WO2014152195A1 - Il-33 antagonists and uses thereof - Google Patents
Il-33 antagonists and uses thereof Download PDFInfo
- Publication number
- WO2014152195A1 WO2014152195A1 PCT/US2014/027058 US2014027058W WO2014152195A1 WO 2014152195 A1 WO2014152195 A1 WO 2014152195A1 US 2014027058 W US2014027058 W US 2014027058W WO 2014152195 A1 WO2014152195 A1 WO 2014152195A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antagonist
- measured
- attached
- surface plasmon
- plasmon resonance
- Prior art date
Links
- 239000005557 antagonist Substances 0.000 title claims abstract description 233
- 102000017761 Interleukin-33 Human genes 0.000 claims abstract description 360
- 108010067003 Interleukin-33 Proteins 0.000 claims abstract description 360
- 230000027455 binding Effects 0.000 claims abstract description 118
- 101000852968 Homo sapiens Interleukin-1 receptor-like 1 Proteins 0.000 claims abstract description 65
- 208000027866 inflammatory disease Diseases 0.000 claims abstract description 60
- 101000585365 Homo sapiens Sulfotransferase 2A1 Proteins 0.000 claims abstract description 46
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 43
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 43
- 238000000034 method Methods 0.000 claims abstract description 37
- 238000011282 treatment Methods 0.000 claims abstract description 10
- 208000026935 allergic disease Diseases 0.000 claims abstract description 8
- 238000003556 assay Methods 0.000 claims description 58
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 claims description 54
- 101000998137 Homo sapiens Interleukin-33 Proteins 0.000 claims description 38
- 238000010494 dissociation reaction Methods 0.000 claims description 33
- 230000005593 dissociations Effects 0.000 claims description 33
- 102000045906 human IL33 Human genes 0.000 claims description 33
- 239000008194 pharmaceutical composition Substances 0.000 claims description 27
- 102000000589 Interleukin-1 Human genes 0.000 claims description 26
- 108010002352 Interleukin-1 Proteins 0.000 claims description 26
- 101000998136 Mus musculus Interleukin-33 Proteins 0.000 claims description 26
- 102000005962 receptors Human genes 0.000 claims description 22
- 108020003175 receptors Proteins 0.000 claims description 22
- 208000006673 asthma Diseases 0.000 claims description 21
- 241000282693 Cercopithecidae Species 0.000 claims description 17
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 claims description 15
- 239000000203 mixture Substances 0.000 claims description 13
- 239000013566 allergen Substances 0.000 claims description 11
- 206010012438 Dermatitis atopic Diseases 0.000 claims description 9
- 206010020751 Hypersensitivity Diseases 0.000 claims description 9
- 201000008937 atopic dermatitis Diseases 0.000 claims description 9
- 201000004681 Psoriasis Diseases 0.000 claims description 8
- 206010003246 arthritis Diseases 0.000 claims description 8
- 239000003814 drug Substances 0.000 claims description 8
- 230000003993 interaction Effects 0.000 claims description 8
- 206010064212 Eosinophilic oesophagitis Diseases 0.000 claims description 7
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims description 7
- 206010039085 Rhinitis allergic Diseases 0.000 claims description 7
- 201000010105 allergic rhinitis Diseases 0.000 claims description 7
- 230000036783 anaphylactic response Effects 0.000 claims description 7
- 201000000708 eosinophilic esophagitis Diseases 0.000 claims description 7
- 238000000338 in vitro Methods 0.000 claims description 7
- 201000006417 multiple sclerosis Diseases 0.000 claims description 7
- 230000002829 reductive effect Effects 0.000 claims description 7
- 150000003431 steroids Chemical class 0.000 claims description 7
- 102100031294 Thymic stromal lymphopoietin Human genes 0.000 claims description 6
- 230000035945 sensitivity Effects 0.000 claims description 6
- 208000024891 symptom Diseases 0.000 claims description 6
- 229940124597 therapeutic agent Drugs 0.000 claims description 6
- 108010029307 thymic stromal lymphopoietin Proteins 0.000 claims description 6
- 206010002198 Anaphylactic reaction Diseases 0.000 claims description 5
- 108090000176 Interleukin-13 Proteins 0.000 claims description 5
- 108090000978 Interleukin-4 Proteins 0.000 claims description 5
- 230000007815 allergy Effects 0.000 claims description 5
- 208000003455 anaphylaxis Diseases 0.000 claims description 5
- UCTWMZQNUQWSLP-VIFPVBQESA-N (R)-adrenaline Chemical compound CNC[C@H](O)C1=CC=C(O)C(O)=C1 UCTWMZQNUQWSLP-VIFPVBQESA-N 0.000 claims description 4
- 229940123932 Phosphodiesterase 4 inhibitor Drugs 0.000 claims description 4
- 208000030961 allergic reaction Diseases 0.000 claims description 4
- 238000000670 ligand binding assay Methods 0.000 claims description 4
- 239000002587 phosphodiesterase IV inhibitor Substances 0.000 claims description 4
- 238000001525 receptor binding assay Methods 0.000 claims description 4
- 229930182837 (R)-adrenaline Natural products 0.000 claims description 3
- 102000013691 Interleukin-17 Human genes 0.000 claims description 3
- 108050003558 Interleukin-17 Proteins 0.000 claims description 3
- 108010002616 Interleukin-5 Proteins 0.000 claims description 3
- GUGOEEXESWIERI-UHFFFAOYSA-N Terfenadine Chemical compound C1=CC(C(C)(C)C)=CC=C1C(O)CCCN1CCC(C(O)(C=2C=CC=CC=2)C=2C=CC=CC=2)CC1 GUGOEEXESWIERI-UHFFFAOYSA-N 0.000 claims description 3
- 230000001387 anti-histamine Effects 0.000 claims description 3
- 239000000739 antihistaminic agent Substances 0.000 claims description 3
- 235000019504 cigarettes Nutrition 0.000 claims description 3
- 239000003246 corticosteroid Substances 0.000 claims description 3
- 239000000850 decongestant Substances 0.000 claims description 3
- 230000009977 dual effect Effects 0.000 claims description 3
- 230000002327 eosinophilic effect Effects 0.000 claims description 3
- 229960005139 epinephrine Drugs 0.000 claims description 3
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 claims description 3
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 claims description 3
- 239000000779 smoke Substances 0.000 claims description 3
- 208000033399 Anaphylactic responses Diseases 0.000 claims description 2
- 108090001005 Interleukin-6 Proteins 0.000 claims description 2
- 230000003110 anti-inflammatory effect Effects 0.000 claims description 2
- 239000003085 diluting agent Substances 0.000 claims description 2
- 230000003292 diminished effect Effects 0.000 claims description 2
- 230000003467 diminishing effect Effects 0.000 claims description 2
- 239000003937 drug carrier Substances 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 claims description 2
- 230000003637 steroidlike Effects 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 8
- 230000011664 signaling Effects 0.000 abstract description 8
- 201000010099 disease Diseases 0.000 abstract description 7
- 230000014509 gene expression Effects 0.000 abstract description 7
- 230000003176 fibrotic effect Effects 0.000 abstract description 3
- 208000035473 Communicable disease Diseases 0.000 abstract description 2
- 208000037765 diseases and disorders Diseases 0.000 abstract description 2
- 230000001413 cellular effect Effects 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 40
- 102100036706 Interleukin-1 receptor-like 1 Human genes 0.000 description 37
- 241000282414 Homo sapiens Species 0.000 description 34
- 150000001413 amino acids Chemical group 0.000 description 32
- 210000004027 cell Anatomy 0.000 description 25
- 230000004913 activation Effects 0.000 description 23
- 102000055002 human IL1RL1 Human genes 0.000 description 19
- 210000003651 basophil Anatomy 0.000 description 18
- 108090000765 processed proteins & peptides Proteins 0.000 description 17
- 230000000903 blocking effect Effects 0.000 description 16
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 16
- 241000699670 Mus sp. Species 0.000 description 14
- 241000699666 Mus <mouse, genus> Species 0.000 description 13
- 206010016654 Fibrosis Diseases 0.000 description 12
- 102000004196 processed proteins & peptides Human genes 0.000 description 12
- 229920001184 polypeptide Polymers 0.000 description 11
- 230000004761 fibrosis Effects 0.000 description 10
- 235000001014 amino acid Nutrition 0.000 description 9
- 239000007924 injection Substances 0.000 description 9
- 238000002347 injection Methods 0.000 description 9
- 101100454807 Caenorhabditis elegans lgg-1 gene Proteins 0.000 description 8
- 238000002820 assay format Methods 0.000 description 8
- 238000012552 review Methods 0.000 description 8
- 210000003414 extremity Anatomy 0.000 description 7
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 101000960952 Homo sapiens Interleukin-1 receptor accessory protein Proteins 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 102000046828 human IL1RAP Human genes 0.000 description 6
- 238000007920 subcutaneous administration Methods 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 5
- 239000005089 Luciferase Substances 0.000 description 5
- 101100018717 Mus musculus Il1rl1 gene Proteins 0.000 description 5
- 230000037396 body weight Effects 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 238000013270 controlled release Methods 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- 101000960950 Mus musculus Interleukin-1 receptor accessory protein Proteins 0.000 description 4
- 102000010168 Myeloid Differentiation Factor 88 Human genes 0.000 description 4
- 108010077432 Myeloid Differentiation Factor 88 Proteins 0.000 description 4
- 238000002835 absorbance Methods 0.000 description 4
- 238000004166 bioassay Methods 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 208000019425 cirrhosis of liver Diseases 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 230000002757 inflammatory effect Effects 0.000 description 4
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 238000013207 serial dilution Methods 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 208000006820 Arthralgia Diseases 0.000 description 3
- 101100395863 Caenorhabditis elegans hst-2 gene Proteins 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- 108060003951 Immunoglobulin Proteins 0.000 description 3
- 108060001084 Luciferase Proteins 0.000 description 3
- 102000005717 Myeloma Proteins Human genes 0.000 description 3
- 108010045503 Myeloma Proteins Proteins 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 239000012980 RPMI-1640 medium Substances 0.000 description 3
- 108010090804 Streptavidin Proteins 0.000 description 3
- 102000003714 TNF receptor-associated factor 6 Human genes 0.000 description 3
- 108090000009 TNF receptor-associated factor 6 Proteins 0.000 description 3
- 108091008324 binding proteins Proteins 0.000 description 3
- -1 ethanol) Chemical compound 0.000 description 3
- 102000018358 immunoglobulin Human genes 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 238000012423 maintenance Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 208000005069 pulmonary fibrosis Diseases 0.000 description 3
- 102220117530 rs112626848 Human genes 0.000 description 3
- 102220238658 rs1468529365 Human genes 0.000 description 3
- 102220268018 rs201210997 Human genes 0.000 description 3
- 239000012146 running buffer Substances 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 238000011269 treatment regimen Methods 0.000 description 3
- 239000001741 Ammonium adipate Substances 0.000 description 2
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 2
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 2
- 101000897042 Homo sapiens Nucleotide pyrophosphatase Proteins 0.000 description 2
- 102100037850 Interferon gamma Human genes 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 102000019223 Interleukin-1 receptor Human genes 0.000 description 2
- 108050006617 Interleukin-1 receptor Proteins 0.000 description 2
- 108010002386 Interleukin-3 Proteins 0.000 description 2
- 241000282567 Macaca fascicularis Species 0.000 description 2
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 2
- 102100021969 Nucleotide pyrophosphatase Human genes 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 102000002689 Toll-like receptor Human genes 0.000 description 2
- 108020000411 Toll-like receptor Proteins 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000008485 antagonism Effects 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 239000012736 aqueous medium Substances 0.000 description 2
- 229940090047 auto-injector Drugs 0.000 description 2
- SESFRYSPDFLNCH-UHFFFAOYSA-N benzyl benzoate Chemical compound C=1C=CC=CC=1C(=O)OCC1=CC=CC=C1 SESFRYSPDFLNCH-UHFFFAOYSA-N 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 238000000423 cell based assay Methods 0.000 description 2
- 230000007882 cirrhosis Effects 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 238000000432 density-gradient centrifugation Methods 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 238000007876 drug discovery Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000012997 ficoll-paque Substances 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 208000014674 injury Diseases 0.000 description 2
- 230000016507 interphase Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 210000003097 mucus Anatomy 0.000 description 2
- 208000008338 non-alcoholic fatty liver disease Diseases 0.000 description 2
- 206010053219 non-alcoholic steatohepatitis Diseases 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- ORMNNUPLFAPCFD-DVLYDCSHSA-M phenethicillin potassium Chemical compound [K+].N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C([O-])=O)=O)C(=O)C(C)OC1=CC=CC=C1 ORMNNUPLFAPCFD-DVLYDCSHSA-M 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 102200148758 rs116840795 Human genes 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000001960 triggered effect Effects 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 240000000850 Astartea fascicularis Species 0.000 description 1
- 208000037874 Asthma exacerbation Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 201000001178 Bacterial Pneumonia Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010051728 Bone erosion Diseases 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 206010014950 Eosinophilia Diseases 0.000 description 1
- 208000007465 Giant cell arteritis Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 108010051539 HLA-DR2 Antigen Proteins 0.000 description 1
- 201000004331 Henoch-Schoenlein purpura Diseases 0.000 description 1
- 206010019617 Henoch-Schonlein purpura Diseases 0.000 description 1
- 206010019668 Hepatic fibrosis Diseases 0.000 description 1
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 1
- 208000031814 IgA Vasculitis Diseases 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102100030704 Interleukin-21 Human genes 0.000 description 1
- 102220506361 Interleukin-21_R69K_mutation Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 206010023203 Joint destruction Diseases 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010024641 Listeriosis Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 208000031998 Mycobacterium Infections Diseases 0.000 description 1
- 206010029888 Obliterative bronchiolitis Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 206010035737 Pneumonia viral Diseases 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 206010051739 Pulmonary sepsis Diseases 0.000 description 1
- 208000032056 Radiation Fibrosis Syndrome Diseases 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 206010038687 Respiratory distress Diseases 0.000 description 1
- 206010061603 Respiratory syncytial virus infection Diseases 0.000 description 1
- 108091027981 Response element Proteins 0.000 description 1
- 241000242678 Schistosoma Species 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 201000010001 Silicosis Diseases 0.000 description 1
- 206010050207 Skin fibrosis Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 206010057179 Toxoplasma infections Diseases 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 206010069351 acute lung injury Diseases 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 201000009961 allergic asthma Diseases 0.000 description 1
- 230000001668 ameliorated effect Effects 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 229940121357 antivirals Drugs 0.000 description 1
- 239000010425 asbestos Substances 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 239000012752 auxiliary agent Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 229960002903 benzyl benzoate Drugs 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 201000003848 bronchiolitis obliterans Diseases 0.000 description 1
- 208000023367 bronchiolitis obliterans with obstructive pulmonary disease Diseases 0.000 description 1
- 102220349284 c.287A>T Human genes 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 230000009787 cardiac fibrosis Effects 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 239000002458 cell surface marker Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 208000015114 central nervous system disease Diseases 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 208000023819 chronic asthma Diseases 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000013024 dilution buffer Substances 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 1
- 229940015979 epipen Drugs 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 229940062714 humalog mix Drugs 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 208000015446 immunoglobulin a vasculitis Diseases 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000011221 initial treatment Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 210000004347 intestinal mucosa Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 201000010659 intrinsic asthma Diseases 0.000 description 1
- 239000000644 isotonic solution Substances 0.000 description 1
- 235000015110 jellies Nutrition 0.000 description 1
- 210000001503 joint Anatomy 0.000 description 1
- 208000018937 joint inflammation Diseases 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 210000000629 knee joint Anatomy 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 150000002617 leukotrienes Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 238000010208 microarray analysis Methods 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 210000002200 mouth mucosa Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 208000027531 mycobacterial infectious disease Diseases 0.000 description 1
- 206010028537 myelofibrosis Diseases 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000020477 pH reduction Effects 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 229940090048 pen injector Drugs 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 1
- 208000030925 respiratory syncytial virus infectious disease Diseases 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 229910052895 riebeckite Inorganic materials 0.000 description 1
- 239000012487 rinsing solution Substances 0.000 description 1
- 102220210869 rs1057524586 Human genes 0.000 description 1
- 102220220520 rs1060503090 Human genes 0.000 description 1
- 102220206698 rs142514490 Human genes 0.000 description 1
- 102220325921 rs1555376589 Human genes 0.000 description 1
- 102220142694 rs192332456 Human genes 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 201000004595 synovitis Diseases 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 206010043207 temporal arteritis Diseases 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- 208000009920 trichuriasis Diseases 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 208000009421 viral pneumonia Diseases 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/02—Nasal agents, e.g. decongestants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/735—Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
Definitions
- the present invention relates to antigen-binding molecules which are capable of antagonizing IL-33, and methods of use thereof.
