WO2014111840A2 - Peptide - Google Patents

Peptide Download PDF

Info

Publication number
WO2014111840A2
WO2014111840A2 PCT/IB2014/058233 IB2014058233W WO2014111840A2 WO 2014111840 A2 WO2014111840 A2 WO 2014111840A2 IB 2014058233 W IB2014058233 W IB 2014058233W WO 2014111840 A2 WO2014111840 A2 WO 2014111840A2
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
mog
disease
peptides
cell
Prior art date
Application number
PCT/IB2014/058233
Other languages
French (fr)
Other versions
WO2014111840A3 (en
Inventor
David Wraith
Heather Streeter
Original Assignee
Apitope International Nv
Merck Serono S.A.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP14703175.1A priority Critical patent/EP2945966B1/en
Priority to JP2015552188A priority patent/JP6347065B2/en
Priority to SG11201505526TA priority patent/SG11201505526TA/en
Priority to CN201480009521.1A priority patent/CN105121463B/en
Priority to AU2014206592A priority patent/AU2014206592B2/en
Priority to CA2897655A priority patent/CA2897655C/en
Priority to BR112015016780A priority patent/BR112015016780A2/en
Priority to KR1020157020496A priority patent/KR102169902B1/en
Application filed by Apitope International Nv, Merck Serono S.A. filed Critical Apitope International Nv
Priority to RU2015134356A priority patent/RU2675479C2/en
Priority to MX2015009085A priority patent/MX369414B/en
Priority to US14/760,493 priority patent/US9862751B2/en
Publication of WO2014111840A2 publication Critical patent/WO2014111840A2/en
Publication of WO2014111840A3 publication Critical patent/WO2014111840A3/en
Priority to IL239871A priority patent/IL239871B/en
Priority to ZA2015/04987A priority patent/ZA201504987B/en
Priority to HK15112229.1A priority patent/HK1211596A1/en
Priority to US15/834,438 priority patent/US10377800B2/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4713Autoimmune diseases, e.g. Insulin-dependent diabetes mellitus, multiple sclerosis, rheumathoid arthritis, systemic lupus erythematosus; Autoantigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag

