WO2014152660A1 - Engineered antibody scaffolds - Google Patents
Engineered antibody scaffolds Download PDFInfo
- Publication number
- WO2014152660A1 WO2014152660A1 PCT/US2014/027588 US2014027588W WO2014152660A1 WO 2014152660 A1 WO2014152660 A1 WO 2014152660A1 US 2014027588 W US2014027588 W US 2014027588W WO 2014152660 A1 WO2014152660 A1 WO 2014152660A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- translational modification
- protein
- post translational
- binding
- Prior art date
Links
- 238000000034 method Methods 0.000 claims abstract description 136
- 230000004481 post-translational protein modification Effects 0.000 claims abstract description 108
- 108090000623 proteins and genes Proteins 0.000 claims description 174
- 102000004169 proteins and genes Human genes 0.000 claims description 141
- 230000027455 binding Effects 0.000 claims description 118
- 238000004873 anchoring Methods 0.000 claims description 96
- 125000000539 amino acid group Chemical group 0.000 claims description 40
- 230000026731 phosphorylation Effects 0.000 claims description 24
- 238000006366 phosphorylation reaction Methods 0.000 claims description 24
- 150000001450 anions Chemical class 0.000 claims description 18
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 claims description 16
- 229910019142 PO4 Inorganic materials 0.000 claims description 16
- 239000010452 phosphate Substances 0.000 claims description 16
- 235000000346 sugar Nutrition 0.000 claims description 16
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 claims description 15
- 230000006295 S-nitrosylation Effects 0.000 claims description 13
- 230000021736 acetylation Effects 0.000 claims description 13
- 238000006640 acetylation reaction Methods 0.000 claims description 13
- 230000013595 glycosylation Effects 0.000 claims description 13
- 238000006206 glycosylation reaction Methods 0.000 claims description 13
- 230000011987 methylation Effects 0.000 claims description 13
- 238000007069 methylation reaction Methods 0.000 claims description 13
- 230000019635 sulfation Effects 0.000 claims description 13
- 238000005670 sulfation reaction Methods 0.000 claims description 13
- 230000001323 posttranslational effect Effects 0.000 claims description 12
- 230000017854 proteolysis Effects 0.000 claims description 12
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 claims description 11
- 150000007942 carboxylates Chemical group 0.000 claims description 10
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 9
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 claims description 8
- OVRNDRQMDRJTHS-KEWYIRBNSA-N N-acetyl-D-galactosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-KEWYIRBNSA-N 0.000 claims description 8
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 claims description 8
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 claims description 8
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 claims description 8
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 claims description 8
- 150000001412 amines Chemical class 0.000 claims description 8
- 210000004899 c-terminal region Anatomy 0.000 claims description 8
- 239000000203 mixture Substances 0.000 abstract description 32
- 230000006870 function Effects 0.000 abstract description 9
- 230000011664 signaling Effects 0.000 abstract description 4
- 238000011161 development Methods 0.000 abstract description 3
- 230000001225 therapeutic effect Effects 0.000 abstract description 3
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 123
- 235000018102 proteins Nutrition 0.000 description 123
- 108090000765 processed proteins & peptides Proteins 0.000 description 109
- 239000000427 antigen Substances 0.000 description 68
- 235000001014 amino acid Nutrition 0.000 description 61
- 150000001413 amino acids Chemical class 0.000 description 61
- 108091007433 antigens Proteins 0.000 description 61
- 102000036639 antigens Human genes 0.000 description 61
- 229940024606 amino acid Drugs 0.000 description 59
- 102000004196 processed proteins & peptides Human genes 0.000 description 48
- 210000004027 cell Anatomy 0.000 description 40
- 210000004264 pstab Anatomy 0.000 description 40
- 101150096038 PTH1R gene Proteins 0.000 description 39
- 150000007523 nucleic acids Chemical class 0.000 description 39
- DCWXELXMIBXGTH-QMMMGPOBSA-N phosphonotyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-QMMMGPOBSA-N 0.000 description 37
- 102000039446 nucleic acids Human genes 0.000 description 36
- 108020004707 nucleic acids Proteins 0.000 description 36
- 239000013598 vector Substances 0.000 description 32
- 238000002965 ELISA Methods 0.000 description 29
- 229920001184 polypeptide Polymers 0.000 description 25
- 125000003275 alpha amino acid group Chemical group 0.000 description 21
- 238000002823 phage display Methods 0.000 description 21
- 102000040430 polynucleotide Human genes 0.000 description 21
- 108091033319 polynucleotide Proteins 0.000 description 21
- 239000002157 polynucleotide Substances 0.000 description 21
- 238000003556 assay Methods 0.000 description 19
- 238000003018 immunoassay Methods 0.000 description 18
- 239000000758 substrate Substances 0.000 description 18
- 108010001441 Phosphopeptides Proteins 0.000 description 16
- -1 phospho Chemical class 0.000 description 16
- 108020004705 Codon Proteins 0.000 description 15
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 15
- 238000001514 detection method Methods 0.000 description 15
- 241000894006 Bacteria Species 0.000 description 14
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 14
- 239000013078 crystal Substances 0.000 description 14
- 239000012634 fragment Substances 0.000 description 14
- 239000002773 nucleotide Substances 0.000 description 14
- 125000003729 nucleotide group Chemical group 0.000 description 14
- 235000021317 phosphate Nutrition 0.000 description 14
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 13
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 13
- 239000013604 expression vector Substances 0.000 description 13
- 239000000523 sample Substances 0.000 description 13
- 239000007787 solid Substances 0.000 description 13
- 230000004048 modification Effects 0.000 description 12
- 238000012986 modification Methods 0.000 description 12
- 239000000243 solution Substances 0.000 description 12
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 11
- 230000001580 bacterial effect Effects 0.000 description 11
- VHRGRCVQAFMJIZ-UHFFFAOYSA-N cadaverine Chemical compound NCCCCCN VHRGRCVQAFMJIZ-UHFFFAOYSA-N 0.000 description 11
- 238000004422 calculation algorithm Methods 0.000 description 11
- 239000001257 hydrogen Substances 0.000 description 11
- 229910052739 hydrogen Inorganic materials 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 11
- 238000006467 substitution reaction Methods 0.000 description 11
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 10
- 241000699666 Mus <mouse, genus> Species 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 10
- 239000000872 buffer Substances 0.000 description 10
- 239000003153 chemical reaction reagent Substances 0.000 description 10
- 230000004927 fusion Effects 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 9
- 108091034117 Oligonucleotide Proteins 0.000 description 9
- 239000011230 binding agent Substances 0.000 description 9
- 150000001875 compounds Chemical class 0.000 description 9
- 238000002703 mutagenesis Methods 0.000 description 9
- 231100000350 mutagenesis Toxicity 0.000 description 9
- 238000012360 testing method Methods 0.000 description 9
- 102000004190 Enzymes Human genes 0.000 description 8
- 108090000790 Enzymes Proteins 0.000 description 8
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 8
- 238000002425 crystallisation Methods 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 230000008569 process Effects 0.000 description 8
- 238000013518 transcription Methods 0.000 description 8
- 230000035897 transcription Effects 0.000 description 8
- 238000013519 translation Methods 0.000 description 8
- 230000014616 translation Effects 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 7
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 239000003795 chemical substances by application Substances 0.000 description 7
- 230000008025 crystallization Effects 0.000 description 7
- 230000001939 inductive effect Effects 0.000 description 7
- 230000003993 interaction Effects 0.000 description 7
- 239000002502 liposome Substances 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 239000012528 membrane Substances 0.000 description 7
- 231100000219 mutagenic Toxicity 0.000 description 7
- 230000003505 mutagenic effect Effects 0.000 description 7
- 239000002244 precipitate Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 6
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 6
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 6
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 6
- 235000011130 ammonium sulphate Nutrition 0.000 description 6
- 229940098773 bovine serum albumin Drugs 0.000 description 6
- 238000013461 design Methods 0.000 description 6
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 6
- 210000003000 inclusion body Anatomy 0.000 description 6
- 230000005764 inhibitory process Effects 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 238000010561 standard procedure Methods 0.000 description 6
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 5
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- 108060003951 Immunoglobulin Proteins 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- 229930006000 Sucrose Natural products 0.000 description 5
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 5
- QTBSBXVTEAMEQO-UHFFFAOYSA-N acetic acid Substances CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 5
- 239000011324 bead Substances 0.000 description 5
- 238000010276 construction Methods 0.000 description 5
- 230000001186 cumulative effect Effects 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 102000018358 immunoglobulin Human genes 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 5
- DCWXELXMIBXGTH-UHFFFAOYSA-N phosphotyrosine Chemical compound OC(=O)C(N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-UHFFFAOYSA-N 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 238000000926 separation method Methods 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 238000012916 structural analysis Methods 0.000 description 5
- 239000005720 sucrose Substances 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 108010010803 Gelatin Proteins 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 101100178822 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) htrA1 gene Proteins 0.000 description 4
- 206010028980 Neoplasm Diseases 0.000 description 4
- 108091005461 Nucleic proteins Proteins 0.000 description 4
- BZQFBWGGLXLEPQ-UHFFFAOYSA-N O-phosphoryl-L-serine Natural products OC(=O)C(N)COP(O)(O)=O BZQFBWGGLXLEPQ-UHFFFAOYSA-N 0.000 description 4
- 108091000080 Phosphotransferase Proteins 0.000 description 4
- 101100277437 Rhizobium meliloti (strain 1021) degP1 gene Proteins 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 150000001408 amides Chemical class 0.000 description 4
- 125000000129 anionic group Chemical group 0.000 description 4
- 239000003593 chromogenic compound Substances 0.000 description 4
- 239000002577 cryoprotective agent Substances 0.000 description 4
- 101150018266 degP gene Proteins 0.000 description 4
- 229950006137 dexfosfoserine Drugs 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 239000008273 gelatin Substances 0.000 description 4
- 229920000159 gelatin Polymers 0.000 description 4
- 235000019322 gelatine Nutrition 0.000 description 4
- 235000011852 gelatine desserts Nutrition 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000004949 mass spectrometry Methods 0.000 description 4
- 108010087904 neutravidin Proteins 0.000 description 4
- 102000020233 phosphotransferase Human genes 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 238000002741 site-directed mutagenesis Methods 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- COCMHKNAGZHBDZ-UHFFFAOYSA-N 4-carboxy-3-[3-(dimethylamino)-6-dimethylazaniumylidenexanthen-9-yl]benzoate Chemical compound C=12C=CC(=[N+](C)C)C=C2OC2=CC(N(C)C)=CC=C2C=1C1=CC(C([O-])=O)=CC=C1C(O)=O COCMHKNAGZHBDZ-UHFFFAOYSA-N 0.000 description 3
- YMZMTOFQCVHHFB-UHFFFAOYSA-N 5-carboxytetramethylrhodamine Chemical compound C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=C(C(O)=O)C=C1C([O-])=O YMZMTOFQCVHHFB-UHFFFAOYSA-N 0.000 description 3
- 239000012099 Alexa Fluor family Substances 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 241000271566 Aves Species 0.000 description 3
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 3
- 230000005778 DNA damage Effects 0.000 description 3
- 231100000277 DNA damage Toxicity 0.000 description 3
- 102000001301 EGF receptor Human genes 0.000 description 3
- 108060006698 EGF receptor Proteins 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 3
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 3
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 3
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 3
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical group CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- 239000004677 Nylon Substances 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 102000006335 Phosphate-Binding Proteins Human genes 0.000 description 3
- 108010058514 Phosphate-Binding Proteins Proteins 0.000 description 3
- 101710130420 Probable capsid assembly scaffolding protein Proteins 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 101710204410 Scaffold protein Proteins 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 229940009098 aspartate Drugs 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 235000020958 biotin Nutrition 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 230000009260 cross reactivity Effects 0.000 description 3
- 239000003398 denaturant Substances 0.000 description 3
- 238000000502 dialysis Methods 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 239000000975 dye Substances 0.000 description 3
- 238000000295 emission spectrum Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 3
- 230000005284 excitation Effects 0.000 description 3
- 238000000695 excitation spectrum Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 238000010353 genetic engineering Methods 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 229930182817 methionine Chemical group 0.000 description 3
- 230000003278 mimic effect Effects 0.000 description 3
- 230000009871 nonspecific binding Effects 0.000 description 3
- 229920001778 nylon Polymers 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 210000001322 periplasm Anatomy 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- 150000003904 phospholipids Chemical class 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 108020001580 protein domains Proteins 0.000 description 3
- 238000002818 protein evolution Methods 0.000 description 3
- 239000012460 protein solution Substances 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 230000006798 recombination Effects 0.000 description 3
- 238000005215 recombination Methods 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 241000701447 unidentified baculovirus Species 0.000 description 3
- 241001515965 unidentified phage Species 0.000 description 3
- 229960005486 vaccine Drugs 0.000 description 3
- 238000010200 validation analysis Methods 0.000 description 3
- 238000002424 x-ray crystallography Methods 0.000 description 3
- QDZOEBFLNHCSSF-PFFBOGFISA-N (2S)-2-[[(2R)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2R)-2-amino-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-N-[(2R)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]pentanediamide Chemical compound C([C@@H](C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](N)CCCNC(N)=N)C1=CC=CC=C1 QDZOEBFLNHCSSF-PFFBOGFISA-N 0.000 description 2
- OBYNJKLOYWCXEP-UHFFFAOYSA-N 2-[3-(dimethylamino)-6-dimethylazaniumylidenexanthen-9-yl]-4-isothiocyanatobenzoate Chemical compound C=12C=CC(=[N+](C)C)C=C2OC2=CC(N(C)C)=CC=C2C=1C1=CC(N=C=S)=CC=C1C([O-])=O OBYNJKLOYWCXEP-UHFFFAOYSA-N 0.000 description 2
- IJSMFQNTEUNRPY-UHFFFAOYSA-N 2-[3-(dimethylamino)-6-dimethylazaniumylidenexanthen-9-yl]-5-isothiocyanatobenzoate Chemical compound C=12C=CC(=[N+](C)C)C=C2OC2=CC(N(C)C)=CC=C2C=1C1=CC=C(N=C=S)C=C1C([O-])=O IJSMFQNTEUNRPY-UHFFFAOYSA-N 0.000 description 2
- BPVHBBXCESDRKW-UHFFFAOYSA-N 5(6)-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C21OC(=O)C1=CC(C(=O)O)=CC=C21.C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BPVHBBXCESDRKW-UHFFFAOYSA-N 0.000 description 2
- NJYVEMPWNAYQQN-UHFFFAOYSA-N 5-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C21OC(=O)C1=CC(C(=O)O)=CC=C21 NJYVEMPWNAYQQN-UHFFFAOYSA-N 0.000 description 2
- IDLISIVVYLGCKO-UHFFFAOYSA-N 6-carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein Chemical compound O1C(=O)C2=CC=C(C(O)=O)C=C2C21C1=CC(OC)=C(O)C(Cl)=C1OC1=C2C=C(OC)C(O)=C1Cl IDLISIVVYLGCKO-UHFFFAOYSA-N 0.000 description 2
- WQZIDRAQTRIQDX-UHFFFAOYSA-N 6-carboxy-x-rhodamine Chemical compound OC(=O)C1=CC=C(C([O-])=O)C=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 WQZIDRAQTRIQDX-UHFFFAOYSA-N 0.000 description 2
- BZTDTCNHAFUJOG-UHFFFAOYSA-N 6-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BZTDTCNHAFUJOG-UHFFFAOYSA-N 0.000 description 2
- VWOLRKMFAJUZGM-UHFFFAOYSA-N 6-carboxyrhodamine 6G Chemical compound [Cl-].C=12C=C(C)C(NCC)=CC2=[O+]C=2C=C(NCC)C(C)=CC=2C=1C1=CC(C(O)=O)=CC=C1C(=O)OCC VWOLRKMFAJUZGM-UHFFFAOYSA-N 0.000 description 2
- ZEKAXIFHLIITGV-UHFFFAOYSA-N 7-methoxycoumarin-4-acetic acid Chemical compound OC(=O)CC1=CC(=O)OC2=CC(OC)=CC=C21 ZEKAXIFHLIITGV-UHFFFAOYSA-N 0.000 description 2
- IKYJCHYORFJFRR-UHFFFAOYSA-N Alexa Fluor 350 Chemical compound O=C1OC=2C=C(N)C(S(O)(=O)=O)=CC=2C(C)=C1CC(=O)ON1C(=O)CCC1=O IKYJCHYORFJFRR-UHFFFAOYSA-N 0.000 description 2
- JLDSMZIBHYTPPR-UHFFFAOYSA-N Alexa Fluor 405 Chemical compound CC[NH+](CC)CC.CC[NH+](CC)CC.CC[NH+](CC)CC.C12=C3C=4C=CC2=C(S([O-])(=O)=O)C=C(S([O-])(=O)=O)C1=CC=C3C(S(=O)(=O)[O-])=CC=4OCC(=O)N(CC1)CCC1C(=O)ON1C(=O)CCC1=O JLDSMZIBHYTPPR-UHFFFAOYSA-N 0.000 description 2
- WEJVZSAYICGDCK-UHFFFAOYSA-N Alexa Fluor 430 Chemical compound CC[NH+](CC)CC.CC1(C)C=C(CS([O-])(=O)=O)C2=CC=3C(C(F)(F)F)=CC(=O)OC=3C=C2N1CCCCCC(=O)ON1C(=O)CCC1=O WEJVZSAYICGDCK-UHFFFAOYSA-N 0.000 description 2
- WHVNXSBKJGAXKU-UHFFFAOYSA-N Alexa Fluor 532 Chemical compound [H+].[H+].CC1(C)C(C)NC(C(=C2OC3=C(C=4C(C(C(C)N=4)(C)C)=CC3=3)S([O-])(=O)=O)S([O-])(=O)=O)=C1C=C2C=3C(C=C1)=CC=C1C(=O)ON1C(=O)CCC1=O WHVNXSBKJGAXKU-UHFFFAOYSA-N 0.000 description 2
- ZAINTDRBUHCDPZ-UHFFFAOYSA-M Alexa Fluor 546 Chemical compound [H+].[Na+].CC1CC(C)(C)NC(C(=C2OC3=C(C4=NC(C)(C)CC(C)C4=CC3=3)S([O-])(=O)=O)S([O-])(=O)=O)=C1C=C2C=3C(C(=C(Cl)C=1Cl)C(O)=O)=C(Cl)C=1SCC(=O)NCCCCCC(=O)ON1C(=O)CCC1=O ZAINTDRBUHCDPZ-UHFFFAOYSA-M 0.000 description 2
- IGAZHQIYONOHQN-UHFFFAOYSA-N Alexa Fluor 555 Chemical compound C=12C=CC(=N)C(S(O)(=O)=O)=C2OC2=C(S(O)(=O)=O)C(N)=CC=C2C=1C1=CC=C(C(O)=O)C=C1C(O)=O IGAZHQIYONOHQN-UHFFFAOYSA-N 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 101710132601 Capsid protein Proteins 0.000 description 2
- 101710094648 Coat protein Proteins 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 102100025698 Cytosolic carboxypeptidase 4 Human genes 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 241000287828 Gallus gallus Species 0.000 description 2
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 2
- 101000932590 Homo sapiens Cytosolic carboxypeptidase 4 Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 108010058683 Immobilized Proteins Proteins 0.000 description 2
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 108091092195 Intron Proteins 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical group CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 101710125418 Major capsid protein Proteins 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 101001033003 Mus musculus Granzyme F Proteins 0.000 description 2
- 101710141454 Nucleoprotein Proteins 0.000 description 2
- 108010004729 Phycoerythrin Proteins 0.000 description 2
- 101710182846 Polyhedrin Proteins 0.000 description 2
- 101710083689 Probable capsid protein Proteins 0.000 description 2
- ATUOYWHBWRKTHZ-UHFFFAOYSA-N Propane Chemical compound CCC ATUOYWHBWRKTHZ-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 101100084022 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lapA gene Proteins 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- 102400000096 Substance P Human genes 0.000 description 2
- 101800003906 Substance P Proteins 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- 108700009124 Transcription Initiation Site Proteins 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 108010046334 Urease Proteins 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 238000002441 X-ray diffraction Methods 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 230000009824 affinity maturation Effects 0.000 description 2
- 239000012491 analyte Substances 0.000 description 2
- 230000002788 anti-peptide Effects 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000003491 array Methods 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 102000005936 beta-Galactosidase Human genes 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- 239000010839 body fluid Substances 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000012875 competitive assay Methods 0.000 description 2
- 230000009137 competitive binding Effects 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 238000003094 enzyme-multiplied immunoassay technique Methods 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 108091006047 fluorescent proteins Proteins 0.000 description 2
- 102000034287 fluorescent proteins Human genes 0.000 description 2
- 238000005194 fractionation Methods 0.000 description 2
- 238000010230 functional analysis Methods 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 229960000789 guanidine hydrochloride Drugs 0.000 description 2
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 2
- 229940022353 herceptin Drugs 0.000 description 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 2
- 230000000984 immunochemical effect Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 230000008676 import Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- XMBWDFGMSWQBCA-YPZZEJLDSA-N iodane Chemical compound [125IH] XMBWDFGMSWQBCA-YPZZEJLDSA-N 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 150000002739 metals Chemical class 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 238000004848 nephelometry Methods 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 230000010355 oscillation Effects 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 101150009573 phoA gene Proteins 0.000 description 2
- 150000003014 phosphoric acid esters Chemical class 0.000 description 2
- USRGIUJOYOXOQJ-GBXIJSLDSA-N phosphothreonine Chemical compound OP(=O)(O)O[C@H](C)[C@H](N)C(O)=O USRGIUJOYOXOQJ-GBXIJSLDSA-N 0.000 description 2
- 239000011148 porous material Substances 0.000 description 2
- 235000008476 powdered milk Nutrition 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 2
- 238000002702 ribosome display Methods 0.000 description 2
- 102200049605 rs1131691346 Human genes 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- HZRPRSVIPZNVKZ-UHFFFAOYSA-M sodium;[2-(4-aminophenyl)-1-hydroxy-1-phosphonoethyl]-hydroxyphosphinate Chemical compound [Na+].NC1=CC=C(CC(O)(P(O)(O)=O)P(O)([O-])=O)C=C1 HZRPRSVIPZNVKZ-UHFFFAOYSA-M 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 239000002562 thickening agent Substances 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 229940035893 uracil Drugs 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- AYDAHOIUHVUJHQ-UHFFFAOYSA-N 1-(3',6'-dihydroxy-3-oxospiro[2-benzofuran-1,9'-xanthene]-5-yl)pyrrole-2,5-dione Chemical compound C=1C(O)=CC=C2C=1OC1=CC(O)=CC=C1C2(C1=CC=2)OC(=O)C1=CC=2N1C(=O)C=CC1=O AYDAHOIUHVUJHQ-UHFFFAOYSA-N 0.000 description 1
- DAKRRPZULHQSKP-UHFFFAOYSA-N 1-oxospiro[2-benzofuran-3,16'-3-oxa-9,23-diazaheptacyclo[17.7.1.15,9.02,17.04,15.023,27.013,28]octacosa-1(27),2(17),4(15),5(28),13,18-hexaene]-5-carboxylic acid Chemical compound C1CCN2CCCC(C=C3C4(OC(=O)C5=CC=C(C=C54)C(=O)O)C4=C5)=C2C1=C3OC4=C1CCCN2CCCC5=C12 DAKRRPZULHQSKP-UHFFFAOYSA-N 0.000 description 1
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- XZKIHKMTEMTJQX-UHFFFAOYSA-N 4-Nitrophenyl Phosphate Chemical compound OP(O)(=O)OC1=CC=C([N+]([O-])=O)C=C1 XZKIHKMTEMTJQX-UHFFFAOYSA-N 0.000 description 1
- YRNWIFYIFSBPAU-UHFFFAOYSA-N 4-[4-(dimethylamino)phenyl]-n,n-dimethylaniline Chemical compound C1=CC(N(C)C)=CC=C1C1=CC=C(N(C)C)C=C1 YRNWIFYIFSBPAU-UHFFFAOYSA-N 0.000 description 1
- SJQRQOKXQKVJGJ-UHFFFAOYSA-N 5-(2-aminoethylamino)naphthalene-1-sulfonic acid Chemical compound C1=CC=C2C(NCCN)=CC=CC2=C1S(O)(=O)=O SJQRQOKXQKVJGJ-UHFFFAOYSA-N 0.000 description 1
- GGMFTOCYWNYUSU-UHFFFAOYSA-N 5-(5-aminopentylcarbamoyl)-2-[3-(dimethylamino)-6-dimethylazaniumylidenexanthen-9-yl]benzoate Chemical compound C=12C=CC(=[N+](C)C)C=C2OC2=CC(N(C)C)=CC=C2C=1C1=CC=C(C(=O)NCCCCCN)C=C1C([O-])=O GGMFTOCYWNYUSU-UHFFFAOYSA-N 0.000 description 1
- MDGNQWAJTIGWLE-UHFFFAOYSA-N 5-[(4,6-dichloro-1,3,5-triazin-2-yl)amino]-3',6'-dihydroxyspiro[2-benzofuran-3,9'-xanthene]-1-one Chemical compound C=1C(O)=CC=C2C=1OC1=CC(O)=CC=C1C2(C1=C2)OC(=O)C1=CC=C2NC1=NC(Cl)=NC(Cl)=N1 MDGNQWAJTIGWLE-UHFFFAOYSA-N 0.000 description 1
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 1
- HWQQCFPHXPNXHC-UHFFFAOYSA-N 6-[(4,6-dichloro-1,3,5-triazin-2-yl)amino]-3',6'-dihydroxyspiro[2-benzofuran-3,9'-xanthene]-1-one Chemical compound C=1C(O)=CC=C2C=1OC1=CC(O)=CC=C1C2(C1=CC=2)OC(=O)C1=CC=2NC1=NC(Cl)=NC(Cl)=N1 HWQQCFPHXPNXHC-UHFFFAOYSA-N 0.000 description 1
- WHCPTFFIERCDSB-UHFFFAOYSA-N 7-(diethylamino)-2-oxochromene-3-carboxylic acid Chemical compound C1=C(C(O)=O)C(=O)OC2=CC(N(CC)CC)=CC=C21 WHCPTFFIERCDSB-UHFFFAOYSA-N 0.000 description 1
- 108091006112 ATPases Proteins 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 239000012103 Alexa Fluor 488 Substances 0.000 description 1
- 239000012104 Alexa Fluor 500 Substances 0.000 description 1
- 239000012105 Alexa Fluor 514 Substances 0.000 description 1
- 239000012109 Alexa Fluor 568 Substances 0.000 description 1
- 239000012110 Alexa Fluor 594 Substances 0.000 description 1
- 239000012111 Alexa Fluor 610 Substances 0.000 description 1
- 239000012112 Alexa Fluor 633 Substances 0.000 description 1
- 239000012114 Alexa Fluor 647 Substances 0.000 description 1
- 239000012115 Alexa Fluor 660 Substances 0.000 description 1
- 239000012116 Alexa Fluor 680 Substances 0.000 description 1
- 239000012117 Alexa Fluor 700 Substances 0.000 description 1
- 239000012118 Alexa Fluor 750 Substances 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 102000036365 BRCA1 Human genes 0.000 description 1
- 108700020463 BRCA1 Proteins 0.000 description 1
- 101150072950 BRCA1 gene Proteins 0.000 description 1
- 108010016529 Bacillus amyloliquefaciens ribonuclease Proteins 0.000 description 1
- 241000194110 Bacillus sp. (in: Bacteria) Species 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 108091033380 Coding strand Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 102000000634 Cytochrome c oxidase subunit IV Human genes 0.000 description 1
- 108090000365 Cytochrome-c oxidases Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 101100285402 Danio rerio eng1a gene Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 239000004338 Dichlorodifluoromethane Substances 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108050001049 Extracellular proteins Proteins 0.000 description 1
- 102000008892 Forkhead-associated (FHA) domains Human genes 0.000 description 1
- 108050000846 Forkhead-associated (FHA) domains Proteins 0.000 description 1
- 102000030902 Galactosyltransferase Human genes 0.000 description 1
- 108060003306 Galactosyltransferase Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- KDYRQBCJBKCHIQ-UHFFFAOYSA-N Hypusin Natural products NCC(O)CNCCCCC(N)C(=O)O KDYRQBCJBKCHIQ-UHFFFAOYSA-N 0.000 description 1
- 230000006133 ISGylation Effects 0.000 description 1
- 238000005588 Kraus reaction Methods 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical group OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical group C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Chemical group CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 108010085220 Multiprotein Complexes Proteins 0.000 description 1
- 102000007474 Multiprotein Complexes Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- HRNLUBSXIHFDHP-UHFFFAOYSA-N N-(2-aminophenyl)-4-[[[4-(3-pyridinyl)-2-pyrimidinyl]amino]methyl]benzamide Chemical compound NC1=CC=CC=C1NC(=O)C(C=C1)=CC=C1CNC1=NC=CC(C=2C=NC=CC=2)=N1 HRNLUBSXIHFDHP-UHFFFAOYSA-N 0.000 description 1
- 230000006181 N-acylation Effects 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 241001195348 Nusa Species 0.000 description 1
- DCWXELXMIBXGTH-QMMMGPOBSA-L O(4)-phosphonato-L-tyrosine(2-) Chemical compound [O-]C(=O)[C@@H]([NH3+])CC1=CC=C(OP([O-])([O-])=O)C=C1 DCWXELXMIBXGTH-QMMMGPOBSA-L 0.000 description 1
- 230000006179 O-acylation Effects 0.000 description 1
- 102220482874 Ornithine decarboxylase antizyme 1_H56K_mutation Human genes 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 108010090127 Periplasmic Proteins Proteins 0.000 description 1
- 229920002565 Polyethylene Glycol 400 Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- HMNSRTLZAJHSIK-YUMQZZPRSA-N Pro-Arg Chemical compound NC(=N)NCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1 HMNSRTLZAJHSIK-YUMQZZPRSA-N 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108091027981 Response element Proteins 0.000 description 1
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- GYDJEQRTZSCIOI-UHFFFAOYSA-N Tranexamic acid Chemical compound NCC1CCC(C(O)=O)CC1 GYDJEQRTZSCIOI-UHFFFAOYSA-N 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000006154 adenylylation Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000004520 agglutination Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 238000010976 amide bond formation reaction Methods 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 210000003484 anatomy Anatomy 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 230000010516 arginylation Effects 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical group N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 238000000429 assembly Methods 0.000 description 1
- 230000000712 assembly Effects 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 238000002819 bacterial display Methods 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000033558 biomineral tissue development Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 230000006242 butyrylation Effects 0.000 description 1
- 238000010514 butyrylation reaction Methods 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 238000005251 capillar electrophoresis Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 230000021235 carbamoylation Effects 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 210000003763 chloroplast Anatomy 0.000 description 1
- 239000012504 chromatography matrix Substances 0.000 description 1
- 230000006329 citrullination Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 238000002967 competitive immunoassay Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 238000005564 crystal structure determination Methods 0.000 description 1
- 239000011549 crystallization solution Substances 0.000 description 1
- 238000012926 crystallographic analysis Methods 0.000 description 1
- 238000002447 crystallographic data Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 238000013480 data collection Methods 0.000 description 1
- 230000006196 deacetylation Effects 0.000 description 1
- 238000003381 deacetylation reaction Methods 0.000 description 1
- 230000006240 deamidation Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000011026 diafiltration Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- PXBRQCKWGAHEHS-UHFFFAOYSA-N dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 1
- 235000019404 dichlorodifluoromethane Nutrition 0.000 description 1
- 238000003748 differential diagnosis Methods 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- FOOBQHKMWYGHCE-UHFFFAOYSA-N diphthamide Chemical compound C[N+](C)(C)C(C(N)=O)CCC1=NC=C(CC(N)C([O-])=O)N1 FOOBQHKMWYGHCE-UHFFFAOYSA-N 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- BFMYDTVEBKDAKJ-UHFFFAOYSA-L disodium;(2',7'-dibromo-3',6'-dioxido-3-oxospiro[2-benzofuran-1,9'-xanthene]-4'-yl)mercury;hydrate Chemical compound O.[Na+].[Na+].O1C(=O)C2=CC=CC=C2C21C1=CC(Br)=C([O-])C([Hg])=C1OC1=C2C=C(Br)C([O-])=C1 BFMYDTVEBKDAKJ-UHFFFAOYSA-L 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000006330 eliminylation Effects 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- VYXSBFYARXAAKO-UHFFFAOYSA-N ethyl 2-[3-(ethylamino)-6-ethylimino-2,7-dimethylxanthen-9-yl]benzoate;hydron;chloride Chemical compound [Cl-].C1=2C=C(C)C(NCC)=CC=2OC2=CC(=[NH+]CC)C(C)=CC2=C1C1=CC=CC=C1C(=O)OCC VYXSBFYARXAAKO-UHFFFAOYSA-N 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000006126 farnesylation Effects 0.000 description 1
- 235000013861 fat-free Nutrition 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 238000004401 flow injection analysis Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- ZFKJVJIDPQDDFY-UHFFFAOYSA-N fluorescamine Chemical compound C12=CC=CC=C2C(=O)OC1(C1=O)OC=C1C1=CC=CC=C1 ZFKJVJIDPQDDFY-UHFFFAOYSA-N 0.000 description 1
- 238000002875 fluorescence polarization Methods 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 230000006251 gamma-carboxylation Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 230000006130 geranylgeranylation Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000035430 glutathionylation Effects 0.000 description 1
- 230000036252 glycation Effects 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N glycerol 1-phosphate Chemical compound OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 150000002332 glycine derivatives Chemical class 0.000 description 1
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 1
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical group [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 1
- 230000006095 glypiation Effects 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000006149 hemylation Effects 0.000 description 1
- 238000013537 high throughput screening Methods 0.000 description 1
- 230000006195 histone acetylation Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 108091008039 hormone receptors Proteins 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 229940127121 immunoconjugate Drugs 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 230000026045 iodination Effects 0.000 description 1
- 238000006192 iodination reaction Methods 0.000 description 1
- 229940044173 iodine-125 Drugs 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 230000006122 isoprenylation Effects 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 238000001499 laser induced fluorescence spectroscopy Methods 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 238000002898 library design Methods 0.000 description 1
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 1
- 230000006144 lipoylation Effects 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000017538 malonylation Effects 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 102000006240 membrane receptors Human genes 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-O methylsulfide anion Chemical compound [SH2+]C LSDPWZHWYPCBBB-UHFFFAOYSA-O 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 210000001700 mitochondrial membrane Anatomy 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 230000010070 molecular adhesion Effects 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- MLEBFEHOJICQQS-UHFFFAOYSA-N monodansylcadaverine Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(=O)(=O)NCCCCCN MLEBFEHOJICQQS-UHFFFAOYSA-N 0.000 description 1
- 230000007498 myristoylation Effects 0.000 description 1
- UATCLPJEZJKNHE-UHFFFAOYSA-N n-(3',6'-dihydroxy-3-oxospiro[2-benzofuran-1,9'-xanthene]-5-yl)-2-iodoacetamide Chemical compound O1C(=O)C2=CC(NC(=O)CI)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 UATCLPJEZJKNHE-UHFFFAOYSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 230000009527 neddylation Effects 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 238000001683 neutron diffraction Methods 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 230000036963 noncompetitive effect Effects 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 230000026792 palmitoylation Effects 0.000 description 1
- 239000000123 paper Substances 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 235000010603 pastilles Nutrition 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 230000005261 phosphopantetheinylation Effects 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-L phosphoramidate Chemical compound NP([O-])([O-])=O PTMHPRAIXMAOOB-UHFFFAOYSA-L 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- INAAIJLSXJJHOZ-UHFFFAOYSA-N pibenzimol Chemical compound C1CN(C)CCN1C1=CC=C(N=C(N2)C=3C=C4NC(=NC4=CC=3)C=3C=CC(O)=CC=3)C2=C1 INAAIJLSXJJHOZ-UHFFFAOYSA-N 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 230000001884 polyglutamylation Effects 0.000 description 1
- 230000019474 polyglycylation Effects 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 230000006267 polysialylation Effects 0.000 description 1
- 108091005626 post-translationally modified proteins Proteins 0.000 description 1
- 102000035123 post-translationally modified proteins Human genes 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 108010004914 prolylarginine Proteins 0.000 description 1
- 239000001294 propane Substances 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 230000006289 propionylation Effects 0.000 description 1
- 238000010515 propionylation reaction Methods 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 230000017614 pupylation Effects 0.000 description 1
- 229940043131 pyroglutamate Drugs 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000006340 racemization Effects 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 108010054624 red fluorescent protein Proteins 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000008844 regulatory mechanism Effects 0.000 description 1
- 238000004153 renaturation Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 239000012465 retentate Substances 0.000 description 1
- 230000006159 retinylidene Schiff base formation Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 238000002922 simulated annealing Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 230000035322 succinylation Effects 0.000 description 1
- 238000010613 succinylation reaction Methods 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- 230000010741 sumoylation Effects 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 238000012731 temporal analysis Methods 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- OVTCUIZCVUGJHS-VQHVLOKHSA-N trans-dipyrrin Chemical compound C=1C=CNC=1/C=C1\C=CC=N1 OVTCUIZCVUGJHS-VQHVLOKHSA-N 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 150000003668 tyrosines Chemical class 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1044—Preparation or screening of libraries displayed on scaffold proteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2440/00—Post-translational modifications [PTMs] in chemical analysis of biological material
Definitions
- Post-translational modifications such as phosphorylation, acetylation, sulfation, S-nitrosylation, methylation, glycosylation and proteolysis, play essential roles in modulating protein function throughout biology.