- lnterleukin-33 (IL-33) is a ligand for ST2, a toll-like/interleukin-1 receptor super-family member that associates with an accessory protein, IL-1 RAcP (for reviews, see, e.g., Kakkar and Lee, Nature Reviews - Drug Discovery 7(1 Oj:827-840 (2008), Schmitz et al., Immunity 23:479- 490 (2005); Liew et al., Nature Reviews - Immunology 10: 103-1 10 (2010); US 2010/0260770; US 2009/0041718).
- IL-33 Upon activation of ST2/IL-1 RAcP by IL-33, a signaling cascade is triggered through downstream molecules such as MyD88 (myeloid differentiation factor 88) and TRAF6 (TNF receptor associated factor 6), leading to activation of N FKB (nuclear factor- ⁇ ), among others.
- MyD88 myeloid differentiation factor 88
- TRAF6 TRAF6
- N FKB nuclear factor- ⁇
- the present invention provides interleukin-33 (IL-33) antagonists.
- the invention provides an IL-33 antagonist comprising a first IL-33 binding domain (D1 ) and a multimerizing domain (M).
- the IL-33 antagonist comprises a first IL-33 binding domain (D1 ) attached to a multimerizing domain (M), wherein D1 comprises an IL-33-binding portion of an ST2 protein.
- the IL-33 antagonist further comprises one or more additional IL-33 binding domains (e.g., D2, D3, D4, etc.).
- the IL-33 binding domain (D1 , D2, D3, D4, etc.) comprises an IL-33-binding portion of an ST2 protein, an extracellular domain of an IL-1 RAcP protein, or other IL-33 binding domain.
- the IL-33 antagonist further comprises a second IL-33 binding domain (D2) attached to D1 and/or M, wherein D2 comprises an extracellular portion of an IL- 1 RAcP protein.
- D1 is attached to the N-terminus of M.
- D1 is attached to the C-terminus of M.
- D2 is attached to the N-terminus of M.
- D2 is attached to the C-terminus of M.
- D1 is attached to the N-terminus of D2, and D2 is attached to the N-terminus of M.
- the multimerizing domain (M) may be a peptide or polypeptide having a N-terminus and a C-terminus.
- the IL-33 binding domain components may be attached to either the N- terminus or the C-terminus of M.
- the D1 , D2 and M components are attached in tandem, such that D1 is attached to the N-terminus of D2, and D2 is attached to the N-terminus of M. Numerous arrangements and configurations of the D1 , D2, and M components are contemplated within the scope of the present invention, examples of which are described herein.
- the IL-33 antagonist binds human interleukin 33 (IL-33) with a binding dissociation equilibrium constant (K D ) of less than about 80 pM as measured in a surface plasmon resonance assay at 25°C, and/or a binding dissociation equilibrium constant (K D ) of less than about 400 pM as measured in a surface plasmon resonance assay at 37°C.
- K D binding dissociation equilibrium constant
- the IL-33 antagonist binds human interleukin 33 (IL-33) with a binding dissociation equilibrium constant (K D ) of less than about 60 pM as measured in a surface plasmon resonance assay at 25°C, and/or a binding dissociation equilibrium constant (K D ) of less than about 1.0 pM as measured in a surface plasmon resonance assay at 37°C.
- K D binding dissociation equilibrium constant
- the IL-33 antagonist binds monkey interleukin 33 (IL-33) with a binding dissociation equilibrium constant (K D ) of less than about 60 pM as measured in a surface plasmon resonance assay at 25°C, and/or a binding dissociation equilibrium constant (K D ) of less than about 200 pM as measured in a surface plasmon resonance assay at 37°C.
- K D binding dissociation equilibrium constant
- the IL-33 antagonist binds monkey interleukin 33 (IL-33) with a binding dissociation equilibrium constant (K D ) of less than about 1.0 pM as measured in a surface plasmon resonance assay at 25°C, and/or a binding dissociation equilibrium constant (K D ) of less than about 1.0 pM as measured in a surface plasmon resonance assay at 37°C.
- K D binding dissociation equilibrium constant
- the IL-33 antagonist binds mouse interleukin 33 (IL-33) with a binding dissociation equilibrium constant (K D ) of less than about 1 10 pM as measured in a surface plasmon resonance assay at 25°C, and/or a binding dissociation equilibrium constant (K D ) of less than about 100 pM as measured in a surface plasmon resonance assay at 37°C.
- K D binding dissociation equilibrium constant
- the IL-33 antagonist binds mouse interleukin 33 (IL-33) with a binding dissociation equilibrium constant (K D ) of less than about 10 pM as measured in a surface plasmon resonance assay at 25°C, and/or a binding dissociation equilibrium constant (K D ) of less than about 5 pM as measured in a surface plasmon resonance assay at 37°C.
- K D binding dissociation equilibrium constant
- the IL-33 antagonist binds human interleukin 33 (IL-33) with a dissociative half-life (t1 ⁇ 2) of greater than or equal to about 9 minutes as measured in a surface plasmon resonance assay at 25°C, and/or a dissociative half-life (t1 ⁇ 2) of greater than or equal to about 4 minutes as measured in a surface plasmon resonance assay at 37°C.
- IL-33 human interleukin 33
- the IL-33 antagonist binds human interleukin 33 (IL-33) with a dissociative half-life (t1 ⁇ 2) of greater than or equal to about 30 minutes as measured in a surface plasmon resonance assay at 25°C, and/or a dissociative half-life (t1 ⁇ 2) of greater than or equal to about 1000 minutes as measured in a surface plasmon resonance assay at 37°C.
- IL-33 human interleukin 33
- the IL-33 antagonist binds monkey interleukin 33 (IL-33) with a dissociative half-life (t1 ⁇ 2) of greater than about 40 minutes as measured in a surface plasmon resonance assay at 25°C, and/or a dissociative half-life (t1 ⁇ 2) of greater than or equal to about 10 minutes as measured in a surface plasmon resonance assay at 37°C.
- IL-33 monkey interleukin 33
- the IL-33 antagonist binds monkey interleukin 33 (IL-33) with a dissociative half-life (t1 ⁇ 2) of greater than about 1000 minutes as measured in a surface plasmon resonance assay at 25°C, and/or a dissociative half-life (t1 ⁇ 2) of greater than or equal to about
- the IL-33 antagonist binds mouse interleukin 33 (IL-33) with a dissociative half-life (t1 ⁇ 2) of greater than about 25 minutes as measured in a surface plasmon resonance assay at 25°C, and/or a dissociative half-life (t1 ⁇ 2) of greater than about 30 minutes as measured in a surface plasmon resonance assay at 37°C.
- IL-33 mouse interleukin 33
- t1 ⁇ 2 ⁇ 2 dissociative half-life of greater than about 25 minutes as measured in a surface plasmon resonance assay at 25°C
- t1 ⁇ 2 dissociative half-life of greater than about 30 minutes as measured in a surface plasmon resonance assay at 37°C.
- the IL-33 antagonist binds mouse interleukin 33 (IL-33) with a dissociative half-life (t1 ⁇ 2) of greater than about 500 minutes as measured in a surface plasmon resonance assay at 25°C, and/or a dissociative half-life (t1 ⁇ 2) of greater than about 1000 minutes as measured in a surface plasmon resonance assay at 37°C.
- IL-33 mouse interleukin 33
- t1 ⁇ 2 dissociative half-life of greater than about 500 minutes as measured in a surface plasmon resonance assay at 25°C
- t1 ⁇ 2 dissociative half-life of greater than about 1000 minutes as measured in a surface plasmon resonance assay at 37°C.
- the IL-33 antagonist blocks the interaction of IL-33 and ST2.
- the IL-33 antagonist blocks the interaction of IL-33 and ST2 with an IC 50 value of less than about 1 15 pM as measured in an in vitro receptor/ligand binding assay at 25°C.
- the IL-33 antagonist blocks the interaction of IL-33 and ST2 with an IC 50 value of less than about 20 pM as measured in an in vitro receptor/ligand binding assay at 25°C.
- D1 comprises the amino acid sequence of SEQ ID NO: 5 or 6, or an amino acid sequence having at least 90% identity thereto.
- D2 comprises the amino acid sequence of SEQ ID NO: 7 or 8, or an amino acid sequence having at least 90% identity thereto.
- the multimerizing component comprises the amino acid sequence of SEQ ID NO: 9 or 10, or an amino acid sequence having at least 90% identity thereto.
- the IL-33 antagonist comprises a first IL-33 binding domain (D1 ) attached to a first multimerizing domain (M1 ), and a second IL-33 binding domain (D2) attached to a second multimerizing domain (M2), wherein the D1 and/or D2 domains comprise an IL-33- binding portion of a receptor selected from the group consisting of ST2 and IL-1 RAcP.
- the IL-33 antagonist comprises a third IL-33 binding domain (D3), which is attached to either D1 or M1 , and wherein D3 comprises an IL-33-binding portion of a receptor selected from the group consisting of ST2 and IL-1 RAcP.
- D3 comprises an IL-33-binding portion of a receptor selected from the group consisting of ST2 and IL-1 RAcP.
- the IL-33 antagonist comprises a fourth IL-33 binding domain (D4), which is attached to either D2 or M2, and wherein D4 comprises an IL-33-binding portion of a receptor selected from the group consisting of ST2 and IL-1 RAcP.
- D4 comprises an IL-33-binding portion of a receptor selected from the group consisting of ST2 and IL-1 RAcP.
- D1 is attached to the N-terminus of M1
- D2 is attached to the N-terminus of M2.
- D3 is attached to the N-terminus of D1.
- D3 is attached to the C-terminus of M1 .
- D4 is attached to the N-terminus of D2.
- D4 is attached to the C-terminus of M2.
- D3 is attached to the N-terminus of D1
- D1 is attached to the N- terminus of M1
- D4 is attached to the N-terminus of D2
- D2 is attached to the N-terminus of M2.
- D3 is identical or substantially identical to D4 and D1 is identical or substantially identical to D2.
- D3 and D4 each comprise an IL-33-binding portion of an ST2 protein; and D1 and D2 each comprise an extracellular portion of an IL-1 RAcP protein.
- the IL-33 antagonist comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 , 2, 3, 4 and 13.
- a second aspect of the invention provides methods of using the IL-33 antagonists described herein for treating an inflammatory disease or disorder, or at least one symptom associated with the inflammatory disease or disorder, the method comprising administering one or more IL-33 antagonists of the invention, or a pharmaceutical composition containing one or more IL-33 antagonists of the invention, to a patient in need thereof, wherein the inflammatory disease or disorder is alleviated, or reduced in severity, duration or frequency of occurrence, or at least one symptom associated with the inflammatory disease or disorder is alleviated, or reduced in severity, duration, or frequency of occurrence.
