WO2014145706A2 - A recombinant fusion protein possessing nuclease and phosphatase activity - Google Patents
A recombinant fusion protein possessing nuclease and phosphatase activity Download PDFInfo
- Publication number
- WO2014145706A2 WO2014145706A2 PCT/US2014/030515 US2014030515W WO2014145706A2 WO 2014145706 A2 WO2014145706 A2 WO 2014145706A2 US 2014030515 W US2014030515 W US 2014030515W WO 2014145706 A2 WO2014145706 A2 WO 2014145706A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fusion protein
- activity
- recombinant fusion
- phosphatase
- exonuclease
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/03—Phosphoric monoester hydrolases (3.1.3)
- C12Y301/03001—Alkaline phosphatase (3.1.3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/11—Exodeoxyribonucleases producing 5'-phosphomonoesters (3.1.11)
- C12Y301/11001—Exodeoxyribonuclease I (3.1.11.1)
Definitions
- Nucleases are useful reagents for removing unwanted nucleic acids from protein preparations. Descriptions of certain nucleases and their preparation by cloning are provided by Eaves et al. (J. Bacteriol. 85:273-8 (1963)), Filimonova et al. (Biochem. Mol. Biol. Int. 33(6): 1229-36 (1994)), Ball et. al. ⁇ Gene 57(2-3): 183-92 (1987), Molin et. al. (U.S. Pat. No. 5,173,4185), and Friedhoff et al. (Protein Expr. Purif. 5(l):37-43 (1994)).
- Exonuclease I digests single-stranded DNA in a 3' to 5 'direction producing 5' mononucleotides. This enzyme is particularly useful in preparing amplified DNA products, such as PCR products, for sequencing. It degrades residual primers from the amplification reaction that would otherwise be carried over into the sequencing reaction.
- U.S. Pat. Nos. 5,741,676 and 5,756,285 generally disclose methods for DNA sequencing via amplification, both of which are hereby incorporated herein by reference. (See also R. L. Olsen et al., Comp. Biochem. Physiol, vol. 99B, No. 4, pp. 755-761 (1991)).
- Amplification primers carried over into a sequencing reaction could act as sequencing primers and generate sequencing reaction products, thereby creating a
- Exonuclease I concentration and specific activity (purity) of commercially available Exonuclease I may vary over a wide range. Commonly the enzyme is manufactured to a specific activity between 50,000 and 150,000 units of enzyme per mg and supplied for the purpose of processing amplified DNA at a concentration around 10 units per microliter. Enzyme with either higher or lower specific activity and either more or less concentrated could be employed in the described applications by suitable alterations in the applied protocol, such as adding less or more volume (or amount) of enzyme, respectively.
- Alkaline Phosphatases as exemplified by Shrimp Alkaline Phosphatase (SAP) and Calf Intestinal Alkaline Phosphatase (CIP), catalyze the hydrolysis of 5'-phosphate residues from DNA, R A, and ribo- and deoxyribonucleoside triphosphates (dNTPs or nucleotide triphosphates).
- SAP is particularly useful in preparing amplified products, such as PCR products, for sequencing because it can readily be inactivated by heat prior to performing a sequencing reaction. SAP degrades residual dNTPs from the amplification reaction.
- dNTPs are carried over from the amplification reaction to the sequencing reaction, they add to, and thereby alter, the concentration of dNTPs in the sequencing reaction in an indeterminant and non-reproducible fashion. Since, within narrow limits, high quality sequencing requires specific ratios between the sequencing reaction dNTPs and ddNTPs, an alteration in the concentration of dNTPs may result in faint sequencing reaction signals.
- a novel recombinant fusion protein possesses two enzymatic activities, a nuclease activity and a phosphatase activity. Methods for the isolation and use of this novel protein are also disclosed.
- Figure 1 depicts a scheme for isolating the chimeric nuclease/phosphatase fusion protein.
- Figure 2 depicts a SDS-PAGE analysis at the indicated stages and fractions.
- Figure 3 depicts (A) a SDS-PAGE analysis of the indicated fraction, (B) buffer volume and the absorbance at 260 nm and 280 nm at various buffer volumes witnessed on the POROS® HS cation exchange column, and (C) buffer volume and the absorbance at 260 nm and 280 nm at various buffer volumes witnessed on the POROS® HQ cation exchange column.
- Figure 4 depicts (A) a SDS-PAGE analysis of fractions collected from the
- POROS® HS cation exchange column and indicates the fractions that were pooled
- B buffer volume and the absorbance at 260 nm and 280 nm at various buffer volumes witnessed on the POROS® HS cation exchange column
- C a SDS-PAGE analysis of fractions collected from the POROS® HQ cation exchange column and indicates the fractions that were pooled
- D buffer volume and the absorbance at 260 nm and 280 nm at various buffer volumes witnessed on the POROS® HQ cation exchange column.
- Figure 5 depicts the Quality Value (QV) score, which represents a per-base estimate of base call accuracy, and electropherograms at the indicated molar concentration of chimeric exonuclease/phosphatase fusion protein and controls.
- QV Quality Value
- Figure 6 depicts an electropherogram from a MicroSeq® reaction using ExoSAP- IT®.
- Figure 7 depicts an electropherogram for a MicroSeq® reaction using the recombinant fusion protein (SEQ ID NO. 2) in place of ExoSAP-IT®.
- Figure 8 depicts an electropherogram from a MicroSeq® "fast” reaction using ExoSAP-IT®.
- Figure 9 depicts an electropherogram from a MicroSeq® "fast” reaction using the recombinant fusion protein (SEQ ID NO. 2) in place of ExoSAP-IT®.
- a recombinant fusion protein indicates that the nucleotide sequence or arrangement of its parts is not a native configuration, and has been manipulated by molecular biological techniques.
- the term implies that the DNA molecule is comprised of segments of DNA that have been artificially joined together, for example, the polynucleotide encoding a nuclease and a phosphatase activity disclosed herein.
- Protocols and reagents to manipulate nucleic acids are common and routine in the art (See e.g., Maniatis et al. (eds.), Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY, 1982; Sambrook et al. (eds.), Molecular Cloning: A Laboratory Manual, Second Edition, Volumes 1-3, Cold Spring Harbor Laboratory Press, NY, 1989; and Ausubel et al. (eds.), Current Protocols in Molecular Biology, Vol. 1-4, John Wiley & Sons, Inc., New York 1994; all of which are herein incorporated by reference).
- Fusion protein refers to a polypeptide composed of a plurality of components, unjoined in their native state but are joined to form a single continuous polypeptide.
