser excitation and can be detected using the En Vision plate reader.
  • a peptide that inhibits this interaction will limit the proximity of the beads and thus a loss in fluorescence signal will occur.
  • EPGQPLDLSCKRPR fluorescence polarization based assay with a fluorescein-labeled 14mer E1A peptide
  • Purified 6xHis-CtBP is incubated with the fluorescein-labeled E1A peptide and changes in the polarization value of the labeled peptide are detected using the En Vision plate reader.
  • a decrease in peptide binding to CtBP can be detected by an increase in polarization, and used to monitor peptide inhibition.
  • IC50 values of designed peptides can be determined using either of these assays through the addition of increasing amounts in each well and monitoring the degree of inhibition of the CtBP-ElA interaction.
  • mRNA libraries were constructed following the Illumina RNA-seq protocol and sequenced on a GAIIx at the UC Denver Sequencing Facility.
  • the differentially expressed genes were used for pathway enrichment analysis using NIH-DAVID and the KEGG pathway definitions (Huang da et al., 2009; Kanehisa et al., 2010).
  • CtBP is overexpressed in multiple human cancers, starting at the hyperplasia stage.
  • CtBP is an important regulator of embryonic development and its expression level is low or undetectable in many adult tissues (Furusawa et al., 1999; Deng et al., 2010; Hildebrand and Soriano, 2002).
  • Figure 1 shows that CtBP is re-expressed in a number of cancers, including lung and breast cancers. In invasive ductal breast cancer, positive nuclear CtBP staining was found in 92% of cases. In contrast, only 4% of normal breast tissue stained positive for CtBP (Deng et al., 2011).
  • FIGS 1 A-C show that similar upregulation of CtBP was found in HNSCC (Head and Neck Squamous Cell Carcinoma), starting at the hyperplasia stage.
  • CtBP expression in human cancers transcriptionally represses the well-known tumor suppressors Brcal and E-cadherin (Deng et al., 2011 ; Deng et al., 2010), consistent with the metastatic characteristics initially identified for CtBP (Boyd et al., 1993).
  • Brcal and E-cadherin Brcal and E-cadherin
  • H1299 cells harboring the CtBP siRNA-expressing construct were inoculated to SCID mice subcutaneously. Briefly, lxlO 6 cells in 0.1 mL DMEM were injected in the left hind flanks of 6-month-old female CB 17SC- RFM SCID mice. The mice were randomly divided into two groups of 10 mice per group. The treatment group received Doxylcycline (1 mg/mL in drinking water) right after tumor inoculation, whereas the control group received no treatment. Tumor diameters were measured every 5 days and tumors were weighed after necropsy.
  • Figures 2B and 2C show that whereas sizable tumors developed in the control group, Doxylcycline-induced siRNA to CtBP dramatically reduced the tumor growth of HI 299 xenografts. This data further supports inhibition of CtBP as a therapeutic approach for cancer therapy.
  • Example 3 Cell Penetrating Peptide (CPP)-EIA Functions as a CtBP Blocker
  • the peptides Tat-El A-flag (SEQ ID NO: 110) and Pepl-El A-flag (SEQ ID NO: 113) were expressed and purified from E. coli.
  • the purified Tat-El A-flag peptide inhibited the CtBP/ElA interaction with an IC50 of -7.7 ⁇ , as shown in Figure 3.
  • H1299 cells were incubated with the Pepl-El A-flag peptide (i.e. , CPP-E1 A-flag peptide), the cells were separated into cytoplasmic and nuclear fractions, and the presence of the CPP-ElA-flag peptide was probed using an anti-flag antibody in a Western blot.
  • Figure 4 shows an example of the Western blot of Pepl-El A-flag treated cells, demonstrating that the CPP-E1 A-flag peptide enters both the cytoplasm and the nucleus.
  • Tat-EIA reduces the viability of A375 and H1299 cells but does not affect 3T3 cells.
  • the Tat peptide alone has no effect on these cells.
  • a short peptide (14 residues) with a desired random sequence is cloned into an M13KE gene III cloning vector of the Ph.D.TM Phage Display System (New England Biolabs).
  • This cloning vector is a modified phage (M13) that can be propagated in bacteria to obtain a starting phage library with peptides displayed at the N-termini of gene II coat protein on phage surfaces.
  • Purified CtBP is biotinylated following New England Biolab's standard biotinylation procedure, and immobilized onto petri dishes coated with streptavidin. The resulting phage library is incubated with CtBP and phages that do not bind are washed away.
  • Phages that bind CtBP are eluted, propagated, and subjected to one or more rounds of selection (i.e., another 3-5 rounds of selection). After the final round of selection, the gene encoding the peptide is sequenced to obtain the sequence of the peptide that binds tightly.
  • Example 6 Use of mRNA display technology to identify cell-penetrating peptides specific to cancer
  • a DNA library encoding random peptides is in vitro transcribed and linked to puromycin through a DNA linker, which enables the generation of an mRNA-puromycin- peptide fusion upon in vitro translation.
  • This mRNA-peptide fusion is incubated with specific cell lines (e.g., non-small cell lung cancer cell lineH1299, breast cancer cell line MCf 7, melanoma cell line A375, colon cancer cell line HT-29, or others), extensively washed, and cell-penetrating peptides are recovered through RT-PCR and sequencing of the mRNAs. Rounds of selection generate cell penetrating peptides that enter cells with high efficiency. Cell-penetrating peptides are screened as described in Kondo et al. (2012) Nat Commun. 3: 951.
  • Example 7 Peptide Assay for IC50 binding
  • the ability of peptides to inhibit CtBP binding can be monitored by two biochemical assays.
  • An AlphaScreen assay (Perkin-Elmer) was developed that is capable of detecting the CtBP-ElA interaction.
  • Purified GST-EIA and 6xHis-CtBP are incubated with glutathione-conjugated donor beads and nickel-chelated acceptor beads respectively.
  • the interaction between CtBP and EIA brings the donor and acceptor beads in close proximity, which produces a fluorescence signal after laser excitation and can be detected using the En Vision plate reader.
  • a peptide that inhibits this interaction will limit the proximity of the beads and thus a loss in fluorescence signal will occur.
  • a fluorescence polarization based assay with a fluorescein-labeled 14mer EIA peptide (EPGQPLDLSCKRPR) was also developed.
  • Purified 6xHis-CtBP is incubated with the fluorescein-labeled EIA peptide and changes in the polarization value of the labeled peptide are detected using the En Vision plate reader.
  • a decrease in peptide binding to CtBP can be detected by an increase in polarization, and used to monitor peptide inhibition.
  • IC50 values of designed peptides can be determined using either of these assays through the addition of increasing amounts in each well and monitoring the degree of inhibition of the CtBP-ElA interaction.
  • the peptides used in the assay described herein are provided in Table 4. Also provided in Table 4 are IC50 for selected peptides.
  • the fluorescence polarization values of the FITC -peptide were measured and plotted against CtBP concentration to determine Kd of the FITC -peptide with CtBP using the Prism program.
  • the peptide EQTVPVDLSVARPR (SEQ ID NO: 133) demonstrated an improved Kd of 2.2 ⁇ as compared to the peptide EPGQPLDLSCKRPR (SEQ ID NO:l) which had a Kd of 4.3 ⁇ (Table 5).
  • a fluorescence polarization assay was utilized. A FITC-labeled 14mer peptide was incubated with CtBP which produced relatively high fluorescence polarization values.
  • the peptide EPGQPLSLSCKRPR (SEQ ID NO: 135) did not inhibit CtBP even though it only differed from the peptide EPGQPLDLSCKRPR (SEQ ID NO: 1) at one residue in the middle of the recognition motif.
  • the peptide PTDEPLNLSLKRPR (SEQ ID NO: 134) demonstrated an improved IC50 of 4.4 ⁇ as compared to the peptide
  • EPGQPLDLSCKRPR (SEQ ID NO:l) which had an IC50 of 6.0 ⁇ (Table 5).
  • mRNA libraries were constructed following the Illumina RNA-seq protocol and sequenced on a GAIIx at the UC Denver Sequencing Facility.
  • the differentially expressed genes were used for pathway enrichment analysis using NIH- DAVID and the KEGG pathway definitions (Huang da et al., 2009; Kanehisa et al., 2010).
  • mice were generated with the B6D2 strain by microinjection of the transgene into the pronuclei of mouse embryos. Mice were genotyped by PCR analysis of tail DNA utilizing primers specific for BK5 (tctgataggcagcctgcacc) and CtBPl (atcccagctgctgtggaagg). Throughout this study, all transgenic mice were heterozygous; all wild type mice were littermates, and at least three independent analyses were performed for each assay, using three to five samples in each group.
  • Immunofluorescence and immunohistochemistry were performed on frozen and paraffin- embedded sections as previously described (Wang et al., 1999). Immunofluorescence was performed using antibodies against CD45, CD4, CD31 (BD Biosciences); Ly-6G (eBioscience); F4/80 (Caltag Laboratories); ALK1 (R&D Systems); pSmad2 (Cell
  • the antibodies used in immunohistochemistry included CtBPl (Millipore), and TGF- ⁇ (R&D Systems). Biotinylated secondary antibodies were used in conjunction with an avidin-peroxidase reagent (VECTASTAIN ® ) and visualized using diaminobenzidine (Sigma). qRT-PCR
  • PEI F25-LMW polyethylenimines, F25 low molecular weight, Sigma
  • PEI F25-LMW polyethylenimines, F25 low molecular weight, Sigma
  • Fadu a human HNSCC line
  • DMEM fetal calf serum
  • ChIP Chromatin immunoprecipitation
  • Fadu cells were used for ChIP assay with an anti-CtBPl antibody and normal rabbit IgG as described previously (Zhang et al., 2006). Sequential ChlPs were carried out using an anti-CtBPl antibody following the first ChIP with an anti-c-Jun antibody (Abeam) or an anti-Spl antibody (Santa Cruz) (Deng et al., 2010; Hoot et al., 2010). Primer sets spanning the TGF- ⁇ promoter were used to q-PCR-amplify the ChIP sample.
  • TGF- ⁇ promoter luciferase reporter plasmid was generated by cloning a PCR-amplified 633 bp fragment of the TGF- ⁇ promoter into the Kpnl and Bglll sites of pGL4.26 vector (Promega).
  • TGF- ⁇ promoter-specific primers used were 5'-ggggtaccACCTTGTTTCC-3' (forward, -strand) and 5'- gaagatctCTCCTCCCCGC-3' (reverse, + strand).
  • Site-directed mutagenesis was performed to generate the mutation at the distal AP-1 site (mtl:
  • TGACTCT to TGgtTCT
  • proximal AP-1 site mt2: TGTCTCA to gtTCTCA
  • SP1 site mt3: GCCCGCC to GCCtaCC
  • An empty renilla luciferase vector pGL4.79 was used for normalization. Fadu cells were co-transfected with the reporters and siRNA to CtBPl for 48 hr and luciferase activity was measured (Zhang et al., 2002). Scrambled siRNA or empty plasmid was used for controls.
  • the AP-1 sites and Spl site were individually mutated. As shown in Figure 10B, the mutation at the proximal AP-1 site or the Spl site did not affect the TGF- ⁇ promoter-driven luciferase reporter activity, but the mutation in the distal AP-1 site attenuated the TGF- ⁇ promoter-driven luciferase reporter activity.
  • Figure 1 0B show s that the expression level of the TGF- ⁇ promoter-driven lucif erase reporter with the mutated distal AP-1 site is similar to the expression level of the wild type promoter-driven luciferase reporter with the CtBPl knockdown in Fadu cells, suggesting that CtBPl regulates TGF- ⁇ through the distal AP-1 site.
  • chromatin immunoprecipitation was performed to see if CtBPl is recruited to the TGF- ⁇ promoter.
  • immunoprecipitation of the cross-linked chromatin with the antibody specific for CtBPl revealed that CtBPl bound the TGF- ⁇ promoter in Fadu cells.
  • sequential ChIP using an anti-c-Jun antibody and then an anti-CtBPl antibody revealed that CtBPl binds to the TGF- ⁇ promoter through c-Jun ( Figure IOC, bottom panel). This finding supports participation of the AP-1 site in CtBPl -mediated activation.
  • the middle panel of Figure IOC shows that no CtBPl binding to the TGF- ⁇ promoter via Spl was observed using sequential ChIP with an anti-Spl antibody, followed by an anti-CtBPl antibody.
  • Example 9 CtBPl Overexpression Causes Inflammation and Increases Angiogenesis Associated with Enhanced TGF- ⁇ Signaling
  • K5. CtBPl transgenic mice were generated by inserting human CtBPl cDNA (99% amino acid homology to mouse CtBPl protein) into a K5 vector (He et al., 2002). When CtBPl transgene expression levels were 3- fold higher than endogenous CtBPl levels in skin (Figure 12B), K5.QBP1 mice displayed an inflammatory phenotype ( Figure 11 A).
  • TGF- ⁇ mRNA was foun d to b e up- regulated by the CtBPl transgene in mouse skin, as shown in Figure 11B. Histopathology shows that K5. CtBPl skin contains numerous infiltrated leukocytes and increased vessel numbers (data not shown). Therefore, tissue sections were stained with CD45 antibody, confirming the presence of leukocytes in transgenic epidermis and dermis but very few in wild type skin (Figure 11C). To further identify infiltrating leukocyte subtypes in CtBPl- transgenic skin, antibodies specific for leukocyte subtype markers were used.
  • K5.QBP1- transgenic epidermis and dermis contained Ly-6G positive granulocytes, as shown in Figure l lC. Staining with an F4/80 antibody showed that K5. CtBPl dermis contained macrophages and CD4 + T cells were present in K5.QBP1 dermis ( Figure 11C). [0320] K5.QBP1 transgenic skin also exhibited increased angiogenesis, confirmed by immunofluorescence staining with the endothelial marker CD31, as shown in Figure 11D.
  • Example 10 CtBPl is Overexpressed in Psoriasis Lesions and the Inflammatory Phase of Wound Healing in Mouse Skin
  • CtBPl transactivates TGF- ⁇ in vivo, CtBPl would be expected to be elevated in parallel with TGF- ⁇ overexpression under some pathological conditions. It has been shown that TGF- ⁇ is overexpressed in human psoriasis (Flisiak et al., 2008; Nockowski et al., 2004). Skin biopsies from healthy volunteers and psoriasis patients were examined. All 10 psoriasis samples displayed uniform nuclear CtBPl staining in the epidermis, as shown in Figure 12A. Cells with CtBPl positive nuclei were also detected in infiltrated leukocytes between rete ridges.
  • TGF- ⁇ Signaling is responsible for Inflammation and Angiogenesis in K5.CtBPl Skin
  • K5.QBP1 skin displayed increased TGF- ⁇ Signaling.
  • the top panel of Figure 13 shows that the TGF- ⁇ protein was barely detectable in wild type skin, but increased in both the epidermis and stroma of K5.QBP1 skin.
  • TGF- ⁇ activation is required for inflammation and angiogenesis in K5.
  • CtBPl skin in vivo knockdown of TGF- ⁇ by delivery of TGF- ⁇ siRNA to CtBPl transgenic skin was performed.
  • the biodegradable polymer PEI F25-LMW polyethylenimines, F25 low molecular weight, Sigma
  • PEI F25-LMW polyethylenimines, F25 low molecular weight, Sigma
  • Figure 14A shows that inflammation, as shown by CD45 staining, was consequently significantly decreased by TGF- ⁇ siRNA-treatment in K5. CtBPl skin. In addition, CD31 + vessels ( Figure 14B) and ALKl-positive vessels ( Figure 14C) were decreased. These data suggest that TGF- ⁇ up-regulation is the key mediator of CtBPl 's effect on inflammation and angiogenesis.
  • Example 12 Treatment of Psoriasis by Interfering with the Interaction between E1A and CtBP
  • the Tat- E1A peptide was evaluated in an IMQ-based psoriasis model and the efficacy of the Tat-EIA peptide (GRKKRRQRRRPPQGGEQTVPVDLSVARPRGL; SEQ ID NO: 137) conjugated to FITC was compared to a Pep 1 -El A peptide
  • Tat-EIA peptide treatment significantly reduced the psoriasis-like phenotype when the Tat-EIA peptide was subcutaneously applied on the skin (Figure 15B).
  • the PBS treated control group ( Figure 15, diamond) displayed inflamed scaly skin lesions resembling plaque type psoriasis following IMQ-induction.
  • Mice treated with either the Pep-El A peptide ( Figure 15B, square) or the Tat-EIA peptide ( Figure 15B, triangle) showed resistance to IMQ-induction of psoriasis.

Abstract

The invention provides a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. The invention also provides related pharmaceutical composition comprising such a peptide construct. Also provided is a conjugate comprising such a peptide construct and a carrier molecule. The invention also provides related pharmaceutical compositions. Also provided are related methods of inhibiting cell proliferation in an individual and methods of treating cancer in by such pharmaceutical compositions. The present application also provides methods of treating an inflammatory disease and inhibiting inflammation in an individual comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP.