Definitions

  • the present invention relates to peptides from myelin oligodendrocyte glycoprotein (MOG).
  • MOG myelin oligodendrocyte glycoprotein
  • the invention relates to peptides which comprise a portion of the region 40-60 of MOG which are capable of binding to an MHC molecule and being presented to a T-cell in vitro without antigen processing.
  • the invention also relates to the use of such peptides in the treatment and/or prevention of a disease.
  • MS Multiple sclerosis
  • MS is a chronic degenerative disease affecting the central nervous system, characterized by demyelination of nerve axons. MS may cause numerous physical and mental symptoms, and often progresses to both physical and cognitive disability. Disease onset usually occurs in young adults (20-40 yrs), is more common in women, and affects more than 1 million people around the world.
  • MS The disease course of MS is varied and may lie dormant or progress steadily over time.
  • Several subtypes of MS have been described based on patterns of progression.
  • a person with MS can suffer almost any neurological symptom or sign, including changes in sensation such as loss of sensitivity or tingling, pricking or numbness (hypoesthesia and paraesthesia), muscle weakness, clonus, muscle spasms, or difficulty in moving; difficulties with coordination and balance (ataxia); problems in speech (dysarthria) or swallowing (dysphagia), visual problems (nystagmus, optic neuritis including phosphenes, or diplopia), fatigue, acute or chronic pain, and bladder and bowel difficulties.
  • MS is currently believed to be an immune-mediated disorder in which the body's own immune system attacks and damages myelin.
  • MS there is no known cure for MS.
  • Several current therapies have proven beneficial in restoring function after an attack (relapse), preventing or reducing the degree or frequency of new attacks (relapses), or preventing or reducing the extent of disability.
  • many current MS therapies have been associated with adverse effects or are poorly tolerated. There is thus a need for alternative therapies for MS which are effective at treating MS and at alleviating or reducing the symptoms of MS.
  • the present inventors have identified a number of peptides derivable from myelin oligodendrocyte glycoprotein which can be presented by fixed antigen presenting cells to T-cells. These peptides may be useful in the prevention and/or treatment of demyelinating diseases such as multiple sclerosis.
  • the present invention provides a peptide which is capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing (i.e. an apitope), which comprises a portion of the region 40-60 of myelin oligodendrocyte glycoprotein (MOG).
  • a T cell without antigen processing i.e. an apitope
  • MOG myelin oligodendrocyte glycoprotein
  • the peptide may comprise a portion of the region 41-59 of myelin oligodendrocyte glycoprotein.
  • the peptide may be selected from the following myelin oligodendrocyte glycoprotein peptides: MOG 41-55, 43-57, 44-58 and 45-59.
  • the peptide may be MOG 41-55.
  • a peptide according to the first aspect of the invention for use in the treatment and/or prevention of a demyelinating disease.
  • the present invention provides a pharmaceutical composition comprising one or more peptide(s) according to the first aspect of the invention.
  • the present invention provides a method for treating and/or preventing a demyelinating disease in a subject in need of same which comprises the step of administering a peptide according to the first aspect of the invention to the subject.
  • the present invention relates to the use of a peptide according to the first aspect of the invention in the manufacture of a medicament for use in the prevention and/or treatment of a demyelinating disease.
  • the disease may be multiple sclerosis.
  • Figure 1 is a graph to show the peptide specificity of various MOG- specific hybridoma clones.
  • Figure 2 shows the results of a recall proliferation assay to test the effect of treatment of mice with ROK5 (MOG 41-55) prior to immunisation with MOG35-55 followed by an in vitro recall with MOG35-55.
  • Figure 3 shows the cytokine profiles from supernatants from splenocytes from mice pretreated in vivo with ROK5 or PBS and immunisation with MOG35-55 followed by an in vitro recall with MOG35-55.
  • Figure 4 schematically illustrates the in vivo EAE prevention protocols.
  • Figure 5 shows that the peptide MOG35-55 induces EAE in a murine model.
  • Figure 6 shows that both mouse and human ROK5 apitopes can reduce the severity of the disease induced by MOG35-55.
  • Figure 7 shows that huROK5 reduced the severity of disease and caused a delay in the peak of disease burden.
  • the present invention relates to a peptide.
  • peptide is used in the normal sense to mean a series of residues, typically L- amino acids, connected one to the other typically by peptide bonds between the ot-amino and carboxyl groups of adjacent amino acids
  • peptide includes modified peptides and synthetic peptide analogues.
  • a peptide of the present invention is of a length that is capable of binding to a major histocompatibility complex (MHC) class I or II molecule in vitro and being presented to a T cell without antigen processing.
  • MHC major histocompatibility complex
  • the peptides are capable of binding directly into the peptide binding groove of the MHC molecule without requiring any trimming at one or both ends.
  • Peptides that bind to MHC class I molecules are typically 7 to 13, more usually 8 to 10 amino acids in length.
  • the binding of the peptide is stabilised at its two ends by contacts between atoms in the main chain of the peptide and invariant sites in the peptide-binding groove of all MHC class I molecules. There are invariant sites at both ends of the groove which bind the amino and carboxy termini of the peptide. Variations in peptide length are accommodated by a kinking in the peptide backbone, often at proline or glycine residues that allow the required flexibility.
  • Peptides which bind to MHC class II molecules are typically between 8 and 20 amino acids in length, more usually between 10 and 17 amino acids in length. These peptides lie in an extended conformation along the MHC II peptide-binding groove which (unlike the MHC class I peptide-binding groove) is open at both ends. The peptide is held in place mainly by main-chain atom contacts with conserved residues that line the peptide-binding groove.
  • the peptide of the present invention may be made using chemical methods (Peptide Chemistry, A practical Textbook. Mikos Bodansky, Springer-Verlag, Berlin.).
  • peptides can be synthesized by solid phase techniques (Roberge JY et al (1995) Science 269: 202-204), cleaved from the resin, and purified by preparative high performance liquid chromatography (e.g., Creighton (1983) Proteins Structures And Molecular Principles, WH Freeman and Co, New York NY). Automated synthesis may be achieved, for example, using the ABI 43 1 A Peptide Synthesizer (Perkin Elmer) in accordance with the instructions provided by the manufacturer.
  • the peptide may alternatively be made by recombinant means, or by cleavage from a longer polypeptide.
  • the peptide may be obtained by cleavage from myelin basic protein.
  • the composition of a peptide may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure).
  • Myelin oligodendrocyte glycoprotein (MOG) Myelin oligodendrocyte glycoprotein (MOG)
  • Myelin oligodendrocyte glycoprotein is a type I integral membrane protein possessing a single extracellular Ig variable domain (Ig-V).
  • the amino acid sequence of MOG is highly conserved among animal species (>90%), indicative of an important biological function. MOG is specifically expressed in the CNS on the outermost lamellae of the myelin sheath as well as the cell body and processes of oligodendrocytes.
  • the peptide of the invention is derivable from region 40-60 of myelin oligodendrocyte glycoprotein (MOG).
  • MOG myelin oligodendrocyte glycoprotein
  • the peptide may be derivable from a fragment of the antigen which arises by natural processing of the antigen by an antigen presenting cell.
  • Region 40-60 of MOG has the following sequence:
  • the peptide may comprise the minimal epitope from the following peptides: MOG 41-55, 43.57, 44-58 and 45-59.
  • MOG 41-55, 43-57, 44-58 and 45-59 are:
  • MOG 41-55 RPPFSRVVHLYRNGK (SEQ ID No. 1)
  • MOG 43-57 PFSRVVHLYRNGKDQ (SEQ ID No. 2)
  • MOG 44-58 FSRVVHLYRNGKDQD (SEQ ID No. 3)
  • MOG 45-59 SRVVHLYRNGKDQDG (SEQ ID No. 4)
  • the peptide may comprise the minimal epitope from MOG 41-55.
  • the peptide may consist of MOG 41-55.
  • T lymphocytes are capable of recognising internal epitopes of a protein antigen.
  • Antigen presenting cells APC take up protein antigens and degrade them into short peptide fragments.
  • a peptide may bind to a major histocompatibility complex (MHC) class I or II molecule inside the cell and be carried to the cell surface.
  • MHC major histocompatibility complex
  • the peptide When presented at the cell surface in conjunction with an MHC molecule, the peptide may be recognised by a T cell (via the T cell receptor (TCR)), in which case the peptide is a T cell epitope.
  • TCR T cell receptor
  • T cell epitopes play a central role in the adaptive immune response to any antigen, whether self or foreign.
  • the central role played by T cell epitopes in hypersensitivity diseases (which include allergy, autoimmune diseases and transplant rejection) has been demonstrated through the use of experimental models. It is possible to induce inflammatory or allergic diseases by injection of synthetic peptides (based on the structure of T cell epitopes) in combination with adjuvant.
  • tolerogenic peptides to treat or prevent disease has attracted considerable attention.
  • One reason for this is that it has been shown that certain tolerogenic epitopes can down-regulate responses of T cells for distinct antigens within the same tissue.
  • This phenomenon known as "bystander suppression” means that it should be possible to induce tolerance to more than one epitope (preferably all epitopes) within a given antigen, and to more than one antigen for a given disease, using a particular tolerogenic peptide (Anderton and Wraith (1998) as above). This would obviate the need to identify all of the pathogenic antigens within a particular disease.
  • Peptides are also a favourable option for therapy because of their relatively low cost and the fact that peptide analogues can be produced with altered immunological properties. Peptides may thus be modified to alter their interactions with either MHC or TCR.
  • MBP myelin basic protein