- phosphorylation is one of the most common regulatory mechanisms in eukaryotes, where roughly 20-30% of all proteins can be phosphorylated by over 500 kinases (1).
- phosphorylation Given the ubiquitous role of phosphorylation in signal transduction, it is not surprising that aberrant phosphorylation either directly causes or is a consequence of many human diseases, such as cancer and neurodegenerative disorders (2).
- the method comprises (1) identifying a noncovalent post translational modification-binding motif in a protein; (2) inspecting known antibody CDRs for an anchoring pocket sequence that adopts the conformation of the noncovalent post translational modification-binding motif; (3) preparing an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise the anchoring pocket; (4) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and (5) identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
- the antibody binds a specific protein comprising the post translational modification.
- the antibody binds a specific post translational modification.
- the post translational modification is an anion.
- the post translational modification is phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation.
- the noncovalent post translational modification- binding motif recognizes an anion.
- the noncovalent post translational modification-binding motif recognizes a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar.
- the method further comprises the step of characterizing the anchoring pocket.
- amino acid residues from two or more CDRs comprise the anchoring pocket.
- a method of identifying antibodies that specifically bind a protein comprising a post translational modification comprises (1) identifying a noncovalent post translational modification-binding motif in a protein; (2) engineering an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise an anchoring pocket that adopts the conformation of the noncovalent post translational modification-binding motif ; (3) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and (4) identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
- the antibody binds a specific protein comprising the post translational modification.
- the antibody binds a specific post translational modification.
- the post translational modification is an anion.
- the post translational modification is phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation.
- the noncovalent post translational modification- binding motif recognizes an anion.
- the noncovalent post translational modification-binding motif recognizes a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar.
- the method further comprises the step of characterizing the anchoring pocket.
- amino acid residues from two or more CDRs comprise the anchoring pocket.
- Figure 1 illustrates the design of phospho-specific antibody scaffold,
- Each H2 residue contributes to anchoring the peptide near the pocket (52 H and 52A H ), specificity (53 H , 55 H , and 56 H ), or conformation (53 H ).
- Figure 2 illustrates the structure of nest motif in non-antibody and antibody scaffolds, (a) Nest motif present in barnase (61), in which three consecutive main-chain amides contact the carbonyl group from a different residue, (b) Structural alignment of CDR H2 bound to Asp/Glu. Alignment of CDR H2 region (50 H -56 H ) from PDB ID H8i (62), lfrg (63), 2igf (64), 2qhr (65), ldqj (66), 2nyy (67), 3bn9 (68), and 3ffd (69).
- All the antibodies contain G54 R (indicated by arrow) and make at least two hydrogen bonds between the Asp/Glu antigen residue and main-chain NH groups, (c) Alignment of the same CDR H2 region bound to sulfate ions from PDB ID lseq (70), 2gsg (71), and 3vg0 (72).
- Figure 3 illustrates the selection and characterization of pSer-, pSer/pThr-, and pTyr-specific scaffolds.
- Competition ELISAs were used to determine the specificity of each antibody scaffold.
- pSAb (a) and pSTAb (b) no binding inhibition was observed for the unphosphorylated peptides up to 2 ⁇ , whereas strong inhibition was observed for the phosphorylated peptides.
- pYAb (c) weak inhibition was observed at high concentrations of the unphosphorylated Tyr peptide, but ⁇ 20-fold less pTyr peptide was required to observe the same level of inhibition.
- the sequence logos of the antibody pools from which each lead clone was derived are depicted in the bottom panels.
- GS and H2 indicate the sequence logos from GS and H2 libraries selected against pSer and pThr. All clones that bound pTyr came from the six-residue libraries and contain two positively charged amino acids at 55H and 56H-
- the H2 sequences of pSAb, pSTAb, and pYAb are ATGGHT, STPRGST, and VTGGR , respectively.
- Figure 4 illustrates Biacore traces of phospho-specific Fabs binding to
- phosphorylated peptides (a) pSAb binding to pSer peptide, (b) pSTAb binding to the pSer peptide, (c) pSTAb binding to the pThr peptide, (d) pYAb binding to the pTyr peptide.
- Figure 5 illustrates density maps of Fab structures. Strong electron density in pSAb:pSer (a), pSTAb:pSer (b), pSTAb:pThr (c), and pYAb:pTyr (d) complexes was observed for the peptide (top panels Fo-Fc maps) and for the phosphoresidue and CDR H2 loop (H50-H56) (bottom panels 2Fo-Fc maps). Fo-Fc maps were contoured to 3 ⁇ and 2Fo-Fc maps were contoured to 1.25 ⁇ .
- Figure 6 illustrates the structural comparison between the mouse and humanized Fab (a), and the bound and unbound Fab (b).
- FIG. 7 illustrates the X-ray crystal structures of phosphoresidue-binding hot spot from pSAb (a), pSTAb (b and c), and pYAb (d).
- pSAb pSer makes hydrogen bonds with all three specificity residues (G53, H55 and T56). The anchoring hydrogen bond to T52A is conserved
- pSTAb the pSer/pThr makes hydrogen bonds with two specificity residues (R53 and S55), one anchor residue (S52), and the conformation residue (G54).
- R53 forms a bidentate interaction with the phosphate.
- the anchor residue T52A is flipped compared to pSAb, which allows the backbone carbonyl to make a new anchoring hydrogen bond
- the pTyr is recognized by a salt bridge with K56 and a hydrophobic interaction between V52 and the phenyl ring of the pTyr. However, longer side chain of pTyr prevents the phosphate group from occupying the phosphate-binding pocket, which is instead occupied by a water molecule (shown as a sphere),
- the structures demonstrate two distinct recognition modules: a phosphoresidue- binding pocket and peptide-binding region.
- Figure 8 illustrates the electrostatic surface representations of the parent Fab (a), pSAb (b), pSTAb (c), and pYAb (d). Comparison of phosphate-binding pocket (indicated by arrow) in CDR H2 reveals larger electropositive pocket for all the phospho-specific scaffolds. Surfaces were calculated with APBS and generated with MacPymol.
- FIG. 9 illustrates the generation of novel recombinant phospho-specific (PS) antibodies using the pSAb and pSTAb scaffolds
- PS phospho-specific
- FIG. 9 illustrates the generation of novel recombinant phospho-specific (PS) antibodies using the pSAb and pSTAb scaffolds
- the binding of each scFv to ten different phosphopeptides was characterized by phage ELISA (b). Representative results are shown for the scFv clones that were selected against P10.
- Figure 10 illustrates the phosphoresidue-binding pocket from natural
- FIG. 11 provides an alignment of the exemplary antibody sequences identified employing the methods described in the present disclosure.
- a motif-specific anchoring hot spot that recognizes a specific post-translational protein modification is first engineered or identified in a CDR of a parent antibody, thus creating an antibody scaffold.
- the sequence-specific designs of the present disclosure are termed "hot spots" or binding pockets or anchoring pockets because they contribute a substantial fraction of the binding energy to a protein-protein interaction (Clackson, T. & Wells, J. A. A hot spot of binding energy in a hormone -receptor interface. Science 267, 383-386 (1995); Bogan, A.A. & Thorn, K.S.
- the antibody scaffold that includes the hot spot provides an initial antigen-binding affinity to the desired modification.
- diverse Ab libraries can then be used for in vitro selection wherein CDR positions are randomized outside of the engineered anchoring hot spot. Selections with these libraries allow a skilled artisan to isolate novel antibodies that are highly specific against peptides harboring the desired post-translational modification.
- noncovalent, post translational modification-binding motif refers to amino acids that adopt a noncovalent conformation that recognizes a post translational modification. Such motifs are present in protein domains that recognize protein
- anchoring pocket sequence or “anchoring pocket” or “hot spot” refers to a non-covalent conformation of a subsequence or portion of one or more antibody CDRs that is specific to and binds to a protein post translational modification.
- the anchoring pocket sequence can be present in a known CDR or can be engineered.
- the anchoring pocket sequence is optionally further modified to have more specific binding properties for the protein post translational modification.
- the noncovalent, post translational modification-binding motif found in a protein domain
- the anchoring pocket sequence found in a CDR or CDRs
- an antibody scaffold is an antibody or antibody fragment that includes a CDR or more than one CDR that forms an anchoring pocket sequence, or "hot spot.”
- antibody refers to a polypeptide comprising a framework region from an immunoglobulin gene or fragments thereof that specifically binds and recognizes an antigen.
- the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes.
- Light chains are classified as either kappa or lambda.
- Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
- Antibodies can be polyclonal or monoclonal, derived from serum, a hybridoma or recombinantly cloned, and can also be chimeric, primatized, or humanized. Antibodies exist, e.g. , as intact immunoglobulins or as a number of well-characterized fragments produced by digestion with various peptidases (see Fundamental Immunology (Paul ed., 3d ed. 1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology.
- antibody also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g. , single chain Fv or Fab fragments) or those identified using phage display libraries (see, e.g., McCafferty et ah, Nature 348:552-554 (1990)).
- CDR Complementarity Determining Region
- the antibodies are full length.
- full length antibody herein is meant the structure that constitutes the natural biological form of an antibody, including variable and constant regions, including one or more modifications as outlined herein.
- the antibodies can be a variety of structures, including, but not limited to, antibody fragments, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, antibody fusions (sometimes referred to as “antibody conjugates”), and fragments of each, respectively.
- the antibody is an antibody fragment.
- Specific antibody fragments include, but are not limited to, (i) the Fab fragment consisting of VL, VH, CL and CHI domains, (ii) the Fd fragment consisting of the VH and CHI domains, (iii) the Fv fragment consisting of the VL and VH domains of a single antibody; (iv) the dAb fragment (Ward et al, 1989, Nature 341 :544-546, entirely incorporated by reference) which consists of a single variable, (v) isolated CDR regions, (vi) F(ab')2 fragments, a bivalent fragment comprising two linked Fab fragments (vii) single chain Fv molecules (scFv), wherein a VH domain and a VL domain are linked by a peptide linker which allows the two domains to associate to form an antigen binding site (Bird et al., 1988, Science 242:423-426, Huston et al,
- the antibody can be a mixture from different species, e.g. a chimeric antibody and/or a humanized antibody. That is, in the present invention, the CDR sets can be used with framework and constant regions other than those specifically described by sequence herein.
- both “chimeric antibodies” and “humanized antibodies” refer to antibodies that combine regions from more than one species.
- “chimeric antibodies” traditionally comprise variable region(s) from a mouse (or rat, in some cases) and the constant region(s) from a human.
- “Humanized antibodies” generally refer to non-human antibodies that have had the variable-domain framework regions swapped for sequences found in human antibodies.
- the entire antibody, except the CDRs is encoded by a polynucleotide of human origin or is identical to such an antibody except within its CDRs.
- the CDRs are grafted into the beta-sheet framework of a human antibody variable region to create an antibody, the specificity of which is determined by the engrafted CDRs.
- the creation of such antibodies is described in, e.g., WO 92/11018, Jones, 1986, Nature 321 :522-525, Verhoeyen et al, 1988, Science 239: 1534-1536, all entirely incorporated by reference.
- immunoglobulin constant region typically that of a human immunoglobulin, and thus will typically comprise a human Fc region.
- Humanized antibodies can also be generated using mice with a genetically engineered immune system. Roque et al , 2004, Biotechnol. Prog. 20:639-654, entirely incorporated by reference. A variety of techniques and methods for humanizing and reshaping non-human antibodies are well known in the art (See Tsurushita & Vasquez, 2004, Humanization of Monoclonal Antibodies, Molecular Biology of B Cells, 533-545, Elsevier Science (USA), and references cited therein, all entirely incorporated by reference).
- Humanization methods include but are not limited to methods described in Jones et al, 1986, Nature 321 :522-525; Riechmann et al , 1988; Nature 332:323-329; Verhoeyen et al, 1988, Science, 239: 1534-1536; Queen et al, 1989, Proc Natl Acad Sci, USA 86: 10029- 33; He et al, 1998, J. Immunol. 160: 1029-1035; Carter et al, 1992, Proc Natl Acad Sci USA 89:4285-9, Presta et al, 1997, Cancer Res. 57(20):4593-9; Gorman et al , 1991 , Proc. Natl. Acad. Sci.
- the parent antibody has been affinity matured, as is known in the art.
- Structure-based methods may be employed for humanization and affinity maturation, for example as described in U.S. Application Serial No. 1 1/004,590.
- Selection based methods may be employed to humanize and/or affinity mature antibody variable regions, including but not limited to methods described in Wu et al, 1999, J. Mol. Biol. 294: 151-162; Baca et al, 1997, J. Biol. Chem. 272(16): 10678-10684; Rosok et a/., 1996, J. Biol. Chem. 271(37): 2261 1-22618; Rader et al, 1998, Proc. Natl. Acad.
- the antibodies are diabodies.
- the antibody is a minibody.
- Minibodies are minimized antibody-like proteins comprising a scFv joined to a CH3 domain.
- Hu et al, 1996, Cancer Res. 56:3055-3061 entirely incorporated by reference.
- the scFv can be joined to the Fc region, and may include some or the entire hinge region.
- the term "antigen" refers to a molecule capable of being bound by an antibody.
- An antigen is additionally capable of inducing a humoral immune response and/or cellular immune response leading to the production of B and/or T-lymphocytes.
- variant refers to a polypeptide, protein, amino acid sequence, Fab, or antibody that is modified from its parental precursor.
- polypeptide or "protein” refers to a polymer of two or more amino acid residues.
- the terms apply to amino acid polymers in which one or more amino acid residue is an artificial, chemical analogue of a corresponding naturally occurring amino acid, as well as to polymers of naturally occurring amino acids.
- recombinant protein refers to a protein that is produced by expression of a nucleotide sequence encoding the amino acid sequence of the protein from a recombinant DNA molecule.
- target peptide refers to a peptide comprising an amino acid sequence recognized by the engineered antibodies described herein.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g. , hydroxyproline, ⁇ - carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g.
- R group e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Such unnatural amino acid analogs have modified R groups ⁇ e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
- amino acid substitution refers to the deletion and/or replacement of a specific acid of a given position.
- post-translationally modified amino acid refers to an amino acid that has been modified following ribosomal translation.
- Non-limiting examples of post-translational modifications are phosphorylated amino acids, e.g., phosphotyrosine (pTry), phosphoserine (pSer), and phosphothreonine (pThr).
- Other post-translational modifications can include oxidized cysteine, sulfated tyrosine, or acetylated lysine.
- Naturally occurring is used to refer to a protein, nucleic acid molecule, cell, or other material that exists in the natural world, for example, a polypeptide or polynucleotide sequence that is present in an organism, including in a virus.
- a naturally occurring material existed in the world prior to its creation, duplication, or identification by a human.
- a naturally occurring material can be in its form as it exists in the natural world, or can be modified by the hand of man such that, for example, it is in an isolated form.
- nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form, and complements thereof.
- the term refers to all forms of nucleic acids ⁇ e.g., gene, pre-mRNA, mRNA) and their
- nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.
- the term encompasses nucleic acids that are naturally occurring or recombinant.
- Nucleic acids can (1) code for an amino acid sequence that has greater than about 60% amino acid sequence identity, 65%, 70%, 75%, 80%, 85%, 90%, preferably 91%, 92%, 93%, 94%, 95%, 96%, 97%), 98%o or 99% or greater amino acid sequence identity, preferably over a region of at least about 25, 50, 100, 200, 500, 1000, or more amino acids, to a polypeptide encoded by a referenced nucleic acid or an amino acid sequence described herein; (2) specifically bind to antibodies, e.g., polyclonal antibodies, raised against an immunogen comprising a referenced amino acid sequence, immunogenic fragments thereof, and conservatively modified variants thereof; (3) specifically hybridize under stringent hybridization conditions to a nucleic acid encoding a referenced amino acid sequence, and conservatively modified variants thereof; (4) have a nucleic acid sequence that has greater than about 95%, preferably greater than about 96%o, 97%o, 98%), 99%o, or higher nu
- recombinant nucleic acid molecule refers to a non-naturally occurring nucleic acid molecule containing two or more linked polynucleotide sequences.
- a recombinant nucleic acid molecule can be produced by recombination methods, particularly genetic engineering techniques, or can be produced by a chemical synthesis method.
- a recombinant nucleic acid molecule can encode a fusion protein, for example, a fluorescent protein variant of the invention linked to a polypeptide of interest.
- recombinant host cell refers to a cell that contains a recombinant nucleic acid molecule.
- a recombinant host cell can express a polypeptide from a "gene” that is not found within the native (non-recombinant) form of the cell.
- Reference to a polynucleotide "encoding" a polypeptide means that, upon transcription of the polynucleotide and translation of the mRNA produced there from, a polypeptide is produced.
- the encoding polynucleotide is considered to include both the coding strand, whose nucleotide sequence is identical to an mRNA, as well as its
- nucleotide sequences encoding a polypeptide can include polynucleotides containing introns as well as the encoding exons.
- An expression control sequence refers to a nucleotide sequence that regulates the transcription or translation of a polynucleotide or the localization of a polypeptide to which it is operatively linked expression control sequences are "operatively linked" when the expression control sequence controls or regulates the transcription and, as appropriate, translation of the nucleotide sequence (i.e., a transcription or translation regulatory element, respectively), or localization of an encoded polypeptide to a specific compartment of a cell.
- an expression control sequence can be a promoter, enhancer, transcription terminator, a start codon (ATG), a splicing signal for intron excision and maintenance of the correct reading frame, a STOP codon, a ribosome binding site, or a sequence that targets a polypeptide to a particular location, for example, a cell compartmentalization signal, which can target a polypeptide to the cytosol, nucleus, plasma membrane, endoplasmic reticulum, mitochondrial membrane or matrix, chloroplast membrane or lumen, medial trans-Golgi cistemae, or a lysosome or endosome.
- ATG start codon
- STOP codon a splicing signal for intron excision and maintenance of the correct reading frame
- STOP codon a ribosome binding site
- a sequence that targets a polypeptide to a particular location for example, a cell compartmentalization signal, which can target a polypeptide to the cytosol, nucleus
- Cell compartmentalization domains are well known in the art and include, for example, a peptide containing amino acid residues 1 to 81 of human type II membrane-anchored protein galactosyltransferase, or amino acid residues 1 to 12 of the presequence of subunit IV of cytochrome c oxidase (see also Hancock et al. , EMBO J. 10:4033-4039, 1991; Buss et al., Mol. Cell. Biol. 8:3960-3963, 1988; and U.S. Pat.
- immunoassay refers to an assay that utilizes an antibody to specifically bind an analyte.
- An immunoassay is characterized by the use of specific binding properties of a particular antibody to isolate, to target, or to quantify the analyte.
- nucleic acids or polypeptide sequences that correspond to each other refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (e.g.
- identity exists for a specified entire sequence or a specified portion thereof or over a region of the sequence that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length.
- a corresponding region is any region within the reference sequence.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated, in some
- a comparison window includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence can be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted (e.g. , by the local homology algorithm of Smith & Waterman, Adv. AppL Math.
- an exemplary algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, Nuc. Acids Res. 25 :3389-3402 (1977) and Altschul et al, JMol. Biol. 215 :403-410 (1990), respectively.
- BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
- This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive -valued threshold score T when aligned with a word of the same length in a database sequence.
- T is referred to as the neighborhood word score threshold (Altschul et al, supra).
- a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- each polynucleotide sequence disclosed herein as encoding a fluorescent protein variant also describes every possible silent variation. It will also be recognized that each codon in a polynucleotide, except AUG, which is ordinarily the only codon for methionine, and UUG, which is ordinarily the only codon for tryptophan, can be modified to yield a functionally identical molecule by standard techniques. Accordingly, each silent variation of a polynucleotide that does not change the sequence of the encoded polypeptide is implicitly described herein.
- substitutions providing functionally similar amino acids are well known in the art, including the following six groups, each of which contains amino acids that are considered conservative substitutes for each another:
- Two or more amino acid sequences or two or more nucleotide sequences are considered to be “substantially identical” or “substantially similar” if the amino acid sequences or the nucleotide sequences share at least 80% or 90%> sequence identity with each other, or with a reference sequence over a given comparison window.
- substantially similar sequences include those having, for example, at least 80%> sequence identity, at least 90%o sequence identity, at least 95% sequence identity, at least 97% sequence identity, at least 98%o sequence identity, or at least 99% sequence identity.
- substitution refers to includes the replacement of one or more amino acid residues either by other naturally occurring amino acids, (conservative and non- conservative substitutions), by non-naturally occurring amino acids (conservative and non- conservative substitutions), or with organic moieties which serve either as true
- peptidonimetics e.g., having the same steric and electrochemical properties as the replaced amino acid
- peptidonimetics e.g., having the same steric and electrochemical properties as the replaced amino acid
- spacers in lieu of an amino acid, so as to keep the spatial relations between the amino acid spanning this replaced amino acid.
- An antibody scaffold is a region of an antibody or antibody fragment comprising one or more CDRs that have anchoring pocket sequences or hot spots that provide an initial binding affinity to a specific post-translational modification.
- an antibody scaffold can include a hot spot that is specific to a phosphorylated amino acid.
- the host spot or anchoring pocket can be further engineered or tailored to provide additional affinity for the post translational modification.
- the antibody scaffolds thus provide an initial template to allow in vitro selection and diversification, as described in detail below, for the generation of novel antibodies specific to the post-translational modification.
- the antibody scaffolds described herein can be engineered for specificity towards any post-translational modifications that can include, but is not limited to, myristoylation, palmitoylation, isoprenylation, prenylation, farnesylation, geranylgeranylation, glypiation, glycosylphosphatidylinositol anchor formation, lipoylation, flavin attachment, heme C attachment, phosphopantetheinylation, retinylidene Schiff base formation, diphthamide formation, ehtanolamine phosphoglycerol attachment, hypusin formation, acylation, O-acylation, N-acylation, sacylation, acetylation, histone acetylation, deacetylation, formylation, aklylation, methylation, amide bond formation, amidation, arginylation, polyglutamylation, polyglycylation, butyrylation, gamm
- Antibody scaffolds are engineered by identifying a suitable parent antibody scaffold that contains or can be used to install the sequence motif hot spot using standard recombinant technology techniques as described in detailed below.
- the scaffold itself can also be mutated by any method well known in the art as described herein to increase the specificity to its particularly designed hot spot prior to in vitro selection.
- the antibody scaffolds described herein can use any antibody known in the art.
- the antibody scaffolds can further be used to create antibody fragments, such as bispecific antibodies, fragment antigen binding (Fab), trifunctional antibodies, single-chain variable fragments, single domain antibody, bi-specific T-cell engagers, and the like.
- Humanized or primatized antibodies can be used to create the antibody scaffolds described herein.
- a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain.
- Methods for humanizing or primatizing non-human antibodies are well known in the art. Humanization can be essentially performed following the method of Winter and co-workers (see, e.g., Jones et al, Nature 321 :522-525 (1986); Riechmann et al, Nature 332:323-327 (1988); Verhoeyen et al, Science 239: 1534-1536 (1988) and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.
- These references are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to constructing antibody scaffolds.
- humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
- humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- the antibody scaffold of the present invention can be generated using vector construction and expression protocols well known in the art. For example, to obtain high level expression of a cloned gene or genome, one typically subclones the nucleic acid into an expression vector that contains a strong promoter to direct transcription, a
- bacterial promoters are well known in the art and described (e.g., in Sambrook et al., and Ausubel et al.., supra.
- Bacterial expression systems for expressing the protein are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al, Gene 22:229-235 (1983)); Mosbach et al, Nature 302:543-545 (1983)), which are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to constructing antibody scaffold vectors. Kits for such expression systems are commercially available.
- Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
- heterologous nucleic acid Selection of the promoter used to direct expression of a heterologous nucleic acid depends on the particular application.
- the promoter is preferably positioned about the same distance from the heterologous transcription start site as it is from the transcription start site in its natural setting. As is known in the art, however, some variation in this distance can be accommodated without loss of promoter function.
- Heterologous refers to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not found in the same relationship to each other in nature.
- the nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source.
- a heterologous protein indicates that the protein comprises two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein).
- phoA promoters can be used for phage display vectors described below.
- the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements required for the expression of the nucleic acid in host cells.
- a typical expression cassette thus contains a promoter operably linked to the nucleic acid sequence encoding the nucleic acid of choice and signals required for efficient polyadenylation of the transcript, ribosome binding sites, and translation termination. Additional elements of the cassette can include enhancers and, if genomic DNA is used as the structural gene, introns with functional splice donor and acceptor sites.
- the expression cassette should also contain a transcription termination region downstream of the structural gene to provide for efficient termination.
- the termination region can be obtained from the same gene as the promoter sequence or can be obtained from different genes.
- the particular expression vector used to transport the genetic information into the cell is not particularly critical. Any of the conventional vectors used for expression in eukaryotic or prokaryotic cells can be used. Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET23D, and fusion expression systems such as MBP, GST, and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc. Sequence tags can be included in an expression cassette for nucleic acid rescue. Markers such as fluorescent proteins, green or red fluorescent protein, 13 -gal, CAT, and the like can be included in the vectors as markers for vector transduction.
- Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, retroviral vectors, and vectors derived from Epstein-Barr virus.
- exemplary eukaryotic vectors include pMSG, pAV009/A + , pMT010/A + , pMAMneo-5, baculovirus pDSVE, pJKl, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, SV40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
- Expression of proteins from eukaryotic vectors can also be regulated using inducible promoters.
- inducible promoters expression levels are tied to the concentration of inducing agents, such as tetracycline, by the incorporation of response elements for these agents into the promoter. Generally, high level expression is obtained from inducible promoters only in the presence of the inducing agent; basal expression levels are minimal.
- Vectors can have a regulatable promoter, e.g. , tet-regulated systems and the RU- 486 system (see, e.g., Gossen & Bujard, PNAS 89:5547 (1992); Oligino et al, Gene Ther. 5:491-496 (1998); Wang et al, Gene Ther. 4:432-441 (1997); Neering et al, Blood 88: 1147- 1155 (1996); and Rendahl et al, Nat. Biotechnol 16:757-761 (1998)). These impart small molecule control on the expression of the candidate target nucleic acids. This beneficial feature can be used to determine that a desired phenotype is caused by a transfected cDNA rather than a somatic mutation.
- a regulatable promoter e.g., tet-regulated systems and the RU- 486 system
- Some expression systems have markers that provide gene amplification such as thymidine kinase and dihydrofolate reductase.
- markers that provide gene amplification such as thymidine kinase and dihydrofolate reductase.
- high yield expression systems not involving gene amplification are also suitable, such as using a baculovirus vector in insect cells, with a sequence of choice under the direction of the polyhedrin promoter or other strong baculovirus promoters.
- the elements that are typically included in expression vectors also include a replicon that functions in E. coli, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of eukaryotic sequences.
- the particular antibiotic resistance gene chosen is not critical, as any of the many resistance genes known in the art are suitable.
- the prokaryotic sequences are preferably chosen such that they do not interfere with the replication of the DNA in eukaryotic cells, if necessary.