- a "recombinant protein” or “recombinant polypeptide” refers to a protein molecule that is expressed from a recombinant DNA molecule. Use of these terms indicates that the primary amino acid sequence, arrangement of its domains or nucleic acid elements which control its expression are not native, and have been manipulated by molecular biology techniques. As indicated above, techniques to manipulate recombinant proteins are also common and routine in the art.
- protein refers to a full-length protein, a portion of a protein, or a peptide. Proteins can be produced via fragmentation of larger proteins, or chemically synthesized. Proteins may, for example, be prepared by recombinant
- Proteins to be placed in a protein microarray of the invention may be, for example, are fusion proteins, for example with at least one affinity tag to aid in purification and/or immobilization.
- at least 2 tags are present on the protein, one of which can be used to aid in purification and the other can be used to aid in immobilization.
- the tag is a His tag, a GST tag, or a biotin tag.
- the tag is a biotin tag
- the tag can be associated with a protein in vitro or in vivo using commercially available reagents (Invitrogen, Carlsbad, Calif).
- a Bioease tag can be used (Invitrogen, Carlsbad, Calif).
- peptide As used herein, the term “peptide,” “oligopeptide,” and “polypeptide” are used interchangeably with protein herein and refer to a sequence of contiguous amino acids linked by peptide bonds.
- protein refers to a polypeptide that can also include post-translational modifications that include the modification of amino acids of the protein and may include the addition of chemical groups or biomolecules that are not amino acid-based. The terms apply to amino acid polymers in which one or more amino acid residue is an analog or mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. Polypeptides can be modified, for example, by the addition of carbohydrate residues to form glycoproteins.
- polypeptide polypeptide
- peptide and “protein” include glycoproteins, as well as non-glycoproteins.
- a recombinant fusion protein wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity.
- Nuclease refers to an enzyme capable of cleaving phosphodiester bonds between the nucleotide subunits of nucleic acids.
- a recombinant fusion protein wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the nuclease activity is exonuclease activity.
- Exonuclease refers to an enzyme that cleaves nucleotides one at a time from the end of a polynucleotide chain via a hydrolyzing reaction that breaks phosphodiester bonds at either the 3 ' or 5' end.
- the "exonuclease” can be a 3' to 5' exonuclease or a 5' to 3' exonuclease.
- E. coli exonuclease I and exonuclease III are two commonly used 3'- exonucleases that have 3'-exonucleolytic single-strand degradation activity.
- E. coli exonuclease VII and T7-exonuclease Gene 6 are two commonly used 5 '-3' exonucleases that have 5'-exonucleolytic single-strand degradation activity.
- Exonucleases can be originated from prokaryotes, such as E. coli exonucleases, or eukaryotes, such as yeast, worm, murine, or human exonucleases.
- Examples of exonucleases that can be used in the disclosed fusion protein include, but are not limited to, E. coli exonuclease I, E. coli exonuclease III, E. coli exonuclease VII, bacteriophage lambda exonuclease, and bacteriophage T7-exonuclease Gene 6, or a combination thereof.
- a recombinant fusion protein wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
- Phosphatase or "alkaline phosphatase” refers to an enzyme capable of hydro lyzing phosphoric monoesters to produce inorganic phosphoric acids.
- Alkaline phosphatases are generally known to be metal-dependent enzymes that have low substrate specificity and require metal ions such as magnesium ions (Mg 2+ ) or zinc ions (Zn 2+ ) for enzymatic reactions.
- Typical alkaline phosphatases include bacterial alkaline phosphatase (BAP), calf intestinal alkaline phosphatase (CIAP), shrimp alkaline phosphatase (SAP) and the like.
- nucleic acid encoding a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
- Nucleic acid refers to polymers of single or double stranded nucleotide.
- a nucleic acid typically refers to a polynucleotide molecule comprised of a linear strand of two or more nucleotides (deoxyribonucleotides and/or ribonucleotides) or variants, derivatives and/or analogs thereof.
- nucleic acid encompasses SEQ ID NO: 1.
- the recombinant fusion protein possessing both nuclease and phosphatase activity encompasses the polypeptide sequence of SEQ ID NO:2.
- nucleic acid insert encodes a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
- the nucleic acid insert encompasses SEQ ID NO: 1.
- the nucleic acid encodes the polypeptide of SEQ ID NO:2.
- Vector refers to any DNA or RNA molecule that acts as an intermediate carrier into which a DNA or RNA segment is inserted for introduction into a host cell for amplification.
- intermediate carriers include plasmids, cosmids, bacteriophages and transposons.
- Host cell refers to any cell type which is susceptible to transformation, transfection, and/or transduction with a nucleic acid construct.
- a host cell can be a prokaryotic or eukaryotic cell.
- the recombinant fusion protein is purified.
- purified and isolated are synonymous, and refer to a material that is substantially or essentially free from other components.
- a recombinant protein is isolated or purified when it is free from other components used in the cloning reaction, or solid state synthesis, isolation or purity is generally determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis, mass spectrometry, or high performance liquid chromatography (HPLC).
- HPLC high performance liquid chromatography
- a polynucleotide, protein or peptide of the present invention is considered to be isolated when it is the predominant species present in a preparation.
- a purified protein, peptide or nucleic acid molecule of the invention represents greater than about 80% of the macromolecular species present, greater than about 90% of the macromolecular species present, greater than about 95% of the macromolecular species present, greater than about 96% of the macromolecular species present, greater than about 97% of the macromolecular species present, greater than about 98% of the macromolecular species present, greater than about 99% of the macromolecular species present in a preparation.
- kits encompassing a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
- kits of the present invention may also comprise instructions for performing one or more methods described herein and/or a description of one or more compositions or reagents described herein. Instructions and/or descriptions may be in printed form and may be included in a kit insert. A kit also may include a written description of an internet location that provides such instructions or descriptions.
- the cells were subjected to centrifugation and then lysed using a high pressure Microfluidizer®.
- the resultant lysate was treated with 2% streptomycin sulfate and centrifuged at 19,000 rpm for 30 minutes at 4°C.
- Peak fractions from a 0 - 1 M NaCl gradient were pooled and diluted 1 :2 prior to loading onto a POROS® HQ anion exchange column equilibrated with 25 mM HEPES (pH 6.3). Peak fractions were pooled and dialyzed against 25 mM HEPES (pH 8.2), 2 mM CaCl 2 and 50% glycerol.