  • a peptide epitope is of an appropriate size to be presented by immature APC without antigen processing, it can induce immunological tolerance (International patent application number PCT/GBOl/03702).
  • PCT/GBOl/03702 International patent application number
  • T cell epitopes are tolerogenic and others are incapable of inducing tolerance can therefore be explained by the fact that some epitopes require antigen processing before they are capable of being presented by an MHC molecule.
  • These epitopes which require further processing do not induce tolerance when administered in a soluble form, despite their capacity to induce disease when injected in combination with adjuvant.
  • apitopes Antigen Processing Independent epiTOPES
  • APIPS Antigen Processing Independent Presentation Systems
  • the peptides of the present invention are capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing. It is possible to test whether a peptide is capable of binding to an MHC molecule without antigen processing using a "processing free" system. Such a system should be capable of presenting antigen via MHC molecules to T cells, but incapable of processing antigen. Thus peptides may be tested for their capacity to bind to an MHC molecule in vitro and being presented to a T cell without antigen processing using an antigen processing independent presentation system (APIPS).
  • APIPS include: a) fixed APC (with or without antibodies to CD28);
  • Lipid membranes containing Class I or II MHC molecules (with or without antibodies to CD28);
  • APC may be fixed using, for example formaldehyde (usually paraformaldehyde) or glutaraldehyde.
  • Lipid membranes (which may be planar membranes or liposomes) may be prepared using artificial lipids or may be plasma membrane/microsomal fractions from APC.
  • the APIPS may be applied to the wells of a tissue culture plate. Peptide antigens are then added and binding of the peptide to the MHC portion of the APIPS is detected by addition of selected T cell lines or clones. Activation of the T cell line or clone may be measured by any of the methods known in the art, for example via 3 H-thymidine incorporation or cytokine secretion.
  • a peptide is capable of being presented to a T cell by an APIPS, then it is capable of binding to the MHC molecule without antigen processing, and is an apitope.
  • the peptides of the present invention are capable of inducing tolerance to myelin oligodendrocyte glycoprotein (MOG).
  • MOG myelin oligodendrocyte glycoprotein
  • tolerogenic means capable of inducing tolerance.
  • Tolerance is the failure to respond to an antigen. Tolerance to self antigens is an essential feature of the immune system, when this is lost, autoimmune disease can result.
  • the adaptive immune system must maintain the capacity to respond to an enormous variety of infectious agents while avoiding autoimmune attack of the self antigens contained within its own tissues. This is controlled to a large extent by the sensitivity of immature T lymphocytes to apoptotic cell death in the thymus (central tolerance). However, not all self antigens are detected in the thymus, so death of self-reactive thymocytes remains incomplete. There are thus also mechanisms by which tolerance may be acquired by mature self-reactive T lymphocytes in the peripheral tissues (peripheral tolerance). A review of the mechanisms of central and peripheral tolerance is given in Anderton et al ( 1999) ⁇ Immunological Reviews 169 : 123 - 137) .
  • Tolerance may result from or be characterised by the induction of anergy in at least a portion of CD4+ T cells.
  • a peptide In order to activate a T cell, a peptide must associate with a "professional" APC capable of delivering two signals to T cells.
  • the first signal (signal 1) is delivered by the MHC-peptide complex on the cell surface of the APC and is received by the T cell via the TCR.
  • the second signal (signal 2) is delivered by co stimulatory molecules on the surface of the APC, such as CD80 and CD86, and received by CD28 on the surface of the T cell. It is thought that when a T cell receives signal 1 in the absence of signal 2, it is not activated and, in fact, becomes anergic.
  • Anergic T cells are refractory to subsequent antigenic challenge, and may be capable of suppressing other immune responses.
  • Anergic T cells are thought to be involved in mediating T cell tolerance.
  • Mature antigen presenting cells such as macrophages, B cells and dendritic cells
  • Apitopes will be able to bind class II MHC on immature APC. Thus they will be presented to T cells without costimulation, leading to T cell anergy and tolerance.
  • apitopes are also capable of binding to MHC molecules at the cell surface of mature APC.
  • the induction of tolerance can therefore be monitored by various techniques including:
  • the peptide of the invention may be used in the treatment and/or prevention of a disease.
  • the disease may be a demyelinating diseases, such as adrenoleukodystrophy, vanishing white matter disease, or multiple sclerosis (MS).
  • demyelinating diseases such as adrenoleukodystrophy, vanishing white matter disease, or multiple sclerosis (MS).
  • MS multiple sclerosis
  • MS is a chronic inflammatory disease characterised by multiple demyelinating lesions disseminated throughout the CNS white matter and occurring at various sites and times (McFarlin and McFarland, 1982 New England J. Medicine 307:1183-1188 and 1246-1251). MS is thought to be mediated by autoreactive T cells.
  • the present invention relates to a pharmaceutical composition comprising one or more peptide(s) of the first aspect of the invention.
  • the present inventors predict that, despite "bystander suppression" it may be necessary to target a number of different T cell clones in order to induce tolerance effectively. Hence a plurality of peptides may be administered to an individual in order to prevent or treat a disease.
  • the pharmaceutical composition may, for example comprise between 1 and 20 apitopes, for example 1 to 15, 2 to 8 or 4 to 6 apitopes.
  • the pharmaceutical composition may be in the form of a kit, in which some or each of the apitopes are provided separately for simultaneous, separate or sequential administration.
  • each dose may be packaged separately.
  • the pharmaceutical composition may comprise a therapeutically or prophylactically effective amount of the or each apitope and optionally a pharmaceutically acceptable carrier, diluent or excipient.
  • the or each apitope may be admixed with any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), or solubilising agent(s).
  • the peptide may be administered in soluble form in the absence of adjuvant.
  • the peptide may be administered by a mucosal route.
  • the peptide may be administered intranasally.
  • a plurality of peptides may be in the form of a "cocktail" which is suitable for administration in single or multiple doses. Alternatively it may be preferable to give multiple doses but vary the relative concentrations of the peptides between doses. In a preferred embodiment a "dose escalation" protocol may be followed, where a plurality of doses is given to the patient in ascending concentrations.
  • phospholipase A2 peptides in immunotherapeutic applications against bee venom allergy (Mtiller et al (1998) J. Allergy Clin Immunol. 101 :747-754 and Akdis et al (1998) J. Clin. Invest. 102:98-106).
  • EXAMPLE 1 Identification of apitopes within myelin oligodendrocyte glycoprotein (MOG)
  • rhMOGE D This recombinant human MOG extracellular domain
  • a panel of 15-mer overlapping peptides spanning rhMOG ED was synthesized using standard F-moc chemistry. The 15mers peptides were displaced by 5aa and overlapping by lOaa.
  • MOG-specific hybridoma T cell clones were generated by immunisation of DR2+ mice.
  • DR2+ mice were immunised with either a pool of MOG overlapping peptides or rhMOG ED in complete Freunds adjuvant (CFA).
  • CFA complete Freunds adjuvant
  • CD4+ T cells were purified and restimulated with antigen/CFA in vitro.
  • T cells were restimulated in vitro with antigen to increase the number of activated antigen-specific cells.
  • activated T cells were fused with the thymoma cell line BW 5147.
  • Hybridoma clones were then selected using HAT selection medium and screened for peptide specificity by IL-2 ELISA.
  • Live or p-formaldehyde fixed Mgar (HLA-DR2 +ve) cells were incubated with peptides in serum or in serum alone, together with T cells for 48 hours.
  • the T cell proliferative response was measured by IL-2 production.
  • the response of various MOG-specific hybridoma clones to presentation of nested MOG peptides is shown in Figure 1.
  • the peptide MOG 41-55 (“ROK5") was defined as an apitope as it could be presented by fixed APC to T cells without further processing.
  • a detailed study was then carried out using overlapping peptides in the region 25-60, using peptides that are displaced by one amino acid.
  • the peptides MOG 41-55, 43-57, 44-58 and 45-59 were identified as apitopes ( Figure 1 ).
  • HLA-DR2 transgenic mice were immunised with either 100 ⁇ g ROK5 (MOG 41-55), 100 ⁇ g MOG 35-55 or PBS on days - 8, -4 and -2.
  • mice were challenged with 100 ⁇ g MOG 35-55 by injection in the tail base in combination with CFA.
  • splenocytes and draining lymph nodes were harvested and their respective cell populations isolated and a recall proliferation assay was set up with MOG 35-55. Cells from individual mice were treated separately and data is plotted separately in Figure 2.
  • ROK5 MOG 41-55
  • MOG 35-55 ROK5
  • EAE experimental autoimmune encephalomyelitis
  • mice were used per group.
  • mMOG35-55 MEVGWYRSPFSRVVHLYRNGK (SEQ ID No. 7)
  • hROK5 (41-55): RPPF SRV VHL YRNGK (SEQ ID No. 1)
  • mROK5 (41-55): RSPFSRVVHL YRNGK (SEQ ID No. 8 )
  • MOG35-55 Human and mouse MOG differ by an amino-acid substitution in position 42, substitution of a proline for a serine. Both MOG35-55 peptides are immunogenic, but the mouse MOG35-55 is more encephalitogenic, therefore mouse MOG35-55 was chosen to induce EAE in the model.
  • CFA Complete Freund's Adjuvant
  • a first experiment was performed where animals were pretreated 3 times (3 days apart) with either mouse ROK5, human ROK5 or PBS, 100 ⁇ g in ⁇ in CFA (s.c. injection in the flank), then all animals were immunised with 200 ⁇ g mMOG35-55 in CFA (s.c. injection at the base of the tail) and with 200ng Pertussis toxin (200ng in PBS, i.p.) at day zero and day 2.
  • experiment 1 shows that both mouse and human ROK5 apitopes can reduce the severity of the disease induced by MOG35-55.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Cell Biology (AREA)
  • Rehabilitation Therapy (AREA)
  • Hematology (AREA)
  • Diabetes (AREA)
  • Rheumatology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Transplantation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Epidemiology (AREA)