- Standard transfection methods are used to produce bacterial, mammalian, yeast or insect cell lines that express large quantities of protein, which are then purified using standard techniques (see, e.g., Colley et al, J. Biol Chem. 264: 17619-17622 (1989); Guide to Protein Purification, in Methods in Enzymology, vol. 182 (Deutscher, ed., 1990)), which are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to constructing antibody scaffold vectors. Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, J. Bact. 132:349-351 (1977); Clark-Curtiss & Curtiss, Methods in Enzymology 101 :347-362 (1983)).
- any of the well-known procedures for introducing foreign nucleotide sequences into host cells can be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, biolistics, liposomes, microinjection, plasma vectors, viral vectors and any of the other well known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Sambrook et ah, supra). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least one gene into the host cell capable of expressing the antibody scaffold proteins of the present invention.
- the vectors of the present invention can be subjected to recombination and/or mutagenesis. This can be achieved by a variety of methods known in the art.
- One such non- limiting method is SOE-PCR as described by Kirchhoff and Desrosiers, PCR Methods and Applications 2:301-304 (1993).
- Another method is Kunkel mutagenesis, which is a type of site-directed mutagenesis that employs multiple mutagenic primers to generate libraries with multiple mutated positions.
- DNA shuffling is the (partially) random process in which a library of chimeric genes is generated from two or more starting genes.
- the starting genes are heterologous such that one gene is different from any other starting gene in at least one nucleotide; e.g., the starting material can be point mutations of each other.
- Much more diversity can be included in the process if the parental genes differ in more positions, e.g. by representing genes encoding homologues of proteins having the same function (and structural family) but originating from different species.
- family shuffling (Crameri et al, Nature, 391 : 288-291 (1998)).
- the transfected cells are cultured under conditions favoring expression of the protein of choice, which is recovered from the culture using standard techniques identified below.
- Either naturally occurring or recombinant proteins can be purified for use in diagnostic assays, for making antibodies (for diagnosis and therapy) and vaccines, and for assaying for anti-viral compounds.
- Naturally occurring protein can be purified, e.g., from primate tissue samples.
- Recombinant protein can be purified from any suitable expression system.
- the antibody scaffold proteins can be purified to substantial purity by standard techniques, including selective precipitation with such substances as ammonium sulfate; column chromatography, immunopurification methods, and others (see, e.g., Scopes, Protein Purification: Principles and Practice (1982); U.S. Patent No. 4,673,641; Ausubel et al, supra; and Sambrook et al, supra), which are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to constructing antibody scaffold vectors.
- proteins having established molecular adhesion properties can be reversibly fused to the protein.
- a specific protein can be selectively adsorbed to a purification column and then freed from the column in a relatively pure form. The fused protein is then removed by enzymatic activity.
- protein can be purified using immunoaffinity columns.
- Recombinant protein can be purified from any suitable source, include yeast, insect, bacterial, and mammalian cells.
- Recombinant proteins can be expressed and purified by transformed bacteria in large amounts, typically after promoter induction; but expression can be constitutive.
- Promoter induction with IPTG is one example of an inducible promoter system. Bacteria are grown according to standard procedures in the art. Fresh or frozen bacteria cells are used for isolation of protein.
- Proteins expressed in bacteria can form insoluble aggregates ("inclusion bodies").
- inclusion bodies Several protocols are suitable for purification of protein inclusion bodies.
- purification of inclusion bodies typically involves the extraction, separation and/or purification of inclusion bodies by disruption of bacterial cells, e.g., by incubation in a buffer of 50 mM TRIS/HCL pH 7.5, 50 niM NaCl, 5 mM MgCl 2 , 1 mM DTT, 0.1 mM ATP, and 1 mM PMSF.
- the cell suspension can be lysed using 2-3 passages through a French Press, homogenized using a Polytron (Brinkman Instruments) or sonicated on ice.
- the inclusion bodies are solubilized, and the lysed cell suspension is typically centrifuged to remove unwanted insoluble matter. Proteins that formed the inclusion bodies can be renatured by dilution or dialysis with a compatible buffer. Suitable solvents include, but are not limited to urea (from about 4 M to about 8 M), formamide (at least about 80%, volume/volume basis), and guanidine hydrochloride (from about 4 M to about 8 M).
- Some solvents which are capable of solubilizing aggregate-forming proteins are inappropriate for use in this procedure due to the possibility of irreversible denaturation of the proteins, accompanied by a lack of immunogenicity and/or activity.
- SDS sodium dodecyl sulfate
- 70% formic acid are inappropriate for use in this procedure due to the possibility of irreversible denaturation of the proteins, accompanied by a lack of immunogenicity and/or activity.
- guanidine hydrochloride and similar agents are denaturants, this denaturation is not irreversible and renaturation can occur upon removal (by dialysis, for example) or dilution of the denaturant, allowing reformation of immunologically and/or biologically active protein.
- Other suitable buffers are known to those skilled in the art. Human proteins are separated from other bacterial proteins by standard separation techniques, e.g. , with Ni-NTA agarose resin.
- the periplasmic fraction of the bacteria can be isolated by cold osmotic shock in addition to other methods known to skill in the art.
- the bacterial cells are centrifuged to form a pellet. The pellet is resuspended in a buffer containing 20%> sucrose.
- the bacteria are centrifuged and the pellet is resuspended in ice-cold 5 mM MgSC ⁇ and kept in an ice bath for approximately 10 minutes.
- the cell suspension is centrifuged and the supernatant decanted and saved.
- the recombinant proteins present in the supernatant can be separated from the host proteins by standard separation techniques well known to those of skill in the art.
- Solubility fractionation can be used as a standard protein separation technique for purifying proteins.
- an initial salt fractionation can separate many of the unwanted host cell proteins (or proteins derived from the cell culture media) from the recombinant protein of interest.
- the preferred salt is ammonium sulfate. Ammonium sulfate precipitates proteins by effectively reducing the amount of water in the protein mixture. Proteins then precipitate on the basis of their solubility. The more hydrophobic a protein is, the more likely it is to precipitate at lower ammonium sulfate concentrations.
- a typical protocol includes adding saturated ammonium sulfate to a protein solution so that the resultant ammonium sulfate concentration is between 20-30%. This concentration will precipitate the most hydrophobic of proteins. The precipitate is then discarded (unless the protein of interest is hydrophobic) and ammonium sulfate is added to the supernatant to a concentration known to precipitate the protein of interest. The precipitate is then solubilized in buffer and the excess salt removed if necessary, either through dialysis or diafiltration. Other methods that rely on solubility of proteins, such as cold ethanol precipitation, are well known to those of skill in the art and can be used to fractionate complex protein mixtures.
- the molecular weight of the protein can be used to isolate it from proteins of greater and lesser size using ultrafiltration through membranes of different pore size (for example, Amicon or Millipore membranes).
- membranes of different pore size for example, Amicon or Millipore membranes.
- the retentate of the ultrafiltration is then ultrafiltered against a membrane with a molecular cut off greater than the molecular weight of the protein of interest.
- the recombinant protein will pass through the membrane into the filtrate.
- the filtrate can then be chromatographed as described below.
- the protein can also be separated from other proteins on the basis of its size, net surface charge, hydrophobicity, and affinity for ligands or substrates using column chromatography.
- antibodies raised against proteins can be conjugated to column matrices and the proteins immunopurified. All of these methods are well known in the art. It will be apparent to one of skill that chromatographic techniques can be performed at any scale and using equipment from many different manufacturers (e.g., Pharmacia Biotech).
- regions outside of the engineered hot spot can be mutated and selected for binding to other motif-containing targets.
- This aspect of the invention includes evolving the scaffold through screening and selection of antibody libraries.
- Methods for high throughput screening of antibody libraries can include, but are not limited to, display techniques including cell display, bacterial display, yeast display, mammalian display, ribosome display, mR A display, and phage display.
- display techniques including cell display, bacterial display, yeast display, mammalian display, ribosome display, mR A display, and phage display.
- the use of phage display to isolate ligands that bind biologically relevant molecules has been reviewed in Felici et al. (1995) Biotechnol. Annual Rev. 1 : 149-183, Katz (1997) Annual Rev. Biophys. Biomol. Struct. 26: 27-45 and Hoogenboom et al. Immunotechnology 4(1): 1-20 (1998).
- Several randomized combinatorial peptide libraries have been constructed to select for polypeptides that bind different targets, e.g.
- An exemplary method for in vitro protein evolution of the Ab scaffolds of the present invention is phage display, and phage display methods are well known in the art.
- Phage display libraries can be created by making a designed series of mutations or variations within a coding sequence for the Ab scaffold template, each mutant sequence encoding an amino acid corresponding in overall structure to the template except having one or more amino acid variations in the sequence of the template.
- Retroviral and phage display vectors can be engineered using standard vector construction techniques well known in the art, as described herein relating to antibody scaffold construction.
- P3 phage display vectors along with compatible protein expression vectors as is well known in the art, can be used to generate phage display vectors for antibody diversification as described herein.
- the novel variegated (mutated) DNA provides sequence diversity, and each transformant phage displays one variant of the initial template amino acid sequence encoded by the DNA, leading to a phage population (library) displaying a vast number of different but structurally related amino acid sequences.
- the amino acid variations are expected to alter the binding properties of the binding peptide or domain without significantly altering its structure, at least for most substitutions.
- a phage library is contacted with and allowed to bind the target, or a particular subcomponent thereof.
- Phage bearing a target-binding moiety can form a complex with the target on the solid support whereas non-binding phage remain in solution and can be washed away with excess buffer.
- Bound phage are then liberated from the target by changing the buffer to an extreme pH (pH 2 or pH 10), changing the ionic strength of the buffer, adding denaturants, or other known means.
- a protein elution is performed.
- the recovered phage can then be amplified through infection of bacterial cells and the screening process can be repeated with the new pool that is now depleted in non-binders and enriched for binders.
- the recovery of even a few binding phage is sufficient to carry the process to completion.
- the gene sequences encoding the binding moieties derived from selected phage clones in the binding pool are determined by conventional methods, described below, revealing the peptide sequence that imparts binding affinity of the phage to the target. When the selection process works, the sequence diversity of the population falls with each round of selection until desirable binders remain.
- sequences converge on a small number of related binders, typically 10-50 out of about 10 9 to 10 10 original candidates from each library.
- An increase in the number of phage recovered at each round of selection is a good indication that convergence of the library has occurred in a screen.
- sequence information can be used to design other secondary phage libraries, biased for members having additional desired properties.
- the antibody scaffolds of the present invention can be characterized for binding to modified antigens.
- Immunoassay techniques and protocols are generally described in Price and Newman, "Principles and Practice of Immunoassay,” 2nd Edition, Grove's Dictionaries, 1997; and Gosling, "Immunoassays: A Practical Approach,” Oxford University Press, 2000.
- a variety of immunoassay techniques, including competitive and non-competitive immunoassays, can be used. (See, e.g., Self et al, Curr. Opin. Biotechnol 7:60-65 (1996)).
- immunoassay encompasses techniques including, without limitation, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme- linked immunosorbent assay (ELISA), IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); immunohistochemical assay, capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL). If desired, such immunoassays can be automated. Immunoassays can also be used in conjunction with laser induced fluorescence. (See, e.g., Schmalzing et al,
- Liposome immunoassays such as flow-injection liposome immunoassays and liposome immunosensors, are also suitable for use in the present invention.
- nephelometry assays in which the formation of protein/antibody complexes results in increased light scatter that is converted to a peak rate signal as a function of the marker concentration, are suitable for use in the methods of the present invention.
- Nephelometry assays are commercially available from Beckman Coulter (Brea, CA; Kit #449430) and can be performed using a Behring Nephelometer Analyzer (Fink et al, J Clin. Chem. Clin. Biochem., 27:261-276 (1989)). These references are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to characterizing the antibody scaffolds described herein.
- detectable moiety can be used in the assays described herein (direct or indirect detection).
- detectable moieties are well known to those skilled in the art, and can be any material detectable by spectroscopic, photochemical, biochemical,
- Detectable moieties can be used, with the choice of label depending on the sensitivity required, ease of conjugation with the antibody, stability requirements, and available instrumentation and disposal provisions.
- Suitable detectable moieties include, but are not limited to, radionuclides, fluorescent dyes ⁇ e.g., fluorescein, fluorescein isothiocyanate (FITC), Oregon GreenTM, rhodamine, Texas red, tetrarhodimine isothiocynate (TRITC), Cy3, Cy5, etc.), fluorescent markers ⁇ e.g., green fluorescent protein (GFP), phycoerythrin, etc.), autoquenched fluorescent compounds that are activated by tumor-associated proteases, enzymes ⁇ e.g., luciferase, horseradish peroxidase, alkaline phosphatase, etc.), nanoparticles, biotin, digoxigenin, metals, and the like.
- fluorescent dyes ⁇ e.g., fluorescein, fluorescein isothiocyanate (FITC), Oregon GreenTM, rhodamine, Texas red, tetrarhodimine isothi
- Direct labels include fluorescent or luminescent tags, metals, dyes, radionucleodies, and the like, attached to the antibody.
- An antibody labeled with iodine- 125 (1251) can be used.
- a chemiluminescence assay using a chemiluminescent antibody specific for nucleic acids or proteins is suitable for sensitive, non-radioactive detection of nucleic acids or protein levels.
- An antibody labeled with fluorochrome is also suitable. Examples of fluorochromes include, without limitation, DAPI, fluorescein, Hoechst 33258, R-phycocyanin, B-phycoerythrin, R- phycoerythrin, rhodamine, Texas red, and lissamine.
- Indirect labels include various enzymes well known in the art, such as horseradish peroxidase (HRP), alkaline phosphatase (AP), ⁇ - galactosidase, urease, and the like.
- HRP horseradish peroxidase
- AP alkaline phosphatase
- ⁇ - galactosidase urease, and the like.
- a horseradish-peroxidase detection system can be used, for example, with the chromogenic substrate tetramethylbenzidine (TMB), which yields a soluble product in the presence of hydrogen peroxide that is detectable at 450 nm.
- TMB tetramethylbenzidine
- An alkaline phosphatase detection system can be used with the chromogenic substrate p- nitrophenyl phosphate, for example, which yields a soluble product readily detectable at 405 nm.
- a ⁇ -galactosidase detection system can be used with the chromogenic substrate o-nitrophenyl-P-D-galactopyranoside (ONPG), which yields a soluble product detectable at 410 nm.
- An urease detection system can be used with a substrate such as urebromocresol purple (Sigma Immunochemicals; St. Louis, MO).
- Other proteins capable of specifically binding immunoglobulin constant regions, such as protein A or protein G can also be used as a label agent. These proteins exhibit a strong non-immunogenic reactivity with
- immunoglobulin constant regions from a variety of species (see, e.g. , Kronval et al, J.
- fluorophores are known in the art and can be used in the present invention.
- the fluorophore exhibits green fluorescence (such as for example 494 nm/519 nm), orange fluorescence (such as for example 554 nm/570 nm), red fluorescence (such as for example 590 nm/617 nm), or far red fluorescence (such as for example 651 nm/672 nm) excitation/emission spectra.
- the fluorophore is a fluorophore with excitation and emission spectra in the range of about 350 nm to about 775 nm.
- the excitation and emission spectra are about 346 nm/446 nm, about 494 nm/519 nm, about 554 nm/570 nm, about 555 nm/572 nm, about 590 nm/617 nm, about 651 nm/672 nm, about 679 nm/702 nm or about
- the fluorophore can include but is not limited to AlexaFluor 3, AlexaFluor 5, AlexaFluor 350, AlexaFluor 405, AlexaFluor 430, AlexaFluor 488, AlexaFluor 500, AlexaFluor 514, AlexaFluor 532, AlexaFluor 546, AlexaFluor 555, AlexaFluor 568, AlexaFluor 594, AlexaFluor 610, AlexaFluor 633, AlexaFluor 647, AlexaFluor 660, AlexaFluor 680, AlexaFluor 700, and AlexaFluor 750 (Molecular Probes AlexaFluor dyes, available from Life Technologies, Inc. (USA)).
- the fluorophore can include but is not limited to Cy dyes, including Cy2, Cy3, Cy3B
- the fluorophore can include but is not limited to DyLight 350, DyLight 405, DyLight 488, DyLight 550, DyLight 594, DyLight 633, DyLight 650, DyLight 680, DyLight
- the fluorophore can include but is not limited to a FluoProbes 390, FluoProbes 488, FluoProbes 532, FluoProbes 547H, FluoProbes 594, FluoProbes 647H, FluoProbes 682, FluoProbes 752 and FluoProbes 782, AMCA, DEAC (7-Diethylaminocoumarin-3-carboxylic acid); 7- Hydroxy-4-methylcoumarin-3; 7-Hydroxycoumarin-3; MCA (7-Methoxycoumarin-4-acetic acid); 7-Methoxycoumarin-3; AMF (4'-(Aminomethyl)fluorescein); 5-DTAF (5-(4,6- Dichlorotriazinyl)aminofluorescein); 6-DTAF (6-(4,6-Dichlorotriazinyl)aminofluorescein); 6-FAM (6
- Western blot (immunoblot) analysis can be used to detect and quantify the presence of an antigen in the sample.
- the technique generally comprises separating sample proteins by gel electrophoresis on the basis of molecular weight, transferring the separated proteins to a suitable solid support, (such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter), and incubating the sample with the antibodies that specifically bind the antigen.
- the anti-antigen antibodies specifically bind to the antigen on the solid support.
- These antibodies can be directly labeled or alternatively can be subsequently detected using labeled antibodies (e.g. , labeled sheep anti-mouse antibodies) that specifically bind to the anti-antigen antibodies.
- An ELISA method can be used as follows: (1) bind an antibody or antigen to a substrate; (2) contact the bound receptor with a fluid or tissue sample containing the virus, a viral antigen, or antibodies to the virus; (3) contact the above with an antibody bound to a detectable moiety (e.g., horseradish peroxidase enzyme or alkaline phosphatase enzyme); (4) contact the above with the substrate for the enzyme; (5) contact the above with a color reagent; (6) observe color change.
- a detectable moiety e.g., horseradish peroxidase enzyme or alkaline phosphatase enzyme
- An antigen and/or a patient's antibodies to the virus can be detected utilizing a capture assay. Briefly, to detect antibodies in a sample, antibodies to an immunoglobulin, e.g., anti-IgG (or IgM) are bound to a solid phase substrate and used to capture the patient's immunoglobulin from serum. The antigen, or reactive fragments of the antigen, is then contacted with the solid phase followed by addition of a labeled antibody. The amount of specific antibody can then be quantitated by the amount of labeled antibody binding. A micro-agglutination test can also be used to detect the presence of an antigen in test samples.
- an immunoglobulin e.g., anti-IgG (or IgM)
- the antigen, or reactive fragments of the antigen is then contacted with the solid phase followed by addition of a labeled antibody.
- the amount of specific antibody can then be quantitated by the amount of labeled antibody binding.
- a micro-agglutination test
- latex beads are coated with an antibody and mixed with a test sample, such that the antigen in the tissue or body fluids that is specifically reactive with the antibody crosslinked with the receptor, causing agglutination.
- the agglutinated antibody- virus complexes within a precipitate, visible with the naked eye or by spectrophotometer.
- конкурентн ⁇ е assays can also be adapted to provide for an indirect measurement of the amount of an antigen present in the sample. Briefly, serum or other body fluids from the subject is reacted with an antibody bound to a substrate (e.g. an ELISA 96-well plate). Excess serum is thoroughly washed away. A labeled (enzyme-linked, fluorescent, radioactive, etc.) monoclonal antibody is then reacted with the previously reacted antibody complex. The amount of inhibition of monoclonal antibody binding is measured relative to a control. Monoclonal antibodies (MABs) can also be used for detection directly in samples by IFA for MABs specifically reactive for the antibody-antigen complex.
- a substrate e.g. an ELISA 96-well plate
- a labeled (enzyme-linked, fluorescent, radioactive, etc.) monoclonal antibody is then reacted with the previously reacted antibody complex. The amount of inhibition of monoclonal antibody binding is measured relative to
- a hapten inhibition assay is another competitive assay.
- the known antigen can be immobilized on a solid substrate.
- a known amount of anti-antigen antibody is added to the sample, and the sample is then contacted with the immobilized antigen.
- the amount of antibody bound to the known immobilized antigen is inversely proportional to the amount of antigen present in the sample.
- the amount of immobilized antibody can be detected by detecting either the immobilized fraction of antibody or the fraction of the antibody that remains in solution. Detection can be direct where the antibody is labeled or indirect by the subsequent addition of a labeled moiety that specifically binds to the antibody as described above.
- an antigen can be immobilized to a solid support. Proteins can be added to the assay that compete for binding of the antisera to the immobilized antigen. The ability of the added proteins to compete for binding of the antisera to the immobilized protein is compared to the ability of the antigen to compete with itself. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with each of the added proteins listed above are selected and pooled. The cross-reacting antibodies are optionally removed from the pooled antisera by immunoabsorption with the added considered proteins, e.g. , distantly related homo logs.
- the immunoabsorbed and pooled antisera can then be used in a competitive binding immunoassay as described above to compare a second protein, thought to be perhaps an allele or polymorphic variant of an antigen, to the immunogen protein.
- the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required to inhibit 50% of binding is less than 10 times the amount of the antigen that is required to inhibit 50%> of binding, then the second protein is said to specifically bind to the polyclonal antibodies generated to antigen.
- a signal from a direct or indirect label can be analyzed, for example, using a spectrophotometer to detect color from a chromogenic substrate; a radiation counter to detect radiation such as a gamma counter for detection of 125 I; or a fluorometer to detect fluorescence in the presence of light of a certain wavelength.
- a radioactive label means for detection include a scintillation counter or photographic film as in autoradiography.
- the label is a fluorescent label, it can be detected by exciting the fiuorochrome with the appropriate wavelength of light and detecting the resulting fluorescence. The fluorescence can be detected visually, by the use of electronic detectors such as charge coupled devices (CCDs) or photomultipliers and the like.
- enzymatic labels can be detected by providing the appropriate substrates for the enzyme and detecting the resulting reaction product. Colorimetric or chemiluminescent labels can be detected simply by observing the color associated with the label. Thus, in various dipstick assays, conjugated gold often appears pink, while various conjugated beads appear the color of the bead.
- a quantitative analysis can be made using a spectrophotometer such as an EMAX Microplate Reader (Molecular Devices; Menlo Park, CA) in accordance with the manufacturer's instructions. If desired, the assays of the present invention can be automated or performed robotically, and the signal from multiple samples can be detected simultaneously.
- the antibodies can be immobilized onto a variety of solid supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (e.g., microtiter wells), pieces of a solid substrate material or membrane (e.g., plastic, nylon, paper), and the like.
- An assay strip can be prepared by coating the antibody or a plurality of antibodies in an array on a solid support. This strip can then be dipped into the test sample and processed quickly through washes and detection steps to generate a measureable signal, such as a colored spot.
- immunoprecipitation can be used to detect and quantify the presence of antibody-antigen binding.
- Immunoprecipitation is the technique of precipitating an antigen out of solution using an antibody specific to that antigen.
- the process can be used to identify protein complexes present in cell extracts by targeting a protein believed to be in the complex.
- the complexes are brought out of solution by insoluble antibody-binding proteins isolated initially from bacteria.
- the antibodies can also be coupled to sepharose beads that can easily be isolated out of solution. After washing, the precipitate can be analyzed using mass spectrometry, Western blotting, or any number of other methods for identifying constituents in the complex.
- Crystals are composed of regular, repeating, three-dimensional arrays of atoms, ions, molecules (e.g., proteins such as antibodies), or molecular assemblies (e.g., antigen/antibody complexes). These three-dimensional arrays are arranged according to specific mathematical relationships that are well-understood in the field.
- the fundamental unit, or building block, that is repeated in a crystal is called the asymmetric unit. Repetition of the asymmetric unit in an arrangement that conforms to a given, well-defined
- crystallographic symmetry provides the "unit cell" of the crystal. Repetition of the unit cell by regular translations in all three dimensions provides the crystal. See Giege and Ducruix (1999) Chapter 1, In Crystallization of Nucleic Acids and Proteins, a Practical Approach, 2nd ed., (Ducruix and Giege, eds.) (Oxford University Press, New York, 1999) pp. 1-16.
- compositions within the scope of the present invention can also contain other compounds, which can be biologically active or inactive.
- one or more immunogenic portions of other antigens can be present, either incorporated into a fusion polypeptide or as a separate compound, within the composition or vaccine.
- Polypeptides can, but need not be, conjugated to other macromolecules as described, for example, within US Patent Nos. 4,372,945 and 4,474,757.
- Pharmaceutical compositions and vaccines can generally be used for prophylactic and therapeutic purposes.
- Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the packaged nucleic acid suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions.
- liquid solutions such as an effective amount of the packaged nucleic acid suspended in diluents, such as water, saline or PEG 400
- capsules, sachets or tablets each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin
- suspensions in an appropriate liquid such as water, saline or PEG 400
- Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, micro crystalline cellulose, gelatin, colloidal silicon dioxide, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers.
- Lozenge forms can comprise the active ingredient in a flavor, e.g., sucrose, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
- a flavor e.g., sucrose
- an inert base such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
- Aerosol formulations e.g., they can be "nebulized" to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.
- Formulations suitable for parenteral administration can include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
- compositions can be administered, for example, by intravenous infusion, orally, topically, intraperitoneally, intravesically or intrathecally.
- Parenteral administration and intravenous administration are the preferred methods of administration.
- the formulations of commends can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.
- compositions can also comprise buffers (e.g., neutral buffered saline or phosphate buffered saline), carbohydrates (e.g., glucose, mannose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, bacteriostats, chelating agents such as EDTA or glutathione, adjuvants (e.g., aluminum hydroxide), solutes that render the formulation isotonic, hypotonic or weakly hypertonic with the blood of a recipient, suspending agents, thickening agents and/or preservatives.
- buffers e.g., neutral buffered saline or phosphate buffered saline
- carbohydrates e.g., glucose, mannose, sucrose or dextrans
- mannitol proteins
- proteins polypeptides or amino acids
- proteins e.glycine
- antioxidants e.g., mannitol
- Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described.
- Cells transduced by nucleic acids for ex vivo therapy can also be administered intravenously or parenterally as described above.
- the dose administered to a patient should be sufficient to affect a beneficial therapeutic response in the patient over time.
- the dose will be determined by the efficacy of the particular vector employed and the condition of the patient, as well as the body weight or surface area of the patient to be treated.
- the size of the dose also will be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular vector, or transduced cell type in a particular patient.
- compositions are determined in part by the particular composition being administered (e.g., nucleic acid, protein, modulatory compounds or transduced cell), as well as by the particular method used to administer the composition. Accordingly, there are a wide variety of suitable formulations of pharmaceutical
- compositions of the present invention see, e.g., Remington's Pharmaceutical Sciences, 17th ed., 1989.
- Administration can be in any convenient manner, e.g., by injection, oral administration, inhalation, transdermal application, or rectal administration.
- the present invention provides a method for identifying antibodies that specifically bind a protein comprising a post translational modification, the method comprising the steps of: (1) identifying a noncovalent post translational modification- binding motif in a protein; (2) inspecting known antibody CDRs for an anchoring pocket sequence that adopts the conformation of the noncovalent post translational modification- binding motif; (3) preparing an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise the anchoring pocket; (4) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and (5) identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
- identifying a noncovalent post translational modification- binding motif in a protein can be performed using any of the methods described herein as well as any other methods known to those of skill in the art.
- the methods further comprise analysis which is performed according the present methods by inspecting known antibody CDRs for an anchoring pocket sequence that adopts the conformation of the noncovalent post translational modification- binding motif.
- CDRs can be screened by any of the methods described herein, including in vitro and in silico methods, as well as any other methods known to those of skill in the art for antibody screening in order to identify anchoring pocket sequences that adopt the
- the methods further comprise preparing an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise the anchoring pocket identified according to the present methods.
- the antibody scaffold comprises two or more CDRs and amino acid residues from the two or more CDRs comprise the anchoring pocket.
- the antibody scaffold comprises two, three, four or more CDRs and amino acid residues from the two, three, four or more CDRs comprise the anchoring pocket.
- the antibody scaffold comprises two CDRs and amino acid residues from the two CDRs comprise the anchoring pocket.
- the antibody scaffold comprises three CDRs and amino acid residues from the three CDRs comprise the anchoring pocket.
- the antibody scaffold comprises four CDRs and amino acid residues from the four CDRs comprise the anchoring pocket.
- the methods further comprise preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket.
- the amino acid residues of the two or more CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket.
- the amino acid residues of the two, three, four or more CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket.
- the amino acid residues of the two CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket.
- the amino acid residues of the three CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket.
- the amino acid residues of the four CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket.
- the methods further comprise identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
- the antibody identified binds a specific protein comprising the post translational modification.
- the antibody identified binds a specific post translational modification.
- the antibody identified binds a specific post translational modification found in one or more proteins.
- the antibody identified binds a specific post translational modification found in a plurality of proteins.
- the antibody identified the post translational modification is any post translation modification know by one of skill in the art.
- the post translational modification is an anion or an anionic modification. Examples of post translational modification include but are not limited to phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation.
- the post translational modification is selected from the group consisting of phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, and glycosylation. In some embodiments, the post translational modification is a
- post translational modifications can be found in a plurality of proteins.
- the noncovalent post translational modification-binding motif recognizes any post translation modification known by one of skill in the art. In some embodiments, the noncovalent post translational modification-binding motif recognizes an anion or an anionic modification. Examples of noncovalent post translational modification- binding motifs which can be recognized by the antibodies identified by the methods disclosed herein include a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar.
- the noncovalent post translational modification-binding motif recognized is a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar.
- the method further comprises the step of characterizing the anchoring pocket.
- the amino acid residues from two or more CDRs comprise the anchoring pocket.
- the amino acid residues from two, three, four or more CDRs comprise the anchoring pocket.
- the amino acid residues from two CDRs comprise the anchoring pocket.
- the amino acid residues from three CDRs comprise the anchoring pocket.
- the amino acid residues from four CDRs comprise the anchoring pocket.
- the present disclosure provides methods for identifying antibodies that specifically bind a protein comprising a post translational modification, the method comprising the steps of: (1) identifying a noncovalent post translational modification- binding motif in a protein; (2) engineering an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise an anchoring pocket that adopts the
- the antibody identified binds a specific protein comprising the post translational modification. In some embodiments, the antibody identified binds a specific post translational modification. In some embodiments, the antibody identified binds a specific post translational modification. In some embodiments, the antibody identified binds a specific post translational modification found in one or more proteins. In some embodiments, the antibody identified binds a specific post translational modification found in a plurality of proteins.
- the antibody identified that specifically bind a protein with the post translational modification binds any post translation modification known by one of skill in the art.
- the post translational modification is an anion or an anionic modification. Examples of post translational modification include but are not limited to phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation.
- the post translational modification is selected from the group consisting of phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, and glycosylation.
- the post translational modification is a phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation.
- the noncovalent post translational modification-binding motif recognizes an anion or an anionic modification.
- noncovalent post translational modification-binding motifs which can be recognized by the antibodies identified by the present disclosure include anions, a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar as well as combinations thereof.
- the method further comprises the step of characterizing the anchoring pocket.
- the amino acid residues from two or more CDRs comprise the anchoring pocket.
- the amino acid residues from two, three, four or more CDRs comprise the anchoring pocket.
- the amino acid residues from two CDRs comprise the anchoring pocket.
- the amino acid residues from three CDRs comprise the anchoring pocket.
- the amino acid residues from four CDRs comprise the anchoring pocket.
- the method of further comprises the step of characterizing the anchoring pocket.
- the anchoring pocket can be characterized based on structural analysis (including for example but not limited to sequence analysis as well as 3D structure analysis), and functional analysis (including for example binding partner analysis).
- the anchoring pocket can be characterized based on a structural analysis.
- the anchoring pocket is characterized based on sequencing analysis.
- the anchoring pocket is characterized based on the CDR sequence analysis.
- the anchoring pocket is sequenced.
- the one, two, three, four or more CDRs in the anchoring pocket are sequenced.
- the one CDR in the anchoring pocket is sequenced.
- the two CDRs in the anchoring pocket are sequenced.
- the three CDRs in the anchoring pocket are sequenced. In some embodiments, the four CDRs in the anchoring pocket are sequenced.