- the chimeric exonuclease/phosphatase fusion protein (SEQ ID NO. 2) was utilized in a DNA sequencing workflow to assess its functional characteristics. Human genomic DNA was used as template for PCR amplification of amplification of 639 bp portion of the HLA locus. After the completion of thermal cycling, various molar concentrations of the chimeric exonuclease/phosphatase fusion protein were added to the PCR amplification tubes and the reactions were incubated for 15 minutes at 37°C, followed by 15 minutes at 80°C. ExoSAP-IT® was added to some amplification tubes as a comparative control.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Wood Science & Technology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- Enzymes And Modification Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
Disclosed herein is a fusion protein possessing both nuclease and phosphatase activities. The described fusion protein simplifies the processing of amplified DNA to degrade residual primers and nucleotide triphosphates and thereby facilitates subsequent DNA analysis.
Description
A RECOMBINANT FUSION PROTEIN POSSESSING NUCLEASE AND
PHOSPHATASE ACTIVITY
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims a priority benefit under 35 U.S. C. § 119(e) from U.S.
Provisional Application No. 61/798,671, filed March 15, 2013, which is incorporated herein by reference.
BACKGROUND
[0002] Nucleases are useful reagents for removing unwanted nucleic acids from protein preparations. Descriptions of certain nucleases and their preparation by cloning are provided by Eaves et al. (J. Bacteriol. 85:273-8 (1963)), Filimonova et al. (Biochem. Mol. Biol. Int. 33(6): 1229-36 (1994)), Ball et. al. {Gene 57(2-3): 183-92 (1987), Molin et. al. (U.S. Pat. No. 5,173,4185), and Friedhoff et al. (Protein Expr. Purif. 5(l):37-43 (1994)).
[0003] Exonuclease I (Exo I) digests single-stranded DNA in a 3' to 5 'direction producing 5' mononucleotides. This enzyme is particularly useful in preparing amplified DNA products, such as PCR products, for sequencing. It degrades residual primers from the amplification reaction that would otherwise be carried over into the sequencing reaction. U.S. Pat. Nos. 5,741,676 and 5,756,285 generally disclose methods for DNA sequencing via amplification, both of which are hereby incorporated herein by reference. (See also R. L. Olsen et al., Comp. Biochem. Physiol, vol. 99B, No. 4, pp. 755-761 (1991)).
[0004] Amplification primers carried over into a sequencing reaction could act as sequencing primers and generate sequencing reaction products, thereby creating a
background of secondary sequences which would obscure or interfere with observing the desired sequence. Both the concentration and specific activity (purity) of commercially available Exonuclease I may vary over a wide range. Commonly the enzyme is manufactured to a specific activity between 50,000 and 150,000 units of enzyme per mg and supplied for the purpose of processing amplified DNA at a concentration around 10 units per microliter. Enzyme with either higher or lower specific activity and either more or less concentrated could be employed in the described applications by suitable alterations in the applied protocol, such as adding less or more volume (or amount) of enzyme, respectively.
[0005] Alkaline Phosphatases, as exemplified by Shrimp Alkaline Phosphatase (SAP) and Calf Intestinal Alkaline Phosphatase (CIP), catalyze the hydrolysis of 5'-phosphate residues from DNA, R A, and ribo- and deoxyribonucleoside triphosphates (dNTPs or nucleotide triphosphates). SAP is particularly useful in preparing amplified products, such as PCR products, for sequencing because it can readily be inactivated by heat prior to performing a sequencing reaction. SAP degrades residual dNTPs from the amplification reaction. If residual dNTPs are carried over from the amplification reaction to the sequencing reaction, they add to, and thereby alter, the concentration of dNTPs in the sequencing reaction in an indeterminant and non-reproducible fashion. Since, within narrow limits, high quality sequencing requires specific ratios between the sequencing reaction dNTPs and ddNTPs, an alteration in the concentration of dNTPs may result in faint sequencing reaction signals.
[0006] Prior to sequencing or other analyses, Exo I and SAP are frequently used to process PCR reaction products. There is a need in the art for an improved composition that provides both nuclease and phosphatase activity.
SUMMARY OF THE INVENTION
[0007] Disclosed herein is a novel recombinant fusion protein. This fusion protein possesses two enzymatic activities, a nuclease activity and a phosphatase activity. Methods for the isolation and use of this novel protein are also disclosed.
BRIEF DESCRIPTION OF THE DRAWINGS
[0008] Figure 1 depicts a scheme for isolating the chimeric nuclease/phosphatase fusion protein.
[0009] Figure 2 depicts a SDS-PAGE analysis at the indicated stages and fractions.
[00010] Figure 3 depicts (A) a SDS-PAGE analysis of the indicated fraction, (B) buffer volume and the absorbance at 260 nm and 280 nm at various buffer volumes witnessed on the POROS® HS cation exchange column, and (C) buffer volume and the absorbance at 260 nm and 280 nm at various buffer volumes witnessed on the POROS® HQ cation exchange column.
[00011] Figure 4 depicts (A) a SDS-PAGE analysis of fractions collected from the
POROS® HS cation exchange column and indicates the fractions that were pooled, (B)
buffer volume and the absorbance at 260 nm and 280 nm at various buffer volumes witnessed on the POROS® HS cation exchange column, (C) a SDS-PAGE analysis of fractions collected from the POROS® HQ cation exchange column and indicates the fractions that were pooled, and (D) buffer volume and the absorbance at 260 nm and 280 nm at various buffer volumes witnessed on the POROS® HQ cation exchange column.
[00012] Figure 5 depicts the Quality Value (QV) score, which represents a per-base estimate of base call accuracy, and electropherograms at the indicated molar concentration of chimeric exonuclease/phosphatase fusion protein and controls. (A) ExoSAP-IT® QV (B) ExoSAP-IT® electropherogram (C) chimeric exonuclease/phosphatase fusion protein 8 μΜ QV (D) chimeric exonuclease/phosphatase fusion protein 8 μΜ electropherogram (E) chimeric
exonuclease/phosphatase fusion protein 4 μΜ QV (F) chimeric exonuclease/phosphatase fusion protein 4 μΜ electropherogram (G) chimeric exonuclease/phosphatase fusion protein 2 μΜ QV (H) chimeric exonuclease/phosphatase fusion protein 2 μΜ electropherogram (I) no enzyme control QV (J) no enzyme control electropherogram.
[00013] Figure 6 depicts an electropherogram from a MicroSeq® reaction using ExoSAP- IT®.
[00014] Figure 7 depicts an electropherogram for a MicroSeq® reaction using the recombinant fusion protein (SEQ ID NO. 2) in place of ExoSAP-IT®.
[00015] Figure 8 depicts an electropherogram from a MicroSeq® "fast" reaction using ExoSAP-IT®.