- the inflammatory disease or disorder that may be treated with any one or more IL-33 antagonists of the invention may be selected from the group consisting of asthma, atopic dermatitis, chronic obstructive pulmonary disease (COPD), inflammatory bowel disease, multiple sclerosis, arthritis, allergic rhinitis, eosinophilic esophagitis and psoriasis.
- COPD chronic obstructive pulmonary disease
- the inflammatory disease or disorder that may be treated with any one or more IL-33 antagonists of the invention is asthma.
- the asthma may be eosinophilic or non-eosinophilic asthma.
- the asthma may be steroid resistant or steroid sensitive asthma.
- the inflammatory disease or disorder that may be treated with any one or more IL-33 antagonists of the invention is atopic dermatitis.
- the inflammatory disease or disorder that may be treated with any one or more IL-33 antagonists of the invention is chronic obstructive pulmonary disease
- the chronic obstructive pulmonary disease may result from, or may be caused in part by cigarette smoke.
- the invention provides a method for treating a patient who demonstrates a sensitivity to an allergen, the method comprising administering an effective amount of one or more of the IL-33 antagonists of the invention, or a pharmaceutical composition comprising one or more of the IL-33 antagonists of the invention, to a patient in need thereof, wherein the patient demonstrates a reduced sensitivity to, or a diminished allergic reaction against the allergen, or does not experience any sensitivity or allergic reaction to, or anaphylactic response to the allergen following administration of the antibody or a composition comprising the antibody.
- the invention provides a pharmaceutical composition comprising one or more of the IL-33 antagonists of the invention for use in treating an inflammatory disease or disorder, wherein the inflammatory disease or disorder is selected from the group consisting of asthma, allergy, anaphylaxis, atopic dermatitis, chronic obstructive pulmonary disease (COPD), inflammatory bowel disease, multiple sclerosis, arthritis, allergic rhinitis, eosinophilic esophagitis and psoriasis.
- COPD chronic obstructive pulmonary disease
- the invention provides a pharmaceutical composition comprising one or more of the IL-33 antagonists of the invention in the manufacture of a medicament for the treatment of an inflammatory disease or disorder, wherein the inflammatory disease or disorder is selected from the group consisting of asthma, allergy, anaphylaxis, atopic dermatitis, chronic obstructive pulmonary disease (COPD), inflammatory bowel disease, multiple sclerosis, arthritis, allergic rhinitis, eosinophilic esophagitis and psoriasis.
- COPD chronic obstructive pulmonary disease
- the invention provides a method of treating an inflammatory disease or disorder by administering one or more of the IL-33 antagonists of the invention in combination with an effective amount of a second therapeutic agent useful for alleviating the inflammatory disease or disorder, or at least one symptom of the inflammatory disease or disorder, or for diminishing an allergic response to an allergen.
- the second therapeutic agent may be selected from the group consisting of a non-steroidal anti-inflammatory (NSAID), a corticosteroid, a bronchial dilator, an antihistamine, epinephrine, a decongestant, a thymic stromal lymphopoietin (TSLP) antagonist, an IL-13 antagonist, an IL-4 antagonist, an I L-4/I L- 13 dual antagonist, an IL-5 antagonist, an IL- 6 antagonist, an IL-12/23 antagonist, an IL-22 antagonist, an IL-25 antagonist, an IL-17 antagonist, an IL-31 antagonist, a PDE4 inhibitor and another IL-33 antagonist or a different antibody to IL-33.
- NSAID non-steroidal anti-inflammatory
- corticosteroid epinephrine
- a decongestant epinephrine
- TSLP thymic stromal lymphopoietin
- TSLP thymic
- a third aspect of the invention provides a pharmaceutical composition comprising any one or more of the IL-33 antagonists described herein and a pharmaceutically acceptable carrier or diluent and therapeutic methods comprising administering such pharmaceutical compositions to subjects in need thereof.
- an additional therapeutically active component is formulated with, or administered in combination with an IL-33 antagonist of the present invention.
- Figure 1 shows four exemplary arrangements of the individual components of the IL-33 antagonists relative to one another.
- Panel A shows an arrangement in which a first IL-33- binding domain (D1 ) is attached to the N-terminus of a first multimerizing domain (M1 ), and a second IL-33-binding domain (D2) is attached to the N-terminus of a second multimerizing domain (M2).
- D1 is shown as a white box and D2 is shown as a black box to indicate that D1 and D2 are derived from different IL-33 binding proteins.
- Panel B shows an arrangement in which a first IL-33-binding domain (D1 ) is attached to the N-terminus of a first multimerizing domain (M1 ), and a second IL-33-binding domain (D2) is attached to the C-terminus of a second multimerizing domain (M2).
- D1 is shown as a white box and D2 is shown as a black box to indicate that D1 and D2 are derived from different IL-33 binding proteins.
- Panels C and D show arrangements comprising four IL-33-binding domains, D1 , D2, D3 and D4.
- D3-D1-M1 and D4-D2-M2 are attached in tandem, wherein D3 is attached to the N-terminus of D1 , and D1 is attached to the N-terminus of M1 ; and D4 is attached to the N- terminus of D2, and D2 is attached to the N-terminus of M2.
- D3 and D4 are identical or substantially identical to one another, and D1 and D2 are identical or substantially identical to one another.
- D1 and D4 are identical or substantially identical to one another, and D3 and D2 are identical or substantially identical to one another.
- interleukin-33 refers to a human IL-33 protein having the amino acid sequence as set forth in NCBI accession Nos. NP_254274.1 (human isoform 1 ), NP_001 186569.1 (human isoform 2), or NP_001 186570.1 (human isoform 3). All references to proteins, polypeptides and protein fragments herein are intended to refer to the human version of the respective protein, polypeptide or protein fragment unless explicitly specified as being from a non-human species (e.g., "mouse IL-33,” “monkey IL- 33,” etc.).
- IL-33 antagonist means any antigen-binding molecule that is capable of binding IL-33 and blocking, attenuating or otherwise interfering with IL-33 signaling and/or the interaction between IL-33 and a cell surface receptor (e.g., ST2).
- a cell surface receptor e.g., ST2
- the IL-33 antagonists of the present invention comprise a first IL-33 binding domain (D1 ) attached to a multimerizing domain (M).
- the IL-33 antagonists of the invention comprise a second IL-33 binding domain (D2) attached to D1 and/or M.
- D1 comprises an IL-33-binding portion of an ST2 protein.
- D2 comprises an extracellular portion of an IL-1 RAcP protein.
- the individual components of the IL-33 antagonists may be arranged relative to one another in a variety of ways that result in functional antagonist molecules capable of binding IL- 33.
- D1 and/or D2 may be attached to the N-terminus of M.
- D1 and/or D2 is attached to the C-terminus of M.
- D1 is attached to the N-terminus of D2
- D2 is attached to the N-terminus of M, resulting in an in-line fusion, from N- to C-terminus, of an antagonist molecule represented by the formula D1 -D2-M.
- Other orientations of the individual components are disclosed elsewhere herein.
- Non-limiting examples of IL-33 antagonists of the invention are shown in the working embodiments herein, and include the antagonists designated "hST2-hFc,” “hST2-mFc,” “hST2- hlL1 RAcP-mFc,” M hST2-hlL1 RAcP-hFc” and "mST2-mlL1 RAcP-mFc".
- hST2-hFc and hST2- mFc may also be referred to as "ST2 receptor proteins”.
- hST2-hlL1 RAcP-mFc, hST2- hlL1 RAcP-hFc and mST2-mlL1 RAcP-mFc may also be referred to herein as "IL-33 Trap proteins”.
- the term "attached”, in the context of a first polypeptide component being “attached” to a second polypeptide component means that the first component is physically connected to the second component either directly or indirectly.
- the C-terminal amino acid of the first component may be connected via a peptide bond to the N-terminal amino acid of the second component, or the N-terminal amino acid of the first component may be connected via a peptide bond to the C-terminal amino acid of the second component.
- Indirect attachment on the other hand, means that the first and second components are each connected physically to different parts of an intervening structure which serves as a link between the first and second
- the intervening structure may be, e.g., a single amino acid, a peptide linker, or another polypeptide component (e.g., another IL-33-binding protein, etc.).
- D1 -D2-M wherein a first IL-33 binding domain [D1] is attached to a second IL-33 binding domain [D2] which in turn is connected to a multimerizing domain [M]
- D1 is regarded as being "attached" to M, even though the attachment is indirect with D2 serving as an intervening structure.
- Standard molecular biological techniques e.g., recombinant DNA technology
- the IL-33 antagonists of the present invention comprise at least one IL-33 binding domain (sometimes referred to herein by the designation "D,” or “D1 ,” “D2,” etc.).
- the IL-33 binding domain comprises an IL-33-binding portion of an ST2 protein.
- An IL-33-binding portion of an ST2 protein can comprise or consist of all or part of the extracellular domain of an ST2 protein.
- an ST2 protein is a human ST2 protein.
- the ST2 protein is an ST2 protein from a non-human species (e.g., mouse ST2, monkey ST2, etc).
- An exemplary IL-33-binding portion of an ST2 protein is set forth herein as the amino acid sequence of SEQ ID NO:5
- an IL-33-binding portion of an ST2 protein is set forth herein as the amino acid sequence of SEQ ID NO:6 (corresponding to the extracellular domain of mouse ST2 [S27-R332 of NCBI Accession No. P14719]).
- the IL-33 binding domain comprises an extracellular portion of an IL-1 RAcP protein.
- an IL-1 RAcP protein is a human IL-1 RAcP protein.
- a "human IL-1 RAcP protein,” as used herein, refers to an IL-1 RAcP protein having the amino acid sequence of SEQ ID NO:13.
- the IL-1 RAcP protein is an IL- 1 RAcP protein from a non-human species (e.g., mouse IL-1 RAcP, monkey IL-1 RAcP, etc).
- An exemplary extracellular portion of an IL-1 RAcP protein is set forth herein as the amino acid sequence of SEQ ID NO:7 (corresponding to the extracellular domain of human I L-1 RAcP [S21- E359 of NCBI Accession No. Q9NPH3]).
- Another example of an extracellular portion of an IL- 1 RAcP protein is set forth herein as the amino acid sequence of SEQ ID NO:8 (corresponding to the extracellular domain of mouse IL-1 RAcP [S21-E359 of NCBI Accession No. Q61730]).
- the present invention includes IL-33 antagonists comprising D1 and/or D2 components having an amino acid sequence that is at least 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to any of the exemplary IL-33 binding domain component amino acid sequences set forth herein (e.g., SEQ ID NOs:5-8).
- the IL-33 antagonists of the present invention also comprise at least one multimerizing domain (sometimes referred to herein by the abbreviation "M,” “M1 ", “M2”, etc.).
- the multimerizing domain(s) of the present invention function to connect the various components of the IL-33 antagonists (e.g., the IL-33-binding domain(s)) with one another.
- a "multimerizing domain” is any macromolecule that has the ability to associate (covalently or non-covalently) with a second macromolecule of the same or similar structure or constitution.
- a multimerizing domain may be a polypeptide comprising an immunoglobulin C H 3 domain.
- a non-limiting example of a multimerizing domain is an Fc portion of an immunoglobulin, e.g., an Fc domain of an IgG selected from the isotypes lgG1 , lgG2, lgG3, and lgG4, as well as any allotype within each isotype group.
- the multimerizing domain is an Fc fragment or an amino acid sequence of 1 to about 200 amino acids in length containing at least one cysteine residues.
- the multimerizing domain is an Fc fragment or an amino acid sequence of 1 to about 200 amino acids in length containing at least one cysteine residues.
- multimerizing domain is a cysteine residue or a short cysteine-containing peptide.
- Other multimerizing domains include peptides or polypeptides comprising or consisting of a leucine zipper, a helix-loop motif, or a coiled-coil motif.
- Non-limiting exemplary multimerizing domains that can be used in the IL-33
- antagonists of the present invention include human lgG1 Fc (SEQ ID NO:9) or mouse lgG2a Fc (SEQ ID NO:10).
- the present invention includes IL-33 antagonists comprising M components having an amino acid sequence that is at least 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to any of the exemplary M component amino acid sequences set forth herein (e.g., SEQ ID NOs:9 or 10).
- the IL-33 antagonists of the present invention comprise two multimerizing domains, M1 and M2, wherein M1 and M2 are identical to one another.
- M1 can be an Fc domain having a particular amino acid sequence
- M2 is an Fc domain with the same amino acid sequence as M1.
- the IL-33 antagonists of the invention comprise two multimerizing domains, M1 and M2, that differ from one another at one or more amino acid position.
- M1 may comprise a first immunoglobulin (Ig) C H 3 domain
- M2 may comprise a second Ig C H 3 domain, wherein the first and second Ig C H 3 domains differ from one another by at least one amino acid, and wherein at least one amino acid difference reduces binding of the targeting construct to Protein A as compared to a reference construct having identical M1 and M2 sequences.
- the Ig C H 3 domain of M1 binds Protein A and the Ig C H 3 domain of M2 contains a mutation that reduces or abolishes Protein A binding such as an H95R modification (by IMGT exon numbering; H435R by EU numbering).
- the C H 3 of M2 may further comprise a Y96F modification (by IMGT; Y436F by EU).
- modifications that may be found within the C H 3 of M2 include: D16E, L18M, N44S, K52N, V57M, and V82I (by IMGT; D356E, L358M, N384S, K392N, V397M, and V422I by EU) in the case of an lgG1 Fc domain; N44S, K52N, and V82I (IMGT; N384S, K392N, and V422I by EU) in the case of an lgG2 Fc domain; and Q15R, N44S, K52N, V57M, R69K, E79Q, and V82I (by IMGT; Q355R, N384S, K392N, V397M, R409K, E419Q, and V422I by EU) in the case of an lgG4 Fc domain.