- the anchoring pocket is characterized based on a functional analysis. In some embodiments, the anchoring pocket is characterized based on the
- characterized of the anchoring pocket includes a
- the anchoring pocket is characterized as an anion anchoring pocket. In some embodiments, the anchoring pocket is characterized as a sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation anchoring pocket.
- sequences identified using the methods described herein include the following. Sequence labeling corresponds to the labeling shown in Figure 9. CDR regions are underlined.
- D6 DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
- the antibodies indentified by the methods disclosed herein include comprise one or more CDRs as part of the anchoring pocket.
- Exemplary CDR sequences include but are not limited to those listed in Table 2 below.
- the CDRs comprising the anchoring pocket include one or more CDRs as listed in Table 2.
- the CDRs comprising the anchoring pocket include 1, 2, 3, 4, 5, 6 or more CDRs as listed in Table 2.
- the CDRs comprising the anchoring pocket bind a phosphorylated residue.
- the CDRs comprising the anchoring pocket include a H2 CDR2 as listed in Table 2.
- Example 1 Design of phospho-specific antibody scaffolds
- superfamilies such as ATPases, helicases, and kinases
- Fig. la The anion
- phi,psi values in successive residues gives rise to anion-binding sites that occur commonly and are found often at functionally important regions.
- J Mol Biol 315, 171-182 (2002) An existing Ab scaffold into which a similar loop could be built was sought. The CDRs were manually inspected for the desired nest conformation from sixty anti-peptide Ab structures.
- a region of CDR H2 within a mouse Fab (PDB ID H8i) (Landry, R.C. et al. Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII. J Mol Biol 308, 883-893 (2001)) was identified that adopts the desired conformation due a hallmark a L glycine at 54 H (Fig. lb). This Ab utilized the H2 loop to bind an acidic residue, which is often used as a phospho-mimic, in the peptide.
- the carboxylate group of Asp8 residue might mimic a phosphorylated residue and thus, the Ab can bind peptides with pSer, pThr, or possibly pTyr in place of Asp8 (Table 5).
- ELISA data confirmed the ability of this Fab to bind pSer- or pThr-containing peptides, albeit with weak affinities (>2000 nM) (Fig. lc and Table 6). Table 5. Phosphorylated peptide antigens utilized.
- a series of p3 phage display vectors along with compatible protein expression vectors was constructed (Table 4).
- a previously described phagemid was designed to express a Fab from a phoA promoter and display the Fab on gene 3 of Ml 3 bacteriophage (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338, 299-310 (2004)).
- a cassette was inserted having of a PelB signal sequence followed by a dummy gene sequence, which is then linked to a truncated gene III coat protein (pJKl).
- a version with a full-length gene III coat protein (pJK2) along with two protein expression vectors was constructed (pJK3 and pJK4).
- pJK2 full-length gene III coat protein
- pJK3 and pJK4 To permit efficient cloning of antibody sequences between all vectors, a dummy gene was flanked by two unique Sfi I restriction sites.
- a gene cassette encoding the heavy and light chains of the mouse Fab was synthesized and cloned into pJKl .
- a humanized version of this scaffold was also constructed by grafting the three heavy chain CDRs from the mouse Fab onto a consensus VH3 heavy chain gene and the three light chain CDRs onto a consensus VLK3 light chain gene (Knappik, A. et al.
- Fully synthetic human combinatorial antibody libraries (HuCAL) based on modular consensus frameworks and CDRs randomized with trinucleotides. J Mol Biol 296, 57-86 (2000)).
- the human Fab template was modified by Kunkel mutagenesis, according to standard protocols (Kunkel, T.A. Rapid and efficient site-specific mutagenesis without phenotypic selection. Proc Natl Acad Sci USA 82, 488-492 (1985)). All restriction enzymes and DNA polymerases were purchased from NEB (Ipswich, MA). Oligonucleotides were purchased from IDT and all constructs were verified by DNA sequencing (Quintara Biosciences).
- a humanized Fab in pJKl with two stop codons within the CDR H2 was used as a template for Kunkel mutagenesis with oligonucleotides designed to correct the stop codons and introduce the designed mutations at each site (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338, 299- 310 (2004) and Kunkel, T.A. Rapid and efficient site-specific mutagenesis without phenotypic selection. Proc Natl Acad Sci USA 82, 488-492 (1985)).
- H2- targeted libraries a set of three libraries was generated in which the codons encoding the parent H2 sequence (STGGYN) was replaced with either i) six random amino acids encoded by NNK (H2 library), ii) seven random amino acids encoded by NNK (H2+1 library), or iii) a core set of two or three amino acids, which were allowed to be only Gly or Ser, and were flanked on both sides by two random amino acids encoded by NNK (GS library).
- Mutagenic oligonucleotides are listed in Table 7. The resulting mutagenesis reactions were
- CDRH3 was diversified using three to nine random amino acids (DVK) followed by three terminal residues (F/M, A/D, and Y) commonly observed in anti-peptide antibodies.
- L3 oligonucleotides (PI and P2) were mixed at a 1:1 molar ratio
- H2 oligonucleotides (1, 2, and 3) were mixed at a 0.1:1:2 ratio
- the resulting libraries were produced using Hyperphage (Rondot, S., Koch, J., Breitling, F. & Dubel, S. A helper phage to improve single-chain antibody presentation in phage display. Nat Biotechnol 19, 75-78 (2001)) to enhance recovery of rare binders and the final diversities of the pSAb and pSTAb libraries were 3.4 x 10 10 and 2.7 x 10 10 , respectively.
- HRP horseradish peroxidase
- GE Healthcare horseradish peroxidase
- phage competition ELISAs plates were coated with 10 ⁇ g/mL NusA-KGNYVVTDH (the native target for the H8i Fab and a weak binder to pSAb, pSTAb, and pYAb), and blocked with 2% BSA. Sub-saturating levels of phage were then pre-bound to the various peptide antigens for two hours at 20°C and then captured on the NusA-peptide coated plates for fifteen minutes.
- scFv-Fc competition ELISAs plates were coated with NeutrAvidin, blocked with 2% BSA, incubated with 100- 200 nM biotinylated peptide, and finally blocked with 200 ⁇ biotin. scFv-Fcs were then pre-bound to a dilution series of peptide antigen and processed as described for phage.
- Bound scFv-Fc were detected with HRP-conjugated Protein A (Pierce).
- Competition ELISA data was fit using a four-parameter logistic equation, with error shown by standard deviation of 2-3 replicates for each sample analyzed.
- the pTyr Abs contained a different binding motif from the pSer/pThr clones consisting of a valine at 52 H , the Gly-Gly motif, and two consecutive basic residues, suggesting that the mode of pTyr recognition differs from that of pSer/pThr recognition (Fig. 3c).
- phage clones by competition ELISA were next analyzed to identify the best scaffold for each PTM target (pSer, pThr, or pTyr) (data not shown). From these experiments, a pSer-specific scaffold (pSAb with the loop sequence ATGGHT), a pSer/pThr-specific scaffold (pSTAb with sequence STPRGST), and a pTyr-specific scaffold (pYAb with sequence VTGGRK) were observed. To determine the phospho-selectivity of these scaffolds, binding to the phosphorylated and unphosphorylated peptides was analyzed. High selectivity for the phosphorylated peptide was observed in all cases (Fig. 3).
- Example 3 Structural analysis of phosphope tide recognition
- thermosensitive phenotype of pre knockout strains Choen, C. et al. High-level accumulation of a recombinant antibody fragment in the periplasm of Escherichia coli requires a triple- mutant (degP pre spr) host strain. Biotechnol Bioeng 85, 463-474 (2004)) to generate the PRO+ strain.
- Fabs were expressed in the C43 PRO+ strain, ⁇ 5% of the Fab was proteolyzed (data not shown).
- Fabs were purified from total cell lysates by Protein A chromatography, ion exchange chromatography, and a gel filtration chromatography step as previously described (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338, 299-310 (2004) and Bostrom, J. et al. Variants of the antibody herceptin that interact with HER2 and VEGF at the antigen binding site. Science 323, 1610-1614 (2009)). Fabs were stored at 4°C for short-term analysis or flash frozen in 10% glycerol for storage at -80°C.
- Selected scFvs were PCR amplified and fused to a rabbit Fc domain (rFc) in a mammalian expression vector (pJK6). These constructs were transiently transfected into 293T cells and the resulting scFv-Fc proteins were purified from the media using Protein A chromatography. Nonphosphorylated versions of all peptides were fused to the C-terminus of NusA, which contained an N-terminal His 6 tag and biotin acceptor peptide and were co-expressed in BL21 (DE3) cells with BirA to enzymatically biotinylate each protein (pJK5).
- Recombinant proteins were purified on a His GraviTrap column (GE Healthcare, Piscataway, NJ) followed by monomeric Avidin resin (Thermo Scientific, Rockford, IL) to a final purity of >95%. All biotinylated peptides were purchased from Elim Biopharmaceuticals (Hayward, CA) or Peptibody, Inc. (Charlotte, NC).
- RivoImkfS (A) 50- 1,55 ?4,I9 - 74,59- 50-1.95 7 J3-2-0
- the X-ray structures of the parent peptide:Fab complexes illustrate how CDR H2 specifically recognizes each phosphoresidue (Fig.7).
- mutations found in the parent H2 loop make the main-chain more accessible and create a large electropositive hot spot (indicated by arrow in Fig.8).
- the phosphoresidue side chain is almost fully engulfed by the Ab in pSAb (80% buried) and pSTAb (92% buried) and anchored by multiple hydrogen bonds to side chains and main-chain amides (five and seven bonds for pSAb and pSTAb, respectively), confirming that the hot spot was successfully optimized in the CDR (Fig. 7a, b, c, and Table 11).
- the pSer residue makes key contacts with specificity residues G53 H , R55 H , and T56 H
- the pSer and pThr residues make key contacts with R53 H , G54 H , and S55 H .
- the insertion of P52B H allows the T52A R anchor to flip out and still contribute a hydrogen bond from the main-chain carbonyl.
- pYAb does not utilize the original designed loop conformation to bind pTyr (Fig. 7d).
- a key ionic interaction between H56K and the phosphate of pTyr and a hydrophobic interaction between V52 R and the phenyl ring contribute to the recognition mode.
- the H2 nest pocket is occupied by a water molecule that is additionally stabilized by the free C- terminus of the peptide, indicating that pYAb may bind differently to the pTyr residue in longer peptides without this neighboring free carboxylate (Fig. 7d).
- the recognition is achieved through two sectors: the phosphoresidue-binding pocket and neighboring peptide sequence "reader" region, which consists primarily of CDRs L3 and H3 (Fig. 7e).
- the in vitro characterization and X-ray crystal structures confirmed that novel Ab scaffolds were designed that utilize pSer, pThr, or pTyr as hot-spot residues.
- Fabs were expressed as described herein and concentrated to 10-15 mg/mL in lOmM Tris pH7.5, 50mM NaCl. Complexes of the Fab with the corresponding peptide were formed at a 1 :2 molar ratio of Fab:peptide. Crystals were grown in hanging drop format by mixing 100 nL of protein solution and 100 nL crystallization solution using a Mosqutio nanoliter pipetting system (TTP Labtech). Crystals formed within one to two weeks at either 18°C or 4°C. A microseeding strategy was generated with a seed stock generated from finely ground pSTAb:pThr crystals in 50 cryoprotectant solution (Luft, J.R. & DeTitta, G.T. A method to produce microseed stock for use in the crystallization of biological
- Crystals for the pSAb:pSer and pSTAb:pSer complexes were generated by hanging drop vapor diffusion with 300 nL drops consisting of 150 nL protein solution, 120 nL reservoir solution, and 30 nL 1 : 100 dilution of seed stock. All crystals were soaked in cryoprotectant solution and flash frozen in liquid nitrogen. Crystallization conditions and cryoprotectant solutions are listed in Table 9.
- Diffraction data were collected using the Advanced Light Source beam line 8.3.1 at the Lawrence Berkeley National Laboratory (Berkeley, California) with a wavelength of 1.1 A.
- the data were indexed, integrated, and scaled using ELVES (Holton, J. & Alber, T. Automated protein crystal structure determination using ELVES. Proc Natl Acad Sci USA 101, 1537-1542 (2004)) and HKL2000 (Otwinowski, Z. & Minor, W. Processing of X-ray diffraction data collected in oscillation mode. Method Enzymol 276, 307-326 (1997)).
- the structure of the pSTAb:pThr complex was solved by molecular replacement using Phenix (Otwinowski, Z. & Minor, W.
- the initial search model consisted of the variable heavy domain from 3n9g and the variable light domain, constant heavy domain, and constant light domain from 2gcy55.
- the pSTAb Fab structure was used as the search model for all other structures. Iterative rounds of model building and refinement were carried out with Phenix and Coot (Emsley, P. & Cowtan, K. Coot: model-building tools for molecular graphics. Acta Crystallogr D Biol Crystallogr 60, 2126-2132 (2004)). For isomorphous crystals, the same refinement test sets for calculating Rfree were used.
- the final Ramachandran statistics % Favored:% Outlier were 98:0.2, 98:0.2, 98:0.2, 98:0, and 97:0.2 for pSAb:pSer, pSTAb:pSer, pSTAb:pThr, pYAb:pTyr, and pYAb, respectively.
- MacPyMol (DeLano Scientific) was used to generate structure figures. Electrostatic surfaces were calculated using APBS (Baker, N.A., Sept, D., Joseph, S., Hoist, M.J. & McCammon, J.A. Electrostatics of nanosystems: application to microtubules and the ribosome.
- Example 4 Generation of novel phospho-specific antibodies using pSer and pSer/pThr scaffolds
- each Ab should have a weak initial affinity for the phosphorylated antigen and this anchor should dramatically enhance the selection of new antibodies.
- pSer- and pThr-containing antigens were targeted because reagents capable of detecting these modifications are lacking in the art.
- the pSAb and pSTAb Fab scaffolds were converted into single chain fragment variable (scFv) scaffolds to improve the display level on phage and ultimately, improve the selection of Abs from the library.
- the surface-exposed positions were diversified in CDR H2 (5 OH, 56H, and 58H) outside of the phosphate-hot spot and CDR L3 (91 L -94 L , 96 L ) using codons designed to mimic natural Ab sequence diversity (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. JMol Biol 338, 299-310 (2004)) (Table 8).
- CDR H3 was diversified with CDR lengths ranging from six to twelve amino acids using a degenerate codon designed to explore maximal chemical diversity, while still allowing efficient sampling of the sequence space in the library.
- the pSAb and pSTAb libraries had diversities of 3.4 x 10 10 and 2.7 x 10 10 , respectively.
- a set of ten biologically relevant pSer- or pThr-containing epitopes were chosen as target antigens (Table 12 and Table 5). Three rounds of selection were performed and single phage clones were analyzed from the third round of selection by single -point ELISA. For seven targets, at least one scFv was isolated that bound only to the phosphorylated and not the unphosphorylated antigen (Table 12 and Fig. 9a). To demonstrate that the isolated clones are specific to each phosphorylated peptide, a panel of ELIS As (as described above) was performed to assay binding of each scFv to each of the ten phosphorylated peptides (Fig. 9b and 9c).
- Described herein is a novel and renewable antibody generation method that entails the design of a motif-specific (e.g. pSer, pThr, or pTyr) antibody scaffold followed by structure-informed mutagenesis of the scaffold to generate monoclonal motif-specific antibodies against a panel of phosphopeptide antigens.
- the high success rate (70%) which does not employ counter selections against the unphosphorylated epitope demonstrates how the motif-specific hot spot greatly improves the selection process as even past Ab libraries generated from immunized animals required stringent counter selections to enrich for PS antibodies (Shih, H.H. et al.
- phospholipids suggested a "phosphate -binding subsite" that conferred recognition of only the phosphorylated or sulfated forms of multiple lipids and haptens (Alving, C.R. Antibodies to liposomes, phospholipids and phosphate esters. Chem Phys Lipids 40, 303-314 (1986)). Furthermore, anion-hot spot-containing Abs may provide a protective role in the recognition of phosphorylated or sulfated antigens, such as lipid A in Gram-negative bacteria (Alving, C.R. Antibodies to liposomes, phospholipids and phosphate esters.
- the pSer/pThr scaffolds described herein bind more efficiently to the phosphoresidue than naturally occurring domains by burying a larger surface area and contributing more hydrogen bonds (Table 1 1).
- Others have recently suggested that these endogenous phosphoresidue-binding and other PTM-binding domains have evolved to bind shorter epitopes with moderate affinities to support the dynamic nature of signal transduction pathways, which potentially limits the range of epitopes they can bind (Yaffe, M.B. & Smerdon, S.J. PhosphoSerine/threonine binding domains: you can't pSERious? Structure 9, R33-38 (2001); Kaneko, T., Joshi, R., Feller, S.M.
- pYAb utilizes a completely different motif to recognize pTyr (Fig. 7d).
- the salt bridge between the phosphate and H56 Lys is more akin to how 14-3-3 and PTB domains bind phosphorylated residues.
- optimization of a single CDR loop generated two different phosphate -recognition modes, both of which are found in natural protein domains (Kaneko, T., Joshi, R., Feller, S.M. & Li, S.S. Phosphotyrosine recognition domains: the typical, the atypical and the versatile.
- the PS Abs described herein utilize a single framework that permits high-level bacterial expression (> 3mg/L) and mammalian expression (-0.5-5 ⁇ g/mL media) in a renewable format.
- the use of a single framework greatly simplifies mutagenesis protocols ⁇ e.g. affinity maturation), sequence-function analysis, and conversion to other antibody formats (e.g. IgG) (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. JMol Biol 338, 299-310 (2004)).
- the recombinant PS antibodies described herein can be genetically fused to a variety of molecules, thus permitting the rapid generation of detection reagents (e.g. Fc fusions) or intracellular probes (e.g.
- substance P fusions (Rizk, S.S. et al. An engineered substance P variant for receptor- mediated delivery of synthetic antibodies into tumor cells. Proc Natl Acad Sci USA 106, 11011-11015 (2009)).
- ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science 316, 1160-1166 (2007)).
- a renewable and reproducible mixture of monoclonal PS Abs that enriches a degenerate phosphorylation motif, such as a consensus substrate motif for a kinase.
- the Ab mixtures described herein are advantageous over traditional affinity- purified polyclonal Abs, which are not renewable and vary from batch to batch. For example, a recent study highlights the ability of a well-defined Ab mixture generated from two or three commercially available PS Abs against known ATM and ATR kinase substrates to serve as immunoaffmity reagents to identify >900 phosphorylation sites induced by DNA damage (Matsuoka, S. et al. ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science 316, 1160-1166 (2007)).
- the scFv clones P3.4 and P3.8 described herein represent the first components of a degenerate pSer-specific antibody pool that cross-reacts with multiple phosphorylated peptides (Fig. 9c). Sequential selections of the libraries against several phosphopeptides that share a common motif beyond the
- phosphoresidue can generate additional antibodies with tailored degenerate specificities.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Pathology (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Computational Biology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention described herein features methods and compositions for generating an antibody specific to post-translational modifications (PTMs). The methods and compositions provide a renewable synthetic antibody strategy that installs a novel motif-specific hot spot into an antibody scaffold that functions independently of the surrounding scaffold. Such antibodies provide a rapid and robust development of antibodies for signaling, diagnostic, and therapeutic applications.
Description
ENGINEERED ANTIBODY SCAFFOLDS
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] The present application claims priority to U.S. Provisional Application No.
61/788,343, filed on March 15, 2013, and which is incorporated herein by reference in its entirety for all purposes.
STATEMENT OF FEDERALLY-SPONSORED RESEARCH
[0002] This invetion was made with government support under Grant No. CA154802 awarded by the National Institutes of Health and Grant No. A 12258 awarded by the Life Science Research Foundation. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
[0003] Post-translational modifications (PTMs), such as phosphorylation, acetylation, sulfation, S-nitrosylation, methylation, glycosylation and proteolysis, play essential roles in modulating protein function throughout biology. In particular, phosphorylation is one of the most common regulatory mechanisms in eukaryotes, where roughly 20-30% of all proteins can be phosphorylated by over 500 kinases (1). Given the ubiquitous role of phosphorylation in signal transduction, it is not surprising that aberrant phosphorylation either directly causes or is a consequence of many human diseases, such as cancer and neurodegenerative disorders (2). Recent advances in phosphoproteomic methods have greatly expanded the number of known phosphorylation sites (> 170,000) and identified global phosphorylation changes that occur during disease (3-6). Ultimately, the validation of key phosphorylation and other post- translational modification events is best conducted at the single-cell level where recent studies utilizing monoclonal antibodies (Abs) specific to particular post-translational modifications have elucidated how stochastic fluctuations and signaling cross-talk contribute to the overall cellular state (7, 8).
[0004] Detection using PTM reagents is limited to antibodies generated through the immunization of animals (9). However, the generation of a polyclonal PTM antibody is often imprecise, low-throughput, expensive, time-consuming, and not renewable. Furthermore, the development of monoclonal antibodies requires additional screening of numerous hybridomas to identify the Ab of interest, which is made more challenging by the rarity of Ab clones specific to post-translational modifications, which is estimated to be 0.1-5% (10, 11). Additionally, the lack of available sequences of PTM Abs generated by immunization makes structure-guided improvements to their biophysical properties (e.g. affinity or stability) extremely difficult.
[0005] Recent attempts to generate renewable phospho-specific Abs using in vitro selection methods, such as phage display (12-16), yeast display (17), and ribosome display (18), have been even less efficient than immunization methods (17, 19-22). Overall, both immunization and in vitro methods fail to generate high affinity Abs due to the fact that most of the naive Abs do not possess any initial affinity for the small peptide antigens. Finally, disproportionately more phosphotyrosine (pTyr)-specific Abs exist than phosphoserine (pSer)- or phosphothreonine (pThr)-specific Abs, which is likely due to the larger surface area of pTyr. This fact has hindered the study of phosphorylation of serine and threonine phosphorylation, which account for 90% and 10%> of all phosphorylation sites, respectively, compared to <0.05%> for tyrosine (23). As an alternative to Abs, several groups have engineered PS reagents using endogenous phosphopeptide-binding domains such as Src- homology-2 (SH2) or forkhead-associated (FHA) domains, but the general utility of such non-antibody scaffolds has not been demonstrated and is limited by poor thermostabilities, weak affinities, and short epitopes recognized by such domains (24-26).
[0006] Very few commercially available antibodies are suitable for rapid, robust methods to generate high-quality, renewable, monoclonal post-translational modification detection reagents as the number of functionally important post-translational modification sites increases. The invention described herein solves these and other problems by providing a novel structure-guided Ab generation strategy that uses antibody scaffolds with engineered hot spots tailored to specific sequence motifs relating to particular post-translational modifications of interest.
BRIEF SUMMARY OF THE INVENTION
[0007] Provided herein are high affinity Abs using a novel structure-guided Ab generation strategy that employs Ab scaffolds with engineered or identified hot spots tailored to bind to a sequence motif specific to a particular post-translational modification. In an embodiment, a method of identifying antibodies that specifically bind a protein comprising a post translational modification are provided. The method comprises (1) identifying a noncovalent post translational modification-binding motif in a protein; (2) inspecting known antibody CDRs for an anchoring pocket sequence that adopts the conformation of the noncovalent post translational modification-binding motif; (3) preparing an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise the anchoring pocket; (4) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and (5) identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
[0008] In an exemplary embodiment, the antibody binds a specific protein comprising the post translational modification. In an exemplary embodiment, the antibody binds a specific post translational modification. In an exemplary embodiment, the post translational modification is an anion. In an exemplary embodiment, the post translational modification is phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation. In an exemplary embodiment, the noncovalent post translational modification- binding motif recognizes an anion. In an exemplary embodiment, the noncovalent post translational modification-binding motif recognizes a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar. In an exemplary embodiment, the method further comprises the step of characterizing the anchoring pocket. In an exemplary embodiment, amino acid residues from two or more CDRs comprise the anchoring pocket.
[0009] In an embodiment, a method of identifying antibodies that specifically bind a protein comprising a post translational modification is provided. The method comprises (1) identifying a noncovalent post translational modification-binding motif in a protein; (2) engineering an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise an anchoring pocket that adopts the conformation of the noncovalent post translational modification-binding motif ; (3) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and (4) identifying
antibodies in the library that specifically bind to a protein comprising a post translational modification.
[0010] In an exemplary embodiment, the antibody binds a specific protein comprising the post translational modification. In an exemplary embodiment, the antibody binds a specific post translational modification. In an exemplary embodiment, the post translational modification is an anion. In an exemplary embodiment, the post translational modification is phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation. In an exemplary embodiment, the noncovalent post translational modification- binding motif recognizes an anion. In an exemplary embodiment, the noncovalent post translational modification-binding motif recognizes a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar. In an exemplary embodiment, the method further comprises the step of characterizing the anchoring pocket. In an exemplary embodiment, amino acid residues from two or more CDRs comprise the anchoring pocket.
BRIEF DESCRIPTION OF THE DRAWINGS
[0011] Figure 1 illustrates the design of phospho-specific antibody scaffold, (a) Structure of CDR H2 loop from antibody (PDB ID H8i) bound to aspartate in peptide antigen (31). Each H2 residue contributes to anchoring the peptide near the pocket (52H and 52AH), specificity (53H, 55H, and 56H), or conformation (53H). (b) Competition phage ELISAs with humanized Fab. Eight different mutant peptides containing D, A, S, T, Y, pS, pT, or pY at position 8 of the peptide were used as soluble competitors to inhibit Fab binding to the immobilized wild-type peptide (KGNYVVTDH) (n=3, error bars represent standard deviation), (c) Representative pooled phage ELISAs from selection of H2 -targeted library against pSer peptide. After three rounds of selection, all library pools exhibited higher binding signal to the pSer peptide than the parent Fab (dashed line).
[0012] Figure 2 illustrates the structure of nest motif in non-antibody and antibody scaffolds, (a) Nest motif present in barnase (61), in which three consecutive main-chain amides contact the carbonyl group from a different residue, (b) Structural alignment of CDR H2 bound to Asp/Glu. Alignment of CDR H2 region (50H-56H) from PDB ID H8i (62), lfrg (63), 2igf (64), 2qhr (65), ldqj (66), 2nyy (67), 3bn9 (68), and 3ffd (69). All the antibodies contain G54R (indicated by arrow) and make at least two hydrogen bonds between the
Asp/Glu antigen residue and main-chain NH groups, (c) Alignment of the same CDR H2 region bound to sulfate ions from PDB ID lseq (70), 2gsg (71), and 3vg0 (72).
[0013] Figure 3 illustrates the selection and characterization of pSer-, pSer/pThr-, and pTyr-specific scaffolds. Competition ELISAs were used to determine the specificity of each antibody scaffold. For both pSAb (a) and pSTAb (b), no binding inhibition was observed for the unphosphorylated peptides up to 2 μΜ, whereas strong inhibition was observed for the phosphorylated peptides. For pYAb (c), weak inhibition was observed at high concentrations of the unphosphorylated Tyr peptide, but ~20-fold less pTyr peptide was required to observe the same level of inhibition. The sequence logos of the antibody pools from which each lead clone was derived are depicted in the bottom panels. GS and H2 indicate the sequence logos from GS and H2 libraries selected against pSer and pThr. All clones that bound pTyr came from the six-residue libraries and contain two positively charged amino acids at 55H and 56H- The H2 sequences of pSAb, pSTAb, and pYAb are ATGGHT, STPRGST, and VTGGR , respectively.
[0014] Figure 4 illustrates Biacore traces of phospho-specific Fabs binding to
phosphorylated peptides, (a) pSAb binding to pSer peptide, (b) pSTAb binding to the pSer peptide, (c) pSTAb binding to the pThr peptide, (d) pYAb binding to the pTyr peptide.
[0015] Figure 5 illustrates density maps of Fab structures. Strong electron density in pSAb:pSer (a), pSTAb:pSer (b), pSTAb:pThr (c), and pYAb:pTyr (d) complexes was observed for the peptide (top panels Fo-Fc maps) and for the phosphoresidue and CDR H2 loop (H50-H56) (bottom panels 2Fo-Fc maps). Fo-Fc maps were contoured to 3σ and 2Fo-Fc maps were contoured to 1.25σ.
[0016] Figure 6 illustrates the structural comparison between the mouse and humanized Fab (a), and the bound and unbound Fab (b). (a) Alignment of the mouse Fab with the humanized Fab reveals no major deviations in the position of CDRs between the Fabs (ca RMSD of 0.78 A), (b) Comparison of the unbound and bound forms of pYAb reveals no major shifts in CDR position upon binding to the peptide (ca RMSD of 1.3 A).
[0017] Figure 7 illustrates the X-ray crystal structures of phosphoresidue-binding hot spot from pSAb (a), pSTAb (b and c), and pYAb (d). (a) In pSAb, pSer makes hydrogen bonds with all three specificity residues (G53, H55 and T56). The anchoring hydrogen bond to T52A is conserved, (b and c) In pSTAb, the pSer/pThr makes hydrogen bonds with two
specificity residues (R53 and S55), one anchor residue (S52), and the conformation residue (G54). In both pSTAb structures bound to pSer and pThr, R53 forms a bidentate interaction with the phosphate. The anchor residue T52A is flipped compared to pSAb, which allows the backbone carbonyl to make a new anchoring hydrogen bond, (d) The pTyr is recognized by a salt bridge with K56 and a hydrophobic interaction between V52 and the phenyl ring of the pTyr. However, longer side chain of pTyr prevents the phosphate group from occupying the phosphate-binding pocket, which is instead occupied by a water molecule (shown as a sphere), (e) The structures demonstrate two distinct recognition modules: a phosphoresidue- binding pocket and peptide-binding region.
[0018] Figure 8 illustrates the electrostatic surface representations of the parent Fab (a), pSAb (b), pSTAb (c), and pYAb (d). Comparison of phosphate-binding pocket (indicated by arrow) in CDR H2 reveals larger electropositive pocket for all the phospho-specific scaffolds. Surfaces were calculated with APBS and generated with MacPymol.
[0019] Figure 9 illustrates the generation of novel recombinant phospho-specific (PS) antibodies using the pSAb and pSTAb scaffolds, (a) Representative phage ELISAs of one scFv clone selected against each of the nine phosphopeptide targets demonstrates that PS Abs to seven out of the ten targets were selected. No hits were observed against P7. To analyze target specificity, the binding of each scFv to ten different phosphopeptides was characterized by phage ELISA (b). Representative results are shown for the scFv clones that were selected against P10. (c) Heatmap representation of the phage ELISA binding signals for each scFv (vertical axis) against each of the ten phosphopeptides (horizontal axis). For each scFv, signals were normalized to the highest overall ELISA signal observed against the ten peptides. The scale goes from zero to one. (d) Competition ELISA data for two of the scFv- Fc fusions demonstrates high affinities for the target phosphopeptides. Calculated KD values for every clone analyzed are shown in Table 11.
[0020] Figure 10 illustrates the phosphoresidue-binding pocket from natural
phosphopeptide binding domains. In all structures, at least one Lys or Arg makes a salt bridge with the phosphoresidue. The CDR H2 pocket from a scFv isolated from an immunized chicken that binds to a pThr-containing peptide is also shown (73). Representative structures for the 14-3-3, WW, BRCA1 C-terminus (BRCT), WD40, forkhead-associated (FHA), Src Homology 2 (SH2), and phosphotyrosine -binding (PTB) domains are from PDB ID lywt (74), lf8a (75), ltl5 (76), lnex (77), lj41 (78), laOt (79), and lshc (80), respectively.
[0021] Figure 11 provides an alignment of the exemplary antibody sequences identified employing the methods described in the present disclosure.
DETAILED DESCRIPTION OF THE INVENTION
Introduction
[0022] Traditional polyclonal Abs generation using immunization and in vitro Ab generation methods fail to generate high affinity post-translational modification-specific Abs because most native Abs do not possess any initial affinity for the small peptide antigens harboring the post-translational modification. The invention described herein provides high affinity Abs using a novel structure-guided Ab generation strategy that employs Ab scaffolds with engineered or identified hot spots tailored to bind to a sequence motif specific to a particular post-translational modification.
[0023] Provided herein are methods and compositions wherein a motif-specific anchoring hot spot that recognizes a specific post-translational protein modification is first engineered or identified in a CDR of a parent antibody, thus creating an antibody scaffold. The sequence-specific designs of the present disclosure are termed "hot spots" or binding pockets or anchoring pockets because they contribute a substantial fraction of the binding energy to a protein-protein interaction (Clackson, T. & Wells, J. A. A hot spot of binding energy in a hormone -receptor interface. Science 267, 383-386 (1995); Bogan, A.A. & Thorn, K.S.