[00016] Figure 9 depicts an electropherogram from a MicroSeq® "fast" reaction using the recombinant fusion protein (SEQ ID NO. 2) in place of ExoSAP-IT®.
DETAILED DESCRIPTION OF THE INVENTION
[00017] In some embodiments are provided a recombinant fusion protein. "Recombinant" or "recombinant nucleic acid" or "recombinant gene" or "recombinant DNA molecule" or "recombinant nucleic acid sequence" indicates that the nucleotide sequence or arrangement of its parts is not a native configuration, and has been manipulated by molecular biological techniques. The term implies that the DNA molecule is comprised of segments of DNA that have been artificially joined together, for example, the polynucleotide encoding a nuclease and a phosphatase activity disclosed herein. Protocols and reagents to manipulate nucleic
acids are common and routine in the art (See e.g., Maniatis et al. (eds.), Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY, 1982; Sambrook et al. (eds.), Molecular Cloning: A Laboratory Manual, Second Edition, Volumes 1-3, Cold Spring Harbor Laboratory Press, NY, 1989; and Ausubel et al. (eds.), Current Protocols in Molecular Biology, Vol. 1-4, John Wiley & Sons, Inc., New York 1994; all of which are herein incorporated by reference).
[00018] "Fusion protein" refers to a polypeptide composed of a plurality of components, unjoined in their native state but are joined to form a single continuous polypeptide.
[00019] Similarly, a "recombinant protein" or "recombinant polypeptide" refers to a protein molecule that is expressed from a recombinant DNA molecule. Use of these terms indicates that the primary amino acid sequence, arrangement of its domains or nucleic acid elements which control its expression are not native, and have been manipulated by molecular biology techniques. As indicated above, techniques to manipulate recombinant proteins are also common and routine in the art.
[00020] As used herein, the word "protein" refers to a full-length protein, a portion of a protein, or a peptide. Proteins can be produced via fragmentation of larger proteins, or chemically synthesized. Proteins may, for example, be prepared by recombinant
overexpression in a species such as, but not limited to, bacteria, yeast, insect cells, and mammalian cells. Proteins to be placed in a protein microarray of the invention, may be, for example, are fusion proteins, for example with at least one affinity tag to aid in purification and/or immobilization. In certain aspects of the invention, at least 2 tags are present on the protein, one of which can be used to aid in purification and the other can be used to aid in immobilization. In certain illustrative aspects, the tag is a His tag, a GST tag, or a biotin tag. Where the tag is a biotin tag, the tag can be associated with a protein in vitro or in vivo using commercially available reagents (Invitrogen, Carlsbad, Calif). In aspects where the tag is associated with the protein in vitro, a Bioease tag can be used (Invitrogen, Carlsbad, Calif).
[00021] As used herein, the term "peptide," "oligopeptide," and "polypeptide" are used interchangeably with protein herein and refer to a sequence of contiguous amino acids linked by peptide bonds. As used herein, the term "protein" refers to a polypeptide that can also include post-translational modifications that include the modification of amino acids of the protein and may include the addition of chemical groups or biomolecules that are not amino
acid-based. The terms apply to amino acid polymers in which one or more amino acid residue is an analog or mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. Polypeptides can be modified, for example, by the addition of carbohydrate residues to form glycoproteins. The terms "polypeptide," "peptide" and "protein" include glycoproteins, as well as non-glycoproteins.
[00022] In some embodiments are provided a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity.
[00023] "Nuclease" refers to an enzyme capable of cleaving phosphodiester bonds between the nucleotide subunits of nucleic acids.
[00024] In some embodiments are provided a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the nuclease activity is exonuclease activity.
[00025] "Exonuclease" refers to an enzyme that cleaves nucleotides one at a time from the end of a polynucleotide chain via a hydrolyzing reaction that breaks phosphodiester bonds at either the 3 ' or 5' end. The "exonuclease" can be a 3' to 5' exonuclease or a 5' to 3' exonuclease. E. coli exonuclease I and exonuclease III are two commonly used 3'- exonucleases that have 3'-exonucleolytic single-strand degradation activity. E. coli exonuclease VII and T7-exonuclease Gene 6 are two commonly used 5 '-3' exonucleases that have 5'-exonucleolytic single-strand degradation activity.
[00026] Exonucleases can be originated from prokaryotes, such as E. coli exonucleases, or eukaryotes, such as yeast, worm, murine, or human exonucleases. Examples of exonucleases that can be used in the disclosed fusion protein include, but are not limited to, E. coli exonuclease I, E. coli exonuclease III, E. coli exonuclease VII, bacteriophage lambda exonuclease, and bacteriophage T7-exonuclease Gene 6, or a combination thereof.
[00027] In some embodiments are provided a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
[00028] "Phosphatase" or "alkaline phosphatase" refers to an enzyme capable of hydro lyzing phosphoric monoesters to produce inorganic phosphoric acids. Alkaline phosphatases are generally known to be metal-dependent enzymes that have low substrate specificity and require metal ions such as magnesium ions (Mg2+) or zinc ions (Zn2+) for enzymatic reactions. Typical alkaline phosphatases include bacterial alkaline phosphatase (BAP), calf intestinal alkaline phosphatase (CIAP), shrimp alkaline phosphatase (SAP) and the like.
[00029] In some embodiments are provided a nucleic acid encoding a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
[00030] "Nucleic acid" refers to polymers of single or double stranded nucleotide. A nucleic acid typically refers to a polynucleotide molecule comprised of a linear strand of two or more nucleotides (deoxyribonucleotides and/or ribonucleotides) or variants, derivatives and/or analogs thereof.
[00031] In some embodiments the nucleic acid encompasses SEQ ID NO: 1.