Description

METHODS AND COMPOSITIONS FOR TREATING CANCER AND
INFLAMMATORY DISEASES
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the priority benefit to U.S. Provisional Patent Application Serial No. 61/780,889, filed March 13, 2013, and U.S. Provisional Patent Application Serial No. 61/780,901, filed March 13, 2013, the entire content of each of which is incorporated herein by reference.
FIELD OF THE INVENTION
[0002] The present invention relates to peptide constructs effective for inhibiting C- terminal Binding Protein (CtBP) activity, to pharmaceutical formulations of these peptide conjugates, to processes for their preparation, and to methods for their use in the treatment of proliferative diseases. The present invention also relates to therapeutic agents effective for inhibiting C-terminal Binding Protein (CtBP) activity, and methods for their use in the treatment of inflammatory diseases.
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR
DEVELOPMENT
[0003] This invention was made with Government support awarded by the National Institutes of Health under grant (contract) number CA115468.
BACKGROUND OF THE INVENTION
[0004] Carboxyl-terminal binding protein (CtBP) was originally identified based on its ability to bind the carboxyl terminus of the EIA oncoprotein (Boyd et al., 1993; Schaeper et al., 1995). Subsequently, CtBP was found to be a transcriptional co-repressor interacting with DNA-binding transcription factors (Chinnadurai, 2002). Unlike most transcription factors with consensus DNA binding sites, CtBP indirectly binds DNA via various DNA binding partners at multiple DNA sequences, thus its transcriptional repression is context- specific. CtBP has remarkable amino acid homology with NADH-dependent
dehydrogenases. Cancer cells typically have more NADH due to both hypoxia and pseudo- hypoxia (NADH production when oxygen concentration is not limited) (Sattler et al., 2007; Yeng et al., 2008; Zhang et al., 2007). The inventors have found NADH binds to CtBP with high affinity (Kd - 100 nM), which, without being tied to any particular theory, presumably causes a conformational change in CtBP that favors its binding to transcriptional factors (e.g., transcriptional repressors) (Zhang et al., 2002). The inventors have elucidated the major pathways controlled by CtBP in cancer cells and found CtBP directly represses epithelial genes and pro-apoptotic genes independently of p53, thus increasing cancer cell survival and migration.
[0005] CtBP interacts with E1A and many of its transcriptional factor partners through a conserved sequence motif, Pro-X-Asp-Leu-Ser (PXDLS) (Schaeper et al., 1995). A 14mer E1A peptide (SEQ ID NO: 1) inhibited the CtBP/ElA interaction in vitro with an IC50 of approximately 7 μΜ (Zhang et al. 2000).
[0006] All references cited herein, including patent applications and publications, are incorporated by reference in their entirety.
SUMMARY OF THE INVENTION
[0007] In one aspect, the present invention provides a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP. In certain embodiments, the peptide construct is a fusion peptide. In certain embodiments, the inhibitory peptide comprises PXiDLS (SEQ ID NO:2). In certain embodiments, the inhibitory peptide comprises PX1DLSX2K (SEQ ID NO:6). In certain embodiments, the inhibitory peptide comprises SEQ ID NO: l. In certain embodiments, the binding affinity of the inhibitory peptide to CtBP is the same or higher than that of SEQ ID NO: l. In certain embodiments, the inhibitory peptide comprises the sequence
EQTVPVDLSVARPR (SEQ ID NO: 132). In certain embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In certain embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In certain embodiments, the inhibitory peptide comprises no more than about 25 amino acids. In certain embodiments, the inhibitory peptide comprises no more than about 15 amino acids. In certain embodiments, the peptide construct is modified for conjugation to a carrier molecule. In certain embodiments, the cell penetrating peptide is an amphipathic peptide or anionic peptide. In certain embodiments, the cell penetrating peptide is a cationic peptide. In certain embodiments, the cell penetrating peptide is selected from the group consisting of Tat, pAntp, Arg9, plsl, and Pepl. In certain embodiments, the cell penetrating peptide is directly fused to the inhibitory peptide. In certain embodiments, the cell penetrating peptide is fused to the inhibitory peptide via a peptide linker. In certain embodiments, the cell penetrating peptide is fused to the N-terminus of the inhibitory peptide.
[0008] In a related aspect, the invention also provides a pharmaceutical composition comprising a peptide described herein. The invention also provides a conjugate comprising the peptide construct described herein and a carrier molecule. In certain embodiments, the carrier molecule is PEG.
[0009] The invention also provides a pharmaceutical composition comprising a conjugate described above.
[0010] In a related aspect, the invention provides a method of inhibiting cell proliferation in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described herein. The invention also provides a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described herein. In certain embodiments, the cancer is cancer having a p53 mutation. In certain embodiments, the pharmaceutical composition is administered intravenously, intratumorally, subcutaneously, orally, and topically.
[0011] The present invention in some embodiments provides a method of treating an inflammatory disease in an individual, comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between EIA and CtBP. The therapeutic agent may or may not further comprise a cell penetrating peptide such as any of the cell penetrating peptides described herein.
[0012] The present invention in some embodiments provides a method of inhibiting inflammation in an individual having an inflammatory disease, comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between EIA and CtBP. The therapeutic agent may or may not further comprise a cell penetrating peptide such as any of the cell penetrating peptides described herein.
[0013] In some embodiments according to (or as applied to) any of the embodiments above, the therapeutic agent is a peptide construct comprising a cell penetrating peptide and the inhibitory peptide.
[0014] In some embodiments according to (or as applied to) any of the embodiments above, the peptide construct is a fusion peptide. [0015] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is an amphipathic peptide or anionic peptide.
[0016] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is a cationic peptide.
[0017] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is selected from the group consisting of Tat, pAntp, Arg9, plsl, and Pepl.
[0018] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is directly fused to the inhibitory peptide.
[0019] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is fused to the inhibitory peptide via a peptide linker.
[0020] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is fused to the N-terminus of the inhibitory peptide.
[0021] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is fused to the C-terminus of the inhibitory peptide.
[0022] In some embodiments according to (or as applied to) any of the embodiments above, the therapeutic agent comprises an inhibitory peptide not linked to a cell penetration peptide.
[0023] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
[0024] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprise P XiDLSX2K (SEQ ID NO:6), wherein Xi and X2 are any amino acids.
[0025] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises EPGQPLDLSCKRPR (SEQ ID NO: l).
[0026] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises EQTVPVDLSVARPR (SEQ ID NO:132).
[0027] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises GGDGPLDLCCRKRP (SEQ ID NO:133).
[0028] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises PTDEPLNLSLKRPR (SEQ ID NO: 134). [0029] In some embodiments according to (or as applied to) any of the embodiments above, the binding affinity of the inhibitory peptide to CtBP is the same or higher than that of EPGQPLDLSCKRPR (SEQ ID NO:l).
[0030] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises no more than about 25 amino acids.
[0031] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises no more than about 15 amino acids.
[0032] In some embodiments according to (or as applied to) any of the embodiments above, the therapeutic agent is administered intravenously, intratumorally, subcutaneously, orally, and topically.
[0033] In some embodiments according to (or as applied to) any of the embodiments above, the inflammatory diseases is selected from the group consisting of psoriasis, mucositis, chronic wound, and trauma.
[0034] In some embodiments, the therapeutic agent has one or more biological activities in an individual selected from the group consisting of: reducing cancer cell proliferation, reducing EMT(epithelial-mesenchymal transition), increasing cancer cell apoptosis, reducing or eliminating TGF-β signaling, reducing or eliminating NF-κΒ signaling, reducing radiation- induced DNA damage, reducing inflammation, reducing angiogenesis, promoting healing in oral mucositis, promoting wound healing, and treating autoimmune disease when administered to an individual.
[0035] In some embodiments, a method provided herein for treating or preventing an inflammatory condition in an individual comprises administering to the individual a therapeutically effective amount of the pharmaceutical composition described herein. In some embodiments, the inflammatory condition may be one or more of a chronic wound, skin inflammation, psoriasis, or an autoimmune disease. In some embodiments, the composition may reduce inflammation through inhibition of TGF-β signaling and/or NF-κΒ signaling.
[0036] In some embodiments, a method provided herein for preventing or treating a disease or disorder in an individual comprises administering to the individual an effective amount of therapeutic agent described herein or a composition thereof. In some embodiments of the method described herein, the therapeutic agent increases cancer cell apoptosis, reduces cancer cell proliferation, reduces EMT, reduces or eliminates TGF-β signaling, reduces or eliminates NF-κΒ signaling, reduces radiation-induced DNA damage, reduces inflammation, and/or reduces angiogenesis in the individual. In some embodiments, the disease or disorder may include one or more of psoriasis, a chronic wound, an acute wound, or mucositis. In some embodiments, the chronic wound may include one or more of diabetic ulcers, pressure ulcers, venous ulcers, or oral ulcers. In some embodiments, the acute wound may include one or more of trauma-induced wounds, surgical wounds, or scarring. In some embodiments, the mucositis may include one or more of radiation-induced mucositis, chemotherapy-induced mucositis, oral mucositis, or gut mucositis.
BRIEF DESCRIPTION OF THE FIGURES
[0037] Figure 1A-G shows CtBP expression in human carcinomas. FIG. 1A-C) CtBP expression in hyperplasic and frankly malignant human head and neck squamous cell carcinoma is depicted in A - C. The dotted line indicates the epithelial/stromal junction; the scale bar is 20 μιη. FIG. 1D-G) CtBP expression is shown in human poorly differentiated colon adenocarcinoma (D), moderately differentiated lung adenocarcinoma (E), ductal invasive breast carcinoma (F), and renal cell carcinoma (G).
[0038] Figure 2A-C shows the effect of CtBP knockdown on tumor growth. FIG. 2A) Western blot analysis of CtBP in HI 299 cells containing a tet- inducible siRNA-CtBP with or without Doxylcycline treatment for 3 days. FIG. 2B) Graph showing tumor growth of xenografts of HI 299 cells containing a tet-inducible siRNA-CtBP with or without
Doxylcycline treatment in SCID mice at the 8-week time point. FIG. 2C) Representative image of the tumor xenografts from the untreated (-) and Doxylcycline treated (+) mice.
[0039] Figure 3 shows a graph indicating that the Tat-ElA-flag peptide inhibits the CtBP/ElA interaction with an IC50 of 7.7 μΜ.
[0040] Figure 4 shows a Western blot analysis of Pepl-El A-flag treated cells revealing that Pepl-El A-flag protein can enter the cytoplasm and the nucleus of H1299 cells. The same membrane was probed for a-tubulin, which is mainly localized in the cytoplasm.
[0041] Figure 5 shows a series of graphs revealing that the Tat-EIA peptide reduces the viability of CtBP overexpressing cancer cells A375 and H1299, but does not affect normal fibroblast 3T3 cells. Tat alone has no effect on these cells.
[0042] Figure 6 shows a graph indicating that the Tat-EIA peptide relieves the suppression of CtBP target genes in H1299 cells.
[0043] Figure 7A-B shows the effect of Pepl-El A on an IMQ-based psoriasis model. FIG. 7A) H&E staining showing Pepl-EIA decreases the IMQ-induced epithelial hyperplasia and inflammatory cell infiltration in the stroma (bottom) compared to the PBS- treated skin (top). The scale bar is 100 μιη. FIG. 7B) Immunostaining showing decreased BrdU (left panels) and CD45 (right panels) after Pep 1 -El A treatment. Sections were counterstained with K14.
[0044] Figure 8 shows a graph revealing that CtBPl knockdown downregulates the TGF- βΐ signaling pathway. Dark grey blocks represent the presence of CtBP target genes in the indicated pathways; components of the TGF-βΙ pathway are indicated with a bullet point.
[0045] Figure 9 shows the control protein E1A 243R [Human adenovirus C] NCBI Reference Sequence: NP_040508.1. Amino acid sequence is SEQ ID NO: 136.
[0046] Figure lOA-C shows transcriptional activation of TGF-βΙ by CtBPl. FIG. 10A) Graph showing that CtBPl knockdown downregulates the TGF-βΙ signaling pathway. FIG. 10B) Graph showing that CtBPl regulates TGF-βΙ via the distal AP-1 site at the TGF-βΙ promoter. FIG. IOC) ChIP analysis showing that CtBPl is recruited by c-Jun to the promoter of TGF-βΙ. Top panel shows the single ChIP assay using control IgG (IgG) or an anti-CtBPl (CtBPl) antibody. Middle panel shows the single ChIP using an anti-Spl antibody (Spl) and the sequential ChIP using an anti-CtBPl antibody following the first ChIP with an anti-Spl antibody (Spl/CtBPl). Bottom panel shows the single ChIP using an anti-c-Jun antibody (c-Jun) and the sequential ChIP using an anti-CtBPl antibody following the first ChIP with an anti-c-Jun antibody (c-Jun/CtBPl).
[0047] Figure 11A-E shows increased inflammation and angiogenesis in K5.QBP1 transgenic skin. FIG. 11A) Generation of K5. CtBPl mice. FIG. 11B) Graph showing elevated TGF-βΙ mRNA in K5. CtBPl transgenic mice skin. FIG. 11C) Immunofluorescence imaging of leukocyte subtypes (counterstained with a K14 (red) antibody). FIG. 11D)
Immunofluorescence imaging of the endothelial marker CD31 (counterstained with a red K14 antibody). The scale bar is 80 μιη. FIG. HE) Immunofluorescence imaging of CD31 (green) and ALK1 (red). K5. CtBPl skin contained more ALK1 -positive vessels (yellow) compared to WT tissue.
[0048] Figure 12A-C shows pathogenesis associated with CtBPl overexpression. FIG. 12A) Immunohistochemistry pictures of CtBPl in psoriasis lesions (bottom) and normal human skin (top). Sections were counterstained with hematoxylin. FIG. 12B) Western blot analysis showing the expression of CtBPl in skins of nontransgenic mice (WT), K5. CtBPl expressors (Tg), and wounded nontransgenic skin (Wound). Tubulin was used as a loading control. FIG. 12C) Immunofluorescence imaging of CtBPl in wound (bottom) and non- wounded normal mouse skin (top). Sections were counterstained with K14. [0049] Figure 13 shows increased TGF-βΙ signaling in K5.QBP1 skin.
Immunohistochemistry imaging of TGF-βΙ (counterstained with hematoxylin) and immunofluorescence staining of phosphorylated Smad2 (counterstained with a red K14 antibody).
[0050] Figure 14A-C shows TGF-βΙ -mediated inflammation and angiogenesis in K5.QBP1 transgenic mice. Immunofluorescence images of CD45 (green, FIG. 14A), CD31 (green, FIG. 14B), and ALK1 (red, FIG. 14C). Sections in FIG. 14A and FIG. 14B were counterstained with a K14 (red) antibody. Sections in FIG. 14C were counterstained with a CD31 (green) antibody.
[0051] Figure 15A-B) shows treatment of psoriasis with a Pepl-EIA peptide and a Tat- EIA peptide. FIG. 15A) Purification of synthesized Tat-EIA and FIG. 15B) Reduction of erythema, thickening and scaling (cumulative score) with Pepl-EIA (squares) or Tat-EIA (triangles) treatment in a psoriasis model. PBS (diamonds) indicates treatment with phosphate buffered saline.
DETAILED DESCRIPTION
[0052] The present application in some aspects provides peptide constructs and uses thereof for treating cancer. The peptide constructs comprise a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP. It was shown that peptide constructs comprising a cell-penetrating peptide and an inhibitory peptide that disrupts CtBP interactions with EIA, i.e., a fusion peptide containing a cell penetration peptide (CPP) and a 14-amino acid peptide derived from EIA (Tat-EIA), can enter the cytoplasm and nuclei of target cancer cells, e.g., A375 melanoma cells or H1299 non-small cell lung cancer cells, and reduce their viability. It was also shown that peptide constructs comprising a cell-penetrating peptide and an inhibitory peptide that disrupts CtBP interactions with EIA, i.e., a fusion peptide containing a cell penetration peptide (CPP) and a 14-amino acid peptide derived from EIA (Pepl-EIA or Tat-EIA), reduces over-proliferation and inflammation in a mouse model of psoriasis. These peptide constructs are therefore particularly useful for inhibiting CtBP function in vivo and for treating diseases such as cancer.
[0053] Thus, the present application in one aspect provides peptide constructs comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP. [0054] In another aspect, there is provided a method of treating cancer in an individual, comprising administering to the individual an effective amount of a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
[0055] The present application also provides therapeutic agents and uses thereof for treating inflammatory diseases. The therapeutic agents comprises an inhibitory peptide that disrupts CtBP interaction with El A, and in some embodiments comprises a peptide constructs comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP.
[0056] This aspect of the present invention is based on the unexpected finding of transactivation of TGF-βΙ by CtBP and its functional impact on inflammation. Specifically, it was found that CtBP is a transcriptional activator of TGF-βΙ, and CtBPl overexpression in transgenic mice causes inflammation and increases angiogenesis associated with enhanced TGF-βΙ signaling. It was further found that CtBPl is overexpressed in human psoriasis lesions and in the inflammatory phase of wound healing, in addition to oral mucositis.
Furthermore, using a peptide construct comprising a cell-penetrating peptide and an inhibitory peptide that disrupts CtBP interactions with E1A, i.e., a fusion peptide containing a cell penetration peptide (CPP) and a 14- amino acid peptide derived from El A (Pep 1 -El A or Tat-EIA), it was further demonstrated that targeting CtBP reduces over-proliferation and inflammation in a mouse model of psoriasis. Thus, targeting CtBPl (either with or without the use of a cell penetrating peptide) can be useful as a therapeutic strategy against inflammatory diseases.
[0057] Thus, the present application in one aspect provides a method of treating an inflammatory disease comprising administering to the individual a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP. In some embodiments, the therapeutic agent is a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP.
[0058] In another aspect, there is provided a method of inhibiting inflammation in an individual having an inflammatory disease, comprising administering to the individual a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP. In some embodiments, the therapeutic agent is a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the therapeutic agent does not comprise a cell penetrating peptide.
[0059] Also provided are kits, unit doses, pharmaceutical compositions, and articles of manufacture comprising the peptide constructs that are suitable for uses in methods described herein.
Peptide Constructs and Conjugates
[0060] The present application in one aspect provides peptide constructs comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP. In some embodiments, the cell penetrating peptide is linked to the N-terminus of the inhibitory peptide via its C-terminus. In some embodiments, the cell penetrating peptide is linked to the C-terminus of the inhibitory peptide via its N-terminus.
[0061] The therapeutic agents useful for methods described herein in some embodiments comprises peptide constructs comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the cell penetrating peptide is linked to the N-terminus of the inhibitory peptide via its C-terminus. In some embodiments, the cell penetrating peptide is linked to the C-terminus of the inhibitory peptide via its N-terminus.
[0062] In some embodiments, the cell penetrating peptide and the inhibitory peptide are directly linked. In some embodiments, the cell penetrating peptide and the inhibitory peptide are linked via a linker. The linker that links the cell penetrating peptide and the inhibitory peptide can be of different nature, so long as it does not interfere with the functions and/or binding properties of the cell penetrating peptide and the inhibitory peptide. In some embodiments, the cell penetrating peptide and the inhibitory peptide are linked via a peptide linker. In some embodiments, the peptide linker is no more than about 20 amino acids (for example no more than about any of 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid long). In some embodiments, the peptide linker is no more than about 10 amino acids (for example, the peptide linker can be about any of 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid long). In some embodiments, the peptide linker is no more than about 5 amino acids (for example, about 2 amino acids). In some embodiments, the linker is a two-amino acid peptide linked having the sequence of LE (SEQ ID NO: 106).
[0063] In some embodiments, the cell penetrating peptide and the inhibitory peptide are linked via a non-peptide linker, e.g. a chemical coupling agent such gluter aldehyde. In some embodiments, the chemical coupling agent is a carbodiimide, e.g. EDC. In some embodiments, the chemical crosslinking agent is m-maleimidobenzoyl-n-hydroxysuccinimide ester or MBS. In some embodiments, heterobifunctional reagents that cross-link by a different coupling moiety on each protein can also be used. Other useful cross-linkers include, without limitation, reagents which link two amino groups (e.g. , N-5-azido-2- nitrobenzoyloxysuccinimide), two sulfhydryl groups (e.g. , 1 ,4-bis-maleimidobutane), an amino group and a sulfhydryl group (e.g. , m-maleimidobenzoyl-N-hydroxysuccinimide ester), an amino group and a carboxyl group (e.g. , 4-[pazidosalicylamido]butylamine), and an amino group and a guanidinium group that is present in the side chain of arginine (e.g. , p- azidophenyl glyoxal monohydrate.
[0064] In some embodiments, the cell penetration peptide is between about 5 to about 30 amino acids long, including for example about 10 to about 25 amino acids long. In some embodiments, the cell penetration peptide is no more than about 30 amino acids long (for example, no more than about any of 21 , 20, 19, 18, 17, 16, 15, 14, 13, 12, 11 , 10, 9, 8, 7, 6, 5, or 4 amino acids long).
[0065] In some embodiments, the inhibitory peptide is about 5 to about 70 amino acids long, including for example about 5 to about 10, about 10 to about 20, about 20 to about 30, about 30 to about 40, about 40 to about 50, about 50 to about 60, or about 60 to about70 amino acids long. In some embodiments, the inhibitory peptide is about 10 to about 20 amino acids long, such as about 14 amino acids long. In some embodiments, the inhibitory peptide is no more than about 30, no more than about 25, or more than about 20, no more than about 15, or no more than about 10 amino acids long.
[0066] In some embodiments, the peptide construct is a fusion peptide. In some embodiments, the fusion peptide is about 10 to about 100 amino acids long, including for example about 10 to about 20, about 20 to about 30, about 30 to about 40, about 40 to about 50, about 50 to about 60, about 60 to about70 amino acids long, about 70 to about 80, about 80 to about 90, or about 90 to about 100 amino acids long. In some embodiments, the inhibitory peptide is no more than about 50, no more than about 40, no more than about 30, no more than about 25, no more than about 20 amino acids, or no more than about 15 amino acids long.