- the individual components of the IL-33 antagonists of the present invention can be arranged relative to one another in a variety of ways, examples of which are described in detail elsewhere herein.
- the multimerizing domains (M1 and/or M2) may be a peptide or polypeptide having a N-terminus and a C-terminus.
- D1 and D2 components may be attached to the M component at either the N- or C-terminus of the M component, for example, D1 may be attached to the N-terminus of M (represented as "D1 -M").
- D1 may be attached to the C-terminus of M (represented as "M-D1 ").
- D2 is attached to the N-terminus of M (represented as "D2-M"), or D2 is attached to the C- terminus of M (represented as “M-D2").
- D1 is attached to the N- terminus of D2
- D2 is attached to the N-terminus of M (represented as "D1 -D2-M”).
- Other exemplary arrangements of the individual components, from N- to C-terminus may thus be represented as follows: D2-D1 -M; M-D1 ; M-D2; M-D1-D2; M-D2-D1 ; D1-M-D2; D2-M-D1 ; etc.
- one or more IL-33 binding domains may be attached to the multimerizing domains in a variety of arrangements. Non-limiting examples of such arrangements are illustrated schematically in Figure 1 .
- the present invention includes IL-33 antagonists comprising a first IL-33 binding domain (D1 ) attached to a first multimerizing domain (M1 ), and a second IL-33 binding domain (D2) attached to a second multimerizing domain (M2).
- the IL-33 antagonists of the invention may also include one or more additional IL-33 binding domains (e.g., D3, D4, etc.).
- the D3 component may be attached to either D1 or M1 ; likewise, where a fourth IL-33 binding domain (D4) is included, the D4 component may be attached to either D2 or M2.
- two or more of the IL-33 binding domains may be identical, or substantially identical, to one another.
- D1 and D2 may be identical, or substantially identical, to one another; and D3 and D4 may be identical, or substantially identical, to one another, etc.
- Non-limiting illustrative examples of IL-33 antagonists of the invention comprising two multimerizing domains (M1 and M2) and four IL-33 binding domains (D1 , D2, D3 and D4) are shown in Figure 1 , arrangements C and D).
- D1 is attached to the N-terminus of M1
- D2 is attached to the N-terminus of M2
- D3 is attached to the N-terminus of D1
- D4 is attached to the N-terminus of D2.
- Panel C depicts the situation wherein D1 and D2 are identical to one another (e.g., each comprising the extracellular domain of IL-1 RAcP), and D3 and D4 are identical to one another (e.g., each comprising the
- Panel C depicts the situation wherein D1 and D2 are non- identical, and D3 and D4 are non-identical. Numerous other arrangements will be apparent to a person of ordinary skill in the art based on the teachings of the present disclosure and are encompassed within the scope of the present invention.
- the individual components of the IL-33 antagonists of the present invention may be attached to one another directly (e.g., D1 and/or D2 may be directly attached to M, etc.); alternatively, the individual components may be attached to one another via a linker component (e.g., D1 and/or D2 may be attached to M via a linker oriented between the individual components; D1 may be attached to D2 via a linker; etc.).
- a linker component e.g., D1 and/or D2 may be attached to M via a linker oriented between the individual components; D1 may be attached to D2 via a linker; etc.
- the attachment may be through a linker (even if not specifically designated as such).
- a linker is any molecule that joins two polypeptide components together.
- a linker may be a peptide comprising from 1 to 20 amino acids connected together via peptide bonds. (A peptide bond per se, however, is not considered a "linker” for purposes of the present disclosure).
- the linker comprises sterically unhindered amino acids such as glycine and alanine.
- the linker is a flexible chain of amino acids that is resistant to proteolytic degradation.
- a linker may comprise two molecular structures that interact with one another.
- a linker may comprise a streptavidin component and a biotin component; the association between streptavidin (attached to one component) and biotin (attached to another component) serves as an attachment between individual components of the IL-33 antagonists.
- the exemplary IL-33 antagonists described herein as hST2-hlL1 RAcP-mFc and mST2- mlL1 RAcP-mFc include a serine-glycine (SG) linker between the IL-1 RAcP component and the Fc multimerizing domain.
- SG serine-glycine
- the present invention includes IL-33 antagonists that bind soluble I L-33 molecules with high affinity.
- the present invention includes IL-33 antagonists (as described elsewhere herein) that bind IL-33 (e.g., at 25°C or 37°C) with a K D of less than about 400 pM as measured by surface plasmon resonance, e.g., using the assay format as defined in Example 2 herein.
- the IL-33 antagonists of the present invention bind IL-33 with a K D of less than about 200 pM, less than about 100 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 10 pM, less than about 9 pM, less than about 8 pM, less than about 6 pM, or less than about 1 pM as measured by surface plasmon resonance, e.g., using the assay format as defined in Example 2 herein, or a substantially similar assay.
- the present invention also includes IL-33 antagonists that specifically bind IL-33 with a dissociative half-life (t1 ⁇ 2) of greater than or equal to about 4 minutes as measured by surface plasmon resonance at 25°C or 37°C, e.g., using the assay format as defined in Example 2 herein, or a substantially similar assay.
- the IL-33 antagonists of the present invention bind IL-33 with a t1 ⁇ 2 of greater than about 10 minutes, greater than about 20 minutes, greater than about 30 minutes, greater than about 40 minutes, greater than about 50 minutes, greater than about 60 minutes, or greater than about 70 minutes, or greater than about 500 minutes, or greater than about 1000 minutes as measured by surface plasmon resonance at 25°C or 37°C, e.g., using the assay format as defined in Example 2 herein, or a substantially similar assay.
- the present invention also includes I L-33 antagonists that block the binding of IL-33 to an IL-33 receptor (e.g., ST2).
- an IL-33 receptor e.g., ST2
- the present invention includes IL-33 antagonists that block the binding of IL-33 to ST2 in vitro, with an IC 50 value of less than about 1 15 pM, as measured by an ELISA-based immunoassay, e.g., using the assay format as defined in
- the IL-33 antagonists of the present invention block the binding of IL-33 to ST2 in vitro with an IC 50 value of less than about 120 pM, less than about 90 pM, less than about 80 pM, less than about 70 pM, less than about 60 pM, less than about 50 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 18 pM, less than about 16 pM, less than about 14 pM, less than about 12 pM, less than about 10 pM, less than about 9 pM, less than about 8 pM, or less than about 7 pM, as measured by an ELISA-based immunoassay, e.g., using the assay format as defined in Example 3 herein, or a substantially similar assay.
- an ELISA-based immunoassay e.g., using the assay format as defined in Example 3 herein, or a substantially similar assay.
- the present invention also includes IL-33 antagonists that inhibit IL-33-mediated cell signaling.
- the present invention includes IL-33 antagonists that inhibit IL-33-mediated signaling in cells expressing human ST2, with an IC 50 value of less than about 500 pM, as measured in a cell-based blocking bioassay, e.g., using the assay format as defined in Example 4 herein, or a substantially similar assay.
- the IL-33 antagonists of the present invention block IL-33-mediated signaling in cells expressing human ST2, with an IC 50 of less than about 400 pM, less than about 300 pM, less than about 200 pM, less than about 100 pM, less than about 80 pM, less than about 60 pM, less than about 40 pM, less than about 30 pM, less than about 20 pM, less than about 18 pM, less than about 16 pM, less than about 14 pM, less than about 12 pM, less than about 10 pM, less than about 8 pM, less than about 7 pM, less than about 6 pM, less than about 5 pM, less than about 4 pM, less than about 3 pM, less than about 2 pM, or less than about 1.5 pM, as measured in a cell-based blocking bioassay, e.g., using the assay format as defined in Example 4 herein, or a substantially similar assay
- the present invention also includes IL-33 antagonists that inhibit IL-33-induced basophil activation and IL-33 antagonists that inhibit IL-33-induced IFN-gamma release from human PBMCs.
- Basophil activation can be defined as degranulation, cell surface marker expression, cytokine release, and other immune mediator release, such as histamines and leukotrienes.
- the IL-33 antagonists of the present invention may possess one or more of the aforementioned biological characteristics, or any combinations thereof.
- Other biological characteristics of the antibodies of the present invention will be evident to a person of ordinary skill in the art from a review of the present disclosure including the working Examples herein.
- the invention provides pharmaceutical compositions comprising the IL-33 antagonists of the present invention.
- the pharmaceutical compositions of the invention may be formulated with suitable carriers, excipients, and other agents that provide improved transfer, delivery, tolerance, and the like.
- suitable carriers, excipients, and other agents that provide improved transfer, delivery, tolerance, and the like.
- a multitude of appropriate formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA.
- formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as LIPOFECTINTM, Life Technologies, Carlsbad, CA), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. See also Powell et al. "Compendium of excipients for parenteral formulations" PDA (1998) J Pharm Sci Technol 52:238-31 1.
- the dose of IL-33 antagonist administered to a patient may vary depending upon the age and the size of the patient, target disease, conditions, route of administration, and the like.
- the preferred dose is typically calculated according to body weight or body surface area.
- intravenously administer the antagonist of the present invention normally at a single dose of about 0.01 to about 20 mg/kg body weight, more preferably about 0.02 to about 7, about 0.03 to about 5, or about 0.05 to about 3 mg/kg body weight.
- the frequency and the duration of the treatment can be adjusted.
- Effective dosages and schedules for administering IL-33 antagonist may be determined empirically; for example, patient progress can be monitored by periodic assessment, and the dose adjusted accordingly. Moreover, interspecies scaling of dosages can be performed using well-known methods in the art (e.g., Mordenti et al., 1991 , Pharmaceut. Res. 8:1351 ).
- compositions of the invention e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the mutant viruses, receptor mediated endocytosis (see, e.g., Wu et al., 1987, J. Biol. Chem. 262:4429-4432).
- Methods of introduction include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
- the composition may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or
- mucocutaneous linings e.g., oral mucosa, rectal and intestinal mucosa, etc.
- Administration can be systemic or local.
- a pharmaceutical composition of the present invention can be delivered
- a pen delivery device readily has applications in delivering a
- Such a pen delivery device can be reusable or disposable.
- a reusable pen delivery device generally utilizes a replaceable cartridge that contains a pharmaceutical composition. Once all of the pharmaceutical composition within the cartridge has been administered and the cartridge is empty, the empty cartridge can readily be discarded and replaced with a new cartridge that contains the pharmaceutical composition. The pen delivery device can then be reused.
- a disposable pen delivery device there is no replaceable cartridge. Rather, the disposable pen delivery device comes prefilled with the pharmaceutical composition held in a reservoir within the device. Once the reservoir is emptied of the pharmaceutical composition, the entire device is discarded.
- Numerous reusable pen and autoinjector delivery devices have applications in the subcutaneous delivery of a pharmaceutical composition of the present invention. Examples include, but are not limited to AUTOPENTM (Owen Mumford, Inc., Woodstock, UK),
- DISETRONICTM pen (Disetronic Medical Systems, Bergdorf, Switzerland), HUMALOG MIX 75/25TM pen, HUMALOGTM pen, HUMALIN 70/30TM pen (Eli Lilly and Co., Indianapolis, IN), NOVOPENTM I, II and III (Novo Nordisk, Copenhagen, Denmark), NOVOPEN JUNIORTM (Novo Nordisk, Copenhagen, Denmark), BDTM pen (Becton Dickinson, Franklin Lakes, NJ),
- OPTIPENTM, OPTIPEN PROTM, OPTIPEN STARLETTM, and OPTICLIKTM are examples of disposable pen delivery devices having applications in subcutaneous delivery of a pharmaceutical composition of the present invention.
- disposable pen delivery devices having applications in subcutaneous delivery of a pharmaceutical composition of the present invention include, but are not limited to the SOLOSTARTM pen (sanofi-aventis), the FLEXPENTM (Novo Nordisk), and the KWIKPENTM (Eli Lilly), the SURECLICKTM Autoinjector (Amgen, Thousand Oaks, CA), the PENLETTM (Haselmeier, Stuttgart, Germany), the EPIPEN (Dey, L.P.), and the HUMIRATM Pen (Abbott Labs, Abbott Park IL), to name only a few.
- the pharmaceutical composition can be delivered in a controlled release system.
- a pump may be used (see Langer, supra; Sefton, 1987, CRC Crit. Ref. Biomed. Eng. 14:201 ).
- polymeric materials can be used; see, Medical Applications of Controlled Release, Langer and Wise (eds.), 1974, CRC Pres., Boca Raton, Florida.
- a controlled release system can be placed in proximity of the composition's target, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, 1984, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138). Other controlled release systems are discussed in the review by Langer, 1990, Science 249:1527-1533.
- the injectable preparations may include dosage forms for intravenous, subcutaneous, intracutaneous and intramuscular injections, drip infusions, etc. These injectable preparations may be prepared by methods publicly known. For example, the injectable preparations may be prepared, e.g., by dissolving, suspending or emulsifying the antagonist or its salt described above in a sterile aqueous medium or an oily medium conventionally used for injections.
- aqueous medium for injections there are, for example, physiological saline, an isotonic solution containing glucose and other auxiliary agents, etc., which may be used in combination with an appropriate solubilizing agent such as an alcohol (e.g., ethanol), a polyalcohol (e.g., propylene glycol, polyethylene glycol), a nonionic surfactant [e.g., polysorbate 80, HCO-50, etc.
- an alcohol e.g., ethanol
- a polyalcohol e.g., propylene glycol, polyethylene glycol
- a nonionic surfactant e.g., polysorbate 80, HCO-50
- polyoxyethylene (50 mol) adduct of hydrogenated castor oil) polyoxyethylene (50 mol) adduct of hydrogenated castor oil
- oily medium there are employed, e.g., sesame oil, soybean oil, etc., which may be used in combination with a solubilizing agent such as benzyl benzoate, benzyl alcohol, etc.