Anatomy of hot spots in protein interfaces. J Mol Biol 280, 1-9 (1998)). The antibody scaffold that includes the hot spot provides an initial antigen-binding affinity to the desired modification. Following generation of the Ab scaffold, diverse Ab libraries can then be used for in vitro selection wherein CDR positions are randomized outside of the engineered anchoring hot spot. Selections with these libraries allow a skilled artisan to isolate novel antibodies that are highly specific against peptides harboring the desired post-translational modification.
Definitions
[0024] Unless specifically indicated otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to
which this invention belongs. In addition, methods or materials that are substantially equivalent to a method or material described herein can be used in the practice of the present invention. For purposes of the present invention, the following terms are defined.
[0025] The phrase "noncovalent, post translational modification-binding motif refers to amino acids that adopt a noncovalent conformation that recognizes a post translational modification. Such motifs are present in protein domains that recognize protein
modifications such as phosphate, sulfate, acetyl, methyl, nitric oxide, N-terminal alpha amine, C-terminal carboxylate, GalNAc sugar or GlcNAc sugar. These motifs are used to identify or design "hot spots" or "anchoring pocket sequences" that are incorporated into antibody CDRs and used to specifically bind post translationally modified proteins.
[0026] The term "anchoring pocket sequence" or "anchoring pocket" or "hot spot" refers to a non-covalent conformation of a subsequence or portion of one or more antibody CDRs that is specific to and binds to a protein post translational modification. The anchoring pocket sequence can be present in a known CDR or can be engineered. The anchoring pocket sequence is optionally further modified to have more specific binding properties for the protein post translational modification. Essentially, the noncovalent, post translational modification-binding motif (found in a protein domain) and the anchoring pocket sequence (found in a CDR or CDRs) perform the same function of binding to post translational modifications.
[0027] As used herein, an antibody scaffold is an antibody or antibody fragment that includes a CDR or more than one CDR that forms an anchoring pocket sequence, or "hot spot."
[0028] The term "antibody" refers to a polypeptide comprising a framework region from an immunoglobulin gene or fragments thereof that specifically binds and recognizes an antigen. The recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively. Typically, the antigen-binding region of an antibody will be most critical in specificity and affinity of binding. Antibodies can be polyclonal or monoclonal, derived from serum, a hybridoma or recombinantly cloned, and
can also be chimeric, primatized, or humanized. Antibodies exist, e.g. , as intact immunoglobulins or as a number of well-characterized fragments produced by digestion with various peptidases (see Fundamental Immunology (Paul ed., 3d ed. 1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology. Thus, the term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g. , single chain Fv or Fab fragments) or those identified using phage display libraries (see, e.g., McCafferty et ah, Nature 348:552-554 (1990)).
[0029] The term "CDR" as used herein specifies the Complementarity Determining Region (see, for example, Harlow and Lane, "Antibodies, a Laboratory Manual," CSH Press, Cold Spring Harbour, 1988). A CDR is a relatively short amino acid sequence found in the variable (V) domains of an antibody. Each variable domain (the heavy chain VH and light chain VL) of an antibody comprises three complementarity determining regions sometimes called hypervariable regions, flanked by four relatively conserved framework regions or "FRs." The six CDRs of an antibody essentially determine the specificity of an antibody and make the contact with a specific ligand.
[0030] In some embodiments, the antibodies are full length. By "full length antibody" herein is meant the structure that constitutes the natural biological form of an antibody, including variable and constant regions, including one or more modifications as outlined herein.
[0031] Alternatively, the antibodies can be a variety of structures, including, but not limited to, antibody fragments, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, antibody fusions (sometimes referred to as "antibody conjugates"), and fragments of each, respectively.
[0032] In some embodiments, the antibody is an antibody fragment. Specific antibody fragments include, but are not limited to, (i) the Fab fragment consisting of VL, VH, CL and CHI domains, (ii) the Fd fragment consisting of the VH and CHI domains, (iii) the Fv fragment consisting of the VL and VH domains of a single antibody; (iv) the dAb fragment
(Ward et al, 1989, Nature 341 :544-546, entirely incorporated by reference) which consists of a single variable, (v) isolated CDR regions, (vi) F(ab')2 fragments, a bivalent fragment comprising two linked Fab fragments (vii) single chain Fv molecules (scFv), wherein a VH domain and a VL domain are linked by a peptide linker which allows the two domains to associate to form an antigen binding site (Bird et al., 1988, Science 242:423-426, Huston et al, 1988, Proc. Natl. Acad. Sci. U.S.A. 85:5879-5883, entirely incorporated by reference), (viii) bispecific single chain Fv (WO 03/11161, hereby incorporated by reference) and (ix) "diabodies" or "triabodies", multivalent or multispecific fragments constructed by gene fusion (Tomlinson et. al, 2000, Methods Enzymol. 326:461-479; WO94/13804; Holliger et al, 1993, Proc. Natl. Acad. Sci. U.S.A. 90:6444-6448, all entirely incorporated by reference).
[0033] In some embodiments, the antibody can be a mixture from different species, e.g. a chimeric antibody and/or a humanized antibody. That is, in the present invention, the CDR sets can be used with framework and constant regions other than those specifically described by sequence herein.
[0034] In general, both "chimeric antibodies" and "humanized antibodies" refer to antibodies that combine regions from more than one species. For example, "chimeric antibodies" traditionally comprise variable region(s) from a mouse (or rat, in some cases) and the constant region(s) from a human. "Humanized antibodies" generally refer to non-human antibodies that have had the variable-domain framework regions swapped for sequences found in human antibodies. Generally, in a humanized antibody, the entire antibody, except the CDRs, is encoded by a polynucleotide of human origin or is identical to such an antibody except within its CDRs. The CDRs, some or all of which are encoded by nucleic acids originating in a non-human organism, are grafted into the beta-sheet framework of a human antibody variable region to create an antibody, the specificity of which is determined by the engrafted CDRs. The creation of such antibodies is described in, e.g., WO 92/11018, Jones, 1986, Nature 321 :522-525, Verhoeyen et al, 1988, Science 239: 1534-1536, all entirely incorporated by reference. "Backmutation" of selected acceptor framework residues to the corresponding donor residues is often required to regain affinity that is lost in the initial grafted construct (US 5530101; US 5585089; US 5693761; US 5693762; US 6180370; US 5859205; US 5821337; US 6054297; US 6407213, all entirely incorporated by reference). The humanized antibody optimally also will comprise at least a portion of an
immunoglobulin constant region, typically that of a human immunoglobulin, and thus will
typically comprise a human Fc region. Humanized antibodies can also be generated using mice with a genetically engineered immune system. Roque et al , 2004, Biotechnol. Prog. 20:639-654, entirely incorporated by reference. A variety of techniques and methods for humanizing and reshaping non-human antibodies are well known in the art (See Tsurushita & Vasquez, 2004, Humanization of Monoclonal Antibodies, Molecular Biology of B Cells, 533-545, Elsevier Science (USA), and references cited therein, all entirely incorporated by reference). Humanization methods include but are not limited to methods described in Jones et al, 1986, Nature 321 :522-525; Riechmann et al , 1988; Nature 332:323-329; Verhoeyen et al, 1988, Science, 239: 1534-1536; Queen et al, 1989, Proc Natl Acad Sci, USA 86: 10029- 33; He et al, 1998, J. Immunol. 160: 1029-1035; Carter et al, 1992, Proc Natl Acad Sci USA 89:4285-9, Presta et al, 1997, Cancer Res. 57(20):4593-9; Gorman et al , 1991 , Proc. Natl. Acad. Sci. USA 88:4181-4185; O'Connor et al, 1998, Protein Eng 1 1 :321-8, all entirely incorporated by reference. Humanization or other methods of reducing the immunogenicity of nonhuman antibody variable regions may include resurfacing methods, as described for example in Roguska et al, 1994, Proc. Natl. Acad. Sci. USA 91 :969-973, entirely
incorporated by reference. In one embodiment, the parent antibody has been affinity matured, as is known in the art. Structure-based methods may be employed for humanization and affinity maturation, for example as described in U.S. Application Serial No. 1 1/004,590. Selection based methods may be employed to humanize and/or affinity mature antibody variable regions, including but not limited to methods described in Wu et al, 1999, J. Mol. Biol. 294: 151-162; Baca et al, 1997, J. Biol. Chem. 272(16): 10678-10684; Rosok et a/., 1996, J. Biol. Chem. 271(37): 2261 1-22618; Rader et al, 1998, Proc. Natl. Acad. Sci. USA 95 : 8910-8915; Krauss et al, 2003, Protein Engineering 16(10):753-759, all entirely incorporated by reference. Other humanization methods may involve the grafting of only parts of the CDRs, including but not limited to methods described in U.S. Application Serial No. 09/810,510; Tan et al, 2002, J. Immunol. 169: 1 1 19-1 125; De Pascalis et al, 2002, J. Immunol. 169:3076-3084, all entirely incorporated by reference.
[0035] In some embodiments the antibodies are diabodies. In some embodiments, the antibody is a minibody. Minibodies are minimized antibody-like proteins comprising a scFv joined to a CH3 domain. Hu et al, 1996, Cancer Res. 56:3055-3061 , entirely incorporated by reference. In some embodiments, the scFv can be joined to the Fc region, and may include some or the entire hinge region.
[0036] The term "antigen" refers to a molecule capable of being bound by an antibody. An antigen is additionally capable of inducing a humoral immune response and/or cellular immune response leading to the production of B and/or T-lymphocytes.
[0037] The term "diversifying" or "to diversify" or "diversification" as used herein refers to a method of enhanced sequence evolution to generate a library of variants having unique amino acid sequence signatures. Protein diversification or evolution is well known in the art.
[0038] The term "variant" as used here refers to a polypeptide, protein, amino acid sequence, Fab, or antibody that is modified from its parental precursor.
[0039] The term "polypeptide" or "protein" refers to a polymer of two or more amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial, chemical analogue of a corresponding naturally occurring amino acid, as well as to polymers of naturally occurring amino acids. The term "recombinant protein" refers to a protein that is produced by expression of a nucleotide sequence encoding the amino acid sequence of the protein from a recombinant DNA molecule.
[0040] The term "target peptide" as used herein refers to a peptide comprising an amino acid sequence recognized by the engineered antibodies described herein.
[0041] The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g. , hydroxyproline, γ- carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g. , an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such unnatural amino acid analogs have modified R groups {e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical
Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
[0042] The term "amino acid substitution" as used herein refers to the deletion and/or replacement of a specific acid of a given position.
[0043] The term "post-translationally modified amino acid" as used herein refers to an amino acid that has been modified following ribosomal translation. Non-limiting examples of post-translational modifications are phosphorylated amino acids, e.g., phosphotyrosine (pTry), phosphoserine (pSer), and phosphothreonine (pThr). Other post-translational modifications can include oxidized cysteine, sulfated tyrosine, or acetylated lysine.
[0044] The term "naturally occurring" is used to refer to a protein, nucleic acid molecule, cell, or other material that exists in the natural world, for example, a polypeptide or polynucleotide sequence that is present in an organism, including in a virus. In general, at least one instance of a naturally occurring material existed in the world prior to its creation, duplication, or identification by a human. A naturally occurring material can be in its form as it exists in the natural world, or can be modified by the hand of man such that, for example, it is in an isolated form.
[0045] The term "nucleic acid" refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form, and complements thereof. The term refers to all forms of nucleic acids {e.g., gene, pre-mRNA, mRNA) and their
polymorphic variants, alleles, mutants, and interspecies homologs. The term nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide. The term encompasses nucleic acids that are naturally occurring or recombinant. Nucleic acids can (1) code for an amino acid sequence that has greater than about 60% amino acid sequence identity, 65%, 70%, 75%, 80%, 85%, 90%, preferably 91%, 92%, 93%, 94%, 95%, 96%, 97%), 98%o or 99% or greater amino acid sequence identity, preferably over a region of at least about 25, 50, 100, 200, 500, 1000, or more amino acids, to a polypeptide encoded by a referenced nucleic acid or an amino acid sequence described herein; (2) specifically bind to antibodies, e.g., polyclonal antibodies, raised against an immunogen comprising a referenced amino acid sequence, immunogenic fragments thereof, and conservatively modified variants thereof; (3) specifically hybridize under stringent hybridization conditions to a nucleic acid encoding a referenced amino acid sequence, and conservatively modified variants thereof; (4)
have a nucleic acid sequence that has greater than about 95%, preferably greater than about 96%o, 97%o, 98%), 99%o, or higher nucleotide sequence identity, preferably over a region of at least about 25, 50, 100, 200, 500, 1000, or more nucleotides, to a reference nucleic acid sequence. Nucleic acid symbols used herein are the standard IUPAC naming for nucleic acids, as exemplified in the following Table 1 :
Table 1. IUPAC Nucleic Acid Naming
[0046] The term "recombinant nucleic acid molecule" refers to a non-naturally occurring nucleic acid molecule containing two or more linked polynucleotide sequences. A recombinant nucleic acid molecule can be produced by recombination methods, particularly genetic engineering techniques, or can be produced by a chemical synthesis method. A recombinant nucleic acid molecule can encode a fusion protein, for example, a fluorescent protein variant of the invention linked to a polypeptide of interest. The term "recombinant host cell" refers to a cell that contains a recombinant nucleic acid molecule. As such, a recombinant host cell can express a polypeptide from a "gene" that is not found within the native (non-recombinant) form of the cell.
[0047] Reference to a polynucleotide "encoding" a polypeptide means that, upon transcription of the polynucleotide and translation of the mRNA produced there from, a polypeptide is produced. The encoding polynucleotide is considered to include both the coding strand, whose nucleotide sequence is identical to an mRNA, as well as its
complementary strand. It will be recognized that such an encoding polynucleotide is considered to include degenerate nucleotide sequences, which encode the same amino acid residues. Nucleotide sequences encoding a polypeptide can include polynucleotides containing introns as well as the encoding exons.
[0048] An expression control sequence refers to a nucleotide sequence that regulates the transcription or translation of a polynucleotide or the localization of a polypeptide to which it is operatively linked expression control sequences are "operatively linked" when the expression control sequence controls or regulates the transcription and, as appropriate, translation of the nucleotide sequence (i.e., a transcription or translation regulatory element, respectively), or localization of an encoded polypeptide to a specific compartment of a cell. Thus, an expression control sequence can be a promoter, enhancer, transcription terminator, a start codon (ATG), a splicing signal for intron excision and maintenance of the correct reading frame, a STOP codon, a ribosome binding site, or a sequence that targets a polypeptide to a particular location, for example, a cell compartmentalization signal, which can target a polypeptide to the cytosol, nucleus, plasma membrane, endoplasmic reticulum, mitochondrial membrane or matrix, chloroplast membrane or lumen, medial trans-Golgi cistemae, or a lysosome or endosome. Cell compartmentalization domains are well known in the art and include, for example, a peptide containing amino acid residues 1 to 81 of human type II membrane-anchored protein galactosyltransferase, or amino acid residues 1 to 12 of the presequence of subunit IV of cytochrome c oxidase (see also Hancock et al. , EMBO J. 10:4033-4039, 1991; Buss et al., Mol. Cell. Biol. 8:3960-3963, 1988; and U.S. Pat.
No. 5,776,689; each of which is incorporated herein by reference).
[0049] The term "immunoassay" refers to an assay that utilizes an antibody to specifically bind an analyte. An immunoassay is characterized by the use of specific binding properties of a particular antibody to isolate, to target, or to quantify the analyte.
[0050] The term "identical" or "identity" or "percent identity," or "sequence identity" in the context of two or more nucleic acids or polypeptide sequences that correspond to each other refer to two or more sequences or subsequences that are the same or have a specified
percentage of amino acid residues or nucleotides that are the same (e.g. , about 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection. Such sequences are then said to be "substantially identical" and are embraced by the term "substantially identical." This definition also refers to, or can be applied to, the compliment of a test sequence. The definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists for a specified entire sequence or a specified portion thereof or over a region of the sequence that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length. A corresponding region is any region within the reference sequence.
[0051] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated, in some
embodiments, default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. A comparison window includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence can be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted (e.g. , by the local homology algorithm of Smith & Waterman, Adv. AppL Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr.,
Madison, WI), or by manual alignment and visual inspection, e.g., Current Protocols in Molecular Biology (Ausubel et al, eds. 1995 supplement)).
[0052] In some embodiments, an exemplary algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, Nuc. Acids Res. 25 :3389-3402 (1977) and Altschul et al, JMol. Biol. 215 :403-410 (1990), respectively. BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive -valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 1 1 , an expectation (E) of 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word length of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89: 10915 (1989)) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
[0053] The term "conservatively modified variation," when used in reference to a particular polynucleotide sequence, refers to different polynucleotide sequences that encode identical or essentially identical amino acid sequences, or where the polynucleotide does not
encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical polynucleotides encode any given polypeptide. For instance, the codons CGU, CGC, CGA, CGG, AGA, and AGG all encode the amino acid arginine. Thus, at every position where an arginine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleotide sequence variations are "silent variations," which can be considered a species of "conservatively modified variations." As such, it will be recognized that each polynucleotide sequence disclosed herein as encoding a fluorescent protein variant also describes every possible silent variation. It will also be recognized that each codon in a polynucleotide, except AUG, which is ordinarily the only codon for methionine, and UUG, which is ordinarily the only codon for tryptophan, can be modified to yield a functionally identical molecule by standard techniques. Accordingly, each silent variation of a polynucleotide that does not change the sequence of the encoded polypeptide is implicitly described herein.
[0054] Furthermore, it will be recognized that individual substitutions, deletions or additions that alter, add or delete a single amino acid or a small percentage of amino acids (typically less than 5%, and generally less than 1%) in an encoded sequence can be considered conservatively modified variations, provided alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative amino acid
substitutions providing functionally similar amino acids are well known in the art, including the following six groups, each of which contains amino acids that are considered conservative substitutes for each another:
[0055] 1) Alanine (Ala, A), Serine (Ser, S), Threonine (Thr, T); [0056] 2) Aspartic acid (Asp, D), Glutamic acid (Glu, E); [0057] 3) Asparagine (Asn, N), Glutamine (Gin, Q); [0058] 4) Arginine (Arg, R), Lysine (Lys, K)
[0059] 5) Isoleucine (He, I), Leucine (Leu, L), Methionine (Met, M), Valine (Val, V); and [0060] 6) Phenylalanine (Phe, F), Tyrosine (Tyr, Y), Tryptophan (Trp, W).
[0061] Two or more amino acid sequences or two or more nucleotide sequences are considered to be "substantially identical" or "substantially similar" if the amino acid sequences or the nucleotide sequences share at least 80% or 90%> sequence identity with each other, or with a reference sequence over a given comparison window. Thus, substantially similar sequences include those having, for example, at least 80%> sequence identity, at least 90%o sequence identity, at least 95% sequence identity, at least 97% sequence identity, at least 98%o sequence identity, or at least 99% sequence identity.
[0062] The term "substitution" refers to includes the replacement of one or more amino acid residues either by other naturally occurring amino acids, (conservative and non- conservative substitutions), by non-naturally occurring amino acids (conservative and non- conservative substitutions), or with organic moieties which serve either as true
peptidonimetics (e.g., having the same steric and electrochemical properties as the replaced amino acid), or merely serve as spacers in lieu of an amino acid, so as to keep the spatial relations between the amino acid spanning this replaced amino acid.
Antibody scaffolds
[0063] An antibody scaffold is a region of an antibody or antibody fragment comprising one or more CDRs that have anchoring pocket sequences or hot spots that provide an initial binding affinity to a specific post-translational modification. For example, an antibody scaffold can include a hot spot that is specific to a phosphorylated amino acid. The host spot or anchoring pocket can be further engineered or tailored to provide additional affinity for the post translational modification. The antibody scaffolds thus provide an initial template to allow in vitro selection and diversification, as described in detail below, for the generation of novel antibodies specific to the post-translational modification.
[0064] One of skill in the art would recognize that the antibody scaffolds described herein can be engineered for specificity towards any post-translational modifications that can include, but is not limited to, myristoylation, palmitoylation, isoprenylation, prenylation, farnesylation, geranylgeranylation, glypiation, glycosylphosphatidylinositol anchor formation, lipoylation, flavin attachment, heme C attachment, phosphopantetheinylation, retinylidene Schiff base formation, diphthamide formation, ehtanolamine phosphoglycerol attachment, hypusin formation, acylation, O-acylation, N-acylation, sacylation, acetylation, histone acetylation, deacetylation, formylation, aklylation, methylation, amide bond
formation, amidation, arginylation, polyglutamylation, polyglycylation, butyrylation, gamma- carboxylation, glycosylation, polysialylation, malonylation, hydroxylation, iodination, ribosylation, oxidation, phosphate ester or phosphoramidate formation, phosphorylation, adenylation, propionylation, pyroglutamate formation, S-glutathionylation, S-nitrosylation, succinylation, sulfation, selenoylation, glycation, biotinylation, pegylation, ISGylation, SUMOylation, ubiquitination, neddylation, pupylation, citrullination, deamidation, eliminylation, carbamylation, disulfide bridge formation, proteolytic cleavage, or
racemization.
[0065] Antibody scaffolds are engineered by identifying a suitable parent antibody scaffold that contains or can be used to install the sequence motif hot spot using standard recombinant technology techniques as described in detailed below. The scaffold itself can also be mutated by any method well known in the art as described herein to increase the specificity to its particularly designed hot spot prior to in vitro selection.
[0066] The antibody scaffolds described herein can use any antibody known in the art. The antibody scaffolds can further be used to create antibody fragments, such as bispecific antibodies, fragment antigen binding (Fab), trifunctional antibodies, single-chain variable fragments, single domain antibody, bi-specific T-cell engagers, and the like. Humanized or primatized antibodies can be used to create the antibody scaffolds described herein.
Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain. Methods for humanizing or primatizing non-human antibodies are well known in the art. Humanization can be essentially performed following the method of Winter and co-workers (see, e.g., Jones et al, Nature 321 :522-525 (1986); Riechmann et al, Nature 332:323-327 (1988); Verhoeyen et al, Science 239: 1534-1536 (1988) and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. These references are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to constructing antibody scaffolds.
Accordingly, such humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are
typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
Construction of antibody scaffold vectors
[0067] The antibody scaffold of the present invention can be generated using vector construction and expression protocols well known in the art. For example, to obtain high level expression of a cloned gene or genome, one typically subclones the nucleic acid into an expression vector that contains a strong promoter to direct transcription, a
transcription/translation terminator, and if for a nucleic acid encoding a protein, a ribosome binding site for translational initiation. Suitable bacterial promoters are well known in the art and described (e.g., in Sambrook et al., and Ausubel et al.., supra. Bacterial expression systems for expressing the protein are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al, Gene 22:229-235 (1983)); Mosbach et al, Nature 302:543-545 (1983)), which are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to constructing antibody scaffold vectors. Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
[0068] Selection of the promoter used to direct expression of a heterologous nucleic acid depends on the particular application. The promoter is preferably positioned about the same distance from the heterologous transcription start site as it is from the transcription start site in its natural setting. As is known in the art, however, some variation in this distance can be accommodated without loss of promoter function. Heterologous refers to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not found in the same relationship to each other in nature. For instance, the nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source. Similarly, a heterologous protein indicates that the protein comprises two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein). Additionally, phoA promoters can be used for phage display vectors described below.
[0069] In addition to the promoter, the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements required for the
expression of the nucleic acid in host cells. A typical expression cassette thus contains a promoter operably linked to the nucleic acid sequence encoding the nucleic acid of choice and signals required for efficient polyadenylation of the transcript, ribosome binding sites, and translation termination. Additional elements of the cassette can include enhancers and, if genomic DNA is used as the structural gene, introns with functional splice donor and acceptor sites.
[0070] In addition to a promoter sequence, the expression cassette should also contain a transcription termination region downstream of the structural gene to provide for efficient termination. The termination region can be obtained from the same gene as the promoter sequence or can be obtained from different genes.
[0071] The particular expression vector used to transport the genetic information into the cell is not particularly critical. Any of the conventional vectors used for expression in eukaryotic or prokaryotic cells can be used. Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET23D, and fusion expression systems such as MBP, GST, and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc. Sequence tags can be included in an expression cassette for nucleic acid rescue. Markers such as fluorescent proteins, green or red fluorescent protein, 13 -gal, CAT, and the like can be included in the vectors as markers for vector transduction.
[0072] Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, retroviral vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, pMT010/A+, pMAMneo-5, baculovirus pDSVE, pJKl, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, SV40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
[0073] Expression of proteins from eukaryotic vectors can also be regulated using inducible promoters. With inducible promoters, expression levels are tied to the concentration of inducing agents, such as tetracycline, by the incorporation of response elements for these
agents into the promoter. Generally, high level expression is obtained from inducible promoters only in the presence of the inducing agent; basal expression levels are minimal.
[0074] Vectors can have a regulatable promoter, e.g. , tet-regulated systems and the RU- 486 system (see, e.g., Gossen & Bujard, PNAS 89:5547 (1992); Oligino et al, Gene Ther. 5:491-496 (1998); Wang et al, Gene Ther. 4:432-441 (1997); Neering et al, Blood 88: 1147- 1155 (1996); and Rendahl et al, Nat. Biotechnol 16:757-761 (1998)). These impart small molecule control on the expression of the candidate target nucleic acids. This beneficial feature can be used to determine that a desired phenotype is caused by a transfected cDNA rather than a somatic mutation.
[0075] Some expression systems have markers that provide gene amplification such as thymidine kinase and dihydrofolate reductase. Alternatively, high yield expression systems not involving gene amplification are also suitable, such as using a baculovirus vector in insect cells, with a sequence of choice under the direction of the polyhedrin promoter or other strong baculovirus promoters.
[0076] The elements that are typically included in expression vectors also include a replicon that functions in E. coli, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of eukaryotic sequences. The particular antibiotic resistance gene chosen is not critical, as any of the many resistance genes known in the art are suitable. The prokaryotic sequences are preferably chosen such that they do not interfere with the replication of the DNA in eukaryotic cells, if necessary.
[0077] Standard transfection methods are used to produce bacterial, mammalian, yeast or insect cell lines that express large quantities of protein, which are then purified using standard techniques (see, e.g., Colley et al, J. Biol Chem. 264: 17619-17622 (1989); Guide to Protein Purification, in Methods in Enzymology, vol. 182 (Deutscher, ed., 1990)), which are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to constructing antibody scaffold vectors. Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, J. Bact. 132:349-351 (1977); Clark-Curtiss & Curtiss, Methods in Enzymology 101 :347-362 (1983)).
[0078] Any of the well-known procedures for introducing foreign nucleotide sequences into host cells can be used. These include the use of calcium phosphate transfection,
polybrene, protoplast fusion, electroporation, biolistics, liposomes, microinjection, plasma vectors, viral vectors and any of the other well known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Sambrook et ah, supra). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least one gene into the host cell capable of expressing the antibody scaffold proteins of the present invention.
[0079] The vectors of the present invention can be subjected to recombination and/or mutagenesis. This can be achieved by a variety of methods known in the art. One such non- limiting method is SOE-PCR as described by Kirchhoff and Desrosiers, PCR Methods and Applications 2:301-304 (1993). Another method is Kunkel mutagenesis, which is a type of site-directed mutagenesis that employs multiple mutagenic primers to generate libraries with multiple mutated positions. This is achieved by (a) generating uracil containing nucleotide template encoding a polypeptide of interest (b) synthesizing 2-50 mutagenic primers corresponding to at least one region of identity in the nucleotide template, wherein each mutagenic primer comprises at least one substitution of the template sequence (or:
insertion/deletion of bases) resulting in at least one amino acid substitution (or
insertion/deletion) in the amino acid sequence encoded by the starting primer, (c) contacting the mutagenic primers with the template of (a) under conditions wherein a mutagenic primer anneals to the template sequence and extension of the primers are catalyzed by a polymerase to generate a mixture of mutagenized polynucleotides and uracil -containing templates, and (d) transforming a host cell with the polynucleotide and template mixture wherein the template is degraded and the mutagenized polynucleotide replicated and thus generating a library of polynucleotide variants of the gene of interest. DNA shuffling can also be used to prepare a mutated library. DNA shuffling is the (partially) random process in which a library of chimeric genes is generated from two or more starting genes. The starting genes are heterologous such that one gene is different from any other starting gene in at least one nucleotide; e.g., the starting material can be point mutations of each other. Much more diversity can be included in the process if the parental genes differ in more positions, e.g. by representing genes encoding homologues of proteins having the same function (and structural family) but originating from different species. The latter experiment has been denoted "family shuffling" (Crameri et al, Nature, 391 : 288-291 (1998)). A number of other formats of carrying out, shuffling, recombination, or site-directed mutagenesis process have been described.
[0080] After the expression vector is introduced into the cells, the transfected cells are cultured under conditions favoring expression of the protein of choice, which is recovered from the culture using standard techniques identified below.
[0081] Either naturally occurring or recombinant proteins can be purified for use in diagnostic assays, for making antibodies (for diagnosis and therapy) and vaccines, and for assaying for anti-viral compounds. Naturally occurring protein can be purified, e.g., from primate tissue samples. Recombinant protein can be purified from any suitable expression system.
Purification of antibody scaffold proteins
[0082] The antibody scaffold proteins can be purified to substantial purity by standard techniques, including selective precipitation with such substances as ammonium sulfate; column chromatography, immunopurification methods, and others (see, e.g., Scopes, Protein Purification: Principles and Practice (1982); U.S. Patent No. 4,673,641; Ausubel et al, supra; and Sambrook et al, supra), which are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to constructing antibody scaffold vectors.
[0083] A number of procedures can be employed when recombinant protein is being purified. For example, proteins having established molecular adhesion properties can be reversibly fused to the protein. With the appropriate ligand or substrate, a specific protein can be selectively adsorbed to a purification column and then freed from the column in a relatively pure form. The fused protein is then removed by enzymatic activity. Finally, protein can be purified using immunoaffinity columns. Recombinant protein can be purified from any suitable source, include yeast, insect, bacterial, and mammalian cells.
[0084] Recombinant proteins can be expressed and purified by transformed bacteria in large amounts, typically after promoter induction; but expression can be constitutive.
Promoter induction with IPTG is one example of an inducible promoter system. Bacteria are grown according to standard procedures in the art. Fresh or frozen bacteria cells are used for isolation of protein.
[0085] Proteins expressed in bacteria can form insoluble aggregates ("inclusion bodies"). Several protocols are suitable for purification of protein inclusion bodies. For example,
purification of inclusion bodies typically involves the extraction, separation and/or purification of inclusion bodies by disruption of bacterial cells, e.g., by incubation in a buffer of 50 mM TRIS/HCL pH 7.5, 50 niM NaCl, 5 mM MgCl2, 1 mM DTT, 0.1 mM ATP, and 1 mM PMSF. The cell suspension can be lysed using 2-3 passages through a French Press, homogenized using a Polytron (Brinkman Instruments) or sonicated on ice. Alternate methods of lysing bacteria are apparent to those of skill in the art (see, e.g., Sambrook et al., supra; Ausubel et al, supra). If necessary, the inclusion bodies are solubilized, and the lysed cell suspension is typically centrifuged to remove unwanted insoluble matter. Proteins that formed the inclusion bodies can be renatured by dilution or dialysis with a compatible buffer. Suitable solvents include, but are not limited to urea (from about 4 M to about 8 M), formamide (at least about 80%, volume/volume basis), and guanidine hydrochloride (from about 4 M to about 8 M). Some solvents which are capable of solubilizing aggregate-forming proteins, for example SDS (sodium dodecyl sulfate), 70% formic acid, are inappropriate for use in this procedure due to the possibility of irreversible denaturation of the proteins, accompanied by a lack of immunogenicity and/or activity. Although guanidine hydrochloride and similar agents are denaturants, this denaturation is not irreversible and renaturation can occur upon removal (by dialysis, for example) or dilution of the denaturant, allowing reformation of immunologically and/or biologically active protein. Other suitable buffers are known to those skilled in the art. Human proteins are separated from other bacterial proteins by standard separation techniques, e.g. , with Ni-NTA agarose resin.