[0067] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide has an IC50 that is no more than the IC50 of the EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide competitively inhibits the binding of EPGQPLDLSCKRPR (SEQ ID NO: l) to CtBP. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0068] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids). [0069] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0070] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N4PX1X2X3X4 (SEQ ID NO: 138), wherein N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N4PXiX2X3X (SEQ ID NO: 139), wherein N4 is Q, V, E or G, and wherein X! is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids). [0071] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PX1X2X3X4 (SEQ ID NO: 140), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence Ν3Ν4ΡΧιΧ2Χ3Χ ΐ (SEQ ID NO:141), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0072] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N PXiX2X3X4 (SEQ ID NO:142), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PXiX2X3X4 (SEQ ID NO:143), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0073] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4 (SEQ ID NO: 144), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4 (SEQ ID NO:145), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0074] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1 (SEQ ID NO: 146), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X4Ci (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0075] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X4CiC2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1X2X3X^^2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0076] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X4CiC2C3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3 (SEQ ID NO:151), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0077] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X4CiC2C3C4 (SEQ ID NO:152), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X CiC2C3C4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0078] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4C5 (SEQ ID NO:154), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0079] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N4PX1X2X3X4C1 (SEQ ID NO: 156), wherein N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N4PX1X2X3X4C1 (SEQ ID NO: 157), wherein N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0080] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PX1X2X3X4C1C2 (SEQ ID NO:158), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PXiX2X3X4CiC2 (SEQ ID NO:159), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0081] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PXiX2X3X4CiC2C3 (SEQ ID NO:160), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PXiX2X3X4CiC2C3 (SEQ ID NO:161), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0082] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence
NiN2N3N4PXiX2X3X CiC2C3C4 (SEQ ID NO: 162), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence
NiN2N3N4PXiX2X3X4CiC2C3C4 (SEQ ID NO: 163), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0083] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X , wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC^ C1C2C3, C C2 3C4, o C C2C3C4C5 at the C-terminus of PXiX2X3X4, wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises PXiX2X X , wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C , CiC2C3C4, or CiC2C3C4C5 at the C-terminus of PXiX2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4Cs (SEQ ID NO:130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0084] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO: 4), wherein Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:5), wherein Xi and X2 are any amino acids, and X3 is R or K. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:6), wherein Xi and X2 are any amino acids. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2Q (SEQ ID NO: 7), wherein Xi and X2 are any amino acids. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0085] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSX1X2 (SEQ ID NO:8), wherein Xi is any amino acids, and X2 is an amino acid having a bulky side chain. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSX1X2 (SEQ ID NO:9), wherein Xi is any amino acids, and X2 is R or K. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some
embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSXiQ (SEQ ID NO: 11), wherein Xi is any amino acid. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some
embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0086] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCR (SEQ ID NO: 13). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCQ (SEQ ID NO: 14). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0087] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCRPR (SEQ ID NO: 16). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCQRPR (SEQ ID NO: 17). n some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PLDLSCRRPR (SEQ ID NO: 122). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0088] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence
EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCRPRP (SEQ ID NO: 18). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCQRPR (SEQ ID NO: 19). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCRRPR (SEQ ID NO:123). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence
GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises (e.g., is) the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0089] In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20. Table 1 provides the amino acid sequences for these and several peptide constructs referred to throughout the specification. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26. In some embodiments, there is provided a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
Table 1: Peptide Constructs
Figure imgf000027_0001
Tat-EIA 27 GSHMGRKKRRQRRRPPQLEEPGQPLDELCKRPR
(LS-EL)
GSHM
Tat-EIA 28 GSHMGRKKRRQRRRPPQLEEPGQPLDLSCQRPR
(K239Q)
GSHM
Pepl-EIA 29 GS HMKETWWETWWTEWS QPKKKRK VLEEPGQPLDLS CKRPR
GSHM
Pepl-EIA 30 GS HMKETWWETWWTEWS QPKKKRK VLEEPGQPLDELCKRPR
(LS-EL)
GSHM
Pepl-EIA 31 GS HMKETWWETWWTEWS QPKKKRK VLEEPGQPLDELCQRPR
(K239Q)
GSHM
Pepl-EIA 124 KETWWETWWTEWSQPKKKRKVLEEPGQPLDLSCQRPR
(K239Q)
v.l
Pepl-EIA 125 GS HMKETWWETWWTEWS QPKKKRK VLEEPGQPLDLS CQRPR
(K239Q)
GSHM
v.l
[0090] In some embodiments, the peptide constructs described herein are modified for increased in vivo stability, bioavailability, and/or biological activity. Such modifications include, but are not limited to, amidation of the N or C-termini or acetylation of one or more of peptide residues, so long as such modification does not interfere with the functionalities of the peptide constructs (Cho et al., Science 261 : 1303-1305 (1993).
[0091] In some embodiments, the peptide constructs described herein are modified for the purpose of conjugating to a larger carrier molecule (such as PEG). For example, in some embodiments, the peptide constructs are modified for conjugation through the addition of one or more cysteine residues to the peptide construct for use in PEGylating the peptide construct. In some embodiments, the one or more cysteine residues are added to the N-terminus of the peptide construct. In some embodiments, the one or more cysteine residues are added to the C-terminus of the peptide construct. In some embodiments, the one or more cysteine residues are added to the N-terminus of the inhibitory peptide. In some embodiments, a 3xGly linker (i.e., Gly-Gly-Gly; SEQ ID NO: 107) is added in addition to the cysteine residue. In some embodiments, the peptide construct further comprises a serine or threonine at the N-terminus of the cell penetrating peptide, for example, for use in placing a single PEG chain at a defined site on the cell penetrating peptide. In some embodiments, the serine or threonine is added at the C-terminus of the cell penetrating peptide. In some embodiments, the serine or threonine is added at the N-terminus of the inhibitory peptide. In some embodiments, the serine or threonine is added at the C-terminus of the inhibitory peptide. The present application thus encompasses any of the modified peptide constructs described herein.
[0092] In some embodiments, the peptide constructs described herein are modified for the purpose of conjugating to a larger carrier molecule (such as PEG). For example, in some embodiments, the peptide constructs are modified for conjugation through the addition of one or more cysteine residues to the peptide construct for use in PEGylating the peptide construct. In some embodiments, a 3XGly linker (i.e., Gly-Gly-Gly; SEQ ID NO: 107) is added in addition to the cysteine. In some embodiments, the one or more cysteine residues are added to the N-terminus of the peptide construct. In some embodiments, the one or more cysteine residues are added to the C-terminus of the peptide construct. In some embodiments, the one or more cysteine residues are added to the N-terminus of the inhibitory peptide. In some embodiments, a 3xGly linker (i.e., Gly-Gly-Gly; SEQ ID NO: 107) is added in addition to the cysteine residue. In some embodiments, the peptide construct further comprises a serine or threonine at the N-terminus of the cell penetrating peptide, for example, for use in placing a single PEG chain at a defined site on the cell penetrating peptide. In some embodiments, the serine or threonine is added at the C-terminus of the cell penetrating peptide. In some embodiments, the serine or threonine is added at the N-terminus of the inhibitory peptide. In some embodiments, the serine or threonine is added at the C-terminus of the inhibitory peptide. The present application thus encompasses any of the modified peptide constructs described herein.
[0093] The present application in some embodiments also provides conjugates comprising any of the peptide constructs described herein and a carrier molecule. Suitable carrier molecules include, but are not limited to: polyethylene glycols, lipids, carbohydrates, immunoglobulins, and albumin. In some embodiments, the carrier molecule is a
polyethylene glycol or a derivative thereof. The peptide construct described herein can be PEGylated as described in, e.g., Lee et al. (1999) Bioconjug. Chem. 10(6): 973-8; Kinstler et al. (2002) Advanced Drug Deliveries Reviews 54:477-485; and Roberts et al. (2002) Advanced Drug Delivery Reviews 54:459-476. In some embodiments, the PEG carrier can improve the stability, or retention of, said peptide construct by at least 50 (e.g., at least 2, 5, 10, 15, 20, 25, 30, 40, or 50 or more) fold. In some embodiments, the carrier molecule is selected from the group consisting of PEG-malemimide, PEG-vinylsulfone, PEG- iodoacetamide, PEG orthopyridyl disulfide, and thiol-reactive PEG created to PEGylate free cysteine residues (Liu, 2011 : http://www.pharmtech.com/pharmtech/Drug+Delivery/Peptide- PEGylation-The-Next-Generation/ArticleStandard/Article/detail/718859, accessed on 03/07/2013).
[0094] In some embodiments, the modified peptide constructs described herein are PEGylated with branched PEGs, thus enabling a larger and purer PEG to be linked with only one reactive group; consequently, this bulkier branched PEG assists in repelling approaching macromolecules from a peptide's active site and protecting the peptide construct and/or conjugate from proteases. In some embodiments, the modified peptide constructs described herein are PEGylated in a number of different ways and tested for in vitro and in vivo activity to determine which method of PEGylation is most effective (e.g., by comparing the number of chains attached to the peptide construct, the molecular weight and structure of the chains, and the specific attachment site/s of the PEG).
[0095] Thus, in some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0096] Thus, in some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0097] Thus, in some embodiments, the therapeutic agents useful for methods described herein comprise a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0098] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N4PX1X2X3X4 (SEQ ID NO: 138), wherein N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N4PX1X2X3X4 (SEQ ID NO: 139), wherein N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0099] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PXiX2X3X4 (SEQ ID NO: 140), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PXiX2X3X4 (SEQ ID NO: 141), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids). [0100] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4 (SEQ ID NO: 142), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein XI is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4 (SEQ ID NO: 143), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein XI is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl , pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl . In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0101] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4 (SEQ ID NO: 144), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0102] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1 (SEQ ID NO: 146), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1 (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0103] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1C2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1C2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0104] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX iX2X3X4C 1C2C3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X4CiC2C3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0105] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4 (SEQ ID NO: 152), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX iX2X3X4C 1C2C3C 1 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0106] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 154), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX 1X2X3X4C 1 C2C3C4C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0107] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N4PXiX2X3X4Ci (SEQ ID NO: 156), wherein N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N4PXiX2X3X4Ci (SEQ ID NO: 157), wherein N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some
embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl . In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0108] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PX1X2X3X4C1C2 (SEQ ID NO: 158), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PXiX2X3X4CiC2 (SEQ ID NO:159), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl , pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0109] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PXiX2X3X CiC2C3 (SEQ ID NO: 160), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4C1C2C3 (SEQ ID NO: 161), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0110] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C (SEQ ID
NO: 162), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C is P, S, G, R or L. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4 (SEQ ID NO:163), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0111] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or N1N2N3N4 at the N-terminus of PX1X2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, C1C2, C1C2C3, C1C2C3C4, or C1C2C3C4C5 at the C-terminus of
PX1X2X3X4, wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or N1N2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, C1C2, C1C2C3, C1C2C3C4, or C1C2C3C4C5 at the C-terminus of PX!X2X3X4, wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence
N 1 N2N3N4PX 1X2X3X4C 1C2C3C4C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence
EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0112] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:4), wherein Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain (such as R or K). In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO: 6), wherein Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence
PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0113] In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
Cell penetration Peptides
[0114] The peptide constructs of the present application comprises cell penetrating peptides. Cell penetrating peptides, also called cell-permeable peptides, protein-transduction domains (PTD) or membrane-translocation sequences (MTS), are known to have the ability to translocate in vitro and/or in vivo mammalian cell membranes and enter into cells. CPPs are capable of directing a conjugated compound of interest to a desired cellular destination, e.g. into the cytoplasm or the nucleus. Accordingly, CPPs can direct or facilitate penetration of a compound of interest across a phospholipid, mitochondrial, endosomal or nuclear membrane. A CPP can also direct a compound of interest from outside the cell through the plasma membrane, and into the cytoplasm or to a desired location within the cell, e.g., the nucleus, the ribosome, the mitochondria, the endoplasmic reticulum, a lysosome, or a peroxisome. In addition, the CPP can direct a compound of interest across the blood-brain, trans-mucosal, hematoretinal, skin, gastrointestinal and/or pulmonary barriers.
[0115] CPPs are typically short peptides (for example about 10 to 30 amino acids in length). They can efficiently penetrate the cell membrane and enter almost all cell types together with its covalently conjugated molecular cargo. Sebbage, 2009, Cell Penetrating Pepetides and Their Therapeutic Applications. Biosciene Horizons, 2, 64-72.
[0116] In some embodiments, the CPP is a amphipathic peptide. In some embodiments, the CPP is a cationic peptide. For example, in some embodiments, at least about 30% (including for example at least about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or 100%) of amino acids in the CPP are positively charged. In some
embodiments, the CPP comprises a nuclear localization signal.
[0117] In some embodiments, the CPP is derived from a naturally occurring protein, including for example HIV-1, Antennapedia protein (e.g., its homeodomain), VP22, Herpes Simplex Virus, Calcitonin, antimicrobial to toxin peptides. In some embodiments, the CPP is a chimeric peptide. For example, in some embodiments, the CPP is a chimeric peptide composed of a portion from galanin and a portion from the wasp venom peptide mastoparan. In some embodiments, the CPP is a non-naturally occurring peptide (for example a peptide that has been altered from a naturally occurring peptide). Heitz et al., British J. of
Pharmacology 157 (2009) 195-2-6 provide additional examples of CPPs that may be suitable for the peptide constructs described herein.
[0118] In some embodiments, the CPP is selected from the group consisting of Tat, Pepl, Pep7, pAntp, MPG, DPV, Buforin II, Haptotactic peptides, C , preCy, CaE, hCT(9-32), HN- 1, Influenza virus nucleoprotein, KALA, K-FGF, Ku70, MAP, MPM (IP/K-FGF), N50 (NLS of NF-κΒ P50), Penetratin, Poly Arginine, pISL, Prion mouse PrPcl-28, pVEC, SAP, SV-40 (NLS), SynB, Tat, Transportan, VP22, VT5, and functionally equivalent variants thereof. In some embodiments, the CPP is selected from the group consisting of Tat, Pepl, pAntp, Arge9, pIsL, and functionally equivalent variants thereof. In some embodiments, the CPP comprises (e.g., is) Tat. In some embodiments, the CPP comprises (e.g., is) Pepl. In some embodiments, the CPP comprises (e.g., is) pAntp. In some embodiments, the CPP is any one of the cell penetration peptides listed in Table 2 (SEQ ID Nos: 33-83). In some
embodiments, the CPP is a functional variant of any one of the cell penetration peptides listed in Table 2 (SEQ ID Nos: 33-83 ).
Table 2: Exemplary Cell Penetrating Peptides
Figure imgf000043_0001
SEQ ID NO: Cell Penetrating Peptides Amino acid sequences (N-terminus to C-terminus)
34 DPV6 GRPRESGKKRKRKRLKP
35 DPV7 GKRKKKGKLGKKRDP
36 DPV7b GKRKKKGKLGKKRPRSR
37 DPV3/10 RKKRRRESRRARRSPRHL
38 DPV10/6 SRRARRSPRESGKKRKRKR
39 DPV1047 VKRGLKLRHVRPRVTRMDV
40 DPV1048 VKRGLKLRHVRPRVTRDV
41 DPV10 SRRARRSPRHLGSG
42 DPV15 LRRERQSRLRRERQSR
43 DPV15b GAYDLRRRERQSRLRRRERQSR
44 GALA WEAALAEALAEALAEHLAEALAEALEALAA
45 Haptotactic peptides
46 c KGSWYSMRKMSMKIRPFFPQQ
47 preCy KTRYYSMKKTTMKIIPFNRL
48 CaE RGADYSLRAVRMKIRPLVTQ
49 hCT(9-32) LGTYTQDFNKFHTFPQTAIGVGAP
50 HN-1 TSPLNIHNGQKL
Influenza virus
51 NSAAFEDLRVLS
nucleoprotein (NLS)
52 KALA WEAKLAKALAKALAKHLAKALAKALKACEA
53 K-FGF AAVALLPAVLLALLAP
54 Ku70 VPMLKPMLKE
55 MAP KLALKLALKALKAALKLA
56 MPG GALFLGFLGAAGSTMGAWSQPKKKRKV
57 MPM (IP/K-FGF) AAVALLPAVLLALLAP
58 N50 (NLS OI NF-KB P50) VQRKRQKLM
59 p-Antp RQIKIWFQNRRMKWKK
60 Pep-1 KETWWETWWTEWSQPKKKRKV
61 Pep-7 SDL WEMMMVSLACQY SEQ ID NO: Cell Penetrating Peptides Amino acid sequences (N-terminus to C-terminus)
62 Penetratin RQIKIWFQNRRMKWKK
63 Short Penetratin RRMKWKK
64 Poly Arginine - R7 RRRRRRR
65 Poly Arginine - R9 RRRRRRRRR
66 pISL RVIRVWFQNKRCKDKK
67 Prion mouse PrPci_28 MANLGYWLLALFVTMWTDVGLCKKRPKP
68 pVEC LLIILRRRIRKQ AH AHS K
69 SAP VRLPPPVRLPPPVRLPPP
70 SV-40 (NLS) PKKKRKV
71 SynBl RGGRLSYSRRRFSTSTGR
72 SynB3 RRLSYSRRRF
73 SynB4 AWSFRVSYRGISYRRSR
74 Tat47_6o YGRKKRRQRRRPPQ
75 Tat48-6o GRKKRRQRRRPPQ
76 Tat48-6i GRKKRRQRRRPPQQ
77 Tat47_57 YGRKKRRQRRR
78 Tat49_57 RKKRRQRRR
79 Transport an GWTLNSAGYLLGKINLKALAALAKKIL
80 Transportan 10 AGYLLGKINLKALAALAKKIL
81 Transportan derivative 1 : GWTLNSAGYLLG
82 VP22 DAATATRGRSAASRPTERPRAPARSASRPRRPVD
83 VT5 DPKGDPKGVTVTVTVTVTGKGDPKPD
[0119] A "variant" of a CPP described herein refers to a peptide that is at least about 50%, preferably at least about 70%, more preferably at least about 80%-85%, preferably at least about 90%, and most preferably at least about 95%-99% identical to the original CPP upon which it is based. For example, CPPs can have substitutions at 1, 2, 3, 4 or more residues.
The CPP can be used in a monomeric form or in a polymeric form such as a dimer or a trimer. A "functionally equivalent variant of a CPP" refers to a variant that has a similar cell penetration property as the original CPP. In some embodiments, the functionally equivalent variant of the CPP has an enhanced function than the original CPP. In some embodiments, the functional equivalent variant of the CPP has a diminished function as compared to the original CPP. Methods of making functionally equivalent variants are known in the art.
[0120] Additional CPP can be obtained or identified, for example, by using the mRNA display technology. In one exemplary method, a DNA library encoding random peptides is transcribed in vitro and linked to puromycin through a DNA linker, which enables the generation of an mRNA-puromycin-peptide fusion upon in vitro translation. This mRNA- peptide fusion can incubate with specific cell lines, extensively washed, and cell-penetrating peptides are recovered through RT-PCR and sequencing of the mRNAs. Multiple rounds of selection generate cell penetrating peptides that enter cells with high efficiency.
Inhibitory Peptides
[0121] The therapeutic agents used in the methods described herein comprises an inhibitory peptide that interferes with the interaction between EIA and CtBP.
[0122] The present application in some embodiments also provides inhibitory peptides described herein.
[0123] Also provided herein are compositions (such as pharmaceutical compositions) comprising any of the peptide constructs and/or conjugates described herein.
[0124] Also provided are methods of treating cancer and/or inflammatory disease comprising administering a therapeutic agent comprising an inhibitory peptide.
[0125] The inhibitory peptides described in the section above ("Peptide Constructs and Conjugates") are all encompassed in the scope of the present application, regardless of whether they are linked or associated with a cell penetrating peptide. Solely for the sake of brevity, the paragraphs below provide a non-exclusive list of these inhibitory peptides.
[0126] In one aspect, the peptide constructs and/or conjugates described herein are used to interfere with the interaction between EIA and CtBP such that their binding is reduced, and in some cases, inhibited. The reduction of EIA and CtBP binding can be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% from the amount of binding that would have occurred had the peptide constructs and/or conjugates of the present invention not been used. Assays to measure protein-protein interactions are routine and well-known in the art.
[0127] The peptide constructs described herein comprise an inhibitory peptide that interferes with the interaction between EIA and CtBP. In some embodiments, the inhibitory peptide has an IC50 of no more than about 30 μΜ (such as no more than about any of 20 μΜ, 15 μΜ, or 10 μΜ) in an in vitro binding assay. In some embodiments, the inhibitory peptide has an IC50 that is no more than the IC50 of the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, the inhibitor peptide binds to the same binding site on CtBP as the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, the inhibitor peptide competitively inhibits the binding of the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO:l) to CtBP. In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence GGDGPLDLCCRKRP (SEQ ID
NO: 133). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
[0128] The peptide constructs described herein comprise an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide has a Kd of no more than about 20 μΜ (such as no more than about any of 15 μΜ, 10 μΜ, 7.5 μΜ, 5.0 μΜ, or 2.5 μΜ) in an in vitro binding assay. In some embodiments, the inhibitory peptide has a Kd that is no more than the Kd of the El A 14mer
EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the inhibitor peptide binds to the same binding site on CtBP as the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, the inhibitor peptide competitively inhibits the binding of the El A 14mer EPGQPLDLSCKRPR (SEQ ID NO:l) to CtBP. In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
[0129] In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A.
[0130] In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:84), wherein Xi is selected from the group consisting of L, M, Q, or I. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3).
[0131] In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C4, or CiC2C3C4C5 at the C-terminus of PXiX2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X , wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C4, or CiC2C3C4Cs at the C-terminus of PXiX2X3X , wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X CiC2C3C4C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134).
[0132] In some embodiments, the inhibitory peptide comprises the sequence PXiDLSX2X3 (SEQ ID NO:4), wherein Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain. Amino acids having a bulky side chain include, e.g., F, W, Y, M, K, R, H and Q. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:5), wherein Xi and X2 are any amino acids, and X3 is R or K. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:6), wherein Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2Q (SEQ ID NO:7), wherein Xi and X2 are any amino acids.
[0133] In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:85), wherein Xi is selected from the group consisting of L, M, Q, or I, X2 is any amino acid, and X3 is an amino acid having a bulky side chain. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:86), wherein Xi is selected from the group consisting of L, M, Q or I, X2 is any amino acid, and X3 is R or K. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:87), wherein Xi is selected from the group consisting of L, M, Q, or I, and X2 is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence
PX1DLSX2Q (SEQ ID NO:88), wherein Xi is selected from the group consisting of L, M, Q, or I, and X2 is any amino acid.
[0134] In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:89), wherein Xi is any amino acids, X2 is selected from the group consisting of C, M, L, or K, and X3 is an amino acid having a bulky side chain. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:90), wherein Xi is any amino acids, X2 is selected from the group consisting of C, M, L, or K, and X3 is R or K. In some embodiments, the inhibitory peptide comprises the sequence PXiDLSX2K (SEQ ID NO:91), wherein Xi is any amino acids, X2 is selected from the group consisting of C, M, L, or K. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2Q (SEQ ID NO:92), wherein Xi is any amino acids, X2 is selected from the group consisting of C, M, L, or K.
[0135] In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:93), wherein Xi is selected from the group consisting of L, M, Q, or I, X2 is selected from the group consisting of C, M, L, or K, and X3 is an amino acid having a bulky side chain. In some embodiments, the inhibitory peptide comprises the sequence
PX1DLSX2X3 (SEQ ID NO:94), wherein Xi is selected from the group consisting of L, M, Q, or I, X2 is selected from the group consisting of C, M, L, or K, and X3 is R or K. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:95), wherein Xi is selected from the group consisting of L, M, Q, or I, X2 is selected from the group consisting of C, M, L, or K. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2Q (SEQ ID NO:96), wherein Xi is selected from the group consisting of L, M, Q, or I, X2 is selected from the group consisting of C, M, L, or K.
[0136] In some embodiments, the inhibitory peptide comprises the sequence PLDLSX1X2 (SEQ ID NO:97), wherein Xi is any amino acids, and X2 is an amino acid having a bulky side chain. In some embodiments, the inhibitory peptide comprises the sequence PLDLSX1X2 (SEQ ID NO:98), wherein Xi is any amino acids, and X2 is R or K. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO:99), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiQ (SEQ ID NO: 100), wherein Xi is any amino acid.
[0137] In some embodiments, the inhibitory peptide comprises the sequence PLDLSX1X2 (SEQ ID NO: 101), wherein Xi is selected from the group consisting of C, M, L, or K, and X2 is an amino acid having a bulky side chain. In some embodiments, the inhibitory peptide comprises the sequence PLDLSX1X2 (SEQ ID NO: 102), wherein Xi is selected from the group consisting of C, M, L, or K, and X2 is R or K. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 103), wherein Xi is selected from the group consisting of C, M, L, or K. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiQ (SEQ ID NO: 104), wherein Xi is selected from the group consisting of C, M, L, or K.
[0138] In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCR (SEQ ID NO: 13). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCQ (SEQ ID NO: 14).
[0139] In some embodiments, the inhibitory peptide comprises the sequence
PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCRPR (SEQ ID NO: 16). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCQRPR (SEQ ID NO: 17). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCRRPR (SEQ ID NO: 122).
[0140] In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCRPR (SEQ ID NO:105). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCQRPR (SEQ ID NO: 19). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCRRPR (SEQ ID NO: 123).
[0141] In some embodiments, the inhibitory peptide comprises at least 5 contiguous (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65) amino acids of the El A N-terminal domain (amino acids 1-67 of El A). In some embodiments, the inhibitory peptide is at least about 80%, 85%, 90%, 95%, 98%, or 99% homologous to a portion of the El A N-terminal domain (such as a peptides sequence having at least 5 contiguous (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65) amino acids of the El A N- terminal domain.
[0142] In some embodiments, the inhibitory peptide is a functionally equivalent variant of a portion of the El A N-terminal domain (such as a peptides sequence having at least 5 contiguous (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65) amino acids of the E1A N-terminal domain (also referred to as the "E1A inhibitory peptides").
[0143] In some embodiments, the inhibitory peptide comprises at least 5 contiguous amino acids (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65 amino acids) of the El A C-terminal domain (e.g. , amino acids 177-243 of El A amino acid sequence in Figure 9). In some embodiments, the inhibitory peptide comprises an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 98%, or 99% homologous to an amino acid sequence of the E1A C-terminal domain. In some embodiments, the inhibitory peptide comprises an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 98%, or 99% homologous to an amino acid sequence of the El A C-terminal domain and has at least 5 contiguous amino acids (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65 amino acids) of the E1A C-terminal domain. In some embodiments, the inhibitory peptide is a functionally equivalent variant of a portion of the El A C-terminal domain such as a peptide sequence having at least 5 contiguous amino acids (such as at least about any of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65 amino acids of the El A C-terminal domain) of the El A C-terminal domain. Inhibitory peptides of the embodiments herein are also referred to as "E1A inhibitory peptides".
[0144] A "variant" of an inhibitory peptide described herein refers to a peptide that is at least about 50%, preferably at least about 70%, more preferably at least about 80%-85%, preferably at least about 90%, and most preferably at least about 95%-99% identical to the original El A inhibitory peptide upon which it is based. For example, the variant can have substitutions at 1 , 2, 3, 4 or more residues. A "functionally equivalent variant" of an inhibitory peptide refers to a variant that has a similar inhibitory activity as the original inhibitory peptide. In some embodiments, the functionally equivalent variant of the inhibitory peptide has lower IC50 in inhibiting the ElA/CtBP binding than the inhibitory peptide. In some embodiments, the functionally equivalent variant of the inhibitory peptide has higher IC50 in inhibiting the ElA/CtBP binding than the inhibitory peptide. Methods of making functionally equivalent variants are described further herein. The present application thus also encompasses methods of screening for inhibitory peptides that are functionally equivalent to any one of the inhibitory peptides described herein.
Peptide Production Methods
[0145] Also provided herein are methods of making any one of the peptide constructs and conjugates described herein. The peptide construct described herein can be produced using a variety of techniques known in the art of molecular biology and protein chemistry. For example, a nucleic acid encoding a peptide construct described herein can be inserted into an expression vector that contains transcriptional and translational regulatory sequences, which include, e.g., promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, transcription terminator signals, polyadenylation signals, and enhancer or activator sequences. The regulatory sequences include a promoter and transcriptional start and stop sequences. In addition, the expression vector can include more than one replication system such that it can be maintained in two different organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification.
[0146] Several possible vector systems are available for the expression of peptide constructs from nucleic acids in mammalian cells. One class of vectors relies upon the integration of the desired gene sequences into the host cell genome. Cells which have stably integrated DNA can be selected by simultaneously introducing drug resistance genes such as E. coli gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or Tn5 neo (Southern and Berg (1982) Mol Appl Genet 1 :327). The selectable marker gene can be either linked to the DNA gene sequences to be expressed, or introduced into the same cell by co- transfection (Wigler et al. (1979) Celll6:77). A second class of vectors utilizes DNA elements which confer autonomously replicating capabilities to an extrachromosomal plasmid. These vectors can be derived from animal viruses, such as bovine papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA, 79: 7147), polyoma virus (Deans et al. (1984) Proc Natl A cad Sci USA 81: 1292), or SV 40 virus (Lusky and Botchan (1981) Nature 293:79).
[0147] The expression vectors can be introduced into cells in a manner suitable for subsequent expression of the nucleic acid. The method of introduction is largely dictated by the targeted cell type, discussed below. Exemplary methods include CaP04 precipitation, liposome fusion, lipofectin, electroporation, viral infection, dextran-mediated transfection, polybrene-mediated transfection, protoplast fusion, and direct microinjection.
[0148] Appropriate host cells for the expression of the peptide constructs include yeast, bacteria, insect, plant, and, as described above, mammalian cells. Of interest are bacteria such as E. coli, fungi such as Saccharomyces cerevisiae and Pichia pastoris, insect cells such as SF9, mammalian cell lines (e.g. , human cell lines), as well as primary cell lines (e.g. , primary mammalian cells). In some embodiments, the peptide constructs can be expressed in Chinese hamster ovary (CHO) cells or in a suitable myeloma cell line such as (NSO).
Suitable cell lines also include, for example, BHK-21 (baby hamster kidney) cells; 293 (human embryonic kidney) cells; HMEpC (Human Mammary Epithelial cells; 3T3 (mouse embryonic fibroblast) cells.
[0149] The inhibitory peptide and the cell penetrating peptide may optionally be directly joined to each other, or may optionally be joined via a linker. Where the inhibitory peptide and the cell penetrating peptide are directly joined, the hybrid vector is made where the DNA encoding the inhibitory peptide and the cell penetrating peptide are themselves directly ligated to each other using known scientific methods. Where a linker is used, the hybrid vector is made where the DNA encoding the inhibitory peptide is ligated to DNA encoding one end of the linker; and the DNA encoding the cell penetrating peptide is ligated to the other end of the linker. Methods are known for performing such ligations in proper orientation. Such ligation may be performed either in series, or as a three way ligation. Examples of sequences which may serve as the linker sequence in the present invention include short peptides of about 2 to about 16 amino acids in length. Among the peptide sequences useful as linkers in the present invention are, e.g., (Leu-Glu)n, where n = 1 to 10, Gly-Ser, and Gly.
[0150] As will be recognized by the skilled artisan, many active moieties which may be used in the present invention occur in nature as secreted proteins in conjunction with a signal or leader peptide and/or as a pro-peptide which undergoes further intra- or extra-cellular processing. In such cases, the hybrid vectors of the present invention may include one or more DNA sequences encoding such signal or leader peptides and/or one or more DNA sequences encoding such propeptide sequence, depending upon whether such secretion and/or processing is desired. Alternatively, the hybrid vectors of the present disclosure may include DNA sequences encoding a different signal or leader peptide and/or pro-peptide sequence chosen to optimize the expression and localization of the peptide construct. In most cases, the signal peptide may be omitted, as the targeting moiety will supply sufficient information for targeting of the active moiety to the desired tissue and cells within the subject's body.
[0151] In some embodiments, a peptide construct described herein can be expressed in, and purified from, transgenic animals (e.g., transgenic mammals). For example, a peptide construct described herein can be produced in transgenic non-human mammals (e.g. , rodents, sheep or goats) and isolated from milk as described in, e.g., Houdebine (2002) Curr Opin Biotechnol 13(6):625-629; van Kuik-Romeijn et al. (2000) Transgenic Res 9(2): 155-159; and Pollock et al. (1999) 1 Immunol Methods 231(1 -2): 147- 157. Additional methods for producing proteins in mammalian milk products are described in, e.g. , U.S. patent application publication nos. 200600105347 and 20040006776 and U.S. patent no. 7,045,676.
[0152] The peptide constructs described herein can be produced from cells by culturing a host cell transformed with the expression vector containing nucleic acid encoding the peptide construct, under conditions, and for an amount of time, sufficient to allow expression of the peptide construct. Such conditions for protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation. For example, polypeptides expressed in E. coli can be refolded from inclusion bodies (see, e.g. , Hou et al. (1998) Cytokine 10:319-30). Bacterial expression systems and methods for their use are well known in the art (see Current Protocols in Molecular Biology, Wiley & Sons, and Molecular Cloning— A Laboratory Manual— 3rd Ed., Cold Spring Harbor Laboratory Press, New York (2001)). The choice of codons, suitable expression vectors and suitable host cells will vary depending on a number of factors, and may be easily optimized as needed. A peptide construct described herein can be expressed in mammalian cells or in other expression systems including but not limited to yeast, baculo virus, and in vitro expression systems (see, e.g. , Kaszubska et al. (2000) Protein Expression and Purification 18:213-220).
[0153] Following expression, the peptide construct can be isolated. The term "purified" or "isolated" as applied to any of the proteins described herein (e.g., a peptide construct, a targeting moiety, and/or an active moiety) refers to a polypeptide that has been separated or purified from components (e.g., proteins or other naturally-occurring biological or organic molecules) which naturally accompany it, e.g., other proteins, lipids, and nucleic acid in a prokaryote expressing the proteins.
[0154] A peptide construct described herein can be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample. Standard purification methods include electrophoretic, molecular, immunological, and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse- phase HPLC chromatography. Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. See, e.g., Scopes (1994) "Protein Purification, 3rd edition," Springer- Verlag, New York City, New York. The degree of purification necessary will vary depending on the desired use. In some instances, no purification of the expressed polypeptide thereof will be necessary.
[0155] Methods for determining the yield or purity of a purified peptide construct are known in the art and include, e.g. , Bradford assay, UV spectroscopy, Biuret protein assay, Lowry protein assay, amido black protein assay, high pressure liquid chromatography (HPLC), mass spectrometry (MS), and gel electrophoretic methods (e.g. , using a protein stain such as Coomassie Blue or colloidal silver stain).
[0156] In some embodiments, a peptide construct described herein can be synthesized de novo in whole or in part, using chemical methods well known in the art. For example, the component amino acid sequences can be synthesized by solid phase techniques, cleaved from the resin, and purified by preparative high performance liquid chromatography followed by chemical linkage to form a desired peptide construct. The composition of the synthetic peptide construct may be confirmed by amino acid analysis or sequences.
[0157] In some embodiments, the peptides used in the invention can be prepared by chemical or biological methods known in the art, including solid phase peptide synthesis, solution phase peptide synthesis, and fragment condensation (either in solution phase or on solid phase).
[0158] In one embodiment, the peptides are synthesized by solid phase peptide synthesis (see Stewart and Young, Solid-Phase Peptide Synthesis, 2nd Ed., Pierce Chemical Co.
(Rockford, 111.), 1984; Merrifield, R.B., 1963, J. Am. Chem. Soc. 85:2149-2154; Fmoc Solid Phase Peptide Synthesis: A Practical Approach (Eds. Chan and White), Oxford University Press (New York), 2000). In some embodiments, the peptide is synthesized with an L-amino acid(s) and/or a D-amino acid(s). The peptide can be synthesized and purified separately, and the peptide can be associated after synthesis and purification of both peptides have been completed. Alternatively, the peptides are synthesized either sequentially or simultaneously by synthesis on a linker which aids in maintaining the association of the peptide. For example, a branched molecule of the form H2Np-(CH2)-CH(NaH2)-COOH can be attached via its carboxyl group to a solid-phase synthesis resin, such as a crosslinked benzhydrylamine or methylbenzhydrylamine resin. The a and β nitrogens can be orthogonally protected (such as with a Mtt group and an Fmoc group, an ivDde group and an Fmoc group, or with an Alloc group and Fmoc group), and one chain is synthesized to the desired length, followed by synthesis of the other chain to its desired length. The covalently linked peptide construct is then cleaved from the solid phase resin and purified. The peptides can have routine modifications, such as acetylation of the N-terminal residue, amidation of the C-terminal residue, or both acetylation of the N-terminal residue and amidation of the C-terminal residue.
[0159] Once expressed and/or purified, a peptide construct described herein can be assayed for any one of a numbered of desired properties using in vitro or in vivo assays such as any of those described herein. For example, a peptide construct described herein can be assayed for its ability to inhibit EIA binding as described in Zhang et al., 2000, Acetylation of adenovirus EIA regulates binding of the transcriptional corepressor CtBP, PNAS vol. 97, no. 26: 14323- 14328.
[0160] In some embodiments, endotoxin can be removed from the peptide construct preparations. Methods for removing endotoxin from a protein sample are known in the art. For example, endotoxin can be removed from a protein sample using a variety of commercially available reagents including, without limitation, the ProteoSpin™ Endotoxin Removal Kits (Norgen Biotek Corporation), Detoxi-Gel Endotoxin Removal Gel (Thermo Scientific; Pierce Protein Research Products), MiraCLEAN® Endotoxin Removal Kit (Minis), or Acrodisc™- Mustang® E membrane (Pall Corporation).
[0161] Methods for detecting and/or measuring the amount of endotoxin present in a sample (both before and after purification) are known in the art and commercial kits are available. For example, the concentration of endotoxin in a protein sample can be determined using the QCL-1000 Chromogenic kit (BioWhittaker), the limulus amebocyte lysate (LAL)- based kits such as the Pyrotell®, Pyrotell®-T, Pyrochrome®, Chromo-LAL, and CSE kits available from the Associates of Cape Cod Incorporated. Following expression and purification, the peptide constructs described herein can be modified. The modifications can be covalent or non-covalent modifications. Such modifications can be introduced into the peptide constructs by, e.g., reacting targeted amino acid residues in the targeting moiety and/or the active moiety with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues. Suitable sites for modification can be chosen using any of a variety of criteria including, e.g., structural analysis or amino acid sequence analysis of the peptide constructs described herein.
[0162] In some embodiments, the peptide constructs described herein can be modified. Following expression and purification, the peptide constructs described herein can be modified. The modifications can be covalent or non-covalent modifications. Such modifications can be introduced into the peptide constructs by, e.g., reacting targeted amino acid residues in the targeting moiety and/or the active moiety with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues. Suitable sites for modification can be chosen using any of a variety of criteria including, e.g., structural analysis or amino acid sequence analysis of the peptide constructs described herein.
[0163] In some embodiments, the peptide construct is conjugated to a carrier molecule. The carrier and the peptide construct may optionally be directly joined to each other, or may optionally be joined via a linker. Where the carrier and peptide construct are directly joined, the hybrid vector is made where the DNA encoding the carrier and peptide construct are themselves directly ligated to each other using known scientific methods. Where a linker is used, the hybrid vector is made where the DNA encoding the carrier is ligated to DNA encoding one end of the linker; and the DNA encoding the peptide construct is ligated to the other end of the linker. Methods are known for performing such ligations in proper orientation. Such ligation may be performed either in series, or as a three way ligation.
Compositions and Pharmaceutical Formulations
[0164] The therapeutic agents useful for methods described herein can be provided in pharmaceutical compositions. The therapeutic agent may or may not further comprise a cell penetrating peptide such as any of the cell penetrating peptides described herein.
[0165] Also provided herein are compositions (such as pharmaceutical compositions) comprising any of the peptide constructs and/or conjugates described herein. Peptide-based therapeutics, such as the peptide constructs and/or conjugates described herein, are usually challenging to formulate. Selection of a suitable surfactant for preparing sufficiently stable emulsions for a particular application is not a predictable or routine exercise. For peptide- based therapeutics, the reduction of drug crystallization and precipitation need to be considered. Lipid-based compositions such as emulsions appear as a promising vehicle system for delivering poorly water-soluble drugs. Emulsions are an intimate mixture of two incompletely miscible liquids, such as oil and water, in which one of the liquids in the form of fine droplets is dispersed in the other liquid, usually with the aid of an emulsifier or surfactant.
[0166] In addition to the other carriers described herein, pharmaceutically acceptable carriers may include sterile aqueous of non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Suitable agents which are known to enhance absorption of drugs through skin are described in Sloan, Use of Solubility Parameters from-Regular Solution Theory to Describe Partitioning-Driven Processes, Ch. 5, "Prodrugs: Topical and Ocular Drug Delivery" (Marcel Dekker, 1992), and at places elsewhere in the text. In addition, preservatives and other additives may also be present such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like. The peptide construct and/or conjugate may also be lyophilized using means well known in the art, for subsequent reconstitution and use according to the invention.