SEQ ID NO. 1 :
AC AAAT AGC GTC C AAG AG A AC ATTGT
AATGAATCCTTCTGATAATTGTCTGATGAGCGATGTCATGAAAGTCAACC
TGTCTCGTCGTAAAATTCTGCAGTTTGGCGGGGCAATGGGTGCTATCGCC
CTGCTGCCTGCGGCTTTTGGTTCGCGCAGCGCATTTGCGAACCCAAGCCA
GCCATTGCAGATCCGTAAAATTACAAATCTCACGTTTACGTCTATTCCGT
TTAGTACCGAAGATCGTGTCATCGTTCCAAAAGGCTATAGTGCGAAGGCG
TTCTATGCCTGGGGCGACCCGGTCGGTCTGGAAAATAATAACCCGCAGTT
TAAAGTTGACGCGTCAAACTCGGCAGAAGAACAGGCCGCTCAGGCGGGCA
TGAACCACGATGGGATGGCGTACTTTCCTTTCGCCGAACATGGTAACGAA
CATGGCCTGCTGGTGATGAACCATGAATACATTGACAACGGTCTCTTGTT
TCCTGATGGGGATAAAACGTGGAGCCTGGATAAGGTGAAAAAATCGCAGA
ACGCTATGGGCATCTCGGTGATTGAAATTAAAAAAGTGAACCAGCAGTGG
GAAGTGGTCCGCCCGAGC AAAT ATGCCCGTCGT ATT ACGCCGCATACCCC
TATGCGTCTGACAGGGCCGGCGAAACATAACGAACTGATGAAAACTGTAG
CCGACCCTTTAGGGGAGTTTGTGCTGGGGACCATGCAGAACTGTGCAAAT
GGTGAAACACCCTGGCGCACTTATCTGACCTGTGAAGAGAACTGGTCCGA
TATTTTTGTGCGTGAATCCGGCGACTTCACGAAGCTGGATAAGCGTTACG
GGATTATGAAGAAAGAAAAAGAAGATAAGTACCGTTGGAATGAATTCGAT
GAACGTTTTAATACGGATAAACATCCGAACGAACCGCACCGCTTCGGCTG
GGTTGTTGAAATTGACCCCTTTGATCCAAACAGCACCCCGGTTAAACACA
CCGCCCTGGGCCGCTTCAAACACGAGGGCGCCATGCTGGTGCTGAGCAAG
GAAGGGCACGCAGTAGTCTACATGGGTGACGATCAGCGTTTCGAGTACAT
CTATAAGTTCGTTTCTAAAGGTAAATACAACCCGGCAGATCGTGCAGCAA
ACATGTATCTTCTGTCCGAAGGCACACTCTATGTCGCCCATTTTAACGAA
GATAACACCGGCGAATGGCGTCCGCTGGTCCATAATCAGAACGGGCTGAC
TGCGGAGAATGGCTTTCTGAATCAGGGCGATGTGACCATCAAGGCACGTA
TGGCGGCTGATGTGGTGGGCGGCACTAAAATGGATCGCCCGGAATGGATC
GCCGTCGATCCATATCAGACTGGCTCTGTGTATTGCACCCTTACAAACAA
TAGCCAGCGTGGTACCGAAGGCAAGGCGGGTATTGATGCCGCCAACCCGC
GCGTTAAGAACTCGTATGGACATATCATTCGCTGGCAAGAGAATGACCAA
GATTACCTGTCCGAGACCTTCTCATGGGATATCTTCGCGCTGGGCGGTAA
TAAATCCAAGGGCGAAAATCATGTGAACGGTGATGATTTCGGTTCCCCGG
ACGGACTCCGTTTCGATAATCACGGCATCTTGTGGGTTCAAACGGACGTG
TCGAGTTCCACGTTAAATAAAAAGGCCTATGAAGGCATGGGTAATAACCA
AATGCTGGCGGTAATTCCAGAGCAGGGCGAGTTTAAACGTTTTTTAACGG
CCCCGAACGGCTCAGAAGTAACCGGTATCGCTTTCACTCCTGACAACAAA
ACCATGTTTATCAATATTCAGCATCCGGGTGAACCAGATAGCGGCGTGAC
CGAACCAGATCAAGTAACAGCCATTTCCACCTGGCCGGACCGTCAAGGTA
AAACCCGCCCTCGCTCTGCTACCGTGGTTATTCAGAAGGAAGATGGTGGC
GTTATTTCATCTCTCGAGCACCACCACCACCACCAC
[00032] In some embodiments the recombinant fusion protein possessing both nuclease and phosphatase activity encompasses the polypeptide sequence of SEQ ID NO:2.
SEQ ID NO:2
MMNDGKQQSTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDY
LPQPGAVLITGITPQEARAKGENEAAFAARIHSLFTVPKTCILGY NVRFDDEVTRNIF
YRNFYDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTK
ANGIEHSNAHDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQM
KPLVHVSGMFGAWRGNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRER
LYTAKTDLGDNAAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRE
NPQVREKVVAIFAEAEPFTPSDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDIT
FVDKRIEKLLFNYRARNFPGTLDYAEQQRWLEHRRQVFTPEFLQGYADELQMLVQQ
YADDKEKVALLKALWQYAEEIVRTGGSGGGSGGGSGTNSVQENIVMNPSDNCLMS
DVMKVNLSRRKILQFGGAMGAIALLPAAFGSRSAFANPSQPLQIRKITNLTFTSIPFST
EDRVIVPKGYSAKAFYAWGDPVGLEN NPQFKVDASNSAEEQAAQAGMNHDGMA
YFPFAEHGNEHGLLVMNHEYIDNGLLFPDGDKTWSLDKVK SQNAMGISVIEIK V
NQQWEVVRPSKYARRITPHTPMRLTGPAKHNELMKTVADPLGEFVLGTMQNCANG
ETPWRTYLTCEENWSDIFVRESGDFTKLDKRYGIMKKEKEDKYRWNEFDERFNTDK
HPNEPHRFGWVVEIDPFDPNSTPVKHTALGRFKHEGAMLVLSKEGHAVVYMGDDQ
RFEYIYKFVSKGKYNPADRAANMYLLSEGTLYVAHFNEDNTGEWRPLVHNQNGLT
AENGFLNQGDVTIKARMAADVVGGTKMDRPEWIAVDPYQTGSVYCTLT NSQRGT
EGKAGIDAANPRVK SYGHIIRWQENDQDYLSETFSWDIFALGGNKSKGENHVNGD
DFGSPDGLRFDNHGILWVQTDVSSSTLNKKAYEGMG NQMLAVIPEQGEFKRFLTA PNGSEVTGIAFTPDNKTMFINIQHPGEPDSGVTEPDQVTAISTWPDRQGKTRPRSATV VIQKEDGGVIS SLEHHHHHH
[00033] In some embodiments are provided a vector with a nucleic acid insert, wherein the nucleic acid insert encodes a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity. In other embodiments, the nucleic acid insert encompasses SEQ ID NO: 1. In some embodiments, the nucleic acid encodes the polypeptide of SEQ ID NO:2.
[00034] "Vector" refers to any DNA or RNA molecule that acts as an intermediate carrier into which a DNA or RNA segment is inserted for introduction into a host cell for amplification. Such intermediate carriers include plasmids, cosmids, bacteriophages and transposons.
[00035] "Host cell" refers to any cell type which is susceptible to transformation, transfection, and/or transduction with a nucleic acid construct. A host cell can be a prokaryotic or eukaryotic cell.
[00036] In some embodiments, the recombinant fusion protein is purified.