Abstract

There is provided a peptide which is capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing (i.e. an apitope) which peptide comprises a portion of the region 40-60 of myelin oligodendrocyte glycoprotein (MOG). In particular there is provided an apitope which is selected from the following myelin oligodendrocyte glycoprotein peptides: MOG 41-55, 43-57, 44-58 and 45-59. There is also provided the use of such a peptide in a pharmaceutical composition and a method to treat and/or prevent a disease using such a peptide.

Description

PEPTIDE
The present invention relates to peptides from myelin oligodendrocyte glycoprotein (MOG). In particular, the invention relates to peptides which comprise a portion of the region 40-60 of MOG which are capable of binding to an MHC molecule and being presented to a T-cell in vitro without antigen processing. The invention also relates to the use of such peptides in the treatment and/or prevention of a disease.
BACKGROUND
Multiple sclerosis (MS) is a chronic degenerative disease affecting the central nervous system, characterized by demyelination of nerve axons. MS may cause numerous physical and mental symptoms, and often progresses to both physical and cognitive disability. Disease onset usually occurs in young adults (20-40 yrs), is more common in women, and affects more than 1 million people around the world.
The disease course of MS is varied and may lie dormant or progress steadily over time. Several subtypes of MS have been described based on patterns of progression. A person with MS can suffer almost any neurological symptom or sign, including changes in sensation such as loss of sensitivity or tingling, pricking or numbness (hypoesthesia and paraesthesia), muscle weakness, clonus, muscle spasms, or difficulty in moving; difficulties with coordination and balance (ataxia); problems in speech (dysarthria) or swallowing (dysphagia), visual problems (nystagmus, optic neuritis including phosphenes, or diplopia), fatigue, acute or chronic pain, and bladder and bowel difficulties.
MS is currently believed to be an immune-mediated disorder in which the body's own immune system attacks and damages myelin.
There is no known cure for MS. Several current therapies have proven beneficial in restoring function after an attack (relapse), preventing or reducing the degree or frequency of new attacks (relapses), or preventing or reducing the extent of disability. However, many current MS therapies have been associated with adverse effects or are poorly tolerated. There is thus a need for alternative therapies for MS which are effective at treating MS and at alleviating or reducing the symptoms of MS.
SUMMARY OF THE INVENTION
The present inventors have identified a number of peptides derivable from myelin oligodendrocyte glycoprotein which can be presented by fixed antigen presenting cells to T-cells. These peptides may be useful in the prevention and/or treatment of demyelinating diseases such as multiple sclerosis.
In a first aspect, therefore, the present invention provides a peptide which is capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing (i.e. an apitope), which comprises a portion of the region 40-60 of myelin oligodendrocyte glycoprotein (MOG).
The peptide may comprise a portion of the region 41-59 of myelin oligodendrocyte glycoprotein.
The peptide may be selected from the following myelin oligodendrocyte glycoprotein peptides: MOG 41-55, 43-57, 44-58 and 45-59.
The peptide may be MOG 41-55.
In a second aspect there is provided a peptide according to the first aspect of the invention for use in the treatment and/or prevention of a demyelinating disease.
In a third aspect, the present invention provides a pharmaceutical composition comprising one or more peptide(s) according to the first aspect of the invention. In a fourth aspect the present invention provides a method for treating and/or preventing a demyelinating disease in a subject in need of same which comprises the step of administering a peptide according to the first aspect of the invention to the subject. In a fifth aspect, the present invention relates to the use of a peptide according to the first aspect of the invention in the manufacture of a medicament for use in the prevention and/or treatment of a demyelinating disease.
In connection with the second, fourth and fifth aspects of the invention, the disease may be multiple sclerosis.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 is a graph to show the peptide specificity of various MOG- specific hybridoma clones.
Figure 2 shows the results of a recall proliferation assay to test the effect of treatment of mice with ROK5 (MOG 41-55) prior to immunisation with MOG35-55 followed by an in vitro recall with MOG35-55.
Figure 3 shows the cytokine profiles from supernatants from splenocytes from mice pretreated in vivo with ROK5 or PBS and immunisation with MOG35-55 followed by an in vitro recall with MOG35-55.
Figure 4 schematically illustrates the in vivo EAE prevention protocols.
Figure 5 shows that the peptide MOG35-55 induces EAE in a murine model.
Figure 6 shows that both mouse and human ROK5 apitopes can reduce the severity of the disease induced by MOG35-55.
Figure 7 shows that huROK5 reduced the severity of disease and caused a delay in the peak of disease burden. DETAILED DESCRIPTION
In a first aspect, the present invention relates to a peptide. Peptides
The term "peptide" is used in the normal sense to mean a series of residues, typically L- amino acids, connected one to the other typically by peptide bonds between the ot-amino and carboxyl groups of adjacent amino acids The term includes modified peptides and synthetic peptide analogues.
A peptide of the present invention is of a length that is capable of binding to a major histocompatibility complex (MHC) class I or II molecule in vitro and being presented to a T cell without antigen processing. In other words the peptides are capable of binding directly into the peptide binding groove of the MHC molecule without requiring any trimming at one or both ends.
Peptides that bind to MHC class I molecules are typically 7 to 13, more usually 8 to 10 amino acids in length. The binding of the peptide is stabilised at its two ends by contacts between atoms in the main chain of the peptide and invariant sites in the peptide-binding groove of all MHC class I molecules. There are invariant sites at both ends of the groove which bind the amino and carboxy termini of the peptide. Variations in peptide length are accommodated by a kinking in the peptide backbone, often at proline or glycine residues that allow the required flexibility.
Peptides which bind to MHC class II molecules are typically between 8 and 20 amino acids in length, more usually between 10 and 17 amino acids in length. These peptides lie in an extended conformation along the MHC II peptide-binding groove which (unlike the MHC class I peptide-binding groove) is open at both ends. The peptide is held in place mainly by main-chain atom contacts with conserved residues that line the peptide-binding groove. The peptide of the present invention may be made using chemical methods (Peptide Chemistry, A practical Textbook. Mikos Bodansky, Springer-Verlag, Berlin.). For example, peptides can be synthesized by solid phase techniques (Roberge JY et al (1995) Science 269: 202-204), cleaved from the resin, and purified by preparative high performance liquid chromatography (e.g., Creighton (1983) Proteins Structures And Molecular Principles, WH Freeman and Co, New York NY). Automated synthesis may be achieved, for example, using the ABI 43 1 A Peptide Synthesizer (Perkin Elmer) in accordance with the instructions provided by the manufacturer. The peptide may alternatively be made by recombinant means, or by cleavage from a longer polypeptide. For example, the peptide may be obtained by cleavage from myelin basic protein. The composition of a peptide may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure). Myelin oligodendrocyte glycoprotein (MOG)
Myelin oligodendrocyte glycoprotein (MOG) is a type I integral membrane protein possessing a single extracellular Ig variable domain (Ig-V). The amino acid sequence of MOG is highly conserved among animal species (>90%), indicative of an important biological function. MOG is specifically expressed in the CNS on the outermost lamellae of the myelin sheath as well as the cell body and processes of oligodendrocytes.
The sequence of mature MOG (lacking the 29 amino acid signal peptide) is given below (SEQ ID No. 5).
SEQ ID No. 5
GQFRVIGPRHPIRALVGDEVELPCRISPGKNATG EVGWYRPPFSRVVHLYRNGKDQDGDQ APEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVL PVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGP LVALIICYNWLHRRLAGQFLEELRNPF The peptide of the invention is derivable from region 40-60 of myelin oligodendrocyte glycoprotein (MOG). The peptide may be derivable from a fragment of the antigen which arises by natural processing of the antigen by an antigen presenting cell. Region 40-60 of MOG has the following sequence:
SEQ ID No. 6
YRP P FS RVVHL YRNGKDQDGD The peptide may comprise the minimal epitope from the following peptides: MOG 41-55, 43.57, 44-58 and 45-59.
The sequences of MOG 41-55, 43-57, 44-58 and 45-59 are:
MOG 41-55: RPPFSRVVHLYRNGK (SEQ ID No. 1)
MOG 43-57: PFSRVVHLYRNGKDQ (SEQ ID No. 2)
MOG 44-58: FSRVVHLYRNGKDQD (SEQ ID No. 3)
MOG 45-59: SRVVHLYRNGKDQDG (SEQ ID No. 4)
The peptide may comprise the minimal epitope from MOG 41-55. The peptide may consist of MOG 41-55.
Apitopes
In an adaptive immune response, T lymphocytes are capable of recognising internal epitopes of a protein antigen. Antigen presenting cells (APC) take up protein antigens and degrade them into short peptide fragments. A peptide may bind to a major histocompatibility complex (MHC) class I or II molecule inside the cell and be carried to the cell surface. When presented at the cell surface in conjunction with an MHC molecule, the peptide may be recognised by a T cell (via the T cell receptor (TCR)), in which case the peptide is a T cell epitope.
T cell epitopes play a central role in the adaptive immune response to any antigen, whether self or foreign. The central role played by T cell epitopes in hypersensitivity diseases (which include allergy, autoimmune diseases and transplant rejection) has been demonstrated through the use of experimental models. It is possible to induce inflammatory or allergic diseases by injection of synthetic peptides (based on the structure of T cell epitopes) in combination with adjuvant.