[0167] Thus, in some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX 1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0168] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N4PX1X2X3X4 (SEQ ID NO: 138), wherein N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence Ν4ΡΧιΧ2Χ3Χ4 (SEQ ID NO: 139), wherein N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0169] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N3N4PXiX2X3X4 (SEQ ID NO: 140), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence Ν3Ν4ΡΧιΧ2Χ3Χ4 (SEQ ID NO: 141), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0170] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4 (SEQ ID NO: 142), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PXiX2X3X4 (SEQ ID
NO: 143), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0171] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4 (SEQ ID NO: 144), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some
embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0172] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1 (SEQ ID
NO: 146), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1 (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some
embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0173] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0174] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X4CiC2C3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the inhibitory peptide comprises the sequence
PXiX2X3X4CiC2C3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0175] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4 (SEQ ID NO: 152), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the inhibitory peptide comprises the sequence PX 1X2X3X4C 1 C2C3C4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0176] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 154), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0177] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N4PX1X2X3X4C1 (SEQ ID NO: 156), wherein N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T. In some embodiments, the inhibitory peptide comprises the sequence N4PX1X2X3X4C1 (SEQ ID NO: 157), wherein N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0178] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N3N4PX1X2X3X4C1C2 (SEQ ID NO: 158), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, the inhibitory peptide comprises the sequence N3N4PX 1X2X3X4C 1 C2 (SEQ ID NO: 159), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0179] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4C1C2C3 (SEQ ID NO:160), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4C1C2C3 (SEQ ID NO: 161), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0180] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4 (SEQ ID NO:162), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4 (SEQ ID NO: 163), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0181] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X , wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC^ C1C2C3, C C2 3C4, o C C2C3C4C5 at the C-terminus of PXiX2X3X4, wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises PXiX2X X , wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, C1C2, CiC2C3, CiC2C3C4, or CiC2C3C4C5 at the C-terminus of PXiX2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence N 1 N2N N PX iX2X X C iC2C C C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein X! is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence
EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0182] Thus, in some embodiments, there is provided a composition (such as a
pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0183] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:4), wherein Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain (such as R or K). In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:6), wherein Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence
PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0184] In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20. In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22. In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26. In some embodiments, there is provided a composition (such as a pharmaceutical composition) comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
[0185] A variety of excipients usually utilized in the pharmaceutical arts can be added to the pharmaceutical compositions of the invention. These pharmaceutically acceptable excipients may be preserving agents, emollients, antifoaming agents, antioxidants, buffers, pigments, coloring agents, sweetening agents, flavoring agents, coating agents, granulating agents, disintegrants, glidants, lubricants, conventional matrix materials, complexing agents, absorbents, and fillers. Suitable excipients include, but are not limited to metilparaben, propilparaben, cyclodextrin, liquid paraffin, dimethicone, Abil EM 90 (silicone). In some embodiments, the excipient is any of: liquid paraffin, methylparaben, propylparaben, cetrimide and cetostearyl alcohol.
Methods of Treating Cancer
[0186] The peptide constructs, conjugates, and compositions (such as pharmaceutical compositions) described herein are useful for treatment of diseases such as cancer. The peptide constructs can be delivered to an individual via a variety of routes, including, but not limited to, intravenous, intratumoral, subcutaneously, oral, transmucosal, transdermal, and topical administrations. The present application thus also encompasses methods of delivering any of the peptide constructs or conjugates described herein to an individual (such as an individual having cancer).
[0187] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX 1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some
embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0188] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0189] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N4PX1X2X3X4 (SEQ ID
NO: 138), wherein N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence N4PXiX2XsX4 (SEQ ID NO: 139), wherein N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0190] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N3N4PX1X2X3X4 (SEQ ID NO: 140), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence N3N4PXiX2X3X4 (SEQ ID NO: 141), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0191] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N2N3N4PXiX2X3X4 (SEQ ID NO: 142), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP. In some embodiments, there is provided a conjugate comprising a peptide construct and a carrier molecule, wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4 (SEQ ID
NO: 143), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0192] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4 (SEQ ID NO: 144), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some
embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl , pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl . In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0193] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1 (SEQ ID
NO: 146), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1 (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some
embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0194] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X4CiC2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X CiC2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0195] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the inhibitory peptide comprises the sequence
PX1X2X3X4C1C2C3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0196] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4 (SEQ ID NO: 152), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the inhibitory peptide comprises the sequence PX 1X2X3X4C 1 C2C3C4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0197] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 154), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0198] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N4PX1X2X3X4C1 (SEQ ID NO: 156), wherein N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T. In some embodiments, the inhibitory peptide comprises the sequence N4PXiX2X3X4Ci (SEQ ID NO: 157), wherein N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0199] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N3N4PXiX2X3X4CiC2 (SEQ ID NO: 158), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, the inhibitory peptide comprises the sequence N3N4PXiX2X3X4CiC2 (SEQ ID NO: 159), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0200] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N2N3N4PXiX2X3X4CiC2C3 (SEQ ID NO:160), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the inhibitory peptide comprises the sequence
N2N3N4PXiX2X3X4CiC2C3 (SEQ ID NO: 161), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0201] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4C1C2C3C4 (SEQ ID NO:162), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the inhibitory peptide comprises the sequence N 1 N2N3N4PX 1X2X3X4C 1 C2C3C4 (SEQ ID NO: 163), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0202] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X , wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC^ C1C2C3, C C2 3C4, o C C2C3C4C5 at the C-terminus of PXiX2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X X , wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C4, or CiC2C3C4C5 at the C-terminus of PXiX2X3X4, wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein X! is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence
EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0203] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:4), wherein Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain (such as R or K). In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO: 6), wherein Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence
PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0204] In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20. In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22. In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a
pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26. In some embodiments, there is provided a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
[0205] In some embodiments, there is provided a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between EIA and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0206] In some embodiments, there is provided a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some
embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0207] In some embodiments, there is provided a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N- terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C4, or CiC2C3C4C5 at the C-terminus of PXiX2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X X , wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or N1N2N3N4 at the N-terminus of PX1X2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, C1C2, C1C2C3, C1C2C3C4, or C1C2C3C4C5 at the C- terminus of PX 1X2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence
PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0208] In some embodiments, there is provided a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:4), wherein Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain (such as R or K). In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:6), wherein Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence
PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0209] In some embodiments, there is provided a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20. In some embodiments, there is provided a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22. In some embodiments, there is provided a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26. In some embodiments, there is provided a method of inhibiting cell proliferation, cell migration, or angiogenesis in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28.
[0210] In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0211] In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID N0:2), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some
embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0212] In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N , or NiN2N3N at the N- terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C4, or CiC2C3C4C5 at the C-terminus of PX!X2X3X4, wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X4, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C4, or CiC2C3C4Cs at the C- terminus of PXiX2X3X4, wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence
PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0213] In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:4), wherein Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain (such as R or K). In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:6), wherein Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence
PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0214] In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:20. In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:22. In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:26. In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO:28. In some embodiments, there is provided a method of decreasing resistance to radiation and chemotherapy in an individual having cancer, comprising administering to the individual an effective amount of a pharmaceutical composition comprising a peptide construct (or a conjugate comprising the peptide construct), wherein the peptide construct comprises a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the peptide construct comprises (e.g., is) SEQ ID NO: 26.
[0215] In some embodiments, the cancer is breast cancer. In some embodiments, the cancer is ovarian cancer. In some embodiments, the cancer is gastric cancer. In some embodiments, the cancer is glioma. In some embodiments, the cancer is skin cancer. In some embodiments, the cancer is melanoma. In some embodiments, the cancer is colon cancer. In some embodiments, the cancer is poorly differentiated colon adenocarcinoma. In some embodiments, the cancer is lung cancer. In some embodiments, the cancer is non-small cell lung cancer. In some embodiments, the lung cancer is moderately differentiated lung adenocarcinoma. In some embodiments, the cancer is ductal invasive breast carcinoma. In some embodiments, the cancer is renal cell carcinoma.
Methods of Treating Inflammatory Diseases
[0216] The present application in some embodiments provide methods of treating inflammatory diseases in an individual by administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP. The therapeutic agents can be delivered to an individual via a variery of routes, including, but not limited to, intravenous, intratumoral, subcutaneously, oral, transmucosal, transdermal, and topical administrations. The present application thus also encompasses methods of delivering any of the therapeutic agents described herein to an individual (such as an individual having an inflammatory disease).
[0217] The therapeutic agent in some embodiments comprisings a peptide construct comprising a cell penetration peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the therapeutic agent comprises an inhibitory peptide not linked to a cell penetration peptide.
[0218] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0219] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence P XiDLS (SEQ ID NO:2), wherien Xi is any amino acid. In some
embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0220] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N4PX1X2X3X4 (SEQ ID NO: 138), wherein N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence N4PX1X2X3X4 (SEQ ID NO: 139), wherein N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0221] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PX 1X2X3X4 (SEQ ID NO: 140), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence N3N4PX1X2X3X4 (SEQ ID NO: 141), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0222] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4 (SEQ ID NO: 142), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence N2N3N4PXiX2X3X (SEQ ID NO: 143), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0223] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4 (SEQ ID NO:144), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N 1PX 1X2X3X^1 (SEQ ID NO: 145), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, N4 is Q, V, E or G, and wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0224] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X4Ci (SEQ ID NO: 146), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X4Ci (SEQ ID NO: 147), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0225] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1C2 (SEQ ID NO: 148), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4C1C2 (SEQ ID NO: 149), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T and C2 is K, A or R. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0226] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X 1C1C2C3 (SEQ ID NO: 150), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X CiC2C3 (SEQ ID NO: 151), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0227] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4C1C2C3C4 (SEQ ID NO: 152), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X4CiC2C3C4 (SEQ ID NO: 153), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0228] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 154), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence
PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 155), wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0229] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N4PX1X2X3X4C1 (SEQ ID NO: 156), wherein N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T. In some embodiments, the inhibitory peptide comprises the sequence N4PX1X2X3X4C1 (SEQ ID NO: 157), wherein N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Q is C, M, L, K, V or T. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0230] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N3N4PX1X2X3X4C1C2 (SEQ ID NO: 158), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, the inhibitory peptide comprises the sequence N3N4PX1X2X3X4C1C2 (SEQ ID NO: 159), wherein N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, and C2 is K, A or R. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0231] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4C1C2C3 (SEQ ID NO: 160), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the inhibitory peptide comprises the sequence N2N3N4PX1X2X3X4C1C2C3 (SEQ ID NO: 161), wherein N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, and C3 is R, T, H, P, K or C. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0232] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4 (SEQ ID NO: 162), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the inhibitory peptide comprises the sequence
NiN2N3N4PXiX2X3X4CiC2C3C4 (SEQ ID NO: 163), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein X! is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, and C4 is P, S, G, R or L. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0233] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or N1N2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, C1C2, C1C2C3, C1C2C3C4, or C1C2C3C4C5 at the C-terminus of PX1X2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises PX1X2X3X4, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PX1X2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, C1C2, C1C2C3, C1C2C3C4, or C1C2C3C4C5 at the C-terminus of PX1X2X3X4, wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence N1N2N3N4PX1X2X3X4C1C2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0234] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:4), wherien Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain. In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:6), wherien Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids). [0235] In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 20. In some embodiments, there is provided a method of treating an
inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 22. In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising
administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 26. In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 28.
[0236] In some embodiments, there is provided a method of inhibiting inflammation in an individual, comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between El A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX 1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiX2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0237] In some embodiments, there is provided a method of inhibiting inflammation in an individual, comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between El A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherien Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0238] In some embodiments, there is provided a method of inhibiting inflammation in an individual, comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between El A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C , or CiC2C3C4C5 at the C-terminus of PXiX2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises PXiX2X3X , wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, dC2C3, dC2C3C4, or CiC2C3C4C5 at the C-terminus of PXiX2X3X4, wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence
GGDGPLDLCCRKRP (SEQ ID NO:133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl , pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl . In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0239] In some embodiments, there is provided a method of inhibiting inflammation in an individual, comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP, wherein the inhibitory peptide comprises the sequence PXiDLSX2X3 (SEQ ID NO:4), wherien Xi and X2 are any amino acids, and X is an amino acid having a bulky side chain. In some embodiments, the inhibitory peptide comprises the sequence PXiDLSX2K (SEQ ID NO: 6), wherien Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence
PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO: l). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids).
[0240] In some embodiments, there is provided a method of inhibiting inflammation in an individual, comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO: 20. In some embodiments, there is provided a method of inhibiting inflammation in an individual, comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO: 22. In some embodiments, there is provided a method of inhibiting inflammation in an individual, comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO: 26. In some embodiments, there is provided a method of inhibiting inflammation in an individual, comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO:28.
[0241] In some embodiments, the inflammatory disease is selected from the group consisting of psoriasis, mucositis, chronic wound and trauma. In some embodiments, the inflammatory disease is selected from the group consisting of psoriatic arthritis,
osteoarthritis, rheumatoid arthritis, and inflammatory bowel disease (e.g., Crohn's disease and ulcerative colitis), sepsis, atopic dermatitis, contact dermatitis, chronic obstructive pulmonary disease and chronic inflammatory pulmonary disease.
[0242] In some embodiments, the inflammatory disease is psoriasis. Psoriasis is a common inflammatory skin disease seen in dermatology clinics. The most frequently seen form of psoriasis is psoriasis vulgaris, occurring in 90% of all cases and characterized by scaly papulosquemous plaque lesions. Less common types of psoriasis, including psoriatic erythroderma, pustular psoriasis, and psoriatic arthritis, are usually thought to be more severe entities of psoriasis. Griffiths et al., 2007. Lancet, vol. 370: 263-271. [0243] Thus, in some embodiments, there is provided a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP. In some embodiments, the inhibitory peptide comprises the sequence PX1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A. In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids). In some embodiments, the therapeutic agent is administered topically.
[0244] Thus, in some embodiments, there is provided a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising inhibitory peptide that interferes with the interaction between E1A and CtBP. In some embodiments, the inhibitory peptide comprises the sequence PXiDLS (SEQ ID NO:2), wherien Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLS (SEQ ID NO:3). In some
embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids). In some embodiments, the therapeutic agent is administered topically.