[00037] The terms "purified" and "isolated" as used herein, are synonymous, and refer to a material that is substantially or essentially free from other components. For example, in one embodiment, a recombinant protein is isolated or purified when it is free from other components used in the cloning reaction, or solid state synthesis, isolation or purity is generally determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis, mass spectrometry, or high performance liquid chromatography (HPLC). In one embodiment, a polynucleotide, protein or peptide of the present invention is considered to be isolated when it is the predominant species present in a preparation. A purified protein, peptide or nucleic acid molecule of the invention represents greater than about 80% of the macromolecular species present, greater than about 90% of the macromolecular species present, greater than about 95% of the macromolecular species present, greater than about 96% of the macromolecular species present, greater than about 97% of the macromolecular species present, greater than about 98% of the macromolecular species present, greater than about 99% of the macromolecular species present in a preparation.
[00038] In some embodiments are provided a kit encompassing a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
[00039] The kits of the present invention may also comprise instructions for performing one or more methods described herein and/or a description of one or more compositions or reagents described herein. Instructions and/or descriptions may be in printed form and may be included in a kit insert. A kit also may include a written description of an internet location that provides such instructions or descriptions.
EXAMPLES
Construction of Fusion Protein
[00040] At the outset, several chimeric fusion proteins possessing both nuclease and phosphatase activity were envisioned and tested. For instance, the combination of exonuclease and shrimp alkaline phosphatase activity of SEQ ID NO. 3 and SEQ ID NO. 4 was constructed and tested. This chimeric fusion protein failed in early stages of
development for lacking solubility and desired enzymatic activity. A number of other chimeric exonuclease/phosphatase fusion proteins were also tested but failed.
SEQ ID NO 3:
AGATCTCGATCCCGCGAAATTAATACGACTCACTATAGGGGAATTGTGAGCGGA
TAACAATTCCCCTCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACATA
TGATGAATGATGGTAAACAGCAATCTACCTTTCTGTTCCACGACTATGAAACCTT
CGGTACTCACCCGGCCCTGGATCGCCCGGCACAGTTCGCTGCGATCCGTACCGAC
TCCGAATTTAACGTGATCGGTGAACCGGAGGTATTCTACTGCAAACCGGCGGAC
GACTACCTGCCACAGCCGGGTGCGGTGCTGATTACCGGTATCACTCCGCAAGAA
GCTCGTGCCAAAGGTGAGAATGAAGCGGCGTTTGCCGCGCGTATCCATAGCCTGT
TCACCGTACCGAAAACCTGCATCCTGGGTTACAACAACGTGCGTTTCGACGACGA
AGTGACCCGTAACATCTTCTACCGTAACTTCTATGACCCATACGCATGGTCCTGG
CAGCACGACAACAGCCGTTGGGATCTGCTGGATGTAATGCGTGCGTGCTATGCTC
TGCGCCCAGAAGGTATTAACTGGCCGGAGAACGACGACGGCCTGCCGAGCTTCC
GTCTGGAGCACCTGACCAAAGCGAACGGTATCGAACACTCCAACGCGCACGATG
CGATGGCAGACGTCTATGCTACTATCGCTATGGCAAAGCTGGTTAAAACCCGTCA
GCCGCGCCTGTTTGACTATCTGTTTACCCACCGTAACAAACACAAACTGATGGCT
CTGATCGACGTTCCGCAGATGAAGCCGCTGGTTCATGTGTCTGGTATGTTTGGTG
CTTGGCGCGGCAACACCTCTTGGGTAGCCCCGCTGGCCTGGCACCCGGAGAACC
GTAACGCTGTGATCATGGTGGACCTGGCGGGTGATATCTCCCCGCTGCTGGAACT
GGACTCTGACACGCTGCGTGAACGTCTGTATACCGCAAAAACCGATCTGGGTGAT
AACGCCGCAGTTCCGGTGAAGCTGGTGCACATCAACAAATGTCCGGTCCTGGCTC
AGGCGAATACCCTGCGTCCGGAAGACGCGGACCGTCTGGGTATTAACCGTCAGC
ATTGCCTGGACAACCTGAAAATTCTGCGCGAAAACCCGCAGGTCCGCGAAAAAG
TTGTAGCCATCTTCGCGGAAGCGGAACCGTTTACCCCATCCGACAACGTTGACGC
TCAGCTGTACAACGGCTTCTTTTCCGATGCGGACCGCGCAGCGATGAAAATTGTT
CTGGAAACCGAACCGCGCAACCTGCCGGCACTGGATATCACTTTCGTCGACAAA
CGTATCGAAAAACTGCTGTTCAACTATCGTGCTCGTAACTTTCCGGGTACTCTGG
ATTACGCTGAGCAACAGCGTTGGCTGGAACATCGTCGTCAGGTATTTACCCCGGA
ATTCCTGCAGGGCTATGCAGATGAACTGCAGATGCTGGTACAACAGTACGCAGA
CGATAAGGAGAAAGTGGCGCTGCTGAAAGCACTGTGGCAGTACGCGGAAGAAAT
TGTTCGTACGGGCGGCTCCGGTGGCGCGAGCGGCGGTTCCGGCGGTCATATGGA
AGAAGATAAAGCATACTGGAACAAAGACGCGCAGGATGCCCTGGACAAACAGC
TGGGTATCAAACTGCGTGAAAAACAGGCCAAAAACGTGATTTTCTTCCTGGGTGA
TGGTATGAGCCTGTCCACGGTTACTGCGGCGCGTATCTATAAAGGCGGTCTGACT
GGTAAATTCGAACGTGAAAAAATCTCTTGGGAAGAGTTCGACTTCGCAGCCCTGT
CTAAAACTTATAATACGGATAAACAGGTTACGGATTCTGCTGCTTCTGCAACCGC
TTATCTGACCGGCGTTAAGACCAACCAGGGTGTTATTGGTCTGGACGCTAACACC
GTTCGTACCAACTGCTCTTACCAGCTGGATGAAAGCCTGTTTACCTACAGCATCG
CACACTGGTTCCAGGAAGCTGGTCGCAGCACCGGTGTTGTGACCTCCACCCGTGT
TACCCACGCTACTCCGGCGGGCACCTACGCGCACGTAGCAGATCGCGATTGGGA
AAACGACAGCGACGTAGTACATGATCGTGAAGACCCGGAAATTTGTGACGATAT
CGCAGAACAGCTGGTATTCCGTGAGCCGGGCAAAAACTTTAAAGTAATCATGGG
TGGCGGTCGTCGCGGTTTCTTCCCGGAAGAAGCGCTGGACATCGAAGATGGTATC
CCGGGTGAGCGTGAAGACGGTAAACACCTGATCACTGACTGGCTGGATGACAAG
GCTTCCCAGGGTGCAACTGCATCCTACGTATGGAACCGTGATGACCTGCTGGCGG
TGGACATCCGCAACACTGATTACCTGATGGGCCTGTTCAGCTACACGCACCTGGA
CACCGTTCTGACCCGTGATGCCGAAATGGACCCGACTCTGCCTGAGATGACTAAA
GTGGCCATCGAAATGCTGACCAAAGACGAAAATGGTTTCTTTCTGCTGGTAGAAG