By contrast, it has been shown to be possible to induce immunological tolerance towards particular peptide epitopes by administration of peptide epitopes in soluble form. Administration of soluble peptide antigens has been demonstrated as an effective means of inhibiting disease in experimental autoimmune encephalomyelitis (EAE - a model for multiple sclerosis (MS)) (Metzler and Wraith (1993) Int. Immunol. 5:1159-1165; Liu and Wraith (1995) Int. Immunol. 7:1255-1263; Anderton and Wraith (1998) Eur. J. Immunol. 28:1251-1261); and experimental models of arthritis, diabetes, and uveoretinitis (reviewed in Anderton and Wraith (1998) as above). This has also been demonstrated as a means of treating an ongoing disease in EAE (Anderton and Wraith (1998) as above).
The use of tolerogenic peptides to treat or prevent disease has attracted considerable attention. One reason for this is that it has been shown that certain tolerogenic epitopes can down-regulate responses of T cells for distinct antigens within the same tissue. This phenomenon, known as "bystander suppression" means that it should be possible to induce tolerance to more than one epitope (preferably all epitopes) within a given antigen, and to more than one antigen for a given disease, using a particular tolerogenic peptide (Anderton and Wraith (1998) as above). This would obviate the need to identify all of the pathogenic antigens within a particular disease. Peptides are also a favourable option for therapy because of their relatively low cost and the fact that peptide analogues can be produced with altered immunological properties. Peptides may thus be modified to alter their interactions with either MHC or TCR.
One possible problem with this approach is that it has been shown that not all peptides which act as T cell epitopes are capable of inducing tolerance. The myelin basic protein (MBP) peptide 89-101 is an immunodominant antigen after immunisation and is also a very effective immunogen both in terms of priming for T cell reactivity and induction of EAE. However, this peptide has been shown to be ineffective at inducing tolerance when administered in solution (Anderton and Wraith (1998), as above).
A number of explanations for the observed hierarchy in the ability of T cell epitopes to induce tolerance have been proposed (reviewed in Anderton and Wraith (1998) as above). In particular, it has been proposed that there is a correlation between the affinity of the peptide for the MHC and tolerogenicity (Liu and Wraith (1995) as above), but this does not tally with some of the observations. For example, MBP [89-101], which is not tolerogenic, binds to I-A with relatively high affinity. It is thus not straightforward to predict which peptides will induce tolerance.
The present inventors have shown that if a peptide epitope is of an appropriate size to be presented by immature APC without antigen processing, it can induce immunological tolerance (International patent application number PCT/GBOl/03702). The observation that some T cell epitopes are tolerogenic and others are incapable of inducing tolerance can therefore be explained by the fact that some epitopes require antigen processing before they are capable of being presented by an MHC molecule. These epitopes which require further processing do not induce tolerance when administered in a soluble form, despite their capacity to induce disease when injected in combination with adjuvant.
The epitopes which do not require further processing are capable of inducing tolerance, and have been termed "apitopes" (Antigen Processing Independent epiTOPES) by the inventors. Antigen Processing Independent Presentation Systems (APIPS)
The peptides of the present invention are capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing. It is possible to test whether a peptide is capable of binding to an MHC molecule without antigen processing using a "processing free" system. Such a system should be capable of presenting antigen via MHC molecules to T cells, but incapable of processing antigen. Thus peptides may be tested for their capacity to bind to an MHC molecule in vitro and being presented to a T cell without antigen processing using an antigen processing independent presentation system (APIPS). Examples of APIPS include: a) fixed APC (with or without antibodies to CD28);
b) Lipid membranes containing Class I or II MHC molecules (with or without antibodies to CD28); and
c) purified natural or recombinant MHC in plate-bound form (with or without antibodies to CD28).
It is known to use fixed APC to investigate T cell responses, for example in studies to investigate the minimal epitope within a polypeptide, by measuring the response to truncated peptides (Fairchild et al (1996) Int. Immunol. 8: 1035-1043). APC may be fixed using, for example formaldehyde (usually paraformaldehyde) or glutaraldehyde.
Lipid membranes (which may be planar membranes or liposomes) may be prepared using artificial lipids or may be plasma membrane/microsomal fractions from APC.
In use, the APIPS may be applied to the wells of a tissue culture plate. Peptide antigens are then added and binding of the peptide to the MHC portion of the APIPS is detected by addition of selected T cell lines or clones. Activation of the T cell line or clone may be measured by any of the methods known in the art, for example via 3H-thymidine incorporation or cytokine secretion.
If a peptide is capable of being presented to a T cell by an APIPS, then it is capable of binding to the MHC molecule without antigen processing, and is an apitope.
Tolerance The peptides of the present invention are capable of inducing tolerance to myelin oligodendrocyte glycoprotein (MOG).
As used herein, the term "tolerogenic" means capable of inducing tolerance.
Tolerance is the failure to respond to an antigen. Tolerance to self antigens is an essential feature of the immune system, when this is lost, autoimmune disease can result. The adaptive immune system must maintain the capacity to respond to an enormous variety of infectious agents while avoiding autoimmune attack of the self antigens contained within its own tissues. This is controlled to a large extent by the sensitivity of immature T lymphocytes to apoptotic cell death in the thymus (central tolerance). However, not all self antigens are detected in the thymus, so death of self-reactive thymocytes remains incomplete. There are thus also mechanisms by which tolerance may be acquired by mature self-reactive T lymphocytes in the peripheral tissues (peripheral tolerance). A review of the mechanisms of central and peripheral tolerance is given in Anderton et al ( 1999) {Immunological Reviews 169 : 123 - 137) .
Tolerance may result from or be characterised by the induction of anergy in at least a portion of CD4+ T cells. In order to activate a T cell, a peptide must associate with a "professional" APC capable of delivering two signals to T cells. The first signal (signal 1) is delivered by the MHC-peptide complex on the cell surface of the APC and is received by the T cell via the TCR. The second signal (signal 2) is delivered by co stimulatory molecules on the surface of the APC, such as CD80 and CD86, and received by CD28 on the surface of the T cell. It is thought that when a T cell receives signal 1 in the absence of signal 2, it is not activated and, in fact, becomes anergic. Anergic T cells are refractory to subsequent antigenic challenge, and may be capable of suppressing other immune responses. Anergic T cells are thought to be involved in mediating T cell tolerance.
Peptides which require processing before they can be presented in conjunction with MHC molecules do not induce tolerance because they have to be handled by mature antigen presenting cells. Mature antigen presenting cells (such as macrophages, B cells and dendritic cells) are capable of antigen processing, but also of delivering both signals 1 and 2 to a T cell, leading to T cell activation. Apitopes, on the other hand, will be able to bind class II MHC on immature APC. Thus they will be presented to T cells without costimulation, leading to T cell anergy and tolerance. Of course, apitopes are also capable of binding to MHC molecules at the cell surface of mature APC. However, the immune system contains a greater abundance of immature than mature APC (it has been suggested that less than 10% of dendritic cells are activated, Summers et al. (2001) Am. J. Pathol. 159: 285-295). The default position to an apitope will therefore be anergy/tolerance, rather than activation.
It has been shown that, when tolerance is induced by peptide inhalation, the capacity of antigen-specific CD4+ T cells to proliferate is reduced. Also, the production of IL-2, IFN- γ and IL-4 production by these cells is down-regulated, but production of IL-10 is increased. Neutralisation of IL-10 in mice in a state of peptide-induced tolerance has been shown to restore completely susceptibility to disease. It has been proposed that a population of regulatory cells persist in the tolerant state which produce IL-10 and mediate immune regulation (Burkhart et al (1999) Int. hrrmunol. 11:1625-1634).
The induction of tolerance can therefore be monitored by various techniques including:
(a) reduced susceptibility to contract the disease for which the peptide is a target epitope in vivo;
(b) the induction of anergy in CD4+ T cells (which can be detected by subsequent challenge with antigen in vitro);
(c) changes in the CD4+ T cell population, including
(i) reduction in proliferation;
(ii) down-regulation in the production of IL-2, IFN-γ and IL-4; and
(iii) increase in the production of IL-10.
Target diseases
The peptide of the invention may be used in the treatment and/or prevention of a disease. The disease may be a demyelinating diseases, such as adrenoleukodystrophy, vanishing white matter disease, or multiple sclerosis (MS).
The peptides of the present invention are particularly useful in the treatment and/or prevention of multiple sclerosis (MS). Multiple sclerosis (MS) is a chronic inflammatory disease characterised by multiple demyelinating lesions disseminated throughout the CNS white matter and occurring at various sites and times (McFarlin and McFarland, 1982 New England J. Medicine 307:1183-1188 and 1246-1251). MS is thought to be mediated by autoreactive T cells.