[0245] In some embodiments, there is provided a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1X2X3X4, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N- terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C4, or CiC2C3C4C5 at the C-terminus of PXiX2X3X4, wherein Ci is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises PXiX2X X , wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A, and further comprises one of N4, N3N4, N2N3N4, or NiN2N3N4 at the N-terminus of PXiX2X3X4, wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, and/or further comprises one of Ci, CiC2, CiC2C3, CiC2C3C4, or CiC2C3C4Cs at the C-terminus of PXiX2X3X4, wherein Q is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 130), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence NiN2N3N4PXiX2X3X4CiC2C3C4C5 (SEQ ID NO: 131), wherein Ni is E, G, P, A or V, N2 is P, Q, G, S, T, V or M, N3 is G, T, D, E or N, and N4 is Q, V, E or G, wherein Xi is L, V, I, M, Q or E, X2 is D or N, X3 is L or I, and X is S, C, T, V or A, and wherein d is C, M, L, K, V or T, C2 is K, A or R, C3 is R, T, H, P, K or C, C4 is P, S, G, R or L, and C5 is R, K, P, T, L or S. In some embodiments, the inhibitory peptide comprises the sequence EQTVPVDLSVARPR (SEQ ID NO: 132). In some embodiments, the inhibitory peptide comprises the sequence GGDGPLDLCCRKRP (SEQ ID NO: 133). In some embodiments, the inhibitory peptide comprises the sequence PTDEPLNLSLKRPR (SEQ ID NO: 134). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids). In some embodiments, the therapeutic agent is administered topically.
[0246] In some embodiments, there is provided a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP, wherein the inhibitory peptide comprises the sequence PX1DLSX2X3 (SEQ ID NO:4), wherien Xi and X2 are any amino acids, and X3 is an amino acid having a bulky side chain (such as R or K). In some embodiments, the inhibitory peptide comprises the sequence PX1DLSX2K (SEQ ID NO:6), wherien Xi and X2 are any amino acids. In some embodiments, the inhibitory peptide comprises the sequence
PLDLSXiK (SEQ ID NO: 10), wherein Xi is any amino acid. In some embodiments, the inhibitory peptide comprises the sequence PLDLSCK (SEQ ID NO: 12). In some embodiments, the inhibitory peptide comprises the sequence PLDLSCKRPR (SEQ ID NO: 15). In some embodiments, the inhibitory peptide comprises (e.g., is) the sequence EPGQPLDLSCKRPR (SEQ ID NO:l). In some embodiments, the therapeutic agent comprises a peptide construct comprising the inhibitory peptide and a cell penetration peptide. In some embodiments, the cell penetrating peptide is an amphipathic peptide. In some embodiments, the cell penetrating peptide is a cationic peptide. In some embodiments, the cell penetrating peptide is selected from the group consisting of Tat, Pepl, pAntp, Arg9, plsl, and functionally equivalent variants thereof. In some embodiments, the cell penetration peptide comprises Tat. In some embodiments, the cell penetration peptide comprises Pepl. In some embodiments, the peptide construct is a fusion peptide, for example a fusion peptide that is no more than about 50 amino acids long. In some embodiments, the peptide construct may comprise a peptide linker (for example a peptide linker of less than about 5 amino acids, such as about 2 amino acids). In some embodiments, the therapeutic agent is administered topically.
[0247] In some embodiments, there is provided a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 20. In some embodiments, there is provided a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 22. In some embodiments, there is provided a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 26. In some embodiments, there is provided a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the indivudal an effective amount of a therapeutic agent comprising a peptide construct comprising (e.g., is) SEQ ID NO 28. In some embodiments, the therapeutic agent is administered topically.
Methods of Administration and Dosage
[0248] The compounds described for use in the present invention can be administered to an individual via any route known in the art, including, but not limited to, those disclosed herein. The peptide constructs and/or conjugates of the present invention may be administered: intravenously, subcutaneously, topically, transdermally, intraperitoneally, orally, via intramuscular injection, intra-arterially, via inhalation (e.g. as mists or sprays), via nasal mucosa, gastrointestinally, and directly to a specific or affected organ. Topical
administration is a preferred route of administration. The compounds described for use herein can be administered in the form of injectables, creams, solutions, emulsions, dispersions, suppositories, food premixes, tablets, pills, powder mixtures, capsules, granules, and in other suitable forms.
[0249] In some embodiments, the peptide constructs and/or conjugates may be formulated to extend their half-lives in vivo, such as by forming conjugates with a biocompatible polymer (e.g., polyethylene glycol (PEG)). In some embodiments, the peptide constructs and/or conjugates provided herein may be delivered using liposomes, microparticles, and nanoparticles for peptide drug delivery, as is known in the art. See, e.g., Tan, M.L. et al., 2010. Peptides, vol. 31 : 184-193, incorporated herein in its entirety. [0250] The amount of the peptide construct and/or conjugate administered to an individual in need thereof can be determined by various factors, such as the type of cancer, the biological and/or physiological response from the individual receiving the peptide therapeutic and other factors known to one of skill in the art. As such, the amount of the peptide construct and/or conjugate to be administered can be adjusted accordingly to achieve the desired beneficial effects. In one aspect, the amount of the peptide construct and/or conjugate to be used is at least about 1 μg peptide construct and/or conjugate/kg of the individual. In other aspects, the amount of the peptide construct and/or conjugate to be used is at least about
2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg/kg, 6 μg/kg, 7 μg/kg, 8 μg/kg, 9 μg/kg, 10 μg/kg, 11 μg/kg,
12 μg/kg, 13 μg/kg, 14 μg/kg, 15 μg/kg, 16 μg/kg, 17 μg/kg, 18 μg/kg, 19 μg/kg, 20 μg/kg,
21 μg/kg, 22 μg/kg, 23 μg kg, 24 μg/kg, 25 μg/kg, 26 μg kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, or 30 μg/kg. In other aspects, the amount of the peptide construct and/or conjugate to be used is at least about 35 μg kg, 40 μg/kg, 45 μg/kg, 50 μg/kg, 55 μg/kg, 60 μg/kg, 65 μg kg, 70 μg/kg, 75 μg/kg, 80 μg kg, 85 μg/kg, 90 μg/kg, 95 μg kg or 100 μg/kg. In other aspects, the amount of the peptide construct and/or conjugate to be used is about 1 μg kg, 2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg kg, 6 μg/kg, 7 μg/kg, 8 μg kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg,
13 μg/kg, 14 μg/kg, 15 μg kg, 16 μg/kg, 17 μg/kg, 18 μg kg, 19 μg/kg, 20 μg/kg, 21 μg/kg,
22 μg/kg, 23 μg/kg, 24 μg/kg, 25 μg/kg, 26 μg/kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, 30 μg kg, 35 μg/kg, 40 μg/kg, 45 μg kg, 50 μg/kg, 55 μg/kg, 60 μg kg, 65 μg/kg, 70 μg/kg, 75 μg/kg, 80 μg/kg, 85 μg/kg, 90 μg kg, 95 μg/kg or 100 μg peptide construct and/or conjugate /kg of the individual. In other aspects, the amount of the conjugate to be used is at most about 1 μg/kg, 2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg/kg, 6 μg/kg, 7 μg/kg, 8 μg/kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg, 13 μg/kg, 14 μg/kg, 15 μg/kg, 16 μg/kg, 17 μg/kg, 18 μg/kg, 19 μg/kg, 20 μg/kg, 21 μg/kg, 22 μg/kg, 23 μg/kg, 24 μg/kg, 25 μg/kg, 26 μg/kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, 30 μg/kg, 35 μg/kg, 40 μg/kg, 45 μg/kg, 50 μg/kg, 55 μg/kg, 60 μg/kg, 65 μg/kg, 70 μg/kg, 75 μg/kg, 80 μg/kg, 85 μg/kg, 90 μg/kg, 95 μg/kg or 100 μg conjugate/kg of the individual. In other aspects, the invention provides for a dosage of range of any of the values given above. For example, the lower limit of the dosage range can be about 1 μg/kg, 2 μg/kg,
3 μg/kg, 4 μg/kg, 5 μg/kg, 6 μg/kg, 7 μg/kg, 8 μg/kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg, 13 μg/kg, 14 μg/kg, 15 μg/kg, 16 μg/kg, 17 μg/kg, 18 μg/kg, 19 μg/kg, 20 μg/kg, 21 μg/kg, 22 μg/kg, 23 μg/kg, 24 μg/kg, 25 μg/kg, 26 μg/kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, 30 μg/kg, 35 μg/kg, 40 μg/kg, 45 μg/kg, 50 μg/kg, 55 μg/kg, 60 μg/kg, 65 μg/kg, 70 μg/kg, 75 μg/kg, 80 μg/kg, 85 μg/kg, 90 μg/kg, 95 μg/kg while the upper limit of the dosage range can be 2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg/kg, 6 μg/kg, 7 μg/kg, 8 μg/kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg, 13 μg kg, 14 μg/kg, 15 μg kg, 16 μg/kg, 17 μg/kg, 18 μg/kg, 19 μg/kg, 20 μg/kg, 21 μg/kg, 22 μg/kg, 23 μg/kg, 24 μg/kg, 25 μg/kg, 26 μg/kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, 30 μg/kg, 35 μg kg, 40 μg/kg, 45 μg kg, 50 μg/kg, 55 μg/kg, 60 μg/kg, 65 μg/kg, 70 μg/kg, 75 μ§^§, 80 μ§¾, 85 μ§^§, 90 μ§¾, 95 μ§^§ or 100 μ§^§.
[0251] Exemplary dosing frequencies for the administration of the peptide constructs include, but are not limited to, daily, every two days, every three days, every four days, every five days, every six days, weekly without break, weekly for three out of four weeks, once every three weeks, once every two weeks, or two out of three weeks. In some embodiments, the composition is administered about once every 2 weeks, once every 3 weeks, once every 4 weeks, once every 6 weeks, or once every 8 weeks. In some embodiments, the composition is administered at least about any of lx, 2x, 3x, 4x, 5x, 6x, or 7x (i.e., daily) a week. In some embodiments, the intervals between each administration are less than about any of 6 months, 3 months, 1 month, 20 days, 15, days, 14 days, 13 days, 12 days, 11 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days, or 1 day. In some embodiments, the intervals between each administration are more than about any of 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, or 12 months. In some embodiments, there is no break in the dosing schedule. In some embodiments, the interval between each administration is no more than about a week.
[0252] The amount of the peptide construct and/or conjugate administered to an individual in need thereof can be determined by various factors, such as the type of cancer, the biological and/or physiological response from the individual receiving the peptide therapeutic and other factors known to one of skill in the art. As such, the amount of the peptide construct and/or conjugate to be administered can be adjusted accordingly to achieve the desired beneficial effects. In one aspect, the amount of the peptide construct and/or conjugate to be used is at least about 1 μg peptide construct and/or conjugate/kg of the individual. In other aspects, the amount of the peptide construct and/or conjugate to be used is at least about 2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg/kg, 6 μg/kg, 7 μg/kg, 8 μg/kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg, 13 μg/kg, 14 μg/kg, 15 μg/kg, 16 μg/kg, 17 μg/kg, 18 μg/kg, 19 μg/kg, 20 μg/kg, 21 μg/kg, 22 μg/kg, 23 μg kg, 24 μg/kg, 25 μg/kg, 26 μg kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, or 30 μg/kg. In other aspects, the amount of the peptide construct and/or conjugate to be used is at least about 35 μg kg, 40 μg/kg, 45 μg/kg, 50 μg/kg, 55 μg/kg, 60 μg/kg, 65 μg kg, 70 μg/kg, 75 μg/kg, 80 μg kg, 85 μg/kg, 90 μg/kg, 95 μg kg or 100 μg/kg. In other aspects, the amount of the peptide construct and/or conjugate to be used is about 1 μg kg, 2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg kg, 6 μg/kg, 7 μg/kg, 8 μg kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg, 13 μg/kg, 14 μg/kg, 15 μg kg, 16 μg/kg, 17 μg/kg, 18 μg kg, 19 μg/kg, 20 μg/kg, 21 μg/kg,
22 μg/kg, 23 μg/kg, 24 μg/kg, 25 μg/kg, 26 μg/kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, 30 μg kg, 35 μg/kg, 40 μg/kg, 45 μg kg, 50 μg/kg, 55 μg/kg, 60 μg kg, 65 μg/kg, 70 μg/kg, 75 μg/kg, 80 μg/kg, 85 μg/kg, 90 μg kg, 95 μg/kg or 100 μg peptide construct and/or conjugate /kg of the individual.
[0253] In other aspects, the amount of the conjugate to be used is at most about 1 μg/kg, 2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg/kg, 6 μg/kg, 7 μg/kg, 8 μg/kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg, 13 μg/kg, 14 μg/kg, 15 μg/kg, 16 μg/kg, 17 μg/kg, 18 μg/kg, 19 μg/kg, 20 μg/kg, 21 μg/kg, 22 μg/kg, 23 μg/kg, 24 μg/kg, 25 μg/kg, 26 μg/kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, 30 μg/kg, 35 μg/kg, 40 μg/kg, 45 μg/kg, 50 μg/kg, 55 μg/kg, 60 μg/kg, 65 μg/kg, 70 μg/kg, 75 μg/kg, 80 μg/kg, 85 μg/kg, 90 μg/kg, 95 μg/kg or 100 μg conjugate/kg of the individual. In other aspects, the invention provides for a dosage of range of any of the values given above. For example, the lower limit of the dosage range can be about 1 μg/kg, 2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg/kg, 6 μg/kg, 7 μg/kg, 8 μg/kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg, 13 μg/kg,
14 μg/kg, 15 μg/kg, 16 μg/kg, 17 μg/kg, 18 μg/kg, 19 μg/kg, 20 μg/kg, 21 μg/kg, 22 μg/kg,
23 μg/kg, 24 μg/kg, 25 μg/kg, 26 μg/kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, 30 μg/kg, 35 μg/kg, 40 μg/kg, 45 μg/kg, 50 μg/kg, 55 μg/kg, 60 μg/kg, 65 μg/kg, 70 μg/kg, 75 μg/kg, 80 μg/kg, 85 μg/kg, 90 μg/kg, 95 μg/kg while the upper limit of the dosage range can be 2 μg/kg, 3 μg/kg, 4 μg/kg, 5 μg/kg, 6 μg/kg, 7 μg/kg, 8 μg/kg, 9 μg/kg, 10 μg/kg, 11 μg/kg, 12 μg/kg, 13 μg/kg, 14 μg/kg, 15 μg/kg, 16 μg/kg, 17 μg/kg, 18 μg/kg, 19 μg/kg, 20 μg/kg, 21 μg/kg, 22 μg/kg, 23 μg/kg, 24 μg/kg, 25 μg/kg, 26 μg/kg, 27 μg/kg, 28 μg/kg, 29 μg/kg, 30 μg/kg, 35 μg/kg, 40 μg/kg, 45 μg/kg, 50 μg/kg, 55 μg/kg, 60 μg/kg, 65 μg/kg, 70 μg/kg, 75 μg/kg, 80 μg/kg, 85 μg/kg, 90 μg/kg, 95 μg/kg or 100 μg/kg. Exemplary dosing frequencies for the administration of the peptide constructs include, but are not limited to, daily, every two days, every three days, every four days, every five days, every six days, weekly without break, weekly for three out of four weeks, once every three weeks, once every two weeks, or two out of three weeks. In some embodiments, the composition is administered about once every 2 weeks, once every 3 weeks, once every 4 weeks, once every 6 weeks, or once every 8 weeks. In some embodiments, the composition is administered at least about any of lx, 2x, 3x, 4x, 5x, 6x, or 7x (i.e., daily) a week. In some embodiments, the intervals between each administration are less than about any of 6 months, 3 months, 1 month, 20 days, 15, days, 14 days, 13 days, 12 days, 11 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days, or 1 day. In some embodiments, the intervals between each administration are more than about any of 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, or 12 months. In some embodiments, there is no break in the dosing schedule. In some embodiments, the interval between each administration is no more than about a week.
[0254] In some embodiments, the dosing frequency is once every two days for one time, two times, three times, four times, five times, six times, seven times, eight times, nine times, ten times, and eleven times. In some embodiments, the dosing frequency is once every two days for five times. The administration of the composition can be extended over an extended period of time, such as from about a month up to about seven years. In some embodiments, the composition is administered over a period of at least about any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 18, 24, 30, 36, 48, 60, 72, or 84 months. The dosing frequency of the composition may be adjusted over the course of the treatment based on the judgment of the administering physician.
Additional Exemplary Embodiments
[0255] The present application in some embodiments provides a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
[0256] In some embodiments according to (or as applied to) any of the embodiments above, the peptide construct is a fusion peptide.
[0257] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises PX1X2X3X4 (SEQ ID NO: 128), wherein Xi is a hydrophobic residue, X2 is a residue that preserves hydrogen bonding with CtBP, X3 is a hydrophobic residue, and X4 is a residue that preserves hydrogen bonding with CtBP.
[0258] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises PX1X2X3X4 (SEQ ID NO: 129), wherein Xi is L, V, I, M, Q, or E, X2 is D or N, X3 is L or I, and X4 is S, C, T, V or A.
[0259] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises PXiDLS (SEQ ID NO:2).
[0260] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises PXiDLSX2K (SEQ ID NO:6).
[0261] In some embodiments according to (or as applied to) any of the embodiments above, inhibitory peptide comprises SEQ ID NO: l.
[0262] In some embodiments according to (or as applied to) any of the embodiments above, inhibitory peptide comprises SEQ ID NO: 132. [0263] In some embodiments according to (or as applied to) any of the embodiments above, inhibitory peptide comprises SEQ ID NO: 133.
[0264] In some embodiments according to (or as applied to) any of the embodiments above, inhibitory peptide comprises SEQ ID NO: 134.
[0265] In some embodiments according to (or as applied to) any of the embodiments above, the binding affinity of the inhibitory peptide to CtBP is the same or higher than that of SEQ ID NO:l.
[0266] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises no more than about 25 amino acids.
[0267] In some embodiments according to (or as applied to) any of the embodiments above, the inhibitory peptide comprises no more than about 15 amino acids.
[0268] In some embodiments according to (or as applied to) any of the embodiments above, the peptide construct comprises SEQ ID NO: 127.
[0269] In some embodiments according to (or as applied to) any of the embodiments above, the peptide construct comprises SEQ ID NO: 137.
[0270] In some embodiments according to (or as applied to) any of the embodiments above, the peptide construct is modified for conjugation to a carrier molecule.
[0271] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is an amphipathic peptide or anionic peptide.
[0272] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is a cationic peptide.
[0273] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is selected from the group consisting of Tat, pAntp, Arg9, plsl, and Pepl.
[0274] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is directly fused to the inhibitory peptide.
[0275] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is fused to the inhibitory peptide via a peptide linker.
[0276] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is fused to the N-terminus of the inhibitory peptide.
[0277] In some embodiments according to (or as applied to) any of the embodiments above, the cell penetrating peptide is fused to the C-terminus of the inhibitory peptide.
[0278] The present application in some embodiments provides a pharmaceutical composition comprising a peptide construct described above. [0279] The present application in some embodiments provides a conjugate comprising a peptide construct described above and a carrier molecule.
[0280] In some embodiments according to (or as applied to) any of the embodiments above, the carrier molecule is PEG.
[0281] The present application in some embodiments provides a pharmaceutical composition comprising a conjugate described above.
[0282] The present application in some embodiments provides a method of inhibiting cell proliferation in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
[0283] The present application in some embodiments provides a method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
[0284] In some embodiments according to (or as applied to) any of the embodiments above, the cancer is cancer having a p53 mutation.
[0285] The present application in some embodiments provides a method of treating an inflammatory disease (such as psoriasis) in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
[0286] The present application in some embodiments provides a method of inhibiting inflammation in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
[0287] The present application in some embodiments provides a method of treating psoriasis (such as psoriasis volgaris) in an individual comprising administering to the individual an effective amount of a pharmaceutical composition described above.
[0288] In some embodiments according to (or as applied to) any of the embodiments above, the pharmaceutical composition is administered intravenously, intratumorally, subcutaneously, orally, and topically.
EXAMPLES
[0289] The invention is illustrated by the following examples which are not intended to be limiting in any way. Example 1: CtBP is Overexpressed in Cancer
Methods and Materials
[0290] The ability of peptides to inhibit CtBP binding can be monitored by two biochemical assays. An AlphaScreen assay (Perkin-Elmer) was developed that is capable of detecting the CtBP-ElA interaction. Purified GST-E1A and 6xHis-CtBP are incubated with glutathione-conjugated donor beads and nickel-chelated acceptor beads respectively. The interaction between CtBP and E1A brings the donor and acceptor beads in close proximity, which produces a fluorescence signal after laser excitation and can be detected using the En Vision plate reader. A peptide that inhibits this interaction will limit the proximity of the beads and thus a loss in fluorescence signal will occur. In addition to the alphascreen, a fluorescence polarization based assay with a fluorescein-labeled 14mer E1A peptide (EPGQPLDLSCKRPR) was also developed. Purified 6xHis-CtBP is incubated with the fluorescein-labeled E1A peptide and changes in the polarization value of the labeled peptide are detected using the En Vision plate reader. A decrease in peptide binding to CtBP can be detected by an increase in polarization, and used to monitor peptide inhibition. IC50 values of designed peptides can be determined using either of these assays through the addition of increasing amounts in each well and monitoring the degree of inhibition of the CtBP-ElA interaction.
[0291] Genome-wide mRNA expression changes in HNSCC cells upon CtBP knockdown were profiled. Fadu, a human HNSCC line, was purchased from ATCC and cultured in DMEM with 10% FBS. To knockdown CtBP, cells were treated with siRNA against human CtBP from Dharmacon using Lipofectamine 2000 (Invitrogen) for 48 hours, then harvested. Western blotting was performed using CtBP antibody (Millipore) to confirm the knockdown of CtBP. Total RNA was isolated using TRIzol (Invitrogen) as previously described (Zhang et al., 2006). mRNA was isolated using oligo-dT magnetic beads and sheared to 100-150 bp fragment. mRNA libraries were constructed following the Illumina RNA-seq protocol and sequenced on a GAIIx at the UC Denver Sequencing Facility. The differentially expressed genes were used for pathway enrichment analysis using NIH-DAVID and the KEGG pathway definitions (Huang da et al., 2009; Kanehisa et al., 2010).
[0292] All animal experiments were performed with the approval of IACUC at University of Colorado Denver.
[0293] Total RNA was isolated using TRIzol (Invitrogen) as previously described (Zhang et al., 2006). One hundred nanograms of RNA from each sample were subjected to qRT-PCR (ThermoFisher). An 18S probe was used as an internal control. Each sample was examined in triplicate. Relative RNA expression levels were determined by normalizing with internal controls, the values were calculated using the comparative Ct method.
Results
[0294] CtBP is overexpressed in multiple human cancers, starting at the hyperplasia stage. CtBP is an important regulator of embryonic development and its expression level is low or undetectable in many adult tissues (Furusawa et al., 1999; Deng et al., 2010; Hildebrand and Soriano, 2002). Figure 1 shows that CtBP is re-expressed in a number of cancers, including lung and breast cancers. In invasive ductal breast cancer, positive nuclear CtBP staining was found in 92% of cases. In contrast, only 4% of normal breast tissue stained positive for CtBP (Deng et al., 2011). Figures 1 A-C show that similar upregulation of CtBP was found in HNSCC (Head and Neck Squamous Cell Carcinoma), starting at the hyperplasia stage. Moreover, CtBP expression in human cancers transcriptionally represses the well-known tumor suppressors Brcal and E-cadherin (Deng et al., 2011 ; Deng et al., 2010), consistent with the metastatic characteristics initially identified for CtBP (Boyd et al., 1993). These data suggest CtBPl is up-regulated early during cancer development and likely contributes to both cancer initiation and development. Furthermore, when CtBP was expressed in the non- transformed human mammary epithelial cells to mimic the CtBP overexpression found in human cancers, cell migration and resistance to radiation/chemo reagents were increased by CtBP expression (data not shown). Therefore, inhibition of CtBP may serve as a therapeutic approach for multiple cancer types.
Example 2: CtBP Knockdown is Sufficient to Suppress Tumorigenesis in vivo
[0295] Previous studies have shown that CtBP-null Ras-transformed cells are less tumorigenic (Grooteclaes et al., 2003), consistent with their increased sensitivity to pro- apoptotic stimuli. In order to directly evaluate the role of CtBP in human tumorigenesis in vivo, a tet-inducible siRNA targeting CtBP was constructed and stable clones were established in the human non-small cell carcinoma cell line H1299. Inclusion of