- solubilizing agent such as benzyl benzoate, benzyl alcohol, etc.
- the injection thus prepared is preferably filled in an appropriate ampoule.
- compositions for oral or parenteral use described above are prepared into dosage forms in a unit dose suited to fit a dose of the active
- Such dosage forms in a unit dose include, for example, tablets, pills, capsules, injections (ampoules), suppositories, etc.
- the amount of the aforesaid antagonist molecule contained is generally about 5 to about 500 mg per dosage form in a unit dose; especially in the form of injection, it is preferred that the aforesaid antagonist molecule is contained in about 5 to about 100 mg and in about 10 to about 250 mg for the other dosage forms.
- IL-33 antagonists of the invention are useful, inter alia, for the treatment, prevention and/or amelioration of any disease or disorder associated with or mediated by IL-33 expression, signaling, or activity, or treatable by blocking the interaction between IL-33 and a IL-33 ligand (e.g., ST2) or otherwise inhibiting IL-33 activity and/or signaling.
- a IL-33 ligand e.g., ST2
- the present invention provides methods for treating infectious diseases (e.g., Leishmania infection, Trichuris infection, Mycobacterium infection, Listeria infection, Toxoplasma infection, Schistosoma infection, respiratory syncytial virus infection, influenza virus infection, etc.), asthma (e.g., eosinophilic or non-eosinophilic asthma, steroid resistant or steroid sensitive asthma, allergic asthma, non-allergic asthma, severe refractory asthma, asthma exacerbations [e.g., viral- or allergen-induced], etc.), atopic dermatitis, psoriasis, other inflammatory disorders, allergy, anaphylaxis, cardiovascular disease, central nervous system disease, pain, and arthritis (e.g., rheumatoid arthritis, osteoarthritis, psoriatic arthritis, etc.), giant cell arteritis, inflammatory bowel disease (e.g Crohn's disease or ulcerative colitis), multiple sclerosis, allergic rhinitis
- fibrotic diseases that are treatable by administering the IL-33 antagonists of the invention include pulmonary fibrosis (e.g., idiopathic pulmonary fibrosis, bleomycin-induced pulmonary fibrosis, asbestos-induced pulmonary fibrosis, and bronchiolitis obliterans syndrome), chronic asthma, fibrosis associated with acute lung injury and acute respiratory distress (e.g., allergen induced fibrosis, bacterial pneumonia induced fibrosis, trauma induced fibrosis, viral pneumonia induced fibrosis, ventilator induced fibrosis, non-pulmonary sepsis induced fibrosis and aspiration induced fibrosis), silicosis, radiation-induced fibrosis, chronic o
- pulmonary fibrosis e.g., idiopathic pulmonary fibrosis, bleomycin-induced pulmonary fibrosis, asbestos-induced pulmonary fibrosis, and bronchiolitis obliterans syndrome
- the IL-33 antagonists may be administered as a monotherapy (i.e., as the only therapeutic agent) or in combination with one or more additional therapeutic agents (examples of which are described elsewhere herein).
- the present invention includes compositions and therapeutic formulations comprising any of the IL-33 antagonists described herein in combination with one or more additional therapeutically active components, and methods of treatment comprising administering such combinations to subjects in need thereof.
- the IL-33 antagonists of the present invention may also be co-formulated with and/or administered in combination with, e.g., cytokine inhibitors or antagonists, including small-molecule cytokine inhibitors and antibodies that bind to cytokines such as IL-1 , IL-2, IL-3, IL-4, IL-5, IL-6, IL-8, IL-9, IL-1 1 , IL-12, IL-13, IL-17, IL-18, IL-21 , IL-22, IL-23, IL-25, IL-26, IL-31 , an IL-4/IL-13 dual antagonist, an IL-12/IL-23 antagonist, a PDE4 inhibitor (in one embodiment, an oral PDE4 inhibitor), and another IL-33 antagonist or a different antibody to
- the IL-33 antagonists of the invention may also be administered and/or co-formulated in combination with antivirals, antibiotics, analgesics, corticosteroids, steroids, oxygen, antioxidants, metal chelators, IFN-gamma, and/or NSAIDs,a bronchial dilator, an antihistamine, epinephrine, or a decongestant.
- the additional therapeutically active component(s) may be administered just prior to, concurrent with, or shortly after the administration of an IL-33 antagonist of the present invention; (for purposes of the present disclosure, such administration regimens are considered the administration of an IL-33 antagonist "in combination with" an additional therapeutically active component).
- the present invention includes pharmaceutical compositions in which an IL- 33 antagonist of the present invention is co-formulated with one or more of the additional therapeutically active component(s) as described elsewhere herein.
- multiple doses of an IL-33 antagonist may be administered to a subject over a defined time course.
- the methods according to this aspect of the invention comprise sequentially administering to a subject multiple doses of an IL-33 antagonist of the invention.
- sequentially administering means that each dose of IL-33 antagonist is administered to the subject at a different point in time, e.g., on different days separated by a predetermined interval (e.g., hours, days, weeks or months).
- the present invention includes methods which comprise sequentially administering to the patient a single initial dose of an IL-33 antagonist, followed by one or more secondary doses of the IL-33 antagonist, and optionally followed by one or more tertiary doses of the IL-33 antagonist.
- the terms "initial dose,” “secondary doses,” and “tertiary doses,” refer to the temporal sequence of administration of the IL-33 antagonist of the invention.
- the “initial dose” is the dose which is administered at the beginning of the treatment regimen (also referred to as the “baseline dose”);
- the “secondary doses” are the doses which are administered after the initial dose;
- the “tertiary doses” are the doses which are administered after the secondary doses.
- the initial, secondary, and tertiary doses may all contain the same amount of IL-33 antagonist, but generally may differ from one another in terms of frequency of administration.
- the amount of IL-33 antagonist contained in the initial, secondary and/or tertiary doses varies from one another (e.g., adjusted up or down as appropriate) during the course of treatment.
- two or more (e.g., 2, 3, 4, or 5) doses are administered at the beginning of the treatment regimen as "loading doses" followed by subsequent doses that are administered on a less frequent basis (e.g.,
- each secondary and/or tertiary dose is administered 1 to 26 (e.g., 1 , 1 1 ⁇ 2, 2, 21 ⁇ 2, 3, 31 ⁇ 2, 4, 41 ⁇ 2, 5, 51 ⁇ 2, 6, 61 ⁇ 2, 7, 71 ⁇ 2, 8, 81 ⁇ 2, 9, 91 ⁇ 2, 10, 101 ⁇ 2, 1 1 , 1 1 1 ⁇ 2, 12, 121 ⁇ 2, 13, 131 ⁇ 2, 14, 141 ⁇ 2, 15, 151 ⁇ 2, 16, 161 ⁇ 2, 17, 171 ⁇ 2, 18, 181 ⁇ 2, 19, 191 ⁇ 2, 20, 201 ⁇ 2, 21 , 21 1 ⁇ 2, 22, 221 ⁇ 2, 23, 231 ⁇ 2, 24, 241 ⁇ 2, 25, 251 ⁇ 2, 26, 261 ⁇ 2, or more) weeks after the immediately preceding dose.
- the phrase "the immediately preceding dose,” as used herein, means, in a sequence of multiple administrations, the dose of IL-33 antagonist which is administered to a patient prior to the administration of the very next dose in the sequence with no intervening doses.
- the methods according to this aspect of the invention may comprise administering to a patient any number of secondary and/or tertiary doses of an IL-33 antagonist.
- any number of secondary and/or tertiary doses of an IL-33 antagonist may comprise administering to a patient any number of secondary and/or tertiary doses of an IL-33 antagonist.
- only a single secondary dose is administered to the patient.
- two or more (e.g., 2, 3, 4, 5, 6, 7, 8, or more) secondary doses are administered to the patient.
- only a single tertiary dose is administered to the patient.
- two or more (e.g., 2, 3, 4, 5, 6, 7, 8, or more) tertiary doses are administered to the patient.
- each secondary dose may be administered at the same frequency as the other secondary doses. For example, each secondary dose may be administered to the patient 1 to 2 weeks or 1 to 2 months after the immediately preceding dose. Similarly, in embodiments involving multiple tertiary doses, each tertiary dose may be administered at the same frequency as the other tertiary doses. For example, each tertiary dose may be administered to the patient 2 to 12 weeks after the immediately preceding dose.
- the frequency at which the secondary and/or tertiary doses are administered to a patient can vary over the course of the treatment regimen. The frequency of administration may also be adjusted during the course of treatment by a physician depending on the needs of the individual patient following clinical examination.
- the present invention includes administration regimens in which 2 to 6 loading doses are administered to a patient a first frequency (e.g., once a week, once every two weeks, once every three weeks, once a month, once every two months, etc.), followed by administration of two or more maintenance doses to the patient on a less frequent basis.
- a first frequency e.g., once a week, once every two weeks, once every three weeks, once a month, once every two months, etc.
- the maintenance doses may be administered to the patient once every six weeks, once every two months, once every three months, etc.
- compositions of the invention are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
- the first IL-33 antagonist (hST2-hFc, SEQ ID NO:1 ) consists of the soluble extracellular region of human ST2 (SEQ ID NO:5) fused at its C-terminus to the N-terminus of a human lgG1 Fc region (SEQ ID NO:9).
- the second IL-33 antagonist (hST2-mFc, SEQ ID NO:2) consists of the soluble extracellular region of human ST2 (SEQ ID NO:5) fused at its C-terminus to the N-terminus of a mouse lgG2a Fc region (SEQ ID NO:10).
- the third IL-33 antagonist (hST2-hlL1 RAcP-mFc, SEQ ID NO: 3) consists of an in-line fusion having human ST2 (SEQ ID NO:5) at its N-terminus, followed by the extracellular region of human IL-1 RAcP (SEQ ID NO:7), followed by a mouse lgG2a Fc (SEQ ID NO:10) at its C- terminus.
- the fourth IL-33 antagonist (mST2-mlL1 RAcP-mFc, SEQ ID NO: 4) consists of an inline fusion having mouse ST2 (SEQ ID NO:6) at its N-terminus, followed by the extracellular region of mouse IL-1 RAcP (SEQ ID NO:8), followed by a mouse lgG2a Fc (SEQ ID NO: 10) at its C-terminus.
- the fifth IL-33 antagonist (hST2-hlL1 RAcP-hFc, SEQ ID NO: 13) consists of an in line fusion having human ST2 of SEQ ID NO: 5 at its N-terminus, followed by the extracellular region of human IL-1 RAcP (SEQ ID NO: 7) followed by a human lgG1 Fc (SEQ ID NO: 9) at its C terminus.
- Table 1 a sets forth a summary description of the different IL-33 antagonists and their component parts.
- Table 1 b sets forth the amino acid sequences of the IL-33 antagonists and their component parts.
- Table 1 a Summary of IL-33 Antagonists
- KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQL human ST2 LKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSE extracellular KNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT domain
- SEQ ID NO:6 SKSSWGLENEALIVRCPQRGRSTYPVEWYYSDTNESIPTQKRNRIFVSRDRLKF (mouse ST2 LPARVEDSGIYACVIRSPNLNKTGYLNVTIHKKPPSCNIPDYLMYSTVRGSDKNF extracellular KITCPTIDLYNWTAPVQWFKNCKALQEPRFRAHRSYLFIDNVTHDDEGDYTCQF domain) THAENGTNYIVTATRSFTVEEKGFSMFPVITNPPYNHTMEVEIGKPASIACSACF
- SEQ ID NO:1 SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQH (M. fascicularis PSSESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLH Identifier Sequence
- the Biacore sensor surface was first derivatized by amine coupling a polyclonal rabbit anti-mouse antibody (GE, # BR-1008-38) or with a monoclonal mouse anti-human Fc antibody (GE, # BR-1008-39) to capture IL-33 Trap and receptor proteins with a C-terminal mouse lgG2a Fc tag or a C-terminal human lgG1 Fc tag, respectively.
- Kinetic experiments were carried out in 0.01 M HEPES pH 7.4, 0.15 M NaCI, 3 mM EDTA, and 0.005% v/v Surfactant Tween-20 (HBST running buffer).
- HBST running buffer Different concentrations of human IL-33, mouse IL-33 or MflL-33-6His prepared in HBST running buffer (ranging from 60nM to 27.4pM, 3-fold dilutions, for Trap proteins and ranging from 60nM to 0.25nM, 3-fold dilutions, for ST2 receptor proteins) were injected over the captured IL-33 Trap and receptor protein surfaces at a flow rate of 50 L/minute. Association of different IL-33 proteins to the different capture surfaces was monitored for 7 minutes for Trap proteins or 4 minutes for ST2 receptor proteins and their dissociation in HBST running buffer was monitored for 14 minutes for Trap proteins or 8 minutes for ST2 receptor proteins.
- the kinetic parameters for the IL-33 Trap proteins binding to human, monkey and mouse IL-33 at 25°C and 37°C are shown in Tables 2 through 7, while the binding kinetics for the ST2 receptor proteins binding to human and mouse IL-33 at 25°C are shown in Tables 2 and 6.
- Table 2 the IL-33 Trap and receptor proteins bound human IL-33 with K D values ranging from approximately 0.53pM to 54pM at 25°C.
- the IL-33 Trap proteins bound MflL-33-6Hls with K D values ranging from approximately 0.596pM to 53.5pM at 25°C.
- the IL-33 Trap proteins bound MflL-33-6Hls with K D values ranging from approximately 0.551 pM to 190pM at 37°C.
- the IL-33 Trap and receptor proteins bound mouse IL-33 with K D values ranging from approximately 6.1 pM to 102pM at 25°C.