[0086] Alternatively, it is possible to purify recombinant protein from bacteria periplasm. After lysis of the bacteria, the periplasmic fraction of the bacteria can be isolated by cold osmotic shock in addition to other methods known to skill in the art. To isolate recombinant proteins from the periplasm, the bacterial cells are centrifuged to form a pellet. The pellet is resuspended in a buffer containing 20%> sucrose. To lyse the cells, the bacteria are centrifuged and the pellet is resuspended in ice-cold 5 mM MgSC^ and kept in an ice bath for approximately 10 minutes. The cell suspension is centrifuged and the supernatant decanted and saved. The recombinant proteins present in the supernatant can be separated from the host proteins by standard separation techniques well known to those of skill in the art.
[0087] Solubility fractionation can be used as a standard protein separation technique for purifying proteins. As an initial step, particularly if the protein mixture is complex, an initial salt fractionation can separate many of the unwanted host cell proteins (or proteins derived
from the cell culture media) from the recombinant protein of interest. The preferred salt is ammonium sulfate. Ammonium sulfate precipitates proteins by effectively reducing the amount of water in the protein mixture. Proteins then precipitate on the basis of their solubility. The more hydrophobic a protein is, the more likely it is to precipitate at lower ammonium sulfate concentrations. A typical protocol includes adding saturated ammonium sulfate to a protein solution so that the resultant ammonium sulfate concentration is between 20-30%. This concentration will precipitate the most hydrophobic of proteins. The precipitate is then discarded (unless the protein of interest is hydrophobic) and ammonium sulfate is added to the supernatant to a concentration known to precipitate the protein of interest. The precipitate is then solubilized in buffer and the excess salt removed if necessary, either through dialysis or diafiltration. Other methods that rely on solubility of proteins, such as cold ethanol precipitation, are well known to those of skill in the art and can be used to fractionate complex protein mixtures.
[0088] The molecular weight of the protein can be used to isolate it from proteins of greater and lesser size using ultrafiltration through membranes of different pore size (for example, Amicon or Millipore membranes). As a first step, the protein mixture is
ultrafiltered through a membrane with a pore size that has a lower molecular weight cut-off than the molecular weight of the protein of interest. The retentate of the ultrafiltration is then ultrafiltered against a membrane with a molecular cut off greater than the molecular weight of the protein of interest. The recombinant protein will pass through the membrane into the filtrate. The filtrate can then be chromatographed as described below.
[0089] The protein can also be separated from other proteins on the basis of its size, net surface charge, hydrophobicity, and affinity for ligands or substrates using column chromatography. In addition, antibodies raised against proteins can be conjugated to column matrices and the proteins immunopurified. All of these methods are well known in the art. It will be apparent to one of skill that chromatographic techniques can be performed at any scale and using equipment from many different manufacturers (e.g., Pharmacia Biotech).
In vitro section for antibody diversification
[0090] In an embodiment, following the generation of an antibody scaffold having an engineered anchoring hot spot specific to a particular sequence motif, regions outside of the engineered hot spot can be mutated and selected for binding to other motif-containing targets.
This aspect of the invention includes evolving the scaffold through screening and selection of antibody libraries.
[0091] Methods for high throughput screening of antibody libraries can include, but are not limited to, display techniques including cell display, bacterial display, yeast display, mammalian display, ribosome display, mR A display, and phage display. The use of phage display to isolate ligands that bind biologically relevant molecules has been reviewed in Felici et al. (1995) Biotechnol. Annual Rev. 1 : 149-183, Katz (1997) Annual Rev. Biophys. Biomol. Struct. 26: 27-45 and Hoogenboom et al. Immunotechnology 4(1): 1-20 (1998). Several randomized combinatorial peptide libraries have been constructed to select for polypeptides that bind different targets, e.g. cell surface receptors or DNA (reviewed by Kay, Perspect. Drug Discovery Des. 2, 251-268 (1995); Kay and Paul, Mol. Divers. 1 : 139-140 (1996)). Proteins and multimeric proteins have been successfully phage-displayed as functional molecules (see EP 0349578A, EP 4527839A, EP 0589877A; Chiswell and McCafferty, Trends Biotechnol. 10, 80-84 (1992)). In addition, functional antibody fragments (e.g. Fab, single chain Fv [scFv]) have been expressed (McCafferty et al, Nature 348: 552- 554 (1990); Barbas et al, Proc. Natl. Acad Sci. USA 88: 7978-7982 (1991); Clackson et al, Nature 352: 624-628 (1991)). These references are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to antibody diversification as described herein.
[0092] An exemplary method for in vitro protein evolution of the Ab scaffolds of the present invention is phage display, and phage display methods are well known in the art. Phage display libraries can be created by making a designed series of mutations or variations within a coding sequence for the Ab scaffold template, each mutant sequence encoding an amino acid corresponding in overall structure to the template except having one or more amino acid variations in the sequence of the template. Retroviral and phage display vectors can be engineered using standard vector construction techniques well known in the art, as described herein relating to antibody scaffold construction. P3 phage display vectors along with compatible protein expression vectors, as is well known in the art, can be used to generate phage display vectors for antibody diversification as described herein.
[0093] The novel variegated (mutated) DNA provides sequence diversity, and each transformant phage displays one variant of the initial template amino acid sequence encoded by the DNA, leading to a phage population (library) displaying a vast number of different but
structurally related amino acid sequences. The amino acid variations are expected to alter the binding properties of the binding peptide or domain without significantly altering its structure, at least for most substitutions.
[0094] In a typical screen, a phage library is contacted with and allowed to bind the target, or a particular subcomponent thereof. To facilitate separation of binders and non-binders, it is convenient to immobilize the target on a solid support. Phage bearing a target-binding moiety can form a complex with the target on the solid support whereas non-binding phage remain in solution and can be washed away with excess buffer. Bound phage are then liberated from the target by changing the buffer to an extreme pH (pH 2 or pH 10), changing the ionic strength of the buffer, adding denaturants, or other known means. To isolate the binding phage exhibiting the polypeptides of the present invention, a protein elution is performed.
[0095] The recovered phage can then be amplified through infection of bacterial cells and the screening process can be repeated with the new pool that is now depleted in non-binders and enriched for binders. The recovery of even a few binding phage is sufficient to carry the process to completion. After a few rounds of selection, the gene sequences encoding the binding moieties derived from selected phage clones in the binding pool are determined by conventional methods, described below, revealing the peptide sequence that imparts binding affinity of the phage to the target. When the selection process works, the sequence diversity of the population falls with each round of selection until desirable binders remain. The sequences converge on a small number of related binders, typically 10-50 out of about 109 to 1010 original candidates from each library. An increase in the number of phage recovered at each round of selection is a good indication that convergence of the library has occurred in a screen. After a set of binding polypeptides is identified, the sequence information can be used to design other secondary phage libraries, biased for members having additional desired properties.
Characterizing antibody scaffolds
[0096] The antibody scaffolds of the present invention can be characterized for binding to modified antigens. Immunoassay techniques and protocols are generally described in Price and Newman, "Principles and Practice of Immunoassay," 2nd Edition, Grove's Dictionaries, 1997; and Gosling, "Immunoassays: A Practical Approach," Oxford University Press, 2000.
A variety of immunoassay techniques, including competitive and non-competitive immunoassays, can be used. (See, e.g., Self et al, Curr. Opin. Biotechnol 7:60-65 (1996)). The term immunoassay encompasses techniques including, without limitation, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme- linked immunosorbent assay (ELISA), IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); immunohistochemical assay, capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL). If desired, such immunoassays can be automated. Immunoassays can also be used in conjunction with laser induced fluorescence. (See, e.g., Schmalzing et al,
Electrophoresis, 25 18:2184-93 (1997); Bao, J Chromatogr. B. Biomed. Sci., 699:463-80 (1997)). Liposome immunoassays, such as flow-injection liposome immunoassays and liposome immunosensors, are also suitable for use in the present invention. (See, e.g., Rongen et al.., J. Immunol. Methods, 204: 105-133 (1997)). In addition, nephelometry assays, in which the formation of protein/antibody complexes results in increased light scatter that is converted to a peak rate signal as a function of the marker concentration, are suitable for use in the methods of the present invention. Nephelometry assays are commercially available from Beckman Coulter (Brea, CA; Kit #449430) and can be performed using a Behring Nephelometer Analyzer (Fink et al, J Clin. Chem. Clin. Biochem., 27:261-276 (1989)). These references are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to characterizing the antibody scaffolds described herein.
[0097] Specific immunological binding of an antibody can be detected directly or indirectly. A detectable moiety can be used in the assays described herein (direct or indirect detection). A variety of detectable moieties are well known to those skilled in the art, and can be any material detectable by spectroscopic, photochemical, biochemical,
immunochemical, electrical, optical or chemical means. Detectable moieties can be used, with the choice of label depending on the sensitivity required, ease of conjugation with the antibody, stability requirements, and available instrumentation and disposal provisions.
Suitable detectable moieties include, but are not limited to, radionuclides, fluorescent dyes {e.g., fluorescein, fluorescein isothiocyanate (FITC), Oregon Green™, rhodamine, Texas red, tetrarhodimine isothiocynate (TRITC), Cy3, Cy5, etc.), fluorescent markers {e.g., green fluorescent protein (GFP), phycoerythrin, etc.), autoquenched fluorescent compounds that are activated by tumor-associated proteases, enzymes {e.g., luciferase, horseradish peroxidase,
alkaline phosphatase, etc.), nanoparticles, biotin, digoxigenin, metals, and the like. Direct labels include fluorescent or luminescent tags, metals, dyes, radionucleodies, and the like, attached to the antibody. An antibody labeled with iodine- 125 (1251) can be used. A chemiluminescence assay using a chemiluminescent antibody specific for nucleic acids or proteins is suitable for sensitive, non-radioactive detection of nucleic acids or protein levels. An antibody labeled with fluorochrome is also suitable. Examples of fluorochromes include, without limitation, DAPI, fluorescein, Hoechst 33258, R-phycocyanin, B-phycoerythrin, R- phycoerythrin, rhodamine, Texas red, and lissamine. Indirect labels include various enzymes well known in the art, such as horseradish peroxidase (HRP), alkaline phosphatase (AP), β- galactosidase, urease, and the like. A horseradish-peroxidase detection system can be used, for example, with the chromogenic substrate tetramethylbenzidine (TMB), which yields a soluble product in the presence of hydrogen peroxide that is detectable at 450 nm. An alkaline phosphatase detection system can be used with the chromogenic substrate p- nitrophenyl phosphate, for example, which yields a soluble product readily detectable at 405 nm. Similarly, a β-galactosidase detection system can be used with the chromogenic substrate o-nitrophenyl-P-D-galactopyranoside (ONPG), which yields a soluble product detectable at 410 nm. An urease detection system can be used with a substrate such as urebromocresol purple (Sigma Immunochemicals; St. Louis, MO). Other proteins capable of specifically binding immunoglobulin constant regions, such as protein A or protein G can also be used as a label agent. These proteins exhibit a strong non-immunogenic reactivity with
immunoglobulin constant regions from a variety of species (see, e.g. , Kronval et al, J.
Immunol. 1 1 1 : 1401-1406 (1973); Akerstrom et al, J. Immunol. 135 :2589-2542 (1985), which are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to characterizing the antibody scaffolds described herein.
[0098] fluorophores are known in the art and can be used in the present invention.
[0099] In some embodiments, a number of fluorescent molecules can be employed with the methods of the present disclosure. In some embodiments, the fluorophore exhibits green fluorescence (such as for example 494 nm/519 nm), orange fluorescence (such as for example 554 nm/570 nm), red fluorescence (such as for example 590 nm/617 nm), or far red fluorescence (such as for example 651 nm/672 nm) excitation/emission spectra. In some embodiments, the fluorophore is a fluorophore with excitation and emission spectra in the range of about 350 nm to about 775 nm. In some embodiments the excitation and emission
spectra are about 346 nm/446 nm, about 494 nm/519 nm, about 554 nm/570 nm, about 555 nm/572 nm, about 590 nm/617 nm, about 651 nm/672 nm, about 679 nm/702 nm or about
749 nm/775 nm. In some embodiments, the fluorophore can include but is not limited to AlexaFluor 3, AlexaFluor 5, AlexaFluor 350, AlexaFluor 405, AlexaFluor 430, AlexaFluor 488, AlexaFluor 500, AlexaFluor 514, AlexaFluor 532, AlexaFluor 546, AlexaFluor 555, AlexaFluor 568, AlexaFluor 594, AlexaFluor 610, AlexaFluor 633, AlexaFluor 647, AlexaFluor 660, AlexaFluor 680, AlexaFluor 700, and AlexaFluor 750 (Molecular Probes AlexaFluor dyes, available from Life Technologies, Inc. (USA)). In some embodiments, the fluorophore can include but is not limited to Cy dyes, including Cy2, Cy3, Cy3B, Cy3.5, Cy5, Cy5.5 and Cy7 (available from GE Life Sciences or Lumiprobes). In some
embodiments the fluorophore can include but is not limited to DyLight 350, DyLight 405, DyLight 488, DyLight 550, DyLight 594, DyLight 633, DyLight 650, DyLight 680, DyLight
750 and DyLight 800 (available from Thermo Scientific (USA)). In some embodiments, the fluorophore can include but is not limited to a FluoProbes 390, FluoProbes 488, FluoProbes 532, FluoProbes 547H, FluoProbes 594, FluoProbes 647H, FluoProbes 682, FluoProbes 752 and FluoProbes 782, AMCA, DEAC (7-Diethylaminocoumarin-3-carboxylic acid); 7- Hydroxy-4-methylcoumarin-3; 7-Hydroxycoumarin-3; MCA (7-Methoxycoumarin-4-acetic acid); 7-Methoxycoumarin-3; AMF (4'-(Aminomethyl)fluorescein); 5-DTAF (5-(4,6- Dichlorotriazinyl)aminofluorescein); 6-DTAF (6-(4,6-Dichlorotriazinyl)aminofluorescein); 6-FAM (6-Carboxyfluorescein), 5(6)-FAM cadaverine; 5-FAM cadaverine; 5(6)-FAM ethylenediamme; 5-FAM ethylenediamme; 5-FITC (FITC Isomer I; fluorescein-5- isothiocyanate); 5-FITC cadaverin; Fluorescein-5-maleimide; 5-IAF (5- Iodoacetamidofluorescein); 6-JOE (6-Carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein); 5- CR1 10 (5-Carboxyrhodamine 110); 6-CRl 10 (6-Carboxyrhodamine 110); 5-CR6G (5- Carboxyrhodamine 6G); 6-CR6G (6-Carboxyrhodamine 6G); 5(6)-Caroxyrhodamine 6G cadaverine; 5(6)-Caroxyrhodamine 6G ethylenediamme; 5-ROX (5-Carboxy-X-rhodamine); 6-ROX (6-Carboxy-X-rhodamine); 5-TAMRA (5-Carboxytetramethylrhodamine); 6- TAMRA (6-Carboxytetramethylrhodamine); 5-TAMRA cadaverine; 6-TAMRA cadaverine; 5-TAMRA ethylenediamme; 6-TAMRA ethylenediamme; 5-TMR C6 malemide; 6-TMR C6 malemide; TR C2 malemide; TR cadaverine; 5-TRITC; G isomer (Tetramethylrhodamine-5- isothiocyanate); 6-TRITC; R isomer (Tetramethylrhodamine-6-isothiocyanate); Dansyl cadaverine (5-Dimethylaminonaphthalene-l-(N-(5-aminopentyl))sulfonamide); EDANS C2 maleimide; fluorescamine; NBD; and pyrromethene and derivatives thereof.
[00100] Western blot (immunoblot) analysis can be used to detect and quantify the presence of an antigen in the sample. The technique generally comprises separating sample proteins by gel electrophoresis on the basis of molecular weight, transferring the separated proteins to a suitable solid support, (such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter), and incubating the sample with the antibodies that specifically bind the antigen. The anti-antigen antibodies specifically bind to the antigen on the solid support. These antibodies can be directly labeled or alternatively can be subsequently detected using labeled antibodies (e.g. , labeled sheep anti-mouse antibodies) that specifically bind to the anti-antigen antibodies.
[00101] An ELISA method can be used as follows: (1) bind an antibody or antigen to a substrate; (2) contact the bound receptor with a fluid or tissue sample containing the virus, a viral antigen, or antibodies to the virus; (3) contact the above with an antibody bound to a detectable moiety (e.g., horseradish peroxidase enzyme or alkaline phosphatase enzyme); (4) contact the above with the substrate for the enzyme; (5) contact the above with a color reagent; (6) observe color change.
[00102] An antigen and/or a patient's antibodies to the virus can be detected utilizing a capture assay. Briefly, to detect antibodies in a sample, antibodies to an immunoglobulin, e.g., anti-IgG (or IgM) are bound to a solid phase substrate and used to capture the patient's immunoglobulin from serum. The antigen, or reactive fragments of the antigen, is then contacted with the solid phase followed by addition of a labeled antibody. The amount of specific antibody can then be quantitated by the amount of labeled antibody binding. A micro-agglutination test can also be used to detect the presence of an antigen in test samples. Briefly, latex beads are coated with an antibody and mixed with a test sample, such that the antigen in the tissue or body fluids that is specifically reactive with the antibody crosslinked with the receptor, causing agglutination. The agglutinated antibody- virus complexes within a precipitate, visible with the naked eye or by spectrophotometer.
[00103] Competitive assays can also be adapted to provide for an indirect measurement of the amount of an antigen present in the sample. Briefly, serum or other body fluids from the subject is reacted with an antibody bound to a substrate (e.g. an ELISA 96-well plate). Excess serum is thoroughly washed away. A labeled (enzyme-linked, fluorescent, radioactive, etc.) monoclonal antibody is then reacted with the previously reacted antibody complex. The amount of inhibition of monoclonal antibody binding is measured relative to a control.
Monoclonal antibodies (MABs) can also be used for detection directly in samples by IFA for MABs specifically reactive for the antibody-antigen complex.
[00104] A hapten inhibition assay is another competitive assay. In this assay the known antigen can be immobilized on a solid substrate. A known amount of anti-antigen antibody is added to the sample, and the sample is then contacted with the immobilized antigen. The amount of antibody bound to the known immobilized antigen is inversely proportional to the amount of antigen present in the sample. The amount of immobilized antibody can be detected by detecting either the immobilized fraction of antibody or the fraction of the antibody that remains in solution. Detection can be direct where the antibody is labeled or indirect by the subsequent addition of a labeled moiety that specifically binds to the antibody as described above.
[00105] Immunoassays in the competitive binding format can also be used for
crossreactivity determinations. For example, an antigen can be immobilized to a solid support. Proteins can be added to the assay that compete for binding of the antisera to the immobilized antigen. The ability of the added proteins to compete for binding of the antisera to the immobilized protein is compared to the ability of the antigen to compete with itself. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with each of the added proteins listed above are selected and pooled. The cross-reacting antibodies are optionally removed from the pooled antisera by immunoabsorption with the added considered proteins, e.g. , distantly related homo logs. The immunoabsorbed and pooled antisera can then be used in a competitive binding immunoassay as described above to compare a second protein, thought to be perhaps an allele or polymorphic variant of an antigen, to the immunogen protein. In order to make this comparison, the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required to inhibit 50% of binding is less than 10 times the amount of the antigen that is required to inhibit 50%> of binding, then the second protein is said to specifically bind to the polyclonal antibodies generated to antigen.
[00106] A signal from a direct or indirect label can be analyzed, for example, using a spectrophotometer to detect color from a chromogenic substrate; a radiation counter to detect radiation such as a gamma counter for detection of 125I; or a fluorometer to detect
fluorescence in the presence of light of a certain wavelength. Where the label is a radioactive label, means for detection include a scintillation counter or photographic film as in autoradiography. Where the label is a fluorescent label, it can be detected by exciting the fiuorochrome with the appropriate wavelength of light and detecting the resulting fluorescence. The fluorescence can be detected visually, by the use of electronic detectors such as charge coupled devices (CCDs) or photomultipliers and the like. Similarly, enzymatic labels can be detected by providing the appropriate substrates for the enzyme and detecting the resulting reaction product. Colorimetric or chemiluminescent labels can be detected simply by observing the color associated with the label. Thus, in various dipstick assays, conjugated gold often appears pink, while various conjugated beads appear the color of the bead. For detection of enzyme-linked antibodies, a quantitative analysis can be made using a spectrophotometer such as an EMAX Microplate Reader (Molecular Devices; Menlo Park, CA) in accordance with the manufacturer's instructions. If desired, the assays of the present invention can be automated or performed robotically, and the signal from multiple samples can be detected simultaneously.
[00107] The antibodies can be immobilized onto a variety of solid supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (e.g., microtiter wells), pieces of a solid substrate material or membrane (e.g., plastic, nylon, paper), and the like. An assay strip can be prepared by coating the antibody or a plurality of antibodies in an array on a solid support. This strip can then be dipped into the test sample and processed quickly through washes and detection steps to generate a measureable signal, such as a colored spot.
[00108] One of skill in the art will appreciate that it is often desirable to minimize nonspecific binding in immunoassays. Particularly, where the assay involves an antigen or antibody immobilized on a solid substrate it is desirable to minimize the amount of nonspecific binding to the substrate. Means of reducing such non-specific binding are well known to those of skill in the art. Typically, this technique involves coating the substrate with a proteinaceous composition. In particular, protein compositions such as bovine serum albumin (BSA), nonfat powdered milk, and gelatin are widely used with powdered milk being most preferred.
[00109] In some embodiments, immunoprecipitation can be used to detect and quantify the presence of antibody-antigen binding. Immunoprecipitation is the technique of precipitating
an antigen out of solution using an antibody specific to that antigen. The process can be used to identify protein complexes present in cell extracts by targeting a protein believed to be in the complex. The complexes are brought out of solution by insoluble antibody-binding proteins isolated initially from bacteria. The antibodies can also be coupled to sepharose beads that can easily be isolated out of solution. After washing, the precipitate can be analyzed using mass spectrometry, Western blotting, or any number of other methods for identifying constituents in the complex.
Structural analysis of antibody scaffolds
[00110] Recognition of post-translation modification by the Ab scaffolds of the present invention can be explored by any structural analysis tools known in the art, e.g. , X-ray crystallography. X-ray crystallography requires that an Ab scaffold be expressed and purified as described herein, and crystallized. Crystallization conditions and cryoprotectant solutions are listed in Table 7 below. Generally, a subject Ab scaffold can be crystallized using any of a variety of crystallization methods known in the art, many of which are reviewed in Caffrey (J. Struct. Biol. 142: 108-32 (2003)). Crystals are one form of the solid state of matter, which is distinct from other forms such as the amorphous solid state or the liquid crystalline state. Crystals are composed of regular, repeating, three-dimensional arrays of atoms, ions, molecules (e.g., proteins such as antibodies), or molecular assemblies (e.g., antigen/antibody complexes). These three-dimensional arrays are arranged according to specific mathematical relationships that are well-understood in the field. The fundamental unit, or building block, that is repeated in a crystal is called the asymmetric unit. Repetition of the asymmetric unit in an arrangement that conforms to a given, well-defined
crystallographic symmetry provides the "unit cell" of the crystal. Repetition of the unit cell by regular translations in all three dimensions provides the crystal. See Giege and Ducruix (1999) Chapter 1, In Crystallization of Nucleic Acids and Proteins, a Practical Approach, 2nd ed., (Ducruix and Giege, eds.) (Oxford University Press, New York, 1999) pp. 1-16.
Crystallization of antibodies and antibody fragments is well known in the art, see e.g. Shenoy et al. (WO/2002/072636). These references are hereby incorporated by reference in their entirety for all purposes and in particular for all teaching related to characterizing the antibody scaffolds described herein. In addition, protein structures can be determined by neutron diffraction and nuclear magnetic resonance.
Pharmaceutical compositions
[00111] Pharmaceutical compositions within the scope of the present invention can also contain other compounds, which can be biologically active or inactive. For example, one or more immunogenic portions of other antigens can be present, either incorporated into a fusion polypeptide or as a separate compound, within the composition or vaccine. Polypeptides can, but need not be, conjugated to other macromolecules as described, for example, within US Patent Nos. 4,372,945 and 4,474,757. Pharmaceutical compositions and vaccines can generally be used for prophylactic and therapeutic purposes.
[00112] Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the packaged nucleic acid suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions. Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, micro crystalline cellulose, gelatin, colloidal silicon dioxide, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers. Lozenge forms can comprise the active ingredient in a flavor, e.g., sucrose, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
[00113] The compound of choice, alone or in combination with other suitable components, can be made into aerosol formulations (e.g., they can be "nebulized") to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.
[00114] Formulations suitable for parenteral administration, for example, by intraarticular (in the joints), intravenous, intramuscular, intradermal, intraperitoneal, and subcutaneous routes, can include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and
preservatives. In the practice of this invention, compositions can be administered, for example, by intravenous infusion, orally, topically, intraperitoneally, intravesically or intrathecally. Parenteral administration and intravenous administration are the preferred methods of administration. The formulations of commends can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.
[00115] Such compositions can also comprise buffers (e.g., neutral buffered saline or phosphate buffered saline), carbohydrates (e.g., glucose, mannose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, bacteriostats, chelating agents such as EDTA or glutathione, adjuvants (e.g., aluminum hydroxide), solutes that render the formulation isotonic, hypotonic or weakly hypertonic with the blood of a recipient, suspending agents, thickening agents and/or preservatives. Alternatively, compositions of the present invention can be formulated as a lyophilizate. Compounds can also be encapsulated within liposomes using well known technology.
[00116] Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Cells transduced by nucleic acids for ex vivo therapy can also be administered intravenously or parenterally as described above.
[00117] The dose administered to a patient, in the context of the present invention should be sufficient to affect a beneficial therapeutic response in the patient over time. The dose will be determined by the efficacy of the particular vector employed and the condition of the patient, as well as the body weight or surface area of the patient to be treated. The size of the dose also will be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular vector, or transduced cell type in a particular patient.
[00118] Pharmaceutically acceptable carriers are determined in part by the particular composition being administered (e.g., nucleic acid, protein, modulatory compounds or transduced cell), as well as by the particular method used to administer the composition. Accordingly, there are a wide variety of suitable formulations of pharmaceutical
compositions of the present invention (see, e.g., Remington's Pharmaceutical Sciences, 17th ed., 1989). Administration can be in any convenient manner, e.g., by injection, oral administration, inhalation, transdermal application, or rectal administration.
Methods of Identifying Antibodies
[00119] In some embodiments, the present invention provides a method for identifying antibodies that specifically bind a protein comprising a post translational modification, the method comprising the steps of: (1) identifying a noncovalent post translational modification- binding motif in a protein; (2) inspecting known antibody CDRs for an anchoring pocket sequence that adopts the conformation of the noncovalent post translational modification- binding motif; (3) preparing an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise the anchoring pocket; (4) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and (5) identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
[00120] In some embodiments, identifying a noncovalent post translational modification- binding motif in a protein can be performed using any of the methods described herein as well as any other methods known to those of skill in the art.
[00121] In some embodiments, the methods further comprise analysis which is performed according the present methods by inspecting known antibody CDRs for an anchoring pocket sequence that adopts the conformation of the noncovalent post translational modification- binding motif. CDRs can be screened by any of the methods described herein, including in vitro and in silico methods, as well as any other methods known to those of skill in the art for antibody screening in order to identify anchoring pocket sequences that adopt the
conformation of the noncovalent post translational modification-binding motif.
[00122] In some embodiments, the methods further comprise preparing an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise the anchoring pocket identified according to the present methods. In some embodiments, the antibody scaffold comprises two or more CDRs and amino acid residues from the two or more CDRs comprise the anchoring pocket. In some embodiments, the antibody scaffold comprises two, three, four or more CDRs and amino acid residues from the two, three, four or more CDRs comprise the anchoring pocket. In some embodiments, the antibody scaffold comprises two CDRs and amino acid residues from the two CDRs comprise the anchoring pocket. In some embodiments, the antibody scaffold comprises three CDRs and amino acid residues from the three CDRs comprise the anchoring pocket. In some embodiments, the antibody scaffold
comprises four CDRs and amino acid residues from the four CDRs comprise the anchoring pocket.
[00123] In some embodiments, the methods further comprise preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket. In some embodiments, the amino acid residues of the two or more CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket. In some embodiments, the amino acid residues of the two, three, four or more CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket. In some embodiments, the amino acid residues of the two CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket. In some embodiments, the amino acid residues of the three CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket. In some embodiments, the amino acid residues of the four CDRs with amino acids comprising the anchoring pocket are randomized outside of the anchoring pocket.
[00124] In some embodiments, the methods further comprise identifying antibodies in the library that specifically bind to a protein comprising a post translational modification. In some embodiments, the antibody identified binds a specific protein comprising the post translational modification. In some embodiments, the antibody identified binds a specific post translational modification. In some embodiments, the antibody identified binds a specific post translational modification found in one or more proteins. In some embodiments, the antibody identified binds a specific post translational modification found in a plurality of proteins.
[00125] In some embodiments, the antibody identified the post translational modification is any post translation modification know by one of skill in the art. In some embodiments, the post translational modification is an anion or an anionic modification. Examples of post translational modification include but are not limited to phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation. In some
embodiments, the post translational modification is selected from the group consisting of phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, and glycosylation. In some embodiments, the post translational modification is a
phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or
glycosylation. In some embodiments, post translational modifications can be found in a plurality of proteins.
[00126] In some embodiments, the noncovalent post translational modification-binding motif recognizes any post translation modification known by one of skill in the art. In some embodiments, the noncovalent post translational modification-binding motif recognizes an anion or an anionic modification. Examples of noncovalent post translational modification- binding motifs which can be recognized by the antibodies identified by the methods disclosed herein include a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar. In some embodiments, the noncovalent post translational modification-binding motif recognized is a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar.
[00127] In some embodiments, the method further comprises the step of characterizing the anchoring pocket. In some embodiments, the amino acid residues from two or more CDRs comprise the anchoring pocket. In some embodiments, the amino acid residues from two, three, four or more CDRs comprise the anchoring pocket. In some embodiments, the amino acid residues from two CDRs comprise the anchoring pocket. In some embodiments, the amino acid residues from three CDRs comprise the anchoring pocket. In some embodiments, the amino acid residues from four CDRs comprise the anchoring pocket.
[00128] In some embodiments, the present disclosure provides methods for identifying antibodies that specifically bind a protein comprising a post translational modification, the method comprising the steps of: (1) identifying a noncovalent post translational modification- binding motif in a protein; (2) engineering an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise an anchoring pocket that adopts the
conformation of the noncovalent post translational modification-binding motif; (3) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and (4) identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
[00129] In some embodiments, the antibody identified binds a specific protein comprising the post translational modification. In some embodiments, the antibody identified binds a specific post translational modification. In some embodiments, the antibody identified binds
a specific post translational modification. In some embodiments, the antibody identified binds a specific post translational modification found in one or more proteins. In some embodiments, the antibody identified binds a specific post translational modification found in a plurality of proteins.
[00130] In some embodiments, the antibody identified that specifically bind a protein with the post translational modification binds any post translation modification known by one of skill in the art. In some embodiments, the post translational modification is an anion or an anionic modification. Examples of post translational modification include but are not limited to phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation. In some embodiments, the post translational modification is selected from the group consisting of phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, and glycosylation. In some embodiments, the post translational modification is a phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation.
[00131] In some embodiments, the noncovalent post translational modification-binding motif recognizes an anion or an anionic modification. Examples of noncovalent post translational modification-binding motifs which can be recognized by the antibodies identified by the present disclosure include anions, a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N-terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar as well as combinations thereof.
[00132] In some embodiments, the method further comprises the step of characterizing the anchoring pocket. In some embodiments, the amino acid residues from two or more CDRs comprise the anchoring pocket. In some embodiments, the amino acid residues from two, three, four or more CDRs comprise the anchoring pocket. In some embodiments, the amino acid residues from two CDRs comprise the anchoring pocket. In some embodiments, the amino acid residues from three CDRs comprise the anchoring pocket. In some embodiments, the amino acid residues from four CDRs comprise the anchoring pocket.
[00133] In some embodiments, the method of further comprises the step of characterizing the anchoring pocket. The anchoring pocket can be characterized based on structural analysis (including for example but not limited to sequence analysis as well as 3D structure analysis), and functional analysis (including for example binding partner analysis).