Doxylcycline at 10 μg/mL in the tissue culture medium induced knockdown of CtBP proteins (Figure 8) and triggered apoptosis (data not shown). Next, H1299 cells harboring the CtBP siRNA-expressing construct were inoculated to SCID mice subcutaneously. Briefly, lxlO6 cells in 0.1 mL DMEM were injected in the left hind flanks of 6-month-old female CB 17SC- RFM SCID mice. The mice were randomly divided into two groups of 10 mice per group. The treatment group received Doxylcycline (1 mg/mL in drinking water) right after tumor inoculation, whereas the control group received no treatment. Tumor diameters were measured every 5 days and tumors were weighed after necropsy. Figures 2B and 2C show that whereas sizable tumors developed in the control group, Doxylcycline-induced siRNA to CtBP dramatically reduced the tumor growth of HI 299 xenografts. This data further supports inhibition of CtBP as a therapeutic approach for cancer therapy.
Example 3: Cell Penetrating Peptide (CPP)-EIA Functions as a CtBP Blocker
[0296] To further pursue novel drugs that inhibit CtBP-mediated pathological alterations, we designed peptide inhibitors (i.e., high-throughput screening was used to identify small molecule inhibitors) of the CtBP and E1A interaction. Such inhibitors should also inhibit the interaction between CtBP and its transcriptional partners because they share the same binding motif as El A.
[0297] The peptides Tat-El A-flag (SEQ ID NO: 110) and Pepl-El A-flag (SEQ ID NO: 113) were expressed and purified from E. coli. The purified Tat-El A-flag peptide inhibited the CtBP/ElA interaction with an IC50 of -7.7 μΜ, as shown in Figure 3. H1299 cells were incubated with the Pepl-El A-flag peptide (i.e. , CPP-E1 A-flag peptide), the cells were separated into cytoplasmic and nuclear fractions, and the presence of the CPP-ElA-flag peptide was probed using an anti-flag antibody in a Western blot. Figure 4 shows an example of the Western blot of Pepl-El A-flag treated cells, demonstrating that the CPP-E1 A-flag peptide enters both the cytoplasm and the nucleus.
[0298] Next, the effect of Tat-EIA on cell viability using A375 derived from melanoma cells and HI 299 derived from non-small cell lung carcinoma, both of which overexpress CtBP, as well as 3T3, which does not significantly overexpress CtBP, was examined. Figure 5 shows that Tat-EIA reduces the viability of A375 and H1299 cells but does not affect 3T3 cells. The Tat peptide alone has no effect on these cells.
[0299] Subsequently, the transcription levels of the endogenous CtBP target genes BAX, BRCA1, and E-Cadherin in Tat-EIA treated H1299 cells were evaluated using real-time PCR. As shown in Figure 6, increasing concentrations of Tat-EIA peptide demonstrated a dose-dependent alleviation of CtBP-mediated suppression of these genes, suggesting that the Tat-EIA peptide inhibits the interaction between CtBP and these transcription factor partners. Example 4: Pepl-EIA Reduces Proliferation and Inflammation in a Psoriasis Model
[0300] To further evaluate the therapeutic effect of the CPP-E1A peptide, an IMQ-based psoriasis model was adopted and the efficacy of the CPP-E1A peptide was evaluated. Pepl- E1A treatment largely reduced the psoriasis-like phenotype when the Pep 1 -El A peptide was either injected subcutaneously, as shown in Figure 7, or applied on the skin (data not shown). The PBS-control group displayed inflamed scaly skin lesions resembling plaque type psoriasis following IMQ-induction. Mice treated with Pepl-EIA showed resistance to the IMQ-induction of psoriasis, as depicted in Figure 7A.
[0301] To elucidate the molecular mechanisms for the Pepl-EIA blocker, H&E and immunostaining for proliferative and inflammatory markers was performed. As shown in Figure 7B, Pepl-EIA treatment largely reduced the BrdU incorporation, suggesting that blocking CtBPl decreases the over-proliferation seen in psoriasis. Figure 7B also shows that prominent inflammation, as revealed by CD45 staining and observed in IMQ-induced mice skin, was largely prevented by Pepl-EIA treatment. These data demonstrate that blocking CtBPl function is effective in combating proliferating and inflammatory diseases.
Example 5: Phage Display Screening to Identify High Affinity CtBP Binding Peptides
[0302] A short peptide (14 residues) with a desired random sequence is cloned into an M13KE gene III cloning vector of the Ph.D.™ Phage Display System (New England Biolabs). This cloning vector is a modified phage (M13) that can be propagated in bacteria to obtain a starting phage library with peptides displayed at the N-termini of gene II coat protein on phage surfaces. Purified CtBP is biotinylated following New England Biolab's standard biotinylation procedure, and immobilized onto petri dishes coated with streptavidin. The resulting phage library is incubated with CtBP and phages that do not bind are washed away.
[0303] Phages that bind CtBP are eluted, propagated, and subjected to one or more rounds of selection (i.e., another 3-5 rounds of selection). After the final round of selection, the gene encoding the peptide is sequenced to obtain the sequence of the peptide that binds tightly.
[0304] Multiple amino acid sequences may appear at positions outside the conserved peptide motif. The most frequently occurring amino acids in these positions are used to design the peptides that bind CtBP with the highest affinity. The affinity of these new peptides is compared to the original 14mer El A peptide (SEQ ID NO: l) by comparing the IC50 of these peptides in inhibiting the CtBP/ElA protein interaction in a competition assay. The peptide identified from phage display that competes with the CtBP/ElA protein interaction better than the original 14mer El A peptide is selected and conjugated to the cell penetrating peptide of the present invention. The peptides used in the assay described herein are provided in Table 3. Also provided in Table 3 are IC50 for selected peptides.
Table 3
Figure imgf000120_0001
GSHM
Pepl-EIA- 119 GS HMKETWWET WWTE W S QPKKKRK VLEEPGQPLDLS C
Flag KRPRDYKDDDDK
GSHM
Pepl-EIA- 120 GS HMKETWWETWWTEWS QPKKKRKVLEEPGQPLDELC
Flag KRPRDYKDDDDK
(LS-EL)
GSHM
Pepl-EIA- 121 GS HMKETWWET WWTE W S QPKKKRKVLEEPGQPLDELC
Flag QRPRDYKDDDDK
(K239Q)
GSHM
Pepl-EIA- 126 KETWWETWWTEWSQPKKKRKVLEEPGQPLDLSCQRPR
Flag DYKDDDDK
(K239Q)
v.l
Pepl-EIA- 127 GS HMKETWWETWWTEWS QPKKKRK VLEEPGQPLDLS C
Flag QRPRDYKDDDDK
(K239Q)
GSHM
v.l
Example 6: Use of mRNA display technology to identify cell-penetrating peptides specific to cancer
[0305] A DNA library encoding random peptides is in vitro transcribed and linked to puromycin through a DNA linker, which enables the generation of an mRNA-puromycin- peptide fusion upon in vitro translation. This mRNA-peptide fusion is incubated with specific cell lines (e.g., non-small cell lung cancer cell lineH1299, breast cancer cell line MCf 7, melanoma cell line A375, colon cancer cell line HT-29, or others), extensively washed, and cell-penetrating peptides are recovered through RT-PCR and sequencing of the mRNAs. Rounds of selection generate cell penetrating peptides that enter cells with high efficiency. Cell-penetrating peptides are screened as described in Kondo et al. (2012) Nat Commun. 3: 951. Example 7: Peptide Assay for IC50 binding
[0306] The ability of peptides to inhibit CtBP binding can be monitored by two biochemical assays. An AlphaScreen assay (Perkin-Elmer) was developed that is capable of detecting the CtBP-ElA interaction. Purified GST-EIA and 6xHis-CtBP are incubated with glutathione-conjugated donor beads and nickel-chelated acceptor beads respectively. The interaction between CtBP and EIA brings the donor and acceptor beads in close proximity, which produces a fluorescence signal after laser excitation and can be detected using the En Vision plate reader. A peptide that inhibits this interaction will limit the proximity of the beads and thus a loss in fluorescence signal will occur. In addition to the alphascreen, a fluorescence polarization based assay with a fluorescein-labeled 14mer EIA peptide (EPGQPLDLSCKRPR) was also developed. Purified 6xHis-CtBP is incubated with the fluorescein-labeled EIA peptide and changes in the polarization value of the labeled peptide are detected using the En Vision plate reader. A decrease in peptide binding to CtBP can be detected by an increase in polarization, and used to monitor peptide inhibition. IC50 values of designed peptides can be determined using either of these assays through the addition of increasing amounts in each well and monitoring the degree of inhibition of the CtBP-ElA interaction. The peptides used in the assay described herein are provided in Table 4. Also provided in Table 4 are IC50 for selected peptides.
Table 4
Figure imgf000122_0001
(K239Q)
Pepl-EIA- 113 KETWWETWWTEWSQPKKKRKVLEEPGQPLDLSCKRPR 26.62 Flag DYKDDDDK
Pepl-EIA- 114 KETWWETWWTEWSQPKKKRKVLEEPGQPLDELCKRPR
Flag DYKDDDDK
(LS-EL)
Pepl-EIA- 115 KETWWETWWTEWSQPKKKRKVLEEPGQPLDELCQRPR
Flag DYKDDDDK
(K239Q)
Tat-EIA- 116 GS HMGRKKRRQRRRPPQLEEPGQPLDLS CKRPRD YKDD
Flag DDK
GSHM
Tat-EIA- 117 GSHMGRKKRRQRRRPPQLEEPGQPLDELCKRPRDYKDD Flag DDK
(LS-EL)
GSHM
Tat-EIA- 118 GS HMGRKKRRQRRRPPQLEEPGQPLDLS CQRPRD YKDD Flag DDK
(K239Q)
GSHM
Pepl-EIA- 119 GS HMKETWWET WWTE W S QPKKKRK VLEEPGQPLDLS C
Flag KRPRDYKDDDDK
GSHM
Pepl-EIA- 120 GS HMKETWWET WWTE W S QPKKKRK VLEEPGQPLDELC Flag KRPRDYKDDDDK
(LS-EL)
GSHM
Pepl-EIA- 121 GS HMKETWWET WWTE W S QPKKKRK VLEEPGQPLDELC Flag QRPRDYKDDDDK
(K239Q)
GSHM
Pepl-EIA- 126 KETWWETWWTEWSQPKKKRKVLEEPGQPLDLSCQRPR Flag DYKDDDDK
(K239Q)
v.l
Pepl-EIA- 127 GS HMKETWWET WWTE W S QPKKKRK VLEEPGQPLDLS C
Flag QRPRDYKDDDDK
(K239Q)
GSHM
v.l [0307] Additional peptides were tested for in vitro inhibitory potency (Table 5). For Kd determination, FITC-labeled peptide (FITC -peptide) was incubated with varying
concentrations of CtBP. The fluorescence polarization values of the FITC -peptide were measured and plotted against CtBP concentration to determine Kd of the FITC -peptide with CtBP using the Prism program. The peptide EQTVPVDLSVARPR (SEQ ID NO: 133) demonstrated an improved Kd of 2.2 μΜ as compared to the peptide EPGQPLDLSCKRPR (SEQ ID NO:l) which had a Kd of 4.3 μΜ (Table 5). For IC50 determination, a fluorescence polarization assay was utilized. A FITC-labeled 14mer peptide was incubated with CtBP which produced relatively high fluorescence polarization values. Increasing concentrations of unlabeled peptide were added to compete with the FITC-labeled peptide, leading to a decreased fluorescence polarization value. An IC50 was calculated to represent the concentration of the unlabeled peptide that resulted in 50% reduction of the fluorescence polarization value. The peptide EPGQPLSLSCKRPR (SEQ ID NO: 135) did not inhibit CtBP even though it only differed from the peptide EPGQPLDLSCKRPR (SEQ ID NO: 1) at one residue in the middle of the recognition motif. The peptide PTDEPLNLSLKRPR (SEQ ID NO: 134) demonstrated an improved IC50 of 4.4 μΜ as compared to the peptide
EPGQPLDLSCKRPR (SEQ ID NO:l) which had an IC50 of 6.0 μΜ (Table 5).
Table 5. Peptides tested for in vitro inhibitory potency
Figure imgf000124_0001
Example 8: CtBPl Transactivates TGF-βΙ
Methods and Materials
mRNA-seq
[0308] Genome-wide mRNA expression changes in HNSCC cells upon CtBPl knockdown were profiled. Fadu, a human HNSCC line, was purchased from ATCC and cultured in DMEM with 10% FBS. To knockdown CtBPl, cells were treated with siRNA against human CtBPl from Dharmacon using Lipofectamine 2000 (In vitro gen) for 48 hours, then harvested. Western blotting was performed using CtBPl antibody (Millipore) to confirm the knockdown of CtBPl. Total RNA was isolated using TRIzol (Invitrogen) as previously described (Zhang et al., 2006). mRNA was isolated using oligo-dT magnetic beads and sheared to 100-150 bp fragment. mRNA libraries were constructed following the Illumina RNA-seq protocol and sequenced on a GAIIx at the UC Denver Sequencing Facility. The differentially expressed genes were used for pathway enrichment analysis using NIH- DAVID and the KEGG pathway definitions (Huang da et al., 2009; Kanehisa et al., 2010).
Generation and identification ofK5. CtBPl mice
[0309] All animal experiments were performed with the approval of IACUC at University of Colorado Denver. The - 1.4 kb full-length wild-type human CtBPl cDNA was inserted into the K5 expression vector (He et al., 2002). The K5. CtBPl transgenic mice were generated with the B6D2 strain by microinjection of the transgene into the pronuclei of mouse embryos. Mice were genotyped by PCR analysis of tail DNA utilizing primers specific for BK5 (tctgataggcagcctgcacc) and CtBPl (atcccagctgctgtggaagg). Throughout this study, all transgenic mice were heterozygous; all wild type mice were littermates, and at least three independent analyses were performed for each assay, using three to five samples in each group.
Human Samples
[0310] Psoriasis and case-matched normal skin tissue samples were surgically resected between the years 2007 and 2009 from consenting patients at the Department of
Dermatology, University of Colorado Denver under an Institutional Review Board approved protocol. Human skin biopsy specimens were taken from lesions of patients with chronic plaque-type psoriasis and normal skin of healthy donors.
Tissue histology, immunofluorescence, and immunohistochemistry
[0311] Skin histology was visualized with hematoxylin and eosin (H&E) staining.
Immunofluorescence and immunohistochemistry were performed on frozen and paraffin- embedded sections as previously described (Wang et al., 1999). Immunofluorescence was performed using antibodies against CD45, CD4, CD31 (BD Biosciences); Ly-6G (eBioscience); F4/80 (Caltag Laboratories); ALK1 (R&D Systems); pSmad2 (Cell
Signaling); and Keratin 14 (Fitzgerald). The antibodies used in immunohistochemistry included CtBPl (Millipore), and TGF-βΙ (R&D Systems). Biotinylated secondary antibodies were used in conjunction with an avidin-peroxidase reagent (VECTASTAIN®) and visualized using diaminobenzidine (Sigma). qRT-PCR
[0312] Total RNA was isolated using TRIzol (Invitrogen) as previously described (Zhang et al., 2006). One hundred nanograms of RNA from each sample were subjected to qRT-PCR (ThermoFisher). An 18S probe was used as an internal control. Each sample was examined in triplicate. Relative RNA expression levels were determined by normalizing with internal controls, the values were calculated using the comparative Ct method.
In vivo knockdown by delivery siRNA to mouse skin
[0313] A biodegradable polymer PEI F25-LMW (polyethylenimines, F25 low molecular weight, Sigma) was used as a delivery vehicle, preventing degradation and increasing cellular uptake of siRNA in vivo without noticeable toxicity (Hobel et al., 2010). TGF-βΙ siRNA from Dharmacon mixed with PEI F25-LMW was injected into K5.QBP1 skin twice/week for 3 weeks.
Cell culture and transfections
[0314] Fadu, a human HNSCC line, was purchased from ATCC and cultured in DMEM with 10% FBS. To knockdown CtBPl, cells were treated with siRNA against human CtBPl from Dharmacon using Lipofectamine 2000 (Invitrogen) for 48 hours, and harvested. Western blotting was performed as previously described (Zhang et al., 2003).
Chromatin immunoprecipitation ( ChIP) and luciferase reporter assay
[0315] Fadu cells were used for ChIP assay with an anti-CtBPl antibody and normal rabbit IgG as described previously (Zhang et al., 2006). Sequential ChlPs were carried out using an anti-CtBPl antibody following the first ChIP with an anti-c-Jun antibody (Abeam) or an anti-Spl antibody (Santa Cruz) (Deng et al., 2010; Hoot et al., 2010). Primer sets spanning the TGF-βΙ promoter were used to q-PCR-amplify the ChIP sample. The pGL4.26 TGF-βΙ promoter luciferase reporter plasmid was generated by cloning a PCR-amplified 633 bp fragment of the TGF-βΙ promoter into the Kpnl and Bglll sites of pGL4.26 vector (Promega). TGF-βΙ promoter-specific primers used were 5'-ggggtaccACCTTGTTTCC-3' (forward, -strand) and 5'- gaagatctCTCCTCCCCGC-3' (reverse, + strand). Site-directed mutagenesis was performed to generate the mutation at the distal AP-1 site (mtl:
TGACTCT to TGgtTCT), the proximal AP-1 site (mt2: TGTCTCA to gtTCTCA), or the SP1 site (mt3: GCCCGCC to GCCtaCC). An empty renilla luciferase vector (pGL4.79) was used for normalization. Fadu cells were co-transfected with the reporters and siRNA to CtBPl for 48 hr and luciferase activity was measured (Zhang et al., 2002). Scrambled siRNA or empty plasmid was used for controls.
Results
[0316] Genome-wide mRNA-seq analysis was performed in Fadu cells with and without CtBPl knockdown. Upon CtBPl knockdown, 102 genes were up-regulated while 200 genes were down-regulated with a two fold cutoff. Genes with significant changes were used for pathway enrichment analysis using NIH-DAVID (Huang da et al., 2009) and the KEGG pathway definitions (Kanehisa et al., 2010). The TGF-βΙ signaling pathway was identified in the signaling pathways highly regulated by CtBPl, as shown in Figure 8. In contrast to the conventional transcriptional repressive role of CtBPl, Figure 10A shows that TGF-βΙ and the canonical mediators for TGF-βΙ signaling were up-regulated by CtBPl, and thus abrogated by CtBPl knockdown.
[0317] Consistent with mRNA changes observed during CtBPl knockdown, the luciferase activity of the TGF-βΙ promoter decreased by 60% with CtBPl siRNA (Figure 10B), suggesting that CtBPl regulates TGF-βΙ transcription via its promoter. As a central mediator for cell growth, inflammation, and angiogenesis, transcriptional regulation of TGF-βΙ has attracted intensive study and the regulatory sites at its promoter are well characterized. We asked if CtBPl could form an active transcription complex at the TGF-βΙ promoter via the previously identified AP-1 sites and the Spl site, which are critical for TGF- βΐ activation (Kim et al., 1989; Weigert et al., 2000). To determine if these cis-elements mediate TGF-βΙ activation by CtBPl, the AP-1 sites and Spl site were individually mutated. As shown in Figure 10B, the mutation at the proximal AP-1 site or the Spl site did not affect the TGF-βΙ promoter-driven luciferase reporter activity, but the mutation in the distal AP-1 site attenuated the TGF-βΙ promoter-driven luciferase reporter activity.
Figure 1 0B show s that the expression level of the TGF-βΙ promoter-driven lucif erase reporter with the mutated distal AP-1 site is similar to the expression level of the wild type promoter-driven luciferase reporter with the CtBPl knockdown in Fadu cells, suggesting that CtBPl regulates TGF-βΙ through the distal AP-1 site.
[0318] To determine whether CtBPl plays a direct role in the regulation of TGF-βΙ gene, chromatin immunoprecipitation (ChIP) was performed to see if CtBPl is recruited to the TGF-βΙ promoter. As shown in the top panel of Figure IOC, immunoprecipitation of the cross-linked chromatin with the antibody specific for CtBPl revealed that CtBPl bound the TGF-βΙ promoter in Fadu cells. Furthermore, sequential ChIP using an anti-c-Jun antibody and then an anti-CtBPl antibody revealed that CtBPl binds to the TGF-βΙ promoter through c-Jun (Figure IOC, bottom panel). This finding supports participation of the AP-1 site in CtBPl -mediated activation. In contrast, the middle panel of Figure IOC shows that no CtBPl binding to the TGF-βΙ promoter via Spl was observed using sequential ChIP with an anti-Spl antibody, followed by an anti-CtBPl antibody.
Example 9: CtBPl Overexpression Causes Inflammation and Increases Angiogenesis Associated with Enhanced TGF-βΙ Signaling
[0319] Both CtBPl and TGF-βΙ are expressed at very low levels in most adult tissue, making it difficult to use CtBPl knockout mice to assess whether CtBPl mediated TGF-βΙ activation has functional consequences. Therefore, K5. CtBPl transgenic mice were generated by inserting human CtBPl cDNA (99% amino acid homology to mouse CtBPl protein) into a K5 vector (He et al., 2002). When CtBPl transgene expression levels were 3- fold higher than endogenous CtBPl levels in skin (Figure 12B), K5.QBP1 mice displayed an inflammatory phenotype (Figure 11 A). Consistent with the results from the genome- wide expression analysis and cell based assays, TGF-βΙ mRNA was foun d to b e up- regulated by the CtBPl transgene in mouse skin, as shown in Figure 11B. Histopathology shows that K5. CtBPl skin contains numerous infiltrated leukocytes and increased vessel numbers (data not shown). Therefore, tissue sections were stained with CD45 antibody, confirming the presence of leukocytes in transgenic epidermis and dermis but very few in wild type skin (Figure 11C). To further identify infiltrating leukocyte subtypes in CtBPl- transgenic skin, antibodies specific for leukocyte subtype markers were used. K5.QBP1- transgenic epidermis and dermis contained Ly-6G positive granulocytes, as shown in Figure l lC. Staining with an F4/80 antibody showed that K5. CtBPl dermis contained macrophages and CD4+ T cells were present in K5.QBP1 dermis (Figure 11C). [0320] K5.QBP1 transgenic skin also exhibited increased angiogenesis, confirmed by immunofluorescence staining with the endothelial marker CD31, as shown in Figure 11D. Furthermore, the endothelial-specific type I TGF-βΙ receptor ALK1, only expressed during the active phase of TGF-βΙ -mediated angiogenesis (Goumans et al., 2003; Goumans et al., 2002), was increased in CtBPl -transgenic skin (Figure HE). These results suggest that activated TGF-βΙ signaling in the stroma contributes to increased inflammation and angiogenesis in K5.QBP1 skin.
Example 10: CtBPl is Overexpressed in Psoriasis Lesions and the Inflammatory Phase of Wound Healing in Mouse Skin
[0321] If CtBPl transactivates TGF-βΙ in vivo, CtBPl would be expected to be elevated in parallel with TGF-βΙ overexpression under some pathological conditions. It has been shown that TGF-βΙ is overexpressed in human psoriasis (Flisiak et al., 2008; Nockowski et al., 2004). Skin biopsies from healthy volunteers and psoriasis patients were examined. All 10 psoriasis samples displayed uniform nuclear CtBPl staining in the epidermis, as shown in Figure 12A. Cells with CtBPl positive nuclei were also detected in infiltrated leukocytes between rete ridges. In contrast, all 10 normal skin samples showed only sporadic CtBPl - positive cells in the epidermis and stroma (Figure 12A). Next, CtBPl expression in mouse skin wounds was examined, in which TGF-βΙ is elevated at the acute inflammation phase (Li et al., 2004). A 6-mm punch biopsy induced CtBPl expression 3-4 fold higher than non-wounded skin on day 3 after wounding, sho wn in Figure 1 2B , when TGF-βΙ is at its peak level during wound healing (Li et al., 2004). Immunofluorescence showed nuclear CtBPl staining primarily in the migrating tongue behind the leading edge and in the wound stroma (Figure 12C). These data suggest that CtBPl plays a role in the inflammatory response and that CtBPl overexpression may contribute to pathological conditions such as psoriasis and chronic inflammation.
Example 11: TGF-βΙ Signaling is Responsible for Inflammation and Angiogenesis in K5.CtBPl Skin
[0322] K5.QBP1 skin displayed increased TGF-βΙ Signaling. The top panel of Figure 13 shows that the TGF-βΙ protein was barely detectable in wild type skin, but increased in both the epidermis and stroma of K5.QBP1 skin. Nuclear staining of phosphorylated Smad2 (pSmad2), a surrogate marker for activated TGF-βΙ signaling, was also more prominent in transgenic epidermis and stroma than in wildtype skin (Figure 13, bottom panel).
[0323] To determine whether TGF-βΙ activation is required for inflammation and angiogenesis in K5. CtBPl skin, in vivo knockdown of TGF-βΙ by delivery of TGF-βΙ siRNA to CtBPl transgenic skin was performed. The biodegradable polymer PEI F25-LMW (polyethylenimines, F25 low molecular weight, Sigma) was used as a delivery vehicle, preventing degradation and increasing cellular uptake of siRNA in vivo without noticeable toxicity (Hobel et al., 2010). TGF-βΙ siRNA mixed with PEI F25-LMW was injected into K5.QBP1 skin twice per week for 3 weeks to knockdown TGF-βΙ.
[0324] Figure 14A shows that inflammation, as shown by CD45 staining, was consequently significantly decreased by TGF-βΙ siRNA-treatment in K5. CtBPl skin. In addition, CD31+ vessels (Figure 14B) and ALKl-positive vessels (Figure 14C) were decreased. These data suggest that TGF-βΙ up-regulation is the key mediator of CtBPl 's effect on inflammation and angiogenesis.
Example 12: Treatment of Psoriasis by Interfering with the Interaction between E1A and CtBP
[0325] To evaluate the therapeutic effect of the El A derived peptide
EQTVPVDLSVARPR (SEQ ID NO: 132) that demonstrated high affinity to CtBPl (Kd=2.2 uM), a Tat- fusion peptide was synthesized and purified by HPLC (Figure 15 A). The Tat- E1A peptide was evaluated in an IMQ-based psoriasis model and the efficacy of the Tat-EIA peptide (GRKKRRQRRRPPQGGEQTVPVDLSVARPRGL; SEQ ID NO: 137) conjugated to FITC was compared to a Pep 1 -El A peptide
(GSHMKETWWETWWTEWSQPKKKRKVLEEPGQPLDLSCQRPRDYKDDDDK; SEQ ID NO:127). Tat-EIA peptide treatment significantly reduced the psoriasis-like phenotype when the Tat-EIA peptide was subcutaneously applied on the skin (Figure 15B). The PBS treated control group (Figure 15, diamond) displayed inflamed scaly skin lesions resembling plaque type psoriasis following IMQ-induction. Mice treated with either the Pep-El A peptide (Figure 15B, square) or the Tat-EIA peptide (Figure 15B, triangle) showed resistance to IMQ-induction of psoriasis.