- the IL-33 Trap proteins bound mouse IL-33 with K D values ranging from approximately 2.78pM to 93.3pM at 37°C.
- Table 2 Binding kinetic parameters of human IL-33 binding to human IL-33 Trap, mouse IL-33 Trap, and human ST2 receptor proteins at 25°C.
- Table 3 Binding kinetics parameters of human IL-33 binding to human and mouse IL-33 Trap at 37°C.
- Table 4 Binding kinetic parameters of monkey IL-33 binding to human and mouse IL-33 Trap at 25°C.
- Table 6 Binding kinetic parameters of mouse IL-33 binding to human IL-33 Trap, mouse IL-33 Trap, and human ST2 receptor proteins at 25°C.
- Table 7 Binding kinetic parameters of mouse IL-33 binding to human and mouse IL-33 Trap at 37°C.
- K D values represent lower and upper limits, respectively.
- exemplary IL-33 antagonists of the invention to block human IL-33 (hi L- 33) binding to the human ST2 receptor was measured using a competition sandwich ELISA.
- a portion of human ST2 protein ecto domain that was expressed with a C-terminal mouse Fc tag (SEQ ID NO:2) was coated at a concentration of 1 ⁇ g mL in PBS buffer on a 96-well microtiter plate overnight at 4°C. Nonspecific binding sites were subsequently blocked with a 0.5% (w/v) BSA solution in PBS.
- Biotinylated hlL-33 protein (R&D systems, #3625-IL/CF) (biot-hl L-33) was added to achieve a constant final concentration of 20 pM to serial dilutions of IL-33 antagonists ranging from 0 to 100 nM.
- the mixture was incubated for 1 hour at room temperature (RT) before transfer to the hST2-hFc coated microtiter plates. After incubation for 1 hour at RT, the wells were then washed, and plate-bound biot-hlL-33 was detected with HRP-conjugated streptavidin (Thermo Scientific, # N200). All samples were developed with a TMB solution (BD biosciences, # 51 -2607KC) to produce a colorimetric reaction and then quenched by
- lnterleukin-33 (IL-33) is a ligand for ST2, a toll-like/interleukin-1 receptor super-family member that associates with an accessory protein, IL-1 RAcP (for review, see Kakkar and Lee, (2008), Nat Rev Drug Discovery, Oct; 7(10): 827-840).
- ST2/IL-1 RAcP a signaling cascade is triggered through downstream molecules such as MyD88 (myeloid differentiation factor 88) and TRAF6 (TN F receptor associated factor 6), leading to activation of N FKB (nuclear factor - ⁇ ) among others.
- human embryonic kidney cells (HEK293) were stably transfected to express human ST2 (amino acids 1 -556 of accession number NP_057316) along with a luciferase reporter [N F B response element (5x)-luciferase-IRES-GFP] (H E K293/hST2/N FkB- luciferase cell line).
- the HEK293 cell line expresses IL-1 RAcP endogenously, and N FKB activation by IL-33 in HEK293 cells has been shown previously (Schmitz et al., (2005), Immunity 23:479-490).
- the stable cell line was isolated and maintained in 10% FBS, DMEM, NEAA, penicillin/streptomycin, and G418.
- HEK293/hST2/ NFKB-luciferase cells were seeded onto 96-well assay plates at 10,000 cells per well in low serum media containing 0.1 %FBS and OPTIMEM (Invitrogen, #31985-070) and then incubated at 37°C in 5% C0 2 overnight.
- IL-33 human IL-33 (hlL-33; R&D Systems, #3625-1 L), cynomolgus monkey IL-33 expressed with a C-terminal hexahistidine tag (MflL-33-6His; SEQ ID:1 1 ), or mouse IL33 (mlL-33; R&D Systems, #3626-1 L) were serially diluted at 1 :3 (hlL33: 15nM - 0.3pM or 10nM - 0.2pM, mflL33: 1.5nM - 0.03pM or 1 nM - 0.05pM , mlL33: 15nM - 0.3pM or 10nM - 0.2pM) and added to the cells. A control containing dilution buffer but no IL-33 was also added to one sample of cells. To measure inhibition, IL-33 Trap and soluble receptor proteins were serially diluted and added to the cells.
- IL-33 concentrations of IL-33 (5pM or 20pM for hlL-33, 5pM or 3pM for MflL-33-6His and 30pM for mlL-33).
- the dilution series of the soluble receptor and Traps before adding to cells was 1 :3, starting at ⁇ 15, 150, 100, or 200nM and ranging down to -0.3, 3, or 2pM, plus a control sample containing no Trap or soluble receptor protein control.
- a human Fc protein (Control Protein) was also serially diluted at 1 :3 ranging from 798nM to 0.01 nM or 10OnM to 0.002nM and tested with hlL-33, MflL-33-6His, and mlL-33 in the same manner as the Trap and receptor proteins.
- Luciferase activity was measured after 5.5 hours of incubation at 37°C in 5% C0 2 using a Victor X (Perkin Elmer) plate reader, and the results were analyzed using nonlinear regression (4- parameter logistics) with Prism 5 software. Results are shown in Table 9.
- HEK293/hST2/NFkB-luciferase cells by IL-33 Trap proteins and soluble human ST2 receptor
- Example 5 An IL-33 Antagonist Inhibits IL-33-Mediated Basophil Activation
- PBMC Peripheral blood mononuclear cells
- K2 EDTA whole blood was diluted 1 :1 in RPMI 1640, carefully layered over Ficoll-Paque (GE Healthcare, # 17-1440-03) and centrifuged to separate PBMC.
- the interphase layer containing the PBMC was aspirated, transferred to a new tube, and washed twice with MACS buffer that was comprised of a 1 :20 dilution of the MACS BSA solution (Militenyi Biotec, #130-091-376) in MACS rinsing solution (Militenyi Biotec, #130-091-222).
- the purified PBMC were then plated (100 ⁇ per well) in a v- bottom, polypropylene 96-well plate at a final concentration of -3.0x10 6 cells/mL in MACS buffer.
- 1 ng of IL-3 (Sigma, # H7166-10UG) in 50 ⁇ Dulbecco's Phosphate-Buffered Saline without Ca ++ or Mg ++ (DPBS) was added to the cell suspension, and then incubated at 37°C for 10 minutes.
- the solutions were mixed with a fixed concentration of 100 pM (final concentration) of human IL-33 (R&D Systems, # 6325- IL/CF) or no IL-33 negative control prior to adding to the PBMC. All samples were tested in duplicate.
- Basophils are identified according the following flow cytometric parameters:
- the I L-33 antagonist hST2-hlL1 RAcP-mFc blocked basophil activation induced by 100 pM human IL-33 challenge with an IC 50 value of 19 pM for donor 655675, an IC 50 value of 15.1 pM for donor 655676, an IC 50 value of 23 pM for donor 655685, an IC 50 value of 20.9 pM for donor 655686, an IC 50 value of 36 pM for donor 698846 and an IC 50 value of 1 1.1 pM for donor 698847.
- the IL-33 antagonist hST2-hlL1 RAcP-hFc blocked basophil activation induced by 100 pM human IL-33 challenge with an IC 50 value of 19.7 pM for donor 698846 and an IC 50 value of 9.79 pM for donor 698847.
- the irrelevant control protein did not block basophil activation from any of the tested donors.
- Example 6 An IL-33 Antagonist Inhibits IL-33-Mediated Cell Activation
- PBMCs peripheral blood mononuclear cells
- PBMCs were purified from fresh whole human blood from six different donors by density gradient centrifugation. Briefly, K2 EDTA whole blood was diluted two-fold in RPMI 1640, carefully layered over Ficoll-Paque (GE Healthcare, #17-1440-03) and centrifuged for 20 minutes. The interphase layer containing the PBMCs was aspirated, transferred to a new tube, and washed twice with PBS.
- the isolated PBMCs were plated (200 ⁇ per well) in round- bottom 96-well plates at a final concentration of 5x10 5 cells/mL in RPMI 1640 supplemented with 10% FBS, 2 mM L-glutamine, 100 U/mL penicillin, and 100 ⁇ g mL streptomycin.
- Table 12 IL-33 Induced IFNy Release From Human PBMC from four Donors.
- Human IL-33 in the presence of hlL-12, induced the release of IFNy from human total PBMC from the four different donors tested, with EC 50 values between 204 pM to 315 pM as shown in Table 12.
- the human IL-33 antagonist hST2-hlL1 RAcP-mFc blocked the release of IFNy from human PBMC induced by 260 pM IL-33, with IC 50 values ranging from 2.13 pM to 334 pM, as shown in Table 13.
- the irrelevant mlgG containing control protein did not demonstrate any measurable blockade of IFNy release in any of the donors tested.
- IA-CFA Complete Freund's Adjuvant
- mice received subcutaneous boost injections of 50 mg/kg of mST2-mll_1 RacP-mFc or 50 mg/kg of an isotype control antibody 24 hours prior to testing in a dynamic weight-bearing assay (BioSeb, Vitrolles, FR).
- mice that received IA-CFA all displayed significantly less (p ⁇ 0.05 by ANOVA) weight bearing on the affected limb.
- mice that received mST2- mlL1 RacP-mFc after IA-CFA administration demonstrated higher percent weight bearing and time spent on affected limb scores at all time points tested compared to the isotype control treated mice after IA-CFA administration as shown in Tables 14 and 15.
- mice treated with mST2-mll_1 RacP-mFc after IA-CFA administration demonstrated more "moderate” and less "severe” knee joints compared to the isotype control treated mice after IA-CFA administration.
- This example therefore indicates that the IL-33 antagonists of the invention are useful in alleviating inflammatory joint pain.
Abstract
Description
Claims
Priority Applications (11)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2014240101A AU2014240101B2 (en) | 2013-03-15 | 2014-03-14 | IL-33 antagonists and uses thereof |
EA201591331A EA034834B1 (en) | 2013-03-15 | 2014-03-14 | Il-33 antagonists and uses thereof |
MX2015011408A MX364591B (en) | 2013-03-15 | 2014-03-14 | Il-33 antagonists and uses thereof. |
KR1020157022680A KR20150127591A (en) | 2013-03-15 | 2014-03-14 | Il-33 antagonists and uses thereof |
JP2016502323A JP6404314B2 (en) | 2013-03-15 | 2014-03-14 | IL-33 antagonists and uses thereof |
CA2904377A CA2904377C (en) | 2013-03-15 | 2014-03-14 | Il-33 antagonists and uses thereof |
CN201480013599.0A CN105007929B (en) | 2013-03-15 | 2014-03-14 | IL-33 antagonist and its purposes |
EP14718264.6A EP2968454B1 (en) | 2013-03-15 | 2014-03-14 | Il-33 antagonists and uses thereof |
NZ712651A NZ712651B2 (en) | 2013-03-15 | 2014-03-14 | Il-33 antagonists and uses thereof |
IL240393A IL240393B (en) | 2013-03-15 | 2015-08-06 | Il-33 antagonists and uses thereof |
HK16108449.2A HK1220373A1 (en) | 2013-03-15 | 2016-07-18 | Il-33 antagonists and uses thereof il-33 |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361787121P | 2013-03-15 | 2013-03-15 | |
US61/787,121 | 2013-03-15 | ||
US201361819029P | 2013-05-03 | 2013-05-03 | |
US61/819,029 | 2013-05-03 | ||
US201361913417P | 2013-12-09 | 2013-12-09 | |
US61/913,417 | 2013-12-09 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2014152195A1 true WO2014152195A1 (en) | 2014-09-25 |
Family
ID=50513479
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2014/027058 WO2014152195A1 (en) | 2013-03-15 | 2014-03-14 | Il-33 antagonists and uses thereof |
Country Status (12)
Country | Link |
---|---|
US (3) | US9637535B2 (en) |
EP (1) | EP2968454B1 (en) |
JP (1) | JP6404314B2 (en) |
KR (1) | KR20150127591A (en) |
CN (1) | CN105007929B (en) |
AU (1) | AU2014240101B2 (en) |
CA (1) | CA2904377C (en) |
EA (1) | EA034834B1 (en) |
HK (1) | HK1220373A1 (en) |
IL (1) | IL240393B (en) |
MX (1) | MX364591B (en) |
WO (1) | WO2014152195A1 (en) |
Cited By (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015164354A1 (en) | 2014-04-21 | 2015-10-29 | The Childen's Hospital Of Philadelphia | Compositions and methods for treating cytokine-related disorders |
WO2016077366A1 (en) | 2014-11-10 | 2016-05-19 | Genentec, Inc. | Therapeutic and diagnostic methods for il-33-mediated disorders |
WO2016077381A1 (en) | 2014-11-10 | 2016-05-19 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
US9453072B2 (en) | 2013-03-13 | 2016-09-27 | Regeneron Pharmaceuticals, Inc. | Anti-IL-33 antibodies |
US9637535B2 (en) | 2013-03-15 | 2017-05-02 | Regeneron Pharmaceuticals, Inc. | IL-33 antagonists and uses thereof |