[00134] In some embodiments, the anchoring pocket can be characterized based on a structural analysis. In some embodiment, the anchoring pocket is characterized based on sequencing analysis. In some embodiments, the anchoring pocket is characterized based on the CDR sequence analysis. In some embodiments, the anchoring pocket is sequenced. In some embodiments, the one, two, three, four or more CDRs in the anchoring pocket are sequenced. In some embodiments, the one CDR in the anchoring pocket is sequenced. In some embodiments, the two CDRs in the anchoring pocket are sequenced. In some
embodiments, the three CDRs in the anchoring pocket are sequenced. In some embodiments, the four CDRs in the anchoring pocket are sequenced.
[00135] In some embodiments, the anchoring pocket is characterized based on a functional analysis. In some embodiments, the anchoring pocket is characterized based on the
noncovalent post translational modification-binding motif recognized by the anchoring pocket. In some embodiments, characterized of the anchoring pocket includes a
determination regarding which noncovalent post translational modification-binding motif is recognized by the anchoring pocket. In some embodiments, the anchoring pocket is characterized as an anion anchoring pocket. In some embodiments, the anchoring pocket is characterized as a sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation anchoring pocket.
[00136] Exemplary sequences identified using the methods described herein include the following. Sequence labeling corresponds to the labeling shown in Figure 9. CDR regions are underlined.
>P2.All
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQSNNIPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF
RKFGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRNT
-DAW—FAYWGQGTLVTVSS
>P2.B8
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQYASYPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF
RKFGMSWVRQAPGKGLEWVATISTPRGSYTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGW
-S MAYWGQGTLVTVSS
>P3.29
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRYNNPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVATISTPRGSATYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-KG- AAFDYWGQGTLVTVSS
>P3.24
DIVLTQSPATLSLSPGERATVSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRAAYPITFGQGTKVEIKRGGGGRGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- AGFAYWGQGTLVTVSS
>P3.22
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRYNYPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVATISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-GSRG- AAFDYWGQGTLVTVSS
>P3.18
DIVLTQSPATLSLSPGERATMSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRNGYPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- AAMAYWGQGTLVTVSS
>P3.17
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRSGVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVATISTPRGSYTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-TG- AAFAYWGQGTLVTVSS
>P3.13
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRAGYPVTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVATIAT-GGHTTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-KG- AAFAYWGQGTLVTVSS
>P3.12
DIVLTQSPATLSLSPGERATVSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRSSYPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- AGFAYWGQGTLVTVSS
>P3.11
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRSAYPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- GAFAYWGQGTLVTVSS
>P3.10
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRTGYPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVATISTPRGSSTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-DG- AAFDYWGQGTLVTVSS
>P3.6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRAGFPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVATIAT-GGHTTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G- AGGAAFDYWGQGTLVTVSS
>P3.5
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRSAFPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASISTPRGSDTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- SSFDYWGQGTLVTVSS
>P3.4
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRATYPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- TAFDYWGQGTLVTVSS
>P3.1
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRSAFPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVATISTPRGSTTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRT-A-AG- AAFAYWGQGTLVTVSS
>P3.28
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRNAYPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-NG- AAMAYWGQGTLVTVSS
>P3.19
DIVLTQSPATLSLSPGERATVSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQHYSFPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGAR-RG- EGFDYWGQGTLVTVSS
>P3.8
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGKG
KKMDYWGQGTLVTVSS
>P3.2
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQRSAYPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVASIAT-GGHTTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-GG- ASFAYWGQGTLVTVSS
>P4.B9
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQGTNDPVTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVASISTPRGSSTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTS YAMDYWGQGTLVTVSS
>P4.All
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQRNAVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVAGISTPRGSYTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRG-GGAG AGFDYWGQGTLVTVSS
>P5.G5
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQHYDIPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR GKA-
-MDYWGQGTLVTVSS
>P5.Hll
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSDSFPVTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK FGMSWVRQAPGKGLEWVATIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRWSWDNRSAT- -MDYWGQGTLVTVSS
>P5.G10
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR
STAAWFDYWGQGTLVTVSS
>P5.C5
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQYDAFPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR GGE—
MDYWGQGTLVTVSS
>P6.G11
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQYSDLPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G
E—G FAYWGQGTLVTVSS
>P6.G10
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQDASFPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR
ATTTS—T FAYWGQGTLVTVSS
>P6.G8
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR A
E— MDYWGQGTLVTVSS
>P6.G7
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQYNGIPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S
T—G FDYWGQGTLVTVSS
>P6.G6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G
A—S MDYWGQGTLVTVSS
>P6.G5
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S
E—S MDYWGQGTLVTVSS
>P6.G4
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S
GYYA FDYWGQGTLVTVSS
>P6.F12
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR N
A—S MDYWGQGTLVTVSS
>P6.F11
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR T
—N—SSWFDYWGQGTLVTVSS
>P6.F3
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQYAGVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR N
S—A MDYWGQGTLVTVYS
>P6.F2
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMN YQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQYAGVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR N
A—T MDYWGQGTLVTVSS
>P6.F1
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQGDAIPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR D
S—G MDYWGQGTLVTVSS
>P6.E12
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQHYNVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S
Y—G FDYWGQGTLVTVSS
>P6.Ell
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQYADIPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G
G—S MDYWGQGTLVTVSS
>P6.E8
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS MEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G
S—T FDYWGQGTLVTVSS
>P6.E7
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQYTSVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR A
D—E MDYWGQGTLVTVSS
>P6.E6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFGVYYCLQDYGFPVTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S
S— —KDWFDYWGQGTLVTVSS
>P6.E2
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR K
S—T FDYWGQGTLVTVSS
>P6. D6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVAAIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRSYYS
G—S MDYWGQGTLVTVSS
>P6.C12
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR R
A— FDYWGQGTLVTVSS
>P6.C6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISS LEPEDFAVYYCLQSASIPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRK
FGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G
E—A MDYWGQGTLVTVSS
>P10.G12
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQYAGLPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVAGISTPRGSNTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRAGRGEG
-FAYWGQGTLVTVSS
>P10.D6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQHATVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRTT-WNN YFAYWGQGTLVTVSS
>P10.BIO
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQHNTFPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVARISTPRGSNTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGG-AYN -FAYWGQGTLVTVSS
>P10.H2
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQGSGAPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVAEIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGG-SMD YWGQGTLVTVSS
>pSAb_HC (Heavy Chain)
EISEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHT
>pSTAb_HC (Heavy Chain)
EISEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHT
>pYAb_HC (Heavy Chain)
EISEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASIVG—GRKTYYSDSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHT
>pSAb_LC
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS
SLEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASWCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>pS Ab_LC
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASWCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>pYAb_LC
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASWCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
ID P8.H9 STANDARD;
PRT; 241 AA
SQ Sequence 241 AA;
DIVLTQSPAT LSLSPGERAT LSCMTSTDID DDMNWYQQKP GQAPRLLISE GNTLRPGVPA 60 RFSGSGSGTD FTLTISSLEP EDFAVYYCLQ STGVPFTFGQ GTKVEIKRGG GGSGGGGSGG 120 GGSEVQLVES GGGLVQPGGS LRLSCVTSGF TFRKFGMSWV RQAPGKGLEW VASIATGGHT 180 TYYSDSVKGR FTISRDNSKN TLYLQMNSLR AEDTAVYYCT RNSSDAWMAY WGQGTLVTVS 240 S 241
[00137] In some embodiments, the antibodies indentified by the methods disclosed herein include comprise one or more CDRs as part of the anchoring pocket. Exemplary CDR sequences include but are not limited to those listed in Table 2 below. In some embodiments, the CDRs comprising the anchoring pocket include one or more CDRs as listed in Table 2. In some embodiments, the CDRs comprising the anchoring pocket include 1, 2, 3, 4, 5, 6 or more CDRs as listed in Table 2. In some embodiments, the CDRs comprising the anchoring pocket bind a phosphorylated residue. In some embodiments, the CDRs comprising the anchoring pocket include a H2 CDR2 as listed in Table 2.
Table 2. Exemplary CDR sequences
DB2/ 24846158.1
DB2/ 24846158.1
EXAMPLES
[00138] The methods system herein described are further illustrated in the following examples, which are provided by way of illustration and are not intended to be limiting.
Example 1 : Design of phospho-specific antibody scaffolds
[00139] The most common anion-binding motif within many different protein
superfamilies, such as ATPases, helicases, and kinases, consists of three consecutive residues where multiple main-chain amides form hydrogen bonds with the anion (Fig. la) (Watson, J.D. & Milner- White, E.J. A novel main-chain anion-binding site in proteins: the nest. A particular combination of phi,psi values in successive residues gives rise to anion-binding sites that occur commonly and are found often at functionally important regions. J Mol Biol 315, 171-182 (2002)). An existing Ab scaffold into which a similar loop could be built was sought. The CDRs were manually inspected for the desired nest conformation from sixty anti-peptide Ab structures. A region of CDR H2 within a mouse Fab (PDB ID H8i) (Landry, R.C. et al. Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII. J Mol Biol 308, 883-893 (2001)) was identified that adopts the desired conformation due a hallmark aL glycine at 54H (Fig. lb). This Ab utilized the H2 loop to bind an acidic residue, which is often used as a phospho-mimic, in the peptide. This recognition is achieved by six loop residues that anchor the peptide (52H and 52AH), stabilize the conformation (54H), or confer specificity to the Asp side chain (53H, 55H, and 56H) (Fig la and Table 3). A larger search of all Ab-antigen structures identified eight Abs that utilize this loop to make hydrogen bonds between the main-chain NH groups in the Ab and an aspartate or glutamate in the peptide (Fig. 2b).
Table 3. Functional description of H2 loop residues.
[00140] To characterize this class of Ab-antigen interactions, gene encoding the mouse H8i Fab was synthesized and cloned into a phage display vector and a protein expression vector (Table 4). A humanized version of the Fab by grafting the six CDRs onto a robustly expressing human Fab scaffold was developed. This humanized scaffold, which expressed at yields > 3mg/L in bacteria, bound the peptide with similar affinity as reported for the mouse Fab (Landry, R.C. et al. Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII. JMol Biol 308, 883-893 (2001)). This suggests that the peptide-binding site was preserved between the mouse and humanized Fabs, which was confirmed by subsequent crystallographic analysis of the humanized Ab.
Table 4. List of vectors utilized.
[00141] To understand the importance of the Asp-loop (residues 50H-56H) interaction in peptide binding, the humanized Fab was displayed on bacteriophage and competition ELISAs were performed to analyze binding of the humanized Fab to a panel of peptides. ELISA data confirmed that the Asp 8 residue of the antigen is a hot spot for binding as mutation to Ala, Ser, Thr, or Tyr substantially reduced Ab binding (>100-fold less) to the peptide (Fig. lc). Without being bound by theory, the carboxylate group of Asp8 residue might mimic a phosphorylated residue and thus, the Ab can bind peptides with pSer, pThr, or possibly pTyr in place of Asp8 (Table 5). ELISA data confirmed the ability of this Fab to bind pSer- or pThr-containing peptides, albeit with weak affinities (>2000 nM) (Fig. lc and Table 6).
Table 5. Phosphorylated peptide antigens utilized.
Table 6. Affinity measurements of antibody scaffolds. aNo binding seen by competition ELISAs.
[00142] To optimize the CDR for binding to each phosphorylated residue, three Ab phage display libraries were constructed (all with diversities exceeding 5 x 109). The six-residue CDR region (52h-56H) was replaced with six fully random residues (H2 library) or seven fully random residues (H2+1 library) to relieve steric clashes with the Ab backbone for each of the peptides. The third library design was similar to the H2 library, but fixed Gly or Ser at 53H and 54R (GS library). This strategy permitted the assessment of the importance of the anchor (52H and 52AH) and conformation (55H) residues as well as altering the specificity residues (53H, 55H, and 56H). Using standard phage display methods, four rounds of selection
against the pSer, pThr, or pTyr peptides were performed. Strong enrichment against each of pSer, pThr, and pTyr peptide targets was observed using all three libraries, except for selections with the H2+1 library against pTyr (Fig. lc).
Vector Construction
[00143] A series of p3 phage display vectors along with compatible protein expression vectors was constructed (Table 4). A previously described phagemid was designed to express a Fab from a phoA promoter and display the Fab on gene 3 of Ml 3 bacteriophage (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338, 299-310 (2004)). In place of the original Fab gene, a cassette was inserted having of a PelB signal sequence followed by a dummy gene sequence, which is then linked to a truncated gene III coat protein (pJKl). Additionally, a version with a full-length gene III coat protein (pJK2) along with two protein expression vectors was constructed (pJK3 and pJK4). To permit efficient cloning of antibody sequences between all vectors, a dummy gene was flanked by two unique Sfi I restriction sites. To construct the initial Fab scaffold of H8i, a gene cassette encoding the heavy and light chains of the mouse Fab was synthesized and cloned into pJKl . A humanized version of this scaffold was also constructed by grafting the three heavy chain CDRs from the mouse Fab onto a consensus VH3 heavy chain gene and the three light chain CDRs onto a consensus VLK3 light chain gene (Knappik, A. et al. Fully synthetic human combinatorial antibody libraries (HuCAL) based on modular consensus frameworks and CDRs randomized with trinucleotides. J Mol Biol 296, 57-86 (2000)). The human Fab template was modified by Kunkel mutagenesis, according to standard protocols (Kunkel, T.A. Rapid and efficient site-specific mutagenesis without phenotypic selection. Proc Natl Acad Sci USA 82, 488-492 (1985)). All restriction enzymes and DNA polymerases were purchased from NEB (Ipswich, MA). Oligonucleotides were purchased from IDT and all constructs were verified by DNA sequencing (Quintara Biosciences).
Generation of Phage Libraries
[00144] A humanized Fab in pJKl with two stop codons within the CDR H2 was used as a template for Kunkel mutagenesis with oligonucleotides designed to correct the stop codons and introduce the designed mutations at each site (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338, 299-
310 (2004) and Kunkel, T.A. Rapid and efficient site-specific mutagenesis without phenotypic selection. Proc Natl Acad Sci USA 82, 488-492 (1985)). To make the H2- targeted libraries, a set of three libraries was generated in which the codons encoding the parent H2 sequence (STGGYN) was replaced with either i) six random amino acids encoded by NNK (H2 library), ii) seven random amino acids encoded by NNK (H2+1 library), or iii) a core set of two or three amino acids, which were allowed to be only Gly or Ser, and were flanked on both sides by two random amino acids encoded by NNK (GS library). Mutagenic oligonucleotides are listed in Table 7. The resulting mutagenesis reactions were
electroporated and phage were produced as previously described (Sidhu, S.S. et al. Phage- displayed antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338, 299-310 (2004)). The final diversities of the H2, H2+1, and GS libraries were 6.5 x 109, 1.6 x 1010, and 5.3 x 109, respectively.
Table 7. Oligonucleotides used to generate antibody libraries
ACC
H3 P6.2 GCCGTC:I¾TTATTGTACCC<JTDV DV DV ATGOMTTACTGGGGTCAAGGA
ACC
H3 P7.,l GCCGTC A-lTATTGTACCCCfT VKDV DV DV TTTGMTTAC GGGGTC!AA
GGAACC
Hi P7.2 GCCGTC'mTTATTGTACCCGTDVKDV DV DVKATGGMTTACTGGGGTCAA
GGAACC
Hi PS.l GCCGTCTATTA'TTGTACCCGTDV D\ G- a Ta>\^ TTTGMTTACTGGGGT
CAAGGAACC
Hi PS.2 GCCGTCTA TATTGTAC:CCGTDV D\^} TO3\¾:DV ATGGMTTACTGGGGT
CAAGGAACC
H3 P9.1. GCCGTCTATTATTGTACCCGTDV103Y D 1CDVKDVKD ¾:TTTGMTTACTGG
GGTCAAGGAACC
H3 P9..2 GCCGTCTATTATTGTACCCGTDVKDYSDVKDVKDV V ATGGMTTACTGG
GGTCAAGGAACC
H3 PIO.l GCCGTCTATTAITGTACCCG'TI VinVKDVKDVi ^V D 7KD ¾TTTGMTTAC
TGGGGTCAAGGAACC
H3 ΡΪ0.2 CTCCGTC:TATTAITGTACCCCfT VKDV DV D¥ DV. D Ta3 ATGGMTTAC
TGGGGTCAAGGAACC
Hi PI Li GCCGTCTATTATTGTACCCGTDVKDV DV DV DV DVKDVKDVKTTTGMT
TACTGGGGTCAAGGAACC:
Hi PI 1.2 GCCGTCTATTATTGTACCCGTDVH3VKDVKl>VKDV DYKDvi 3V ATGGM
TTACTGGGGTCAAGGAACC
Hi P12.1 i3t:CGTCTATTATTGTAC:C'CGTDViaiV inKI}V DVKDY DYKDVKDV TTT
GMTTACTGGGGTCAAGGAACC
H3 PI 2.2 GCCGTCTATTATTGTAC!CCGTDV DY DV DVKDVKDV DV DV DV AT
GGMTT ACTGGGG TC A A GG A AC C
[00145] To make the PS antibody libraries, two scFv templates were constructed, which included the pSAb and pSTab variable light chain linked to the variable heavy chain by a (Gly4Ser)3 linker, from pSAb and pSTAb and introduced two stop codons in the CDR H3. These plasmids were then used as templates for Kunkel mutagenesis. The light chain CDR L3 was diversified at positions 91-94 and 96 and the heavy chain CDR H2 was diversified at positions 50, 56, and 58 using degenerate codons designed to mimic the natural sequence diversity found at these positions (Table 8) (Sidhu, S.S. et al. Phage-displaved antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338, 299- 310 (2004) and Bostrom, J. et al. Variants of the antibody herceptin that interact with HER2 and VEGF at the antigen binding site. Science 323, 1610-1614 (2009)). CDRH3 was diversified using three to nine random amino acids (DVK) followed by three terminal residues (F/M, A/D, and Y) commonly observed in anti-peptide antibodies. For the
mutagenesis reactions, L3 oligonucleotides (PI and P2) were mixed at a 1:1 molar ratio, H2 oligonucleotides (1, 2, and 3) were mixed at a 0.1:1:2 ratio and H3 oligonucleotides (PX.l and PX.2, where X = CDR length) were mixed at a 2: 1 ratio. The resulting libraries were produced using Hyperphage (Rondot, S., Koch, J., Breitling, F. & Dubel, S. A helper phage
to improve single-chain antibody presentation in phage display. Nat Biotechnol 19, 75-78 (2001)) to enhance recovery of rare binders and the final diversities of the pSAb and pSTAb libraries were 3.4 x 1010 and 2.7 x 1010, respectively.
Table 8. Amino acid diversity of phosphoscaffold libraries. *H3 CDRs (H95-H102) were six to twelve amino acids in length.
Phage Display Sections and ELISAs
[00146] All phage preparations and ELISAs were performed according to standard protocols (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain
complementarity determining regions. J Mol Biol 338, 299-310 (2004) and Sidhu, S.S., Lowman, H.B., Cunningham, B.C. & Wells, J.A. Phage display for selection of novel binding peptides. Methods Enzymol 328, 333-363 (2000)). Briefly, 96-well Maxisorp plates were coated with 10 μg/mL NeutrAvidin overnight at 4°C and subsequently blocked with 2% BSA for two hours at 20°C. Various concentrations of Fab-phage were mixed with a fixed concentration of biotinylated peptide and captured on the NeutrAvidin-coated wells for fifteen minutes. The bound phage were then detected using a horseradish peroxidase (HRP)- conjugated anti-M13 monoclonal (GE Healthcare). For phage competition ELISAs, plates were coated with 10 μg/mL NusA-KGNYVVTDH (the native target for the H8i Fab and a weak binder to pSAb, pSTAb, and pYAb), and blocked with 2% BSA. Sub-saturating levels of phage were then pre-bound to the various peptide antigens for two hours at 20°C and then captured on the NusA-peptide coated plates for fifteen minutes. For scFv-Fc competition ELISAs, plates were coated with NeutrAvidin, blocked with 2% BSA, incubated with 100-
200 nM biotinylated peptide, and finally blocked with 200 μΜ biotin. scFv-Fcs were then pre-bound to a dilution series of peptide antigen and processed as described for phage.
Bound scFv-Fc were detected with HRP-conjugated Protein A (Pierce). Competition ELISA data was fit using a four-parameter logistic equation, with error shown by standard deviation of 2-3 replicates for each sample analyzed.
[00147] Selections with the H2 -targeted libraries were performed using biotinylated phosphopeptide antigens captured with streptavidin-coated magnetic beads (Promega) (Table 5). In total, four rounds of the selection were performed with decreasing amounts of peptide antigen (500, 250, 100, and 10 nM) and individual phage clones were analyzed from the fourth round of selection. Selections with the pSAb and pSTAb libraries were identically performed except only three rounds were conducted.
Example 2: Characterization of phospho-specific (PS) antibody scaffolds
[00148] For each phosphopeptide antigen, single phage clones were isolated from each library and analyzed binding to the phosphopeptide by single-point ELISA (data not shown). For clones that gave ELISA signals >20-fold above background, the CDR H2 region was sequenced and sequences were constructed. Selections against the pSer and pThr peptides gave similar sequence logos and thus were combined into one logo. Analysis of the sequence logos from the H2- and GS-library selections against pSer/pThr highlighted the conservation of the key anchoring residue T52AR and conformation residue G54R in the loop, whereas more diversity was observed in the specificity residues (55H and 56H) (Fig. 3a). In the H2+1 libraries, a strong enrichment for a Pro-Arg insertion was observed in place of G53R and complete conservation of G54H (Fig. 3b). The G54H residue occupies a region of the Ramachandran plot in which only glycine is allowed, thus suggesting that this glycine is critical for the conformation (Landry, R.C. et al. Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII. JMol Biol 308, 883-893 (2001); Hollingsworth, S.A. & Karplus, P. A. A fresh look at the Ramachandran plot and the occurrence of standard structures in proteins. Biomol Concepts 1, 271-283 (2010); and North, B., Lehmann, A. & Dunbrack, R.L., Jr. A new clustering of antibody CDR loop conformations. J Mol Biol 406, 228-256 (2011)). The pTyr Abs contained a different binding motif from the pSer/pThr clones consisting of a valine at 52H, the Gly-Gly motif, and two consecutive basic residues,
suggesting that the mode of pTyr recognition differs from that of pSer/pThr recognition (Fig. 3c).
[00149] The phage clones by competition ELISA (as described above) were next analyzed to identify the best scaffold for each PTM target (pSer, pThr, or pTyr) (data not shown). From these experiments, a pSer-specific scaffold (pSAb with the loop sequence ATGGHT), a pSer/pThr-specific scaffold (pSTAb with sequence STPRGST), and a pTyr-specific scaffold (pYAb with sequence VTGGRK) were observed. To determine the phospho-selectivity of these scaffolds, binding to the phosphorylated and unphosphorylated peptides was analyzed. High selectivity for the phosphorylated peptide was observed in all cases (Fig. 3). For both the pSAb and pSTAb scaffolds, no binding to the unphosphorylated Ser or Thr peptides was observed up to 2 μΜ (Fig. 3a and 3b). pSAb bound to pSer ~10-fold tighter than pThr whereas pSTAb bound similarly to both pSer and pThr. pYAb bound >20-fold better to the pTyr peptide versus the unphosphorylated version (Fig. 3c). The specificities and binding affinities by surface plasmon resonance using purified Fabs and biotinylated peptides were confirmed (Fig. 4; Table 6).
Biacore Analysis
[00150] Surface plasmon resonance data were measured on a Biacore model 4000 (Biacore, Uppsala, Sweden). All proteins were in TBS containing O. lmg/mL BSA and 0.01% Tween- 20. A Biacore CM5 chip was coated with NeutrAvidin at -3000 RU and biotinylated antigens were captured at < 100 RU. Serial dilutions of the Fabs were flowed over the immobilized antigens and 1 : 1 Langmuir binding models were used to calculate the kon, koff, and KD for each Fab: antigen pair.
Example 3: Structural analysis of phosphope tide recognition
[00151] To explore the mode of phosphoresidue recognition using X-ray crystallography, four Fab:peptide complexes (sSAb:pSer, pSTAb:pSer, pSTAb:pThr, and pYAb:pTyr) and the unbound pYAb Fab were expressed, purified, and crystallized. To express the Ab scaffolds, selected Fabs were amplified by PCR from the phage display vector, cloned into pJK4, and transformed into the C43 (DE3) bacterial strain for periplasmic protein expression. Protein expression was induced with ImM IPTG and the culture was grown overnight (18-20 hrs) at 30°C. A high level (up to -50%) of proteolyzed Fabs was initially observed after expression. Similar results were observed in other bacterial strains. Recombineering was used to
knockout the genes that encode for the degP and pre proteases in the isogenic strain C43 (DE3) to generate the PRO ( degP Aprc AompT) strain. Recombineering was performed according to standard protocols (Sharan, S.K., Thomason, L.C., Kuznetsov, S.G. & Court, D.L. Recombineering: a homologous recombination-based method of genetic engineering. Nat Protoc 4, 206-223 (2009)) to replace degP with a cassette encoding kanamycin resistance and pre with a cassette encoding tetracycline resistance. Additionally, a mutagenic oligonucleotide was used to introduce a W148R mutation in spr to correct the
thermosensitive phenotype of pre knockout strains (Chen, C. et al. High-level accumulation of a recombinant antibody fragment in the periplasm of Escherichia coli requires a triple- mutant (degP pre spr) host strain. Biotechnol Bioeng 85, 463-474 (2004)) to generate the PRO+ strain. When Fabs were expressed in the C43 PRO+ strain, <5% of the Fab was proteolyzed (data not shown).
[00152] Expressed Fabs were purified from total cell lysates by Protein A chromatography, ion exchange chromatography, and a gel filtration chromatography step as previously described (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. J Mol Biol 338, 299-310 (2004) and Bostrom, J. et al. Variants of the antibody herceptin that interact with HER2 and VEGF at the antigen binding site. Science 323, 1610-1614 (2009)). Fabs were stored at 4°C for short-term analysis or flash frozen in 10% glycerol for storage at -80°C. Selected scFvs were PCR amplified and fused to a rabbit Fc domain (rFc) in a mammalian expression vector (pJK6). These constructs were transiently transfected into 293T cells and the resulting scFv-Fc proteins were purified from the media using Protein A chromatography. Nonphosphorylated versions of all peptides were fused to the C-terminus of NusA, which contained an N-terminal His6 tag and biotin acceptor peptide and were co-expressed in BL21 (DE3) cells with BirA to enzymatically biotinylate each protein (pJK5). Recombinant proteins were purified on a His GraviTrap column (GE Healthcare, Piscataway, NJ) followed by monomeric Avidin resin (Thermo Scientific, Rockford, IL) to a final purity of >95%. All biotinylated peptides were purchased from Elim Biopharmaceuticals (Hayward, CA) or Peptibody, Inc. (Charlotte, NC).
[00153] Four Fab:peptide complexes were successfully crystallized (pSAb:pSer, pSTAb:pSer, pSTAb:pThr, and pYAb:pTyr) as well as the unbound pYAb Fab (Table 9). Crystals for all four Fab:peptide complexes diffracted to better than 2 A, whereas the unbound Fab diffracted to 2.63 A (Table 9). Strong electron density for the bound peptide
was observed in all pSer and pThr structures (Fig. 5). For the pYAb Fab, only one of the two Fab copies in the asymmetric unit was fully occupied by the peptide, likely due to the packing arrangement of the Fabs (Fig. 5). No changes in the positions of the CDRs were observed between the mouse 31 and humanized antibodies, which aligned with a ca RMSD of 0.78Ά. Furthermore, binding of the peptide to the antibody did not induce any major CDR movements (caRMSD of 1.3 A) (Fig. 6).
Table 9. Crystallization and cryoprotection conditions for Fab compl
pYAb 25% P£G150:G%UM I M hs apm wit 1.0% 1 is
MT s>H 4 ! PBG200 sua! 25% PEG! 580
Table 10. Data collection and refinement statistics (molecular replacement) i $TA0:i:0ci ϊ>ΥΑ0 i' -i -I ~i F ¾ 2< 2< F2i2s 25 F >: 2 I P 322 1
Cell αΐϊϊί-ι ΐχ-
«, h. (A) 93,81,95,59, 45.05. 43.5, 152.05, 152.20,
.80, 94.87. 152.85, 152.20.
119.92 0,58 85,20 83.55
90.90, 90 00.00.0 99, 00.90 90, 90. oo 90, 00.120
50 -L55 (1.004 54,10 74.50 - 50 - L05 70.1.3 - 2.03
- 1.55) LSI (1,875 t~5(!.S13 (2.02 - (2.724 -
- LSI) ~ j Ϊ.0 ) 2.63)
0.005 (0.51) 0,119(0.0') 0,113 0.097 0 i 15(0.9")
(0,5 i ( (0,071
J/ f 15,22 (2.39) 0J4(!,9O) 7.22(1,90) 9.32(2-1 ) IIM (1,86)
97,85 86. 3) 90:70 00.49 99.92 99.49(95,97)
(99.48) (09.33) 99.81)
? 6 (2,9) 5.8(5.8} 3.9(3,9) 4.1 (4.1) 7.0 (5.4)
Rs-i seiwesit
RivoImkfS (A) 50- 1,55 ?4,I9 - 74,59- 50-1.95 7 J3-2-0
LSI 1.75
"2 3 (3059) 40909 50977 8,3503 53257 (1710)
(24 8) (2022) (4100)
5 5 20 52
Wafer 623 015 075 977 50
W¾¾a B-valae {A} 13,33 18.50 15.42 2.059 59.75
18.4 23. 19 52 S2,0
B-wl ksgOs* (A) 0.0O9 0,003 0,0) 0.000
Boad asgfcs- f ) 1.51 .ss 1,32 1.2 0,80
[00154] The X-ray structures of the parent peptide:Fab complexes illustrate how CDR H2 specifically recognizes each phosphoresidue (Fig.7). For all three scaffolds, mutations found in the parent H2 loop make the main-chain more accessible and create a large electropositive hot spot (indicated by arrow in Fig.8). The phosphoresidue side chain is almost fully engulfed by the Ab in pSAb (80% buried) and pSTAb (92% buried) and anchored by
multiple hydrogen bonds to side chains and main-chain amides (five and seven bonds for pSAb and pSTAb, respectively), confirming that the hot spot was successfully optimized in the CDR (Fig. 7a, b, c, and Table 11). In pSAb, the pSer residue makes key contacts with specificity residues G53H, R55H, and T56H, whereas in pSTAb, the pSer and pThr residues make key contacts with R53H, G54H, and S55H . In pSTAb, the insertion of P52BH allows the T52AR anchor to flip out and still contribute a hydrogen bond from the main-chain carbonyl. In contrast, pYAb does not utilize the original designed loop conformation to bind pTyr (Fig. 7d). A key ionic interaction between H56K and the phosphate of pTyr and a hydrophobic interaction between V52R and the phenyl ring contribute to the recognition mode. The H2 nest pocket is occupied by a water molecule that is additionally stabilized by the free C- terminus of the peptide, indicating that pYAb may bind differently to the pTyr residue in longer peptides without this neighboring free carboxylate (Fig. 7d). For all phosphopeptides, the recognition is achieved through two sectors: the phosphoresidue-binding pocket and neighboring peptide sequence "reader" region, which consists primarily of CDRs L3 and H3 (Fig. 7e). Combined, the in vitro characterization and X-ray crystal structures confirmed that novel Ab scaffolds were designed that utilize pSer, pThr, or pTyr as hot-spot residues.
Table 11. Contact analysis between phosphopeptides and various binding domains
pSAb (pSer) 80 5 Herein pSTAb (pSer) 92 7 Herein pSTAb (pThr) 92.7 7 Herein pYAb (pTyr) 38.3 3 Herein
Crystallization of peptide :Fab complexes
[00155] Fabs were expressed as described herein and concentrated to 10-15 mg/mL in lOmM Tris pH7.5, 50mM NaCl. Complexes of the Fab with the corresponding peptide were formed at a 1 :2 molar ratio of Fab:peptide. Crystals were grown in hanging drop format by mixing 100 nL of protein solution and 100 nL crystallization solution using a Mosqutio nanoliter pipetting system (TTP Labtech). Crystals formed within one to two weeks at either 18°C or 4°C. A microseeding strategy was generated with a seed stock generated from finely ground pSTAb:pThr crystals in 50 cryoprotectant solution (Luft, J.R. & DeTitta, G.T. A method to produce microseed stock for use in the crystallization of biological
macromolecules. Acta Crystallogr D Biol Crystallogr 55, 988-993 (1999)). Crystals for the pSAb:pSer and pSTAb:pSer complexes were generated by hanging drop vapor diffusion with 300 nL drops consisting of 150 nL protein solution, 120 nL reservoir solution, and 30 nL 1 : 100 dilution of seed stock. All crystals were soaked in cryoprotectant solution and flash frozen in liquid nitrogen. Crystallization conditions and cryoprotectant solutions are listed in Table 9.