Pharmaceutical composition
In a second aspect, the present invention relates to a pharmaceutical composition comprising one or more peptide(s) of the first aspect of the invention.
The present inventors predict that, despite "bystander suppression" it may be necessary to target a number of different T cell clones in order to induce tolerance effectively. Hence a plurality of peptides may be administered to an individual in order to prevent or treat a disease.
The pharmaceutical composition may, for example comprise between 1 and 20 apitopes, for example 1 to 15, 2 to 8 or 4 to 6 apitopes.
Where there are two or more apitopes, the pharmaceutical composition may be in the form of a kit, in which some or each of the apitopes are provided separately for simultaneous, separate or sequential administration.
Alternatively (or in addition) if the pharmaceutical composition (or any part thereof) is to be administered in multiple doses, each dose may be packaged separately. The pharmaceutical composition may comprise a therapeutically or prophylactically effective amount of the or each apitope and optionally a pharmaceutically acceptable carrier, diluent or excipient. Also, in the pharmaceutical compositions of the present invention, the or each apitope may be admixed with any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), or solubilising agent(s).
Administration
The peptide may be administered in soluble form in the absence of adjuvant.
The peptide may be administered by a mucosal route. Studies have shown that peptide, when given in soluble form intraperitoneally (i.p.), intravenously (i.v.) or intranasally (i.n.) or orally can induce T cell tolerance (Anderton and Wraith (1998) as above; Liu and Wraith (1995) as above; Metzler and Wraith (1999) Immunology 97:257-263). The peptide may be administered intranasally.
Studies in mice have demonstrated that the duration of peptide administration required to induce tolerance depends on the precursor frequency of T cells in the recipient (Burkhart et al (1999) as above). In many experimental studies, it has been shown that repeated doses of peptide are required to induce tolerance (Burkhart et al (1999) as above). The exact dose and number of doses of peptide will therefore depend on the individual, however, in a preferred embodiment a plurality of doses is administered.
If a plurality of peptides is administered simultaneously, they may be in the form of a "cocktail" which is suitable for administration in single or multiple doses. Alternatively it may be preferable to give multiple doses but vary the relative concentrations of the peptides between doses. In a preferred embodiment a "dose escalation" protocol may be followed, where a plurality of doses is given to the patient in ascending concentrations. Such an approach has been used, for example, for phospholipase A2 peptides in immunotherapeutic applications against bee venom allergy (Mtiller et al (1998) J. Allergy Clin Immunol. 101 :747-754 and Akdis et al (1998) J. Clin. Invest. 102:98-106).
EXAMPLES The following examples serve to illustrate the present invention, but should not be construed as a limitation thereof. The invention particularly relates to the specific embodiments described in these examples
EXAMPLE 1 - Identification of apitopes within myelin oligodendrocyte glycoprotein (MOG)
Materials and Methods
Antigens
A nucleic acid sequence encoding the 125-amino acid N-terminal portion of human MOG, which represents the extracellular domain, was cloned into a bacterial expression vector (pET system). This recombinant human MOG extracellular domain (rhMOGED) was expressed in a bacterial system as a fusion protein with a His tag on the C-terminus. A panel of 15-mer overlapping peptides spanning rhMOGED was synthesized using standard F-moc chemistry. The 15mers peptides were displaced by 5aa and overlapping by lOaa.
Generation of T cell clones
MOG-specific hybridoma T cell clones were generated by immunisation of DR2+ mice. DR2+ mice were immunised with either a pool of MOG overlapping peptides or rhMOGED in complete Freunds adjuvant (CFA). After 10 days, the spleen and draining lymph nodes were removed, CD4+ T cells were purified and restimulated with antigen/CFA in vitro. A week later, T cells were restimulated in vitro with antigen to increase the number of activated antigen-specific cells. After 3 days, activated T cells were fused with the thymoma cell line BW 5147. Hybridoma clones were then selected using HAT selection medium and screened for peptide specificity by IL-2 ELISA.
Proliferation assay
Live or p-formaldehyde fixed Mgar (HLA-DR2 +ve) cells were incubated with peptides in serum or in serum alone, together with T cells for 48 hours. The T cell proliferative response was measured by IL-2 production.
Results
The response of various MOG-specific hybridoma clones to presentation of nested MOG peptides is shown in Figure 1. The peptide MOG 41-55 ("ROK5") was defined as an apitope as it could be presented by fixed APC to T cells without further processing. A detailed study was then carried out using overlapping peptides in the region 25-60, using peptides that are displaced by one amino acid. The peptides MOG 41-55, 43-57, 44-58 and 45-59 were identified as apitopes (Figure 1 ).
The sequences of these peptides are given in Table 1. Table 1 - Sequence of MOG peptides identified as apitopes
Figure imgf000016_0001
EXAMPLE 2 - Ex vivo tolerance assay
In order to determine whether the peptides identified as apitopes are capable of inducing tolerance to antigen, an ex vivo study was performed. HLA-DR2 transgenic mice were immunised with either 100 μg ROK5 (MOG 41-55), 100μg MOG 35-55 or PBS on days - 8, -4 and -2. On day 0, mice were challenged with 100 μg MOG 35-55 by injection in the tail base in combination with CFA. On day 10, splenocytes and draining lymph nodes were harvested and their respective cell populations isolated and a recall proliferation assay was set up with MOG 35-55. Cells from individual mice were treated separately and data is plotted separately in Figure 2. For the recall response cells were treated ex vivo with a dose range of MOG35-55 (100, 10, 1, 0.1, 0.01, 0 μg) and proliferation via 3H- thymidine incorporation determined. Stimulation index (compared to proliferation with no antigen) was calculated for each condition.
As shown in Figure 2, ROK5 (MOG 41-55) was able to suppress the immune response to challenge with MOG 35-55.
The effect of ROK5 pre-treatment on various cytokine profiles was also investigated. As shown in Figure 3, the production of IFNy, IL-2, GM-CSF, IL6 by splenocytes are clearly affected by the ROK5 pretreatment. EXAMPLE 3 - ROK5 EAE prevention
EAE (experimental autoimmune encephalomyelitis) is a widely studied model of MS, and can be induced in a wide range of genetically susceptible laboratory animal species (including rodents and primates) by immunization with myelin or myelin components (including MOG) in strong adjuvants. To test the capacity of ROK5 to prevent MOG-induced EAE in HLA-DR2 transgenic mice, the disease model was established in this strain of mice. To induce the disease, the encephalitogenic MOG peptide, mouse MOG 35-55 (mMOG35-55) was used. Then, ROK5 was tested in EAE prevention experiments as follows:
Experiment 1 : with 3 ROK5 dose pre-treatments, followed by immunisation with mMOG35-55.
Experiment 2: with 5 ROK5 dose pre-treatments, followed by immunisation with mMOG35-55.
In each experiment, 10 mice were used per group.
Peptides sequences:
mMOG35-55: MEVGWYRSPFSRVVHLYRNGK (SEQ ID No. 7)
hROK5 (41-55): RPPF SRV VHL YRNGK (SEQ ID No. 1)
mROK5 (41-55): RSPFSRVVHL YRNGK (SEQ ID No. 8 )
Human and mouse MOG differ by an amino-acid substitution in position 42, substitution of a proline for a serine. Both MOG35-55 peptides are immunogenic, but the mouse MOG35-55 is more encephalitogenic, therefore mouse MOG35-55 was chosen to induce EAE in the model.
In vivo EAE prevention protocols are described in figures 4 A and 4B.
MOG-induced EAE model:
Two groups of DR2 transgenic mice were setup, at day zero, animals (n=7) in group "ΙΟΟμ^' received 100μg mMOG35-55 in Complete Freund's Adjuvant (CFA) (ΙΟΟμΙ, s.c, base of the tail injection), animals (n=8) in group "200μ " received 200μg mMOG35-55 in CFA. At day zero and day2, all animals received an injection of Pertussis toxin (200ng in PBS, i.p.). Every day, clinical EAE was scored and animal body weight measured. As shown in figures 5 A, 5B and table 2 below, both doses of mMOG35-55 can induce EAE with a good incidence.
Table 2
Figure imgf000019_0001
ROK5 EAE prevention experiments:
On this basis, the ability of ROK5 to prevent MOG-induced EAE was tested. A / First experiment
A first experiment was performed where animals were pretreated 3 times (3 days apart) with either mouse ROK5, human ROK5 or PBS, 100μg in ΙΟΟμΙ in CFA (s.c. injection in the flank), then all animals were immunised with 200μg mMOG35-55 in CFA (s.c. injection at the base of the tail) and with 200ng Pertussis toxin (200ng in PBS, i.p.) at day zero and day 2.
Every day, clinical EAE was scored and animal body weight measured. Figure 6 shows that both mouse and human ROK5 apitope can reduce the severity of the disease induced by MOG. Interestingly, human ROK5 is more efficient.
As shown in Figure 6A and 6B, experiment 1 shows that both mouse and human ROK5 apitopes can reduce the severity of the disease induced by MOG35-55.
B / Second Experiment
A second experiment was performed where animals were pretreated 5 times (3 days apart) with either human ROK5 or PBS, 100μg in ΙΟΟμΙ in CFA (s.c. injection in the flank), then all animals were immunised with 200μg mMOG35-55 in CFA (s.c. injection at the base of the tail) and with 200ng Pertussis toxin (200ng in PBS, i.p.) at day zero and day 2. Every day, clinical EAE was scored.
In Experiment 2 (Figure 7), huROK5 reduced the severity of disease and caused a delay in the peak of disease burden.
As a conclusion, Human ROK5 apitope was able to reduce disease severity in both EAE experiments. Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in chemistry or molecular biology or related fields are intended to be covered by the present invention. All publications mentioned in the above specification are herein incorporated by reference.