WO2018102597A1 (en) | 2016-12-01 | 2018-06-07 | Regeneron Pharmaceuticals, Inc. | Methods of treating inflammatory conditions |
WO2018148585A1 (en) | 2017-02-10 | 2018-08-16 | Genentech, Inc. | Anti-tryptase antibodies, compositions thereof, and uses thereof |
US10059764B2 (en) | 2014-01-10 | 2018-08-28 | Anaptysbio, Inc. | Antibodies directed against interleukin-33 (IL-33) and methods of making and using |
WO2018190990A1 (en) | 2017-04-13 | 2018-10-18 | Regeneron Pharmaceuticals, Inc. | Treatment and inhibition of inflammatory lung diseases in patients having risk alleles in the genes encoding il33 and il1rl1 |
WO2019157358A1 (en) | 2018-02-09 | 2019-08-15 | Genentech, Inc. | Therapeutic and diagnostic methods for mast cell-mediated inflammatory diseases |
WO2019199910A1 (en) | 2018-04-11 | 2019-10-17 | Regeneron Pharmaceuticals, Inc. | Methods for quantifying il-33 |
US10544212B2 (en) | 2016-04-27 | 2020-01-28 | Pfizer Inc. | Anti-IL-33 antibodies, compositions, methods and uses thereof |
WO2021183849A1 (en) | 2020-03-13 | 2021-09-16 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
WO2021180858A1 (en) | 2020-03-13 | 2021-09-16 | Medimmune Limited | Therapeutic methods for the treatment of subjects with risk alelles in il33 |
WO2021204707A1 (en) | 2020-04-06 | 2021-10-14 | Medimmune Limited | Treating acute respiratory distress syndrome with il-33 axis binding antagonists |
US11492398B2 (en) | 2017-08-31 | 2022-11-08 | Mitsubishi Tanabe Pharma Corporation | IL-33 antagonist-containing therapeutic agent for endometriosis |
WO2023086807A1 (en) | 2021-11-10 | 2023-05-19 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
US11725049B2 (en) | 2013-12-26 | 2023-08-15 | Mitsubishi Tanabe Pharma Corporation | Human anti-IL-33 neutralizing monoclonal antibody |
Families Citing this family (47)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AR095196A1 (en) | 2013-03-15 | 2015-09-30 | Regeneron Pharma | SERUM FREE CELL CULTIVATION MEDIA |
AU2013400609B9 (en) | 2013-09-13 | 2020-03-05 | Beigene Switzerland Gmbh | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
WO2016000619A1 (en) | 2014-07-03 | 2016-01-07 | Beigene, Ltd. | Anti-pd-l1 antibodies and their use as therapeutics and diagnostics |
NZ728688A (en) | 2014-07-22 | 2023-06-30 | Cb Therapeutics Inc | Anti-pd-1 antibodies |
RU2722212C9 (en) | 2014-08-05 | 2020-07-23 | СиБи ТЕРЕПЬЮТИКС, ИНК. | Anti-pd-1 antibody |
EP3265493B1 (en) | 2015-03-02 | 2024-01-10 | 180 Therapeutics LP | Method of treating a localized fibrotic disorder using an il-33 antagonist |
TW202340452A (en) | 2015-08-04 | 2023-10-16 | 美商再生元醫藥公司 | Taurine supplemented cell culture medium and methods of use |
US10005834B2 (en) * | 2015-10-06 | 2018-06-26 | Regeneron Pharmaceuticals, Inc. | Biomarkers related to interleukin-33 (IL-33)-mediated diseases and uses thereof |
WO2017087838A2 (en) * | 2015-11-19 | 2017-05-26 | George Mason University | Dual inhibitory action peptidomimetic inhibitor for il-33 and il-1beta |
BR112018014247A2 (en) * | 2016-01-14 | 2018-12-18 | Anaptysbio Inc | allergic reaction inhibition using an il-33 inhibitor |
CN109475536B (en) | 2016-07-05 | 2022-05-27 | 百济神州有限公司 | Combination of a PD-l antagonist and a RAF inhibitor for the treatment of cancer |
CN106198953B (en) * | 2016-07-19 | 2018-06-29 | 重庆医科大学 | Purposes of the interleukin-33 in Diagnosis of pulmonary source property acute lung injury kit is prepared |
EP4353747A2 (en) | 2016-08-19 | 2024-04-17 | BeiGene Switzerland GmbH | Combination of zanubrutinib with an anti-cd20 or an anti-pd-1 antibody for use in treating cancer |
WO2018039499A1 (en) | 2016-08-24 | 2018-03-01 | Regeneron Pharmaceuticals, Inc. | Host cell protein modification |
WO2018137681A1 (en) | 2017-01-25 | 2018-08-02 | Beigene, Ltd. | Crystalline forms of (s) -7- (1- (but-2-ynoyl) piperidin-4-yl) -2- (4-phenoxyphenyl) -4, 5, 6, 7-tetrahy dropyrazolo [1, 5-a] pyrimidine-3-carboxamide, preparation, and uses thereof |
US10093731B2 (en) | 2017-02-24 | 2018-10-09 | Kindred Biosciences, Inc. | Anti-IL31 antibodies for veterinary use |
US11248054B2 (en) | 2017-06-12 | 2022-02-15 | Bluefin Biomedicine, Inc. | Anti-IL1RAP antibodies and antibody drug conjugates |
US11597768B2 (en) | 2017-06-26 | 2023-03-07 | Beigene, Ltd. | Immunotherapy for hepatocellular carcinoma |
TW201934570A (en) | 2017-07-06 | 2019-09-01 | 美商雷傑納榮製藥公司 | Cell culture process for making a glycoprotein |
CN111801334B (en) | 2017-11-29 | 2023-06-09 | 百济神州瑞士有限责任公司 | Treatment of indolent or invasive B-cell lymphomas using combinations comprising BTK inhibitors |
MX2020006639A (en) | 2017-12-22 | 2020-09-14 | Regeneron Pharma | System and method for characterizing drug product impurities. |
EP3746471A1 (en) | 2018-01-31 | 2020-12-09 | Regeneron Pharmaceuticals, Inc. | System and method for characterizing size and charge variant drug product impurities |
TW202311746A (en) | 2018-02-02 | 2023-03-16 | 美商再生元醫藥公司 | System and method for characterizing protein dimerization |
MX2020008988A (en) | 2018-02-28 | 2020-09-28 | Regeneron Pharma | Systems and methods for identifying viral contaminants. |
EP4317959A3 (en) | 2018-03-19 | 2024-03-27 | Regeneron Pharmaceuticals, Inc. | Microchip capillary electrophoresis assays and reagents |
TW202016125A (en) | 2018-05-10 | 2020-05-01 | 美商再生元醫藥公司 | Systems and methods for quantifying and modifying protein viscosity |
MX2021002279A (en) | 2018-08-27 | 2021-05-27 | Regeneron Pharma | Use of raman spectroscopy in downstream purification. |
CN112601963A (en) | 2018-08-30 | 2021-04-02 | 瑞泽恩制药公司 | Method for characterizing protein complexes |
MX2021008589A (en) | 2019-01-16 | 2021-08-11 | Regeneron Pharma | Methods for identifying free thiols in proteins. |
CN113785203A (en) | 2019-05-13 | 2021-12-10 | 里珍纳龙药品有限公司 | Improved competitive ligand binding assays |
MX2022003438A (en) | 2019-09-24 | 2022-04-19 | Regeneron Pharma | Systems and methods for chromatography use and regeneration. |
BR112022009974A2 (en) | 2019-11-25 | 2022-08-16 | Regeneron Pharma | METHODS OF PRODUCTION OF A POLYMER OR POLYMER-COATED MICROPARTICLES, TO PRODUCE POLYMERIC OR POLYMER-COATED MICROSPHERES, AND TO PRODUCE MICROPARTICLES, SUSTAINED RELEASE COMPOSITION, MICROPARTICLES, AND, PHARMACEUTICAL COMPOSITION |
US11835527B2 (en) | 2020-01-21 | 2023-12-05 | Regeneron Pharmaceuticals, Inc. | Deglycosylation methods for electrophoresis of glycosylated proteins |
IL300828A (en) | 2020-08-31 | 2023-04-01 | Regeneron Pharma | Asparagine feed strategies to improve cell culture performance and mitigate asparagine sequence variants |
EP4251128A1 (en) | 2020-11-25 | 2023-10-04 | Regeneron Pharmaceuticals, Inc. | Sustained release formulations using non-aqueous membrane emulsification |
US20220257707A1 (en) | 2020-12-17 | 2022-08-18 | Regeneron Pharmaceuticals, Inc. | Fabrication of protein-encapsulating microgels |
CN116761880A (en) | 2021-01-20 | 2023-09-15 | 瑞泽恩制药公司 | Method for improving protein titer in cell culture |
EP4302098A1 (en) | 2021-03-03 | 2024-01-10 | Regeneron Pharmaceuticals, Inc. | Systems and methods for quantifying and modifying protein viscosity |
CA3211302A1 (en) | 2021-03-26 | 2022-09-29 | Ross Kenyon | Methods and systems for developing mixing protocols |
TW202314240A (en) | 2021-06-01 | 2023-04-01 | 美商再生元醫藥公司 | Microchip capillary electrophoresis assays and reagents |
WO2023009975A2 (en) * | 2021-07-24 | 2023-02-02 | Anwita Biosciences, Inc. | Fusion proteins comprising suppression of tumorigenicity 2 or interleukin-33, pharmaceutical compositions, and therapeutic applications |
TW202326138A (en) | 2021-09-08 | 2023-07-01 | 美商再生元醫藥公司 | A high-throughput and mass-spectrometry-based method for quantitating antibodies and other fc-containing proteins |
WO2023044139A1 (en) | 2021-09-20 | 2023-03-23 | Regeneron Pharmaceuticals, Inc. | Methods of controlling antibody heterogeneity |
US20230116199A1 (en) | 2021-10-07 | 2023-04-13 | Regeneron Pharmaceuticals, Inc. | Systems and methods of ph modeling and control |
CA3230985A1 (en) | 2021-10-07 | 2023-04-13 | Ross BROWNE | Ph meter calibration and correction |
US20230129265A1 (en) | 2021-10-26 | 2023-04-27 | Regeneron Pharmaceuticals, Inc. | Systems and methods for generating laboratory water and distributing laboratory water at different temperatures |
US20230296559A1 (en) | 2022-03-18 | 2023-09-21 | Regeneron Pharmaceuticals, Inc. | Methods and systems for analyzing polypeptide variants |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5576191A (en) * | 1994-06-17 | 1996-11-19 | Immunex Corporation | Cytokine that binds ST2 |
US20070087411A1 (en) * | 2005-10-19 | 2007-04-19 | Prerna Sharma | Monomeric self-associating fusion polypeptides and therapeutic uses thereof |
US20090041718A1 (en) | 2004-02-17 | 2009-02-12 | Schering Corporation | Methods of Modulating Cytokine Activity; Related Reagents |
US20100260770A1 (en) | 2007-05-18 | 2010-10-14 | Medimmune, Llc | Il-33 in inflammatory disease |
Family Cites Families (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US1000056A (en) | 1910-11-03 | 1911-08-08 | Carlos Van Bergh | Threshing-machine. |
US1001164A (en) | 1911-06-09 | 1911-08-22 | Arthur W Porter | Cotton-sweep. |
IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
JP4124480B2 (en) | 1991-06-14 | 2008-07-23 | ジェネンテック・インコーポレーテッド | Immunoglobulin variants |
AU2003299441A1 (en) | 2002-12-19 | 2004-07-14 | Centre National De La Recherche Scientifique - Cnrs | Nf-hev compositions and methods of use |
US8865645B2 (en) * | 2006-05-24 | 2014-10-21 | Biogen Idec Ma Inc. | Method of treating lung fibrosis using ST2 polypeptide |
AT502353B1 (en) | 2006-06-29 | 2007-07-15 | Avl List Gmbh | Combined humidifier and heat exchanger unit for e.g. proton exchange membrane-fuel cell, has feed line with branch lines that are conducted across heat exchanger integrated into coolant circuit of low-temperature fuel cell |
US7560530B1 (en) | 2006-07-20 | 2009-07-14 | Schering Corporation | IL-33 receptor |
US8119771B2 (en) * | 2007-04-26 | 2012-02-21 | The Provost, Fellow and Scholars of the College of the Holy and Undivided Trinity of Queen Elizabeth, Near Dublin | Products for altering IL-33 activity and methods thereof |
EP2211905A1 (en) | 2007-10-26 | 2010-08-04 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. | Inhibitors of caspase i-dependent cytokines in the treatment of neurodegenerative disorders |
AU2009231733B2 (en) * | 2008-03-31 | 2015-12-24 | Genentech, Inc. | Compositions and methods for treating and diagnosing asthma |
WO2011031600A1 (en) | 2009-09-10 | 2011-03-17 | Schering Corporation | Use of il-33 antagonists to treat fibrotic disease |
US9090694B2 (en) | 2012-04-30 | 2015-07-28 | Janssen Biotech, Inc. | ST2L antibody antagonists |
AR091069A1 (en) | 2012-05-18 | 2014-12-30 | Amgen Inc | PROTEINS OF UNION TO ANTIGEN DIRECTED AGAINST THE ST2 RECEIVER |
JO3532B1 (en) | 2013-03-13 | 2020-07-05 | Regeneron Pharma | Anti-il-33 antibodies and uses thereof |
WO2014152195A1 (en) | 2013-03-15 | 2014-09-25 | Regeneron Pharmaceuticals, Inc. | Il-33 antagonists and uses thereof |
WO2015099175A1 (en) | 2013-12-26 | 2015-07-02 | 田辺三菱製薬株式会社 | Human anti-il-33 neutralizing monoclonal antibody |
RU2019118984A (en) | 2014-01-10 | 2019-08-06 | Анаптисбайо, Инк. | ANTIBODIES AIMED AGAINST INTERLEUKIN-33 (IL-33) |
-
2014
- 2014-03-14 WO PCT/US2014/027058 patent/WO2014152195A1/en active Application Filing
- 2014-03-14 US US14/210,599 patent/US9637535B2/en active Active
- 2014-03-14 JP JP2016502323A patent/JP6404314B2/en active Active
- 2014-03-14 CN CN201480013599.0A patent/CN105007929B/en not_active Expired - Fee Related