GCGGTCGCATTGACCACATGCACCACGCGAACCAGATCCGTCAGTCTCTGGCTGA
GACCCTGGACATGGAGGAGGCCGTTAGCATGGCGCTGAGCATGACTGATCCGGA
AGAAACGATCATCCTGGTTACCGCTGATCACGGTCATACGCTGACTATCACCGGT
TACGCGGACCGTAACACGGATATTCTGGATTTCGCTGGCATCAGCGATCTGGACG
ACCGTCGCTACACTATCCTGGATTACGGTTCTGGTCCGGGTTACCACATCACTGA
GGACGGCAAACGCTACGAACCGACTGAAGAGGATCTGAAAGATATCAATTTCCG
CTACGCGTCTGCAGCACCAAAACATTCTGTTACCCACGATGGTACTGATGTCGGT
ATCTGGGTTAACGGCCCGTTCGCGCACCTGTTCACCGGCGTTTACGAGGAGAACT
ATATCCCGCACGCTCTGGCTTACGCGGCATGTGTTGGCACTGGTCGTACGTTCTG
CGACGAAAAATAATGAAAGCTTGCGGCCGCACTCGAG
SEQ ID NO. 4
MMNDGKQQSTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDY
LPQPGAVLITGITPQEARAKGENEAAFAARIHSLFTVPKTCILGYNNVRFDDEVTRNIF
YRNFYDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTK
ANGIEHSNAHDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQM
KPLVHVSGMFGAWRGNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRER
LYTAKTDLGDNAAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRE
NPQVREKVVAIFAEAEPFTPSDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDIT
FVDKRIEKLLFNYRARNFPGTLDYAEQQRWLEHRRQVFTPEFLQGYADELQMLVQQ
YADDKEKVALLKALWQYAEEIVRTGGSGGASGGSGGHMEEDKAYWNKDAQDALD
KQLGIKLREKQAKNVIFFLGDGMSLSTVTAARIYKGGLTGKFEREKISWEEFDFAALS
KTYNTDKQVTDSAASATAYLTGVKTNQGVIGLDANTVRTNCSYQLDESLFTYSIAH
WFQEAGRSTGVVTSTRVTHATPAGTYAHVADRDWENDSDVVHDREDPEICDDIAEQ
LVFREPGKNFKVIMGGGRRGFFPEEALDIEDGIPGEREDGKHLITDWLDDKASQGAT
ASYVWNRDDLLAVDIRNTDYLMGLFSYTHLDTVLTRDAEMDPTLPEMTKVAIEMLT
KDENGFFLLVEGGRIDHMHHANQIRQSLAETLDMEEAVSMALSMTDPEETIILVTAD
HGHTLTITGYADRNTDILDFAGISDLDDRRYTILDYGSGPGYHITEDGKRYEPTEEDL
KDINFRYASAAPKHSVTHDGTDVGIWVNGPFAHLFTGVYEENYIPHALAYAACVGT
GRTFCDEK
Purification of Chimeric Enzyme from Bacterial Host Cells
[00041] In order to isolate the fusion protein (SEQ ID NO. 2) the following procedure was used, schematically represented in Figure 1. Escherichia coli cells harboring an expression plasmid with the chimeric exonuclease/phosphatase fusion protein as an insert were cultured at 37°C to an optical density (OD) of 0.5 when measured at 600 nm (OD6oo). At this point the culture temperature was reduced to 18°C and ImM of isopropyl β-D-l-thiogalactopyranoside (IPTG) was added to induce expression of the chimeric exonuclease/phosphatase fusion protein. Expression was allowed to proceed overnight at 18°C. Following this, the cells were subjected to centrifugation and then lysed using a high pressure Microfluidizer®. The resultant lysate was treated with 2% streptomycin sulfate and centrifuged at 19,000 rpm for 30 minutes at 4°C.
[00042] To precipitate the chimeric exonuclease/phosphatase fusion protein, after centrifugation 40% saturated ammonium sulfate was added to the supernatant and then this was subjected to centrifugation. The resulting pellet is resuspended in 25 mM HEPES (pH 6.3).
[00043] The resuspended pellet was then loaded onto a POROS® HS cation exchange column equilibrated with 25 mM HEPES (pH 6.3). Peak fractions from a 0 - 1 M NaCl gradient were pooled and diluted 1 :2 prior to loading onto a POROS® HQ anion exchange column equilibrated with 25 mM HEPES (pH 6.3). Peak fractions were pooled and dialyzed against 25 mM HEPES (pH 8.2), 2 mM CaCl2 and 50% glycerol.
[00044] This methodology resulted in approximately 3 mg. of the expressed chimeric exonuclease/phosphatase fusion protein per gram of bacteria.
[00045] At a number of steps in the purification process, samples were taken and analyzed by SDS-PAGE. Results of these analyses are depicted in Figures 2, 3 and 4.
Analysis of the Chimeric Exonuclease/Phosphatase Fusion Protein in Functional Assays
[00046] The chimeric exonuclease/phosphatase fusion protein (SEQ ID NO. 2) was utilized in a DNA sequencing workflow to assess its functional characteristics. Human genomic DNA was used as template for PCR amplification of amplification of 639 bp portion of the HLA locus. After the completion of thermal cycling, various molar concentrations of the chimeric exonuclease/phosphatase fusion protein were added to the PCR amplification tubes and the reactions were incubated for 15 minutes at 37°C, followed by 15 minutes at 80°C. ExoSAP-IT® was added to some amplification tubes as a comparative control.
[00047] After the incubation was complete, each reaction was subjected to DNA cycle sequencing. Resulting QV and electropherograms from the cycling sequencing are depicted in Figure 5.
[00048] In addition to the human HLA locus DNA sequencing was performed using a bacterial 16S ribosomal RNA gene (rDNA) sequence as a template. To accomplish this, an approximately 500 bp amplicon was generated by PCR amplification of a bacterial rDNA sequence. After PCR amplification, the chimeric exonuclease/phosphatase fusion protein was added to the reaction and incubated, followed by cycle sequencing and gel electrophoresis. Results from representative experiments using the protein of SEQ ID NO. 2 are depicted in Figures 6 - 9.