Claims

1. A peptide which is capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing, and which comprises a portion of the region 40-60 of myelin oligodendrocyte glycoprotein (MOG).
2. A peptide according to claim 1 or 2, which is selected from the following myelin oligodendrocyte glycoprotein peptides: MOG 41-55, 43-57, 44-58 and 45-59.
3. A peptide according to claim 2 which is MOG 41-55.
4. A peptide according to any preceding claim, for use in the treatment and/or prevention of a demyelinating disease.
5. A peptide according to claim 4, wherein the disease is multiple sclerosis.
6. A pharmaceutical composition comprising one or more peptide according to any of claims 1 to 5.
7. A method for treating and/or preventing a demyelinating disease in a subject in need of same which comprises the step of administering a peptide according to any of claims 1 to 5 to the subject.
8. A method according to claim 7, wherein the disease is multiple sclerosis.
9. The use of a peptide according to any of claims 1 to 5 in the manufacture of a medicament for use in the prevention and/or treatment of a demyelinating disease.
10. The use according to claim 9, wherein the disease is multiple sclerosis.
PCT/IB2014/058233 2013-01-15 2014-01-13 Peptide WO2014111840A2 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
RU2015134356A RU2675479C2 (en) 2013-01-15 2014-01-13 Peptide
JP2015552188A JP6347065B2 (en) 2013-01-15 2014-01-13 peptide
MX2015009085A MX369414B (en) 2013-01-15 2014-01-13 Peptide.
AU2014206592A AU2014206592B2 (en) 2013-01-15 2014-01-13 Peptide
CA2897655A CA2897655C (en) 2013-01-15 2014-01-13 Antigen processing-independent epitopes (apitopes) of myelin oligodendrocyte glycoprotein
BR112015016780A BR112015016780A2 (en) 2013-01-15 2014-01-13 PEPTIDES
KR1020157020496A KR102169902B1 (en) 2013-01-15 2014-01-13 Peptide
EP14703175.1A EP2945966B1 (en) 2013-01-15 2014-01-13 Peptide
SG11201505526TA SG11201505526TA (en) 2013-01-15 2014-01-13 Peptide
CN201480009521.1A CN105121463B (en) 2013-01-15 2014-01-13 Peptides
US14/760,493 US9862751B2 (en) 2013-01-15 2014-01-13 Myelin oligodendrocyte glycoprotein peptides
IL239871A IL239871B (en) 2013-01-15 2015-07-09 A myelin oligodendrocyte glycoprotein peptide for use in the preparation of a medicament
ZA2015/04987A ZA201504987B (en) 2013-01-15 2015-07-10 Peptide
HK15112229.1A HK1211596A1 (en) 2013-01-15 2015-12-11 Peptide
US15/834,438 US10377800B2 (en) 2013-01-15 2017-12-07 Myelin oligodendrocyte glycoprotein (MOG) peptide

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GBGB1300684.6A GB201300684D0 (en) 2013-01-15 2013-01-15 Peptide
GB1300684.6 2013-01-15

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/760,493 A-371-Of-International US9862751B2 (en) 2013-01-15 2014-01-13 Myelin oligodendrocyte glycoprotein peptides
US15/834,438 Continuation US10377800B2 (en) 2013-01-15 2017-12-07 Myelin oligodendrocyte glycoprotein (MOG) peptide

Publications (2)

Publication Number Publication Date
WO2014111840A2 true WO2014111840A2 (en) 2014-07-24
WO2014111840A3 WO2014111840A3 (en) 2014-10-30

Family

ID=47757995

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2014/058233 WO2014111840A2 (en) 2013-01-15 2014-01-13 Peptide

Country Status (16)

Country Link
US (2) US9862751B2 (en)
EP (1) EP2945966B1 (en)
JP (1) JP6347065B2 (en)
KR (1) KR102169902B1 (en)
CN (1) CN105121463B (en)
AU (1) AU2014206592B2 (en)
BR (1) BR112015016780A2 (en)
CA (1) CA2897655C (en)
GB (1) GB201300684D0 (en)
HK (1) HK1211596A1 (en)
IL (1) IL239871B (en)
MX (1) MX369414B (en)
RU (1) RU2675479C2 (en)
SG (1) SG11201505526TA (en)
WO (1) WO2014111840A2 (en)
ZA (1) ZA201504987B (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019034862A1 (en) * 2017-08-14 2019-02-21 Apitope Technology (Bristol) Limited Method
GB201909774D0 (en) 2019-07-08 2019-08-21 Apitope Tech Bristol Limited Method

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201300684D0 (en) 2013-01-15 2013-02-27 Apitope Int Nv Peptide
CN106986930B (en) * 2017-04-14 2021-06-11 广东省生物资源应用研究所 Protein for inducing experimental autoimmune encephalomyelitis of cynomolgus monkey and application