- 2014-03-14 KR KR1020157022680A patent/KR20150127591A/en active IP Right Grant
- 2014-03-14 EA EA201591331A patent/EA034834B1/en not_active IP Right Cessation
- 2014-03-14 AU AU2014240101A patent/AU2014240101B2/en active Active
- 2014-03-14 CA CA2904377A patent/CA2904377C/en active Active
- 2014-03-14 MX MX2015011408A patent/MX364591B/en active IP Right Grant
- 2014-03-14 EP EP14718264.6A patent/EP2968454B1/en active Active
-
2015
- 2015-08-06 IL IL240393A patent/IL240393B/en active IP Right Grant
-
2016
- 2016-07-18 HK HK16108449.2A patent/HK1220373A1/en unknown
-
2017
- 2017-03-20 US US15/463,910 patent/US10011647B2/en active Active
-
2018
- 2018-05-29 US US15/991,763 patent/US10774128B2/en active Active
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5576191A (en) * | 1994-06-17 | 1996-11-19 | Immunex Corporation | Cytokine that binds ST2 |
US20090041718A1 (en) | 2004-02-17 | 2009-02-12 | Schering Corporation | Methods of Modulating Cytokine Activity; Related Reagents |
US20070087411A1 (en) * | 2005-10-19 | 2007-04-19 | Prerna Sharma | Monomeric self-associating fusion polypeptides and therapeutic uses thereof |
US20100260770A1 (en) | 2007-05-18 | 2010-10-14 | Medimmune, Llc | Il-33 in inflammatory disease |
Non-Patent Citations (21)
Title |
---|
"Medical Applications of Controlled Release", 1974, CRC PRES |
ALI S ET AL: "Caspase 3 inactivates biologically active full length interleukin-33 as a classical cytokine but does not prohibit nuclear translocation", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ACADEMIC PRESS INC. ORLANDO, FL, US, vol. 391, no. 3, 15 January 2010 (2010-01-15), pages 1512 - 1516, XP026854479, ISSN: 0006-291X, [retrieved on 20100114], DOI: 10.1016/J.BBRC.2009.12.107 * |
CHOE, JY, J. EXP. MED., vol. 197, no. 4, 17 February 2003 (2003-02-17), pages 537 - 542 |
FOO Y LIEW ET AL: "Disease-associated functions of IL-33: the new kid in the IL-1 family", NATURE REVIEWS. IMMUNOLOGY, NATURE PUBLISHING GROUP, UNITED KINGDOM, vol. 10, no. 2, 1 February 2010 (2010-02-01), pages 103 - 110, XP002658775, ISSN: 1474-1741, [retrieved on 20100118], DOI: 10.1038/NRI2692 * |
GOODSON, MEDICAL APPLICATIONS OF CONTROLLED RELEASE, vol. 2, 1984, pages 115 - 138 |
H. HAYAKAWA ET AL: "Soluble ST2 Blocks Interleukin-33 Signaling in Allergic Airway Inflammation", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 282, no. 36, 1 January 2007 (2007-01-01), pages 26369 - 26380, XP055030354, ISSN: 0021-9258, DOI: 10.1074/jbc.M704916200 * |
KAKKAR; LEE, NAT REV DRUG DISCOVERY, vol. 7, no. 10, October 2008 (2008-10-01), pages 827 - 840 |
KAKKAR; LEE, NATURE REVIEWS - DRUG DISCOVERY, vol. 7, no. 10, 2008, pages 827 - 840 |
KWANGWON HONG ET AL: "The inhibitory function of Fc-ST2 depends on cell type; IL-1RAcP and ST2 are necessary but insufficient for IL-33 activity", IMMUNOLOGIC RESEARCH, vol. 56, no. 1, 23 February 2013 (2013-02-23), pages 122 - 130, XP055123041, ISSN: 0257-277X, DOI: 10.1007/s12026-013-8388-9 * |
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
LIEW ET AL., NATURE REVIEWS - IMMUNOLOGY, vol. 10, 2010, pages 103 - 110 |
LÖHNING M ET AL: "T1/ST2 is preferentially expressed on murine Th2 cells, independent of IL-4, IL-5, and IL-10, and important for Th2 effector function", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 95, no. 12, 1 June 1998 (1998-06-01), pages 6930 - 6935, XP002101454, ISSN: 0027-8424, DOI: 10.1073/PNAS.95.12.6930 * |
MORDENTI ET AL., PHARMACEUT. RES., vol. 8, 1991, pages 1351 |
PALMER G ET AL: "The IL-1 receptor accessory protein (AcP) is required for IL-33 signaling and soluble AcP enhances the ability of soluble ST2 to inhibit IL-33", CYTOKINE, ACADEMIC PRESS LTD, PHILADELPHIA, PA, US, vol. 42, no. 3, 1 June 2008 (2008-06-01), pages 358 - 364, XP022696634, ISSN: 1043-4666, [retrieved on 20080502], DOI: 10.1016/J.CYTO.2008.03.008 * |
PALMER GABY ET AL: "Interleukin-33 biology with potential insights into human diseases.", NATURE REVIEWS. RHEUMATOLOGY JUN 2011, vol. 7, no. 6, June 2011 (2011-06-01), pages 321 - 329, XP009178467, ISSN: 1759-4804 * |
POWELL ET AL.: "Compendium of excipients for parenteral formulations", J PHARM SCI TECHNOL, vol. 52, 1998, pages 238 - 311, XP009119027 |
SCHMITZ ET AL., IMMUNITY, vol. 23, 2005, pages 479 - 490 |
SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1987, pages 201 |
SHAFAQAT ALI: "Characterization of Interleukin-33 and IL-33 Receptor Complex", DISSERTATION,, 1 July 2009 (2009-07-01), pages 1 - 126, XP009169477 * |
SMITHGALL ET AL., INTERNATIONAL IMMUNOLOGY, vol. 20, no. 8, 2008, pages 1019 - 1030 |
WU ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 4429 - 4432 |
Cited By (34)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10519230B2 (en) | 2013-03-13 | 2019-12-31 | Regeneron Pharmaceuticals, Inc. | Nucleic acids encoding IL-33 antibodies |
US9453072B2 (en) | 2013-03-13 | 2016-09-27 | Regeneron Pharmaceuticals, Inc. | Anti-IL-33 antibodies |
US11104729B2 (en) | 2013-03-13 | 2021-08-31 | Regeneron Pharmaceuticals, Inc. | Anti-IL-33 antibodies and uses thereof |
US10000564B2 (en) | 2013-03-13 | 2018-06-19 | Regeneron Pharmaceuticals, Inc. | Methods of treating an inflammatory condition or sensitivity to an allergen with anti-IL-33 antibodies |
US10011647B2 (en) | 2013-03-15 | 2018-07-03 | Regeneron Pharmaceuticals, Inc. | IL-33 antagonists and uses thereof |
US10774128B2 (en) | 2013-03-15 | 2020-09-15 | Regeneron Pharmaceuticals, Inc. | IL-33 antagonists and uses thereof |
US9637535B2 (en) | 2013-03-15 | 2017-05-02 | Regeneron Pharmaceuticals, Inc. | IL-33 antagonists and uses thereof |
US11725049B2 (en) | 2013-12-26 | 2023-08-15 | Mitsubishi Tanabe Pharma Corporation | Human anti-IL-33 neutralizing monoclonal antibody |
US10059764B2 (en) | 2014-01-10 | 2018-08-28 | Anaptysbio, Inc. | Antibodies directed against interleukin-33 (IL-33) and methods of making and using |
US10836820B2 (en) | 2014-01-10 | 2020-11-17 | Anaptysbio, Inc. | Method of treating inflammatory disorder with antibodies directed against interleukin-33 (IL-33) |
WO2015164354A1 (en) | 2014-04-21 | 2015-10-29 | The Childen's Hospital Of Philadelphia | Compositions and methods for treating cytokine-related disorders |
US10093730B2 (en) | 2014-11-10 | 2018-10-09 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
EP3783023A1 (en) | 2014-11-10 | 2021-02-24 | H. Hoffnabb-La Roche Ag | Anti-interleukin-33 antibodies and uses thereof |
US11725050B2 (en) | 2014-11-10 | 2023-08-15 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
WO2016077381A1 (en) | 2014-11-10 | 2016-05-19 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
US11708608B2 (en) | 2014-11-10 | 2023-07-25 | Genentech, Inc. | Therapeutic and diagnostic methods for IL-33-mediated disorders |
US10723795B2 (en) | 2014-11-10 | 2020-07-28 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
WO2016077366A1 (en) | 2014-11-10 | 2016-05-19 | Genentec, Inc. | Therapeutic and diagnostic methods for il-33-mediated disorders |
US10544212B2 (en) | 2016-04-27 | 2020-01-28 | Pfizer Inc. | Anti-IL-33 antibodies, compositions, methods and uses thereof |
US10815305B2 (en) | 2016-12-01 | 2020-10-27 | Regeneron Pharmaceuticals, Inc. | Methods of treating inflammatory conditions |
US11866503B2 (en) | 2016-12-01 | 2024-01-09 | Regeneron Pharmaceuticals, Inc. | Methods for treating inflammatory conditions of the airway or lungs by administering antagonist monoclonal antibodies to interleukin-33 and interleukin-4 receptor |
WO2018102597A1 (en) | 2016-12-01 | 2018-06-07 | Regeneron Pharmaceuticals, Inc. | Methods of treating inflammatory conditions |
WO2018148585A1 (en) | 2017-02-10 | 2018-08-16 | Genentech, Inc. | Anti-tryptase antibodies, compositions thereof, and uses thereof |
EP3957752A2 (en) | 2017-04-13 | 2022-02-23 | Regeneron Pharmaceuticals, Inc. | Treatment and inhibition of inflammatory lung diseases in patients having risk alleles in the genes encoding il33 and il1rl1 |
US11708415B2 (en) | 2017-04-13 | 2023-07-25 | Regeneron Pharmaceuticals, Inc. | Treatment and inhibition of inflammatory lung diseases in patients having risk alleles in the genes encoding IL33 and IL1RL1 |
WO2018190990A1 (en) | 2017-04-13 | 2018-10-18 | Regeneron Pharmaceuticals, Inc. | Treatment and inhibition of inflammatory lung diseases in patients having risk alleles in the genes encoding il33 and il1rl1 |
US11492398B2 (en) | 2017-08-31 | 2022-11-08 | Mitsubishi Tanabe Pharma Corporation | IL-33 antagonist-containing therapeutic agent for endometriosis |
WO2019157358A1 (en) | 2018-02-09 | 2019-08-15 | Genentech, Inc. | Therapeutic and diagnostic methods for mast cell-mediated inflammatory diseases |
WO2019199910A1 (en) | 2018-04-11 | 2019-10-17 | Regeneron Pharmaceuticals, Inc. | Methods for quantifying il-33 |
WO2021180858A1 (en) | 2020-03-13 | 2021-09-16 | Medimmune Limited | Therapeutic methods for the treatment of subjects with risk alelles in il33 |
WO2021183849A1 (en) | 2020-03-13 | 2021-09-16 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
US11760797B2 (en) | 2020-03-13 | 2023-09-19 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
WO2021204707A1 (en) | 2020-04-06 | 2021-10-14 | Medimmune Limited | Treating acute respiratory distress syndrome with il-33 axis binding antagonists |
WO2023086807A1 (en) | 2021-11-10 | 2023-05-19 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
CA2904377A1 (en) | 2014-09-25 |
CA2904377C (en) | 2021-07-13 |
JP6404314B2 (en) | 2018-10-10 |
AU2014240101B2 (en) | 2018-05-17 |
NZ712651A (en) | 2021-04-30 |
EA034834B1 (en) | 2020-03-26 |
CN105007929A (en) | 2015-10-28 |
US20180265567A1 (en) | 2018-09-20 |
EA201591331A1 (en) | 2016-01-29 |
HK1220373A1 (en) | 2017-05-05 |
EP2968454B1 (en) | 2019-02-13 |
IL240393A0 (en) | 2015-09-24 |
US10011647B2 (en) | 2018-07-03 |
AU2014240101A1 (en) | 2015-10-15 |
IL240393B (en) | 2019-03-31 |
US20170204158A1 (en) | 2017-07-20 |
MX364591B (en) | 2019-05-02 |
US10774128B2 (en) | 2020-09-15 |
KR20150127591A (en) | 2015-11-17 |
JP2016515130A (en) | 2016-05-26 |
EP2968454A1 (en) | 2016-01-20 |
US20140271642A1 (en) | 2014-09-18 |
MX2015011408A (en) | 2016-04-27 |
US9637535B2 (en) | 2017-05-02 |
CN105007929B (en) | 2019-05-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10774128B2 (en) | IL-33 antagonists and uses thereof | |
JP7132220B2 (en) | Methods of treating inflammatory conditions | |
US20180251542A1 (en) | Anti-IL-33 Antibodies and Uses Thereof | |
JP6916319B2 (en) | Anti-IL-25 antibody and its use | |
NZ712651B2 (en) | Il-33 antagonists and uses thereof | |
NZ710831B2 (en) | Anti-il-33 antibodies and uses thereof | |
BR112015020470B1 (en) | ISOLATED HUMAN MONOCLONAL ANTI-IL-33 ANTIBODY OR ANTIGEN-BINDING FRAGMENT THEREOF, ITS USES, ISOLATED NUCLEIC ACID MOLECULE, EXPRESSION VECTOR, AND PHARMACEUTICAL COMPOSITION |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14718264 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 240393 Country of ref document: IL |
|
WWE | Wipo information: entry into national phase |
Ref document number: 201591331 Country of ref document: EA |
|
ENP | Entry into the national phase |
Ref document number: 20157022680 Country of ref document: KR Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/011408 Country of ref document: MX |
|
ENP | Entry into the national phase |
Ref document number: 2904377 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2016502323 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2014718264 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2014240101 Country of ref document: AU Date of ref document: 20140314 Kind code of ref document: A |