[00156] Diffraction data were collected using the Advanced Light Source beam line 8.3.1 at the Lawrence Berkeley National Laboratory (Berkeley, California) with a wavelength of 1.1 A. The data were indexed, integrated, and scaled using ELVES (Holton, J. & Alber, T. Automated protein crystal structure determination using ELVES. Proc Natl Acad Sci USA 101, 1537-1542 (2004)) and HKL2000 (Otwinowski, Z. & Minor, W. Processing of X-ray diffraction data collected in oscillation mode. Method Enzymol 276, 307-326 (1997)). The structure of the pSTAb:pThr complex was solved by molecular replacement using Phenix (Otwinowski, Z. & Minor, W. Processing of X-ray diffraction data collected in oscillation mode. Method Enzymol 276, 307-326 (1997)). The initial search model consisted of the variable heavy domain from 3n9g and the variable light domain, constant heavy domain, and constant light domain from 2gcy55. The pSTAb Fab structure was used as the search model
for all other structures. Iterative rounds of model building and refinement were carried out with Phenix and Coot (Emsley, P. & Cowtan, K. Coot: model-building tools for molecular graphics. Acta Crystallogr D Biol Crystallogr 60, 2126-2132 (2004)). For isomorphous crystals, the same refinement test sets for calculating Rfree were used. Simulated annealing composite omit maps calculated using Phenix were used to remove model bias. After two rounds of refinement, peptides were built into each model using Coot. Riding hydrogens as implemented in Phenix were used in the final stages of refinement for the pSAb:pSer, pSTAb:pSer, and pSTAb:pThr complexes. Final refinement statistics can be found in Table 10. The final coordinates were validated using MolProbity (Chen, V.B. et al. MolProbity: all-atom structure validation for macromolecular crystallography. Acta Crystallogr D Biol Crystallogr 66, 12-21 (2010)). The final Ramachandran statistics % Favored:% Outlier) were 98:0.2, 98:0.2, 98:0.2, 98:0, and 97:0.2 for pSAb:pSer, pSTAb:pSer, pSTAb:pThr, pYAb:pTyr, and pYAb, respectively. MacPyMol (DeLano Scientific) was used to generate structure figures. Electrostatic surfaces were calculated using APBS (Baker, N.A., Sept, D., Joseph, S., Hoist, M.J. & McCammon, J.A. Electrostatics of nanosystems: application to microtubules and the ribosome. Proc Natl Acad Sci USA 98, 10037-10041 (2001)) and buried surface areas were calculated using CCP4 (Winn, M.D. et al. Overview of the CCP4 suite and current developments. Acta Crystallogr D Biol Crystallogr 67, 235-242 (201 1)).
Example 4: Generation of novel phospho-specific antibodies using pSer and pSer/pThr scaffolds
[00157] Because every member of the initial library contains a phospho-hot spot, each Ab is should have a weak initial affinity for the phosphorylated antigen and this anchor should dramatically enhance the selection of new antibodies. As a proof of principle, pSer- and pThr-containing antigens were targeted because reagents capable of detecting these modifications are lacking in the art. The pSAb and pSTAb Fab scaffolds were converted into single chain fragment variable (scFv) scaffolds to improve the display level on phage and ultimately, improve the selection of Abs from the library. The surface-exposed positions were diversified in CDR H2 (5 OH, 56H, and 58H) outside of the phosphate-hot spot and CDR L3 (91L-94L, 96L) using codons designed to mimic natural Ab sequence diversity (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. JMol Biol 338, 299-310 (2004)) (Table 8). CDR H3 was diversified with CDR lengths ranging from six to twelve amino acids using a degenerate codon designed
to explore maximal chemical diversity, while still allowing efficient sampling of the sequence space in the library. The pSAb and pSTAb libraries had diversities of 3.4 x 1010 and 2.7 x 1010, respectively.
[00158] A set of ten biologically relevant pSer- or pThr-containing epitopes were chosen as target antigens (Table 12 and Table 5). Three rounds of selection were performed and single phage clones were analyzed from the third round of selection by single -point ELISA. For seven targets, at least one scFv was isolated that bound only to the phosphorylated and not the unphosphorylated antigen (Table 12 and Fig. 9a). To demonstrate that the isolated clones are specific to each phosphorylated peptide, a panel of ELIS As (as described above) was performed to assay binding of each scFv to each of the ten phosphorylated peptides (Fig. 9b and 9c). The data demonstrated the exquisite target selectivity of most of the scFv clones, indicating the absence of promiscuous pSer-/pThr peptide binding scFvs. These scFvs efficiently expressed in both bacteria (2-10 mg/L) and mammalian 293T cells (as Fc fusions with yields of 0.5-5 μg/mL) (data not shown). Additionally, the scFv-Fc fusions exhibited affinities ranging from 42 to 2430 nM (Table 12), which matches or exceeds previous reports of PS antibody affinities (Feldhaus, M.J. et al. Flow-cvtometric isolation of human antibodies from a nonimmune Saccharomyces cerevisiae surface display library. Nat Biotechnol 21 , 163-170 (2003) and Shih, H.H. et al. An ultra-specific avian antibody to phosphorylated tau reveals a unique mechanism for phosphoepitope recognition. J Biol Chem (2012)). These library selections validate the strategy of using a designed PS scaffold to rapidly generate novel PS antibodies.
Table 12. Summary of scFv hits versus new phosphopeptide targets. ascFv clones that exhibited >5-fold higher ELISA signal against phosphorylated peptide compared to unphosphorylated peptide (Fig. 9). bAs determined by competition ELISA with scFv-Fc protein (n = 2-3). Clone ID is shown in parentheses. cOnly partial competition was observed at the concentrations of peptide used.
Discussion
[00159] Described herein is a novel and renewable antibody generation method that entails the design of a motif-specific (e.g. pSer, pThr, or pTyr) antibody scaffold followed by structure-informed mutagenesis of the scaffold to generate monoclonal motif-specific antibodies against a panel of phosphopeptide antigens. The high success rate (70%), which does not employ counter selections against the unphosphorylated epitope demonstrates how the motif-specific hot spot greatly improves the selection process as even past Ab libraries generated from immunized animals required stringent counter selections to enrich for PS antibodies (Shih, H.H. et al. An ultra-specific avian antibody to phosphorylated tau reveals a unique mechanism for phosphoepitope recognition. J Biol Chem (2012) and Vielemeyer, O. et al. Direct selection of monoclonal phosphospecific antibodies without prior phosphoamino acid mapping. J Biol Chem 284, 20791-20795 (2009)). Structural validation of the hot spot prior to library generation allowed confirmation of the mode of recognition and to identify the key antibody residues involved in the recognition (Fig. 7). In the case of pSAb and pSTAb, the hot spot contains a hallmark ( glycine at 54 that contributes to the main-chain conformation of CDR H2. There is a remarkably high frequency of occurrence for this H2 conformation in Abs (-12% of all H2 conformations (North, B., Lehmann, A. & Dunbrack, R.L., Jr. A new clustering of antibody CDR loop conformations. JMol Biol 406, 228-256 (2011))). Moreover, eight Ab structures reveal an aspartate or glutamate bound to the same H2 hot spot, and three Ab structures have a sulfate ion bound. A recent structure of a chicken scFv, which was generated from an immunized phage display library with a phosphopeptide antigen, was reported that utilized a similar H2 conformation to bind pThr (Shih, H.H. et al. An ultra-specific avian antibody to phosphorylated tau reveals a unique mechanism for phosphoepitope recognition. J Biol Chem (2012)). Together these data suggest there may be a germline-encoded anion-hot spot capable of binding phosphate or sulfate groups (Fig. 2). The conservation of this site is intriguing because previous work on Abs that bind
phospholipids suggested a "phosphate -binding subsite" that conferred recognition of only the
phosphorylated or sulfated forms of multiple lipids and haptens (Alving, C.R. Antibodies to liposomes, phospholipids and phosphate esters. Chem Phys Lipids 40, 303-314 (1986)). Furthermore, anion-hot spot-containing Abs may provide a protective role in the recognition of phosphorylated or sulfated antigens, such as lipid A in Gram-negative bacteria (Alving, C.R. Antibodies to liposomes, phospholipids and phosphate esters. Chem Phys Lipids 40, 303-314 (1986).), or conversely, a more sinister role in autoimmune diseases, such as antiphospolipid syndrome (Levine, J.S., Branch, D.W. & Rauch, J. The antiphospholipid syndrome. N EnglJ Med 346, 752-763 (2002)).
[00160] The main chain dominated mode of pSer/pThr recognition is completely different from most endogenous pSer/pThr-binding domains such as SH2, 14-3-3, and FHA, that predominantly utilize side chains to bind the phospho-residue (Yaffe, M.B. & Smerdon, S.J. PhosphoSerine/threonine binding domains: you can't pSERious? Structure 9, R33-38 (2001)) (Fig. 7 and Fig. 10). Only the WW domain sometimes utilizes two main-chain amides to bind a phosphate. In fact, the pSer/pThr scaffolds described herein bind more efficiently to the phosphoresidue than naturally occurring domains by burying a larger surface area and contributing more hydrogen bonds (Table 1 1). Others have recently suggested that these endogenous phosphoresidue-binding and other PTM-binding domains have evolved to bind shorter epitopes with moderate affinities to support the dynamic nature of signal transduction pathways, which potentially limits the range of epitopes they can bind (Yaffe, M.B. & Smerdon, S.J. PhosphoSerine/threonine binding domains: you can't pSERious? Structure 9, R33-38 (2001); Kaneko, T., Joshi, R., Feller, S.M. & Li, S.S. Phosphotyrosine recognition domains: the typical, the atypical and the versatile. Cell Commun Signal 10, 32 (2012); and Seet, B.T., Dikic, I., Zhou, M.M. & Pawson, T. Reading protein modifications with interaction domains. Nat Rev Mol Cell Biol 7, 473-483 (2006)). Additionally, the designed PS hot spots described herein function independently of other CDRs as those could be diversified to target highly diverse phosphopeptides (Fig. 9 and Table 5). Because many other PTM-binding motifs exist in nature, such motifs can be similarly designed into Abs to generate high-affinity monoclonal reagents capable of detecting other PTMs beyond phosphorylation.
[00161] pYAb utilizes a completely different motif to recognize pTyr (Fig. 7d). The salt bridge between the phosphate and H56 Lys is more akin to how 14-3-3 and PTB domains bind phosphorylated residues. Thus, optimization of a single CDR loop generated two
different phosphate -recognition modes, both of which are found in natural protein domains (Kaneko, T., Joshi, R., Feller, S.M. & Li, S.S. Phosphotyrosine recognition domains: the typical, the atypical and the versatile. Cell Commun Signal 10, 32 (2012) and Hirsch, A.K., Fischer, F.R. & Diederich, F. Phosphate recognition in structural biology. Angew Chem Int Ed Engl 46, 338-352 (2007)), providing an example of convergent evolution among multiple protein folds. Furthermore, highly specific recognition of pTyr was obtained despite not burying most of the pTyr phenyl ring (Fig. 3c and Fig. 7d).
[00162] In stark contrast to traditional monoclonal or polyclonal PS Abs, the PS Abs described herein utilize a single framework that permits high-level bacterial expression (> 3mg/L) and mammalian expression (-0.5-5 μg/mL media) in a renewable format. The use of a single framework greatly simplifies mutagenesis protocols {e.g. affinity maturation), sequence-function analysis, and conversion to other antibody formats (e.g. IgG) (Sidhu, S.S. et al. Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions. JMol Biol 338, 299-310 (2004)). Additionally, the recombinant PS antibodies described herein can be genetically fused to a variety of molecules, thus permitting the rapid generation of detection reagents (e.g. Fc fusions) or intracellular probes (e.g.
substance P fusions) (Rizk, S.S. et al. An engineered substance P variant for receptor- mediated delivery of synthetic antibodies into tumor cells. Proc Natl Acad Sci USA 106, 11011-11015 (2009)).
[00163] The ability to rapidly generate recombinant, monoclonal PS antibodies provides several future applications. One emerging application is the use of PTM-specific antibodies to immunoenrich biological samples for subsequent mass spectrometry analysis. For example, several pan-specific pTyr Abs, that recognize pTyr peptides with limited specificity for the neighboring residues, have revolutionized the study of pTyr signaling by permitting efficient enrichment of this low abundant phosphospecies (<0.05%) (Blagoev, B., Ong, S.E., Kratchmarova, I. & Mann, M. Temporal analysis of phosphotyrosine-dependent signaling networks by quantitative proteomics. Nat Biotechnol 22, 1139-1145 (2004) and Nita-Lazar, A., Saito-Benz, H. & White, F.M. Quantitative phosphoproteomics by mass spectrometry: past, present, and future. Proteomics 8, 4433-4443 (2008)). However, all of these antibodies have inherent sequence biases outside of the pTyr motif and thus, numerous pTyr sites are likely missed (Nita-Lazar, A., Saito-Benz, H. & White, F.M. Quantitative phosphoproteomics by mass spectrometry: past, present, and future. Proteomics 8, 4433-4443
(2008) and Matsuoka, S. et al. ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science 316, 1160-1166 (2007)). Ideally, one would perform global identification of pTyr sites using an immunoenrichment reagent capable of isolating ~XpYX~, where X is any amino acid. Alternatively, one could focus on a subset of pTyr sites involved a particular signaling pathway {e.g. ~(D/E)pY(I/L/V)~ for EGFR kinase substrates) using a more tailored Ab reagent. In either case, one could develop a renewable and reproducible mixture of monoclonal PS Abs that enriches a degenerate phosphorylation motif, such as a consensus substrate motif for a kinase.
[00164] The Ab mixtures described herein are advantageous over traditional affinity- purified polyclonal Abs, which are not renewable and vary from batch to batch. For example, a recent study highlights the ability of a well-defined Ab mixture generated from two or three commercially available PS Abs against known ATM and ATR kinase substrates to serve as immunoaffmity reagents to identify >900 phosphorylation sites induced by DNA damage (Matsuoka, S. et al. ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science 316, 1160-1166 (2007)). The scFv clones P3.4 and P3.8 described herein represent the first components of a degenerate pSer-specific antibody pool that cross-reacts with multiple phosphorylated peptides (Fig. 9c). Sequential selections of the libraries against several phosphopeptides that share a common motif beyond the
phosphoresidue can generate additional antibodies with tailored degenerate specificities.
[00165] The use of global-scale phosphoproteomics experiments to first identify potential phosphorylated biomarkers (Wang, Y. et al. Phosphorylated alpha-svnuclein in Parkinson's disease. Sci Transl Med 4, 121ral20 (2012) and Hampel, H. et al. Measurement of phosphorylated tau epitopes in the differential diagnosis of Alzheimer disease: a comparative cerebrospinal fluid study. Arch Gen Psychiatry 61, 95-102 (2004)) followed by rapid in vitro generation of monoclonal, PS Abs is a powerful diagnostic platform and potential therapeutic strategy (Tagliabracci, V.S. et al. Secreted kinase phosphorylates extracellular proteins that regulate biomineralization. Science 336, 1150-1153 (2012)) in the treatment of human disease. Additionally, the bacteriophage-derived PS Ab platform, which can be automated, rapidly generates Abs within two weeks as opposed to the several months required for hybridoma methods. Finally, the motif-specific scaffold method described herein can be generalize to the targeting of virtually any antigen with a defined motif.
[00166] The examples set forth above are provided to give those of ordinary skill in the art a complete disclosure and description of how to make and use the embodiments of the compositions, systems and methods of the disclosure, and are not intended to limit the scope of what the inventors regard as their disclosure. Modifications of the above-described modes for carrying out the disclosure that are obvious to persons of skill in the art are intended to be within the scope of the following claims. All patents and publications mentioned in the specification are indicative of the levels of skill of those skilled in the art to which the disclosure pertains. All references cited in this disclosure are incorporated by reference to the same extent as if each reference had been incorporated by reference in its entirety
individually.
[00167] The examples set forth above are provided to give those of ordinary skill in the art a complete disclosure and description of how to make and use the embodiments of the compositions, systems and methods of the disclosure, and are not intended to limit the scope of what the inventors regard as their disclosure. Modifications of the above-described modes for carrying out the disclosure that are obvious to persons of skill in the art are intended to be within the scope of the following claims. All patents and publications mentioned in the specification are indicative of the levels of skill of those skilled in the art to which the disclosure pertains. All references cited in this disclosure are incorporated by reference to the same extent as if each reference had been incorporated by reference in its entirety
individually.
[00168] All headings and section designations are used for clarity and reference purposes only and are not to be considered limiting in any way. For example, those of skill in the art will appreciate the usefulness of combining various aspects from different headings and sections as appropriate according to the spirit and scope of the invention described herein.
[00169] All references cited herein are hereby incorporated herein by reference herein in their entireties and for all purposes to the same extent as if each individual publication or patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety for all purposes.
[00170] Many modifications and variations of this application can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. The specific embodiments and examples described herein are offered by way of example only, and the
disclosure is to be limited only by the terms of the appended claims, along with the full scope of equivalents to which the claims are entitled.
Listing of Antibody Sequences
>P2.All
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQSNNIPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF
RKFGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRNT
-DAW—FAYWGQGTLVTVSS
>P2.B8
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQYASYPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF
RKFGMSWVRQAPGKGLEWVATISTPRGSYTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGW
-S MAYWGQGTLVTVSS
>P3.29
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRYNNPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVATISTPRGSATYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-KG- AAFDYWGQGTLVTVSS
>P3.24
DIVLTQSPATLSLSPGERATVSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRAAYPITFGQGTKVEIKRGGGGRGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- AGFAYWGQGTLVTVSS
>P3.22
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRYNYPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVATISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-GSRG- AAFDYWGQGTLVTVSS
>P3.18
DIVLTQSPATLSLSPGERATMSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRNGYPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- AAMAYWGQGTLVTVSS
>P3.17
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRSGVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVATISTPRGSYTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-TG- AAFAYWGQGTLVTVSS
>P3.13
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRAGYPVTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVATIAT-GGHTTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-KG- AAFAYWGQGTLVTVSS
>P3.12
DIVLTQSPATLSLSPGERATVSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRSSYPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- AGFAYWGQGTLVTVSS
>P3.11
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRSAYPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- GAFAYWGQGTLVTVSS
>P3.10
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRTGYPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVATISTPRGSSTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-DG- AAFDYWGQGTLVTVSS
>P3.6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRAGFPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVATIAT-GGHTTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G- AGGAAFDYWGQGTLVTVSS
>P3.5
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRSAFPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASISTPRGSDTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- SSFDYWGQGTLVTVSS
>P3.4
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRATYPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-AG- TAFDYWGQGTLVTVSS
>P3.1
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRSAFPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVATISTPRGSTTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRT-A-AG- AAFAYWGQGTLVTVSS
>P3.28
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRNAYPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-NG- AAMAYWGQGTLVTVSS
>P3.19
DIVLTQSPATLSLSPGERATVSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQHYSFPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGAR-RG- EGFDYWGQGTLVTVSS
>P3.8
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGKG
KKMDYWGQGTLVTVSS
>P3.2
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQRSAYPITFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVASIAT-GGHTTNYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRA-G-GG- ASFAYWGQGTLVTVSS
>P4.B9
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQGTNDPVTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVASISTPRGSSTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTS YAMDYWGQGTLVTVSS
>P4.All
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQRNAVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVAGISTPRGSYTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRG-GGAG AGFDYWGQGTLVTVSS
>P5.G5
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQHYDIPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR GKA—
MDYWGQGTLVTVSS
>P5.Hll
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSDSFPVTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS WVRQAPGKGLEWVATIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRWSWDNRSA — MDYWGQGTLVTVSS
>P5.G10
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR
STAAWFDYWGQGTLVTVSS
>P5.C5
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQYDAFPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIATGGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR GGE—
MDYWGQGTLVTVSS
>P6.G11
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQYSDLPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G E—G— FAYWGQGTLVTVSS
>P6.G10
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQDASFPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR ATTTS—T— FAYWGQGTLVTVSS
>P6.G8
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR A E— — MDYWGQGTLVTVSS
>P6.G7
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQYNGIPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S T—G— FDYWGQGTLVTVSS
>P6.G6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G A—S— MDYWGQGTLVTVSS
>P6.G5
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S E—S— MDYWGQGTLVTVSS
>P6.G4
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S GYYA— FDYWGQGTLVTVSS
>P6.F12
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR N A—S— MDYWGQGTLVTVSS
>P6.F11
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR T — —
SSWFDYWGQGTLVTVSS
>P6.F3
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQYAGVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR N S—A— MDYWGQGTLVTVYS
>P6.F2
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQYAGVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR N A—T— MDYWGQGTLVTVSS
>P6.F1
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQGDAIPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR D S—G— MDYWGQGTLVTVSS
>P6.E12
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQHYNVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S Y—G— FDYWGQGTLVTVSS
>P6.Ell
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQYADIPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G G—S— MDYWGQGTLVTVSS
>P6.E8
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSME PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G S— — FDYWGQGTLVTVSS
>P6.E7
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQYTSVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR A D—E— MDYWGQGTLVTVSS
>P6.E6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFGVYYCLQDYGFPVTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR S S— —
KDWFDYWGQGTLVTVSS
>P6.E2
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR K S— — FDYWGQGTLVTVSS
>P6. D6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVAAIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRSYYS G—S— MDYWGQGTLVTVSS
>P6.C12
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSFNVPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR R A— — FDYWGQGTLVTVSS
>P6.C6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQSASIPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMS
WVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTR G E—A— MDYWGQGTLVTVSS
>P10.G12
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQYAGLPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVAGISTPRGSNTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRAGRGEG
-FAYWGQGTLVTVSS
>P10.D6
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQHATVPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRTT-WNN YFAYWGQGTLVTVSS
>P10.BIO
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQHNTFPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVARISTPRGSNTDYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGG-AYN -FAYWGQGTLVTVSS
>P10.H2
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQGSGAPFTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVTSGFTF RKFGMSWVRQAPGKGLEWVAEIAT-GGHTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGG-SMD YWGQGTLVTVSS
>pSAb_HC
EISEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASIAT-GGHTTYYSDSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHT
>pS Ab_HC
EISEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHT
>pYAb_HC
EISEVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASIVG—GRKTYYSDSVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHT
>pSAb_LC
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASWCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>pSTAb_LC
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASWCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>pYAb_LC
DIVLTQSPATLSLSPGERATLSCMTSTDIDDDMNWYQQKPGQAPRLLISEGNTLRPGVPARFSGSGSGTDFTLTIS SLEPEDFAVYYCLQSFNVPLTFGQGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASWCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
ID P8.H9 STANDARD;
PRT; 241 AA
SQ Sequence 241 AA;
DIVLTQSPAT LSLSPGERAT LSCMTSTDID DDMNWYQQKP GQAPRLLISE GNTLRPGVPA 60 RFSGSGSGTD FTLTISSLEP EDFAVYYCLQ STGVPFTFGQ GTKVEIKRGG GGSGGGGSGG 120 GGSEVQLVES GGGLVQPGGS LRLSCVTSGF TFRKFGMSWV RQAPGKGLEW VASIATGGHT 180 TYYSDSVKGR FTISRDNSKN TLYLQMNSLR AEDTAVYYCT RNSSDAWMAY WGQGTLVTVS 240 S 241
Claims
1. A method of identifying antibodies that specifically bind a protein comprising a post translational modification, the method comprising the steps of:
(1) identifying a noncovalent post translational modification-binding motif in a protein;
(2) inspecting known antibody CDRs for an anchoring pocket sequence that adopts the conformation of the noncovalent post translational modification-binding motif;
(3) preparing an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise the anchoring pocket;
(4) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and
(5) identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
2. The method of claim 1, wherein the antibody binds a specific protein comprising the post translational modification.
3. The method of claim 1, wherein the antibody binds a specific post translational modification.
4. The method of claim 3, wherein the post translational modification is an anion.
5. The method of claim 3, wherein the post translational modification is
phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation.
6. The method of claim 1 , wherein the noncovalent post translational modification- binding motif recognizes an anion.
7. The method of claim 1 , wherein the noncovalent post translational modification- binding motif recognizes a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N- terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar.
8. The method of claim 1, further comprising the step of characterizing the anchoring pocket.
9. The method of claim 1, wherein amino acid residues from two or more CDRs comprise the anchoring pocket.
10. A method of identifying antibodies that specifically bind a protein comprising a post translational modification, the method comprising the steps of:
(1) identifying a noncovalent post translational modification-binding motif in a protein;
(2) engineering an antibody scaffold comprising a CDR, wherein amino acid residues from the CDR comprise an anchoring pocket that adopts the conformation of the noncovalent post translational modification-binding motif ;
(3) preparing a library comprising the antibody scaffold, wherein the CDR is randomized outside of the anchoring pocket; and
(4) identifying antibodies in the library that specifically bind to a protein comprising a post translational modification.
11. The method of claim 10, wherein the antibody binds a specific protein comprising the post translational modification.
12. The method of claim 10, wherein the antibody binds a specific post translational modification.
13. The method of claim 12, wherein the post translational modification is an anion.
14. The method of claim 12, wherein the post translational modification is
phosphorylation, sulfation, acetylation, S-nitrosylation, methylation, proteolysis, or glycosylation.
15. The method of claim 10, wherein the noncovalent post translational modification- binding motif recognizes an anion.
16. The method of claim 10, wherein the noncovalent post translational modification- binding motif recognizes a phosphate, a sulfate, an acetyl, a methyl, a nitric oxide, a N- terminal alpha amine, a C-terminal carboxylate, a GalNAc sugar or a GlcNAc sugar.
17. The method of claim 10, further comprising the step of characterizing the anchoring pocket.
18. The method of claim 10, wherein amino acid residues from two or more CDRs comprise the anchoring pocket.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/776,122 US20160003843A1 (en) | 2013-03-15 | 2014-03-14 | Engineered antibody scaffolds |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361788343P | 2013-03-15 | 2013-03-15 | |
US61/788,343 | 2013-03-15 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2014152660A1 true WO2014152660A1 (en) | 2014-09-25 |
Family
ID=51581274
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2014/027588 WO2014152660A1 (en) | 2013-03-15 | 2014-03-14 | Engineered antibody scaffolds |
Country Status (2)
Country | Link |
---|---|
US (1) | US20160003843A1 (en) |
WO (1) | WO2014152660A1 (en) |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3198065A4 (en) * | 2014-09-25 | 2018-02-28 | Idea Orchard, LLC | Antibody like protein |
EP3447075A2 (en) | 2015-05-15 | 2019-02-27 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor superfamily antibodies |
WO2019025866A3 (en) * | 2017-08-04 | 2019-06-27 | Abcam Plc | Methods and compositions for the development of antibodies specific to epitope post-translational modification status |
WO2022008905A1 (en) * | 2020-07-07 | 2022-01-13 | Abcam Plc | Method of validating the selectivity of antibodies for post translational modifications |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2019521955A (en) * | 2016-04-25 | 2019-08-08 | イデア オーチャード, リミテッド ライアビリティ カンパニー | Engineered FHA domain |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050079574A1 (en) * | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
US20120244594A9 (en) * | 1998-09-04 | 2012-09-27 | Cell Signaling Technology, Inc. | Immunoaffinity isolation of modified peptides from complex mixtures |
-
2014
- 2014-03-14 WO PCT/US2014/027588 patent/WO2014152660A1/en active Application Filing
- 2014-03-14 US US14/776,122 patent/US20160003843A1/en not_active Abandoned
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20120244594A9 (en) * | 1998-09-04 | 2012-09-27 | Cell Signaling Technology, Inc. | Immunoaffinity isolation of modified peptides from complex mixtures |
US20050079574A1 (en) * | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
Non-Patent Citations (1)
Title |
---|
KOERBER ET AL.: "Nature -inspired design of motif-specific antibody scaffolds.", NAT BIOTECHNOL, vol. 31, no. 10, October 2013 (2013-10-01), pages 916 - 21 * |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10370776B2 (en) | 2013-09-25 | 2019-08-06 | Idea Orchard, Llc | Antibody like protein |
EP3198065A4 (en) * | 2014-09-25 | 2018-02-28 | Idea Orchard, LLC | Antibody like protein |
EP3447075A2 (en) | 2015-05-15 | 2019-02-27 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor superfamily antibodies |
EP4292664A2 (en) | 2015-05-15 | 2023-12-20 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor superfamily antibodies |
WO2019025866A3 (en) * | 2017-08-04 | 2019-06-27 | Abcam Plc | Methods and compositions for the development of antibodies specific to epitope post-translational modification status |
CN111201239A (en) * | 2017-08-04 | 2020-05-26 | 艾博抗公开有限公司 | Methods and compositions for developing antibodies specific for epitope post-translational modification states |
WO2022008905A1 (en) * | 2020-07-07 | 2022-01-13 | Abcam Plc | Method of validating the selectivity of antibodies for post translational modifications |
Also Published As
Publication number | Publication date |
---|---|
US20160003843A1 (en) | 2016-01-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Koerber et al. | Nature-inspired design of motif-specific antibody scaffolds | |
Koide et al. | Exploring the capacity of minimalist protein interfaces: interface energetics and affinity maturation to picomolar KD of a single-domain antibody with a flat paratope | |
JP6092773B2 (en) | Fibronectin cradle molecule and its library | |
Zahnd et al. | A designed ankyrin repeat protein evolved to picomolar affinity to Her2 | |
Koide et al. | Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold | |
US11447891B2 (en) | Compositions and methods for rapid production of versatile nanobody repertoires | |
US20160003843A1 (en) | Engineered antibody scaffolds | |
US20090124023A1 (en) | Reagens for the Detection of Protein Acetylation Signaling Pathways | |
Oyen et al. | Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihydrofolate reductase of Escherichia coli | |
US9261511B2 (en) | Allergen-binding IgE monoclonal antibodies and method for preparing hypoallergens | |
Macpherson et al. | The allosteric modulation of complement C5 by knob domain peptides | |
CN107383199B (en) | Monoclonal antibody of S-adenosylmethionine synthetase and application thereof | |
Nakasako et al. | The pH-dependent structural variation of complementarity-determining region H3 in the crystal structures of the Fv fragment from an anti-dansyl monoclonal antibody | |
AU2018310860A1 (en) | Methods and compositions for the development of antibodies specific to epitope post-translational modification status | |
Kelil et al. | CellectSeq: In Silico Discovery of Antibodies Targeting Integral Membrane Proteins Combining In Situ Selections of Phage Displayed Synthetic Antibodies and Next-Generation Sequencing | |
CN117836308A (en) | Means and methods for selecting specific binding agents | |
Green | Structural characterization of membrane proteins and antibody-antigen complexes using single particle electron microscopy | |
Lerma Romero | Modulation of the FKBP51 structure by protein engineering and isolation of conformation-locking antibodies and affibodies | |
WO2024091897A2 (en) | De novo designed modular peptide binding proteins by superhelical matching | |
Le Bihan et al. | de Novo Sequencing of Antibodies for Identification of Neutralizing Antibodies in Human Plasma Post SARS-CoV-2 Vaccination | |
Medina-Cucurella | Engineering Deep Sequencing-Guided Platforms to Evaluate Sequence-Function Relationships between Proteins for the Development of Therapeutic Antibodies | |
Stewart et al. | Side chain requirements for affinity and specificity in D5, an HIV-1 antibody derived from the VH 1-69 germline segment | |
WO2022268993A1 (en) | Means and methods for selection of specific binders | |
Beton | In vitro characterisation of ERAP1 mechanism and antigen processing | |
Venegas | Generating and Characterizing Phosphospecific Affinity Reagents Using the Forkhead-Associated 1 Domain |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14767594 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 14776122 Country of ref document: US |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 14767594 Country of ref document: EP Kind code of ref document: A1 |