Claims

1. A peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP.
2. The peptide construct of claim 1, wherein the peptide construct is a fusion peptide.
3. The peptide construct of claim 1 or 2, wherein the inhibitory peptide comprises PXiDLS (SEQ ID NO:2).
4. The peptide construct of claim 1 or 2, wherein the inhibitory peptide comprises PXiDLSX2K (SEQ ID NO:6).
5. The peptide construct of claim 4, wherein the inhibitory peptide comprises SEQ ID NO: l.
6. The peptide construct of any one of claims 1-5, wherein the binding affinity of the inhibitory peptide to CtBP is the same or higher than that of SEQ ID NO: 1.
7. The peptide construct of any one of claims 1-6, wherein the inhibitory peptide comprises no more than about 25 amino acids.
8. The peptide construct of claim 7, wherein the inhibitory peptide comprises no more than about 15 amino acids.
9. The peptide construct of any one of claims 1-8, wherein the peptide construct is modified for conjugation to a carrier molecule.
10. The peptide construct of any one of claims 1-9, wherein the cell penetrating peptide is an amphipathic peptide or anionic peptide.
11. The peptide construct of any one of claims 1-9, wherein the cell penetrating peptide is selected from the group consisting of Tat, pAntp, Arg9, plsl, and Pepl.
12. The peptide construct of any one of claims 1-11, wherein the cell penetrating peptide is directly fused to the inhibitory peptide.
13. The peptide construct of any one of claims 1-11, wherein the cell penetrating peptide is fused to the inhibitory peptide via a peptide linker.
14. The peptide construct of any one of claims 1-13, wherein the cell penetrating peptide is fused to the N-terminus of the inhibitory peptide.
15. A pharmaceutical composition comprising the peptide construct of any one of claims 1-14.
16. A conjugate comprising the peptide construct of any one of claims 1-14 and a carrier molecule.
17. The conjugate of claim 16, wherein the carrier molecule is PEG.
18. A pharmaceutical composition comprising the conjugate of any one of claims 16-17.
19. A method of inhibiting cell proliferation in an individual comprising administering to the individual an effective amount of a pharmaceutical composition of claims 15 or 18.
20. A method of treating cancer in an individual comprising administering to the individual an effective amount of a pharmaceutical composition of claims 15 or 18.
21. The method of claim 20, wherein the cancer is cancer having a p53 mutation.
22. The method of any one of claims 19-21, wherein the pharmaceutical composition is administered intravenously, intratumorally, subcutaneously, orally, and topically.
23. A method of treating an inflammatory disease in an individual, comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP.
24. A method of inhibiting inflammation in an individual having an inflammatory disease, comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between El A and CtBP.
25. The method of claim 23 or claim 24, wherein the therapeutic agent is a peptide construct comprising a cell penetrating peptide and the inhibitory peptide.
26. The method of claim 25, wherein the peptide construct is a fusion peptide.
27. The method of any one of claims 25-26, wherein the cell penetrating peptide is an amphipathic peptide or anionic peptide.
28. The method of any one of claims 25-27, wherein the cell penetrating peptide is selected from the group consisting of Tat, pAntp, Arg9, plsl, and Pepl.
29. The method of any one of claims 25-28, wherein the cell penetrating peptide is directly fused to the inhibitory peptide.
30. The method of any one of claims 25-29, wherein the cell penetrating peptide is fused to the inhibitory peptide via a peptide linker.
31. The method of any one of claims 25-30, wherein the cell penetrating peptide is fused to the N-terminus of the inhibitory peptide.
32. The method of claim 23 or claim 24, wherein the therapeutic agent comprises an inhibitory peptide not linked to a cell penetration peptide.
33. The method of any one of claims 23-32, wherein the inhibitory peptide comprises PXiDLS (SEQ ID NO:2), wherein Xi is any amino acid.
34. The method of any one of claims 23-33, wherein the inhibitory peptide comprise PXiDLSX2K (SEQ ID NO:6), wherein Xi and X2 are any amino acids.
35. The method of claim 34, wherein the inhibitory peptide comprises EPGQPLDLSCKRPR (SEQ ID NO:l).
36. The method of any one of claims 23-34, wherein the binding affinity of the inhibitory peptide to CtBP is the same or higher than that of EPGQPLDLSCKRPR (SEQ ID NO: l).
37. The method of any one of claims 23-36, wherein the inhibitory peptide comprises no more than about 25 amino acids.
38. The method of claim 37, wherein the inhibitory peptide comprises no more than about 15 amino acids.
39. The method of any one of claims 23-38, wherein the therapeutic agent is administered intravenously, intratumorally, subcutaneously, orally, and topically.
40. The method of any one of claims 23-39, wherein the inflammatory diseases is selected from the group consisting of psoriasis, mucositis, chronic wound, and trauma.
PCT/US2014/026874 2013-03-13 2014-03-13 Methods and compositions for treating cancer and inflammatory diseases WO2014160508A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US14/775,643 US9683025B2 (en) 2013-03-13 2014-03-13 Methods and compositions for treating cancer and inflammatory diseases
EP14772587.3A EP2970510A4 (en) 2013-03-13 2014-03-13 Methods and compositions for treating cancer and inflammatory diseases

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201361780901P 2013-03-13 2013-03-13
US201361780889P 2013-03-13 2013-03-13
US61/780,889 2013-03-13
US61/780,901 2013-03-13

Publications (2)

Publication Number Publication Date
WO2014160508A1 true WO2014160508A1 (en) 2014-10-02
WO2014160508A8 WO2014160508A8 (en) 2015-08-06

Family

ID=51625445

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/026874 WO2014160508A1 (en) 2013-03-13 2014-03-13 Methods and compositions for treating cancer and inflammatory diseases

Country Status (3)

Country Link
US (1) US9683025B2 (en)
EP (1) EP2970510A4 (en)
WO (1) WO2014160508A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11505574B2 (en) * 2016-11-29 2022-11-22 The Regents Of The University Of California Modulation of P53 for the treatment of cancer

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11746334B2 (en) 2018-11-21 2023-09-05 Mayo Foundation For Medical Education And Research Adenoviruses and methods for using adenoviruses
CA3138527C (en) 2019-04-29 2024-03-12 Mayo Foundation For Medical Education And Research Multivalent pd-l1 binding compounds for treating cancer
WO2021050689A1 (en) * 2019-09-11 2021-03-18 The Regents Of The University Of Colorado, A Body Corporate COMPOSITIONS, METHODS AND USES FOR TARGETING C-TERMINAL BINDING PROTEIN (CtBP) IN TRAUMATIC BRAIN INJURY

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998017806A1 (en) * 1996-10-18 1998-04-30 Targeted Genetics Corporation Mini-e1a genes and gene products
US6716964B1 (en) * 1997-12-12 2004-04-06 Saint Louis University CtIP, a novel protein that interacts with CtBP and uses therefor
WO2011103471A1 (en) * 2010-02-22 2011-08-25 Duke University Compositions and methods for the treatment of neurologic and psychiatric conditions

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998017806A1 (en) * 1996-10-18 1998-04-30 Targeted Genetics Corporation Mini-e1a genes and gene products
US6716964B1 (en) * 1997-12-12 2004-04-06 Saint Louis University CtIP, a novel protein that interacts with CtBP and uses therefor
WO2011103471A1 (en) * 2010-02-22 2011-08-25 Duke University Compositions and methods for the treatment of neurologic and psychiatric conditions

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
SCHAEPER U. ET AL.: "Interaction between a Cellular Protein That Binds to the C-terminal Region of Adenovirus E1A (CtBP) and a Novel Cellular Protein Is Disrupted by E1A through a Conserved PLDLS Motif", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 273, no. 15, 1998, pages 8549 - 8552, XP002918081 *
SCHAEPER U. ET AL.: "Molecular cloning and characterization of a cellular phosphoprotein that interacts with a conserved C-terminal domain of adenovirus E1A involved in negative modulation of oncogenic transformation", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES USA, vol. 92, 1995, pages 10467 - 10471, XP001245697 *
See also references of EP2970510A4 *
VOCERO-AKBANI A. ET AL.: "Transduction of Full-Length Tat Fusion Proteins Directly into Mammalian Cells: Analysis of T Cell Receptor Activation-Induced Cell Death", METHODS IN ENZYMOLOGY, vol. 322, pages 508 - 521, XP001155737 *
ZHANG Q. ET AL.: "Acetylation of adenovirus E1A regulates binding of the transcriptional corepressor CtBP", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES USA, vol. 97, no. 26, 2000, pages 14323 - 14328, XP002269408 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11505574B2 (en) * 2016-11-29 2022-11-22 The Regents Of The University Of California Modulation of P53 for the treatment of cancer

Also Published As

Publication number Publication date
EP2970510A1 (en) 2016-01-20
US20160159872A1 (en) 2016-06-09
EP2970510A4 (en) 2016-08-24
US9683025B2 (en) 2017-06-20
WO2014160508A8 (en) 2015-08-06

Similar Documents

Publication Publication Date Title
JP7368522B2 (en) Cell-penetrating peptides, conjugates containing the same, and compositions containing the same
CA2632451C (en) Cell penetrating peptides for intracellular delivery of molecules
US7579318B2 (en) Cell penetrating peptides for intracellular delivery of molecules
US8278413B2 (en) Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US10188699B2 (en) CAPCNA peptide therapeutics for cancer
EP1914310A2 (en) Cell-permeable peptide inhibitors of the JNK signal transduction pathway
US20160060314A1 (en) Development of a Protein-Based Biotherapeutic Agent That Penetrates Cell-Membrane and Induces Anti-Tumor Effect in Solid Tumors - Improved Cell-Permeable Suppressor of Cytokine Signaling (iCP-SOCS3) Proteins, Polynucleotides Encoding the Same, and Anti-Tumor Compositions Comprising the Same
WO2015063747A2 (en) Peptide inhibitors of tead/yap-taz interaction
US9683025B2 (en) Methods and compositions for treating cancer and inflammatory diseases
EP1795539B1 (en) Cell penetrating peptides for intracellular delivery of molecules
WO2018109771A1 (en) Fusion proteins for treatment of cancer
KR102348838B1 (en) Active TRAIL trimer and tumor targeting peptide multi-displayed on ferritin nanocage and use in anti-cancer agent thereof
US10316077B2 (en) Cell-penetrating ATF5 polypeptides and uses thereof
WO2007109908A1 (en) Therapeutic yb-1 phosphorylation decoys
KR102275912B1 (en) Peptide for inhibiting hsp expression and composition containing same
CN113195704A (en) Peptide therapeutics for treating cancer and uses thereof
EP2060581A1 (en) Scaffold proteins for recombinant peptide aptamers
CN111148752A (en) Peptide derivatives and pharmaceutical compositions containing the same

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14772587

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 14775643

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2014772587

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2014772587

Country of ref document: EP