Claims
1. A composition comprising a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
2. The composition of claim 1, wherein the nuclease activity is an exonuc lease activity.
3. A nucleic acid encoding the recombinant fusion protein of claim 1.
4. A vector comprising the nucleic acid of claim 3.
5. A host cell comprising the nucleic acid of claim 3.
6. The nucleic acid of claim 1, wherein the nucleic acid sequence comprises SEQ ID NO: l .
7. A method comprising expressing a recombinant fusion protein within a host cell, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity and obtaining the recombinant fusion protein from the host cell.
8. A kit comprising a single container comprising a recombinant fusion protein, wherein the recombinant fusion protein possesses two enzymatic activities, wherein the first enzymatic activity is a nuclease activity and the second enzymatic activity is a phosphatase activity.
9. The composition of claim 1, wherein the recombinant fusion protein is substantially purified.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/776,856 US20160230156A1 (en) | 2013-03-15 | 2014-03-17 | Recombinant fusion protein possessing nuclease and phosphatase activity |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361798671P | 2013-03-15 | 2013-03-15 | |
| US61/798,671 | 2013-03-15 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014145706A2 true WO2014145706A2 (en) | 2014-09-18 |
| WO2014145706A3 WO2014145706A3 (en) | 2014-11-13 |
Family
ID=50489444
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/030515 Ceased WO2014145706A2 (en) | 2013-03-15 | 2014-03-17 | A recombinant fusion protein possessing nuclease and phosphatase activity |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20160230156A1 (en) |
| WO (1) | WO2014145706A2 (en) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5173418A (en) | 1985-05-10 | 1992-12-22 | Benzon Pharma, A/S | Production in Escherichia coli of extracellular Serratia spp. hydrolases |
| US5741676A (en) | 1991-09-27 | 1998-04-21 | Amersham Life Science, Inc. | DNA cycle sequencing |
| US5756285A (en) | 1991-09-27 | 1998-05-26 | Amersham Life Science, Inc. | DNA cycle sequencing |
-
2014
- 2014-03-17 US US14/776,856 patent/US20160230156A1/en not_active Abandoned
- 2014-03-17 WO PCT/US2014/030515 patent/WO2014145706A2/en not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5173418A (en) | 1985-05-10 | 1992-12-22 | Benzon Pharma, A/S | Production in Escherichia coli of extracellular Serratia spp. hydrolases |
| US5741676A (en) | 1991-09-27 | 1998-04-21 | Amersham Life Science, Inc. | DNA cycle sequencing |
| US5756285A (en) | 1991-09-27 | 1998-05-26 | Amersham Life Science, Inc. | DNA cycle sequencing |
Non-Patent Citations (8)
| Title |
|---|
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", vol. 1-4, 1994, JOHN WILEY & SONS, INC. |
| BALL, GENE, vol. 57, no. 2-3, 1987, pages 183 - 92 |
| EAVES ET AL., J. BACTERIOL., vol. 85, 1963, pages 273 - 8 |
| FILIMONOVA ET AL., BIOCHEM. MOL. BIOL. INT., vol. 33, no. 6, 1994, pages 1229 - 36 |
| FRIEDHOFF ET AL., PROTEIN EXPR. PURIF., vol. 5, no. 1, 1994, pages 37 - 43 |
| MANIATIS ET AL.: "Molecular Cloning: A Laboratory Manual", 1982, COLD SPRING HARBOR LABORATORY PRESS |
| R. L. OLSEN ET AL., COMP. BIOCHEM. PHYSIOL., vol. 99B, no. 4, 1991, pages 755 - 761 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, Second Edition,", vol. 1-3, 1989, COLD SPRING HARBOR LABORATORY PRESS |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2014145706A3 (en) | 2014-11-13 |
| US20160230156A1 (en) | 2016-08-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA2749693A1 (en) | Enzyme preparation containing thermostable dna polymerase, method for producing same, and method for detecting subject organism to be detected | |
| EP1224295A1 (en) | Method and compositions for improved polynucleotide synthesis | |
| CN106244569B (en) | Esterase EstC10, and coding gene and application thereof | |
| CN108285895A (en) | A kind of esterase EstC11 and its encoding gene and application | |
| US7981653B2 (en) | Highly efficient hyperthermophilic DNA ligase | |
| Kaplan et al. | Recombinant production of Thermus aquaticus single-strand binding protein for usage as PCR enhancer | |
| US20160230156A1 (en) | Recombinant fusion protein possessing nuclease and phosphatase activity | |
| JP4857260B2 (en) | Cryogenic microorganism-derived endonuclease | |
| CN114645033B (en) | A kind of nucleoside triphosphate hydrolase and its purification method and application | |
| US20110020896A1 (en) | Mutant dna polymerases and their genes | |
| CN109735516A (en) | The guidance of subject nucleotide segment has the PIWI albumen of specific nucleic acid endonuclease activity | |
| RU2809366C1 (en) | METHOD OF OBTAINING LARGE FRAGMENT OF Bst POLYMERASE (OPTIONS) | |
| JPWO2002010360A1 (en) | Novel DNA synthase | |
| CN118460500B (en) | Fusion DNA polymerase and preparation method and application thereof | |
| JP5935382B2 (en) | RrhJ1II nuclease and its gene | |
| WO2004020621A1 (en) | Thermostable ribonuclease h | |
| CN112143721B (en) | Low-temperature catalase and preparation method and application thereof | |
| US20240360477A1 (en) | Systems and methods for transposing cargo nucleotide sequences | |
| US12595467B2 (en) | DNA polymerase and Dna polymerase derived 3′-5′exonuclease | |
| KR100969477B1 (en) | Thermo-resistant DNA polymerase derived from Thermococcus guamatissis strain and polymerase chain reaction method using the same | |
| CN113151213B (en) | A kind of high fidelity DNA polymerase and its preparation method and PCR application | |
| JP6120066B2 (en) | Novel nuclease and its gene | |
| US20230125232A1 (en) | Atp-dependent dna ligase | |
| KR101866810B1 (en) | Cold-adaptive peptidase from Janthinobacterium sp. and preparation method thereof | |
| Traving et al. | The sialate‐pyruvate lyase from pig kidney: Elucidation of the primary structure and expression of recombinant enzyme activity |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14717964 Country of ref document: EP Kind code of ref document: A2 |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 14717964 Country of ref document: EP Kind code of ref document: A2 |