Family Cites Families (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU7725894A (en) * 1993-09-03 1995-03-22 Immulogic Pharmaceutical Corporation Uses of myelin oligodendrocyte glycoprotein and peptide portions thereof in protocols related to autoimmune disease
WO1995007096A1 (en) 1993-09-06 1995-03-16 La Trobe University Treatment of autoimmune disease
US6251396B1 (en) 1994-11-18 2001-06-26 Neurocrine Biosciences, Inc. Methods for treatment of multiple sclerosis using peptide analogs of human myelin basic protein
EP0922057A1 (en) * 1996-03-28 1999-06-16 Immulogic Pharmaceutical Corporation Myelin oligodendrocyte glycoprotein peptides and uses thereof
SE9703287D0 (en) 1997-09-11 1997-09-11 Astra Ab Peptides
WO2000053019A1 (en) 1999-03-12 2000-09-14 The Board Of Trustees Of The Leland Stanford Junior University Dna vaccination for treatment of autoimmune disease
IL132611A0 (en) 1999-10-27 2001-03-19 Yeda Res & Dev Synthetic genes and polypeptides and pharmaceutical compositions comprising them
DE60142684D1 (en) 2000-03-29 2010-09-09 Univ Ohio State Res Found METHOD FOR BLOCKING THE DESTRUCTION OF TISSUE BY AUTOREACTIVE T CELLS
HU229377B1 (en) 2000-08-21 2013-11-28 Apitope Technology Bristol Ltd Tolerogenic human peptides
US8231878B2 (en) 2001-03-20 2012-07-31 Cosmo Research & Development S.P.A. Receptor trem (triggering receptor expressed on myeloid cells) and uses thereof
CA2462459C (en) 2001-10-03 2007-12-18 Jack L. Strominger Copolymers for suppression of autoimmune diseases, and methods of use
CA2614171C (en) 2001-10-03 2012-04-24 President And Fellows Of Harvard College Copolymers for suppression of autoimmune diseases, and methods of use
IL146016A0 (en) 2001-10-17 2002-07-25 Yeda Res & Dev Synthetic peptides and dna sequences and compositions comprising them for treatment of multiple sclerosis
US7700572B2 (en) 2001-11-02 2010-04-20 Giuliani International, Ltd. SMAD7 inhibitors for the treatment of CNS diseases
BRPI0305769A8 (en) 2002-08-08 2017-09-12 Baylor College Medicine ISOLATION AND IDENTIFICATION OF T CELLS
AU2003279084A1 (en) 2002-09-25 2004-04-19 Genentech, Inc. Novel compositions and methods for the treatment of psoriasis
JP2008500006A (en) 2003-05-21 2008-01-10 バイオテック トゥールス ソシエテ アノニム Peptide complex
AU2011202900B2 (en) 2003-09-05 2012-08-02 Oregon Health & Science University Monomeric recombinant MHC molecules useful for manipulation of antigen-specific T cells
CA2537759C (en) 2003-09-05 2015-03-24 Oregon Health & Science University Monomeric recombinant mhc molecules useful for manipulation of antigen-specific t cells
JP5294635B2 (en) 2004-11-29 2013-09-18 イエダ リサーチ アンド デベロップメント カンパニー リミテッド Induction of neurogenesis and stem cell therapy in combination with Copolymer 1
CA2601518A1 (en) 2005-03-14 2006-09-21 Irun R. Cohen Compositions of hsp60 peptides and viral antigens for vaccination and diagnosis
IL185932A (en) 2005-03-14 2014-02-27 Yeda Res & Dev Viral antigens, conjugates and compositions thereof for vaccination and diagnosis
AU2012201067A1 (en) 2005-03-14 2012-03-15 B.G. Negev Technologies And Applications Ltd. Compositions of HSP60 peptides and viral antigens for vaccination and diagnosis
US8202835B2 (en) 2005-06-17 2012-06-19 Yitzchak Hillman Disease treatment via antimicrobial peptides or their inhibitors
KR20080047564A (en) 2005-09-28 2008-05-29 사이토스 바이오테크놀로지 아게 Interleukin-1 conjugates and uses thereof
US8128934B2 (en) 2005-11-14 2012-03-06 Ribomic, Inc. Method for treatment or prevention of disease associated with functional disorder of regulatory T cell
EP1969119B1 (en) 2005-11-17 2011-07-20 The Cleveland Clinic Foundation Multipotent neural stem cells
US7803364B2 (en) 2005-11-17 2010-09-28 The Cleveland Clinic Foundation Multipotent neural stem cells
WO2007094003A2 (en) 2006-02-15 2007-08-23 Ramot At Tel Aviv University Ltd. Viral display vehicles for treating multiple sclerosis
US20080317710A1 (en) 2006-02-22 2008-12-25 University Of Zurich Methods For Treating Autoimmune or Demyelinating Diseases
ES2553192T3 (en) 2006-05-05 2015-12-04 Opexa Therapeutics T cell vaccine
AU2012202776A1 (en) 2006-05-31 2012-05-31 Lpath, Inc. Novel Bioactive Lipid Derivatives, Immune-derived Moieties Reactive Thereto, and Methods of Making and Using Same
AU2012202713B2 (en) 2006-05-31 2015-04-09 Lpath, Inc. Immune-derived moieties reactive against lysophosphatidic acid
US8148084B2 (en) 2006-06-22 2012-04-03 Dana-Farber Cancer Institute, Inc. Diagnosis of autoimmune disease
CA2667634C (en) 2006-10-25 2016-07-12 Revalesio Corporation Mixing device and output fluids of same
US8188218B2 (en) 2006-10-27 2012-05-29 University Of Kansas Bi-functional peptides for multiple sclerosis treatment and diagnosis
JP5795833B2 (en) 2006-10-27 2015-10-14 エルパス・インコーポレイテッドLpath, Inc. Compositions and methods for binding sphingosine-1-phosphate
EP2164508B1 (en) 2007-06-04 2014-01-08 Rappaport Family Institute for Research in the Medical Sciences Agents for the treatment of inflammatory diseases and methods of using same
EP2050814A1 (en) 2007-10-17 2009-04-22 Txcell Compositions for treating multiple sclerosis
US20090227018A1 (en) 2007-10-25 2009-09-10 Revalesio Corporation Compositions and methods for modulating cellular membrane-mediated intracellular signal transduction
JP5361895B2 (en) 2007-10-31 2013-12-04 アピトープ テクノロジー (ブリストル) リミテッド Composition
ES2650236T3 (en) 2008-02-14 2018-01-17 Life Sciences Research Partners Vzw CD4 + T lymphocytes with cytolytic properties
EP2355660A4 (en) 2008-10-13 2012-05-02 Biovista Inc Compositions and methods for treating multiple sclerosis
EP2350263A4 (en) 2008-10-22 2013-07-03 Revalesio Corp Compositions and methods for treating thymic stromal lymphopoietin (tslp)-mediated conditions
US8871202B2 (en) 2008-10-24 2014-10-28 Lpath, Inc. Prevention and treatment of pain using antibodies to sphingosine-1-phosphate
EP2353004B1 (en) 2008-11-12 2018-01-03 Yeda Research and Development Co. Ltd. Diagnosis of multiple sclerosis
EP2233502A1 (en) 2009-03-27 2010-09-29 Deutsches Rheuma-Forschungszentrum Berlin Sialylated antigen-specific antibodies for treatment or prophylaxis of unwanted inflammatory immune reactions and methods of producing them
BRPI1013992A2 (en) 2009-04-27 2016-08-16 Revalesio Corp compositions and methods for treating insulin resistance and diabetes mellitus
US8703711B2 (en) 2009-06-09 2014-04-22 Val-Chum, Limited Partnership Ninjurin-1 modulation and uses thereof
US8293468B2 (en) 2009-06-10 2012-10-23 Centre Hospitalier De L'université De Montréal MCAM modulation and uses thereof
IN2012DN02753A (en) 2009-08-31 2015-09-18 Amplimmune Inc
US9334323B2 (en) 2009-12-09 2016-05-10 Mitsubishi Tanabe Pharma Corporation Method of reducing recurrence of multiple sclerosis symptoms in a mammal by administering an anti-repulsive guidance molecule neutralizing antibody
US20110189178A1 (en) 2010-02-04 2011-08-04 Xencor, Inc. Immunoprotection of Therapeutic Moieties Using Enhanced Fc Regions
WO2011097527A2 (en) 2010-02-04 2011-08-11 Xencor, Inc. Immunoprotection of therapeutic moieties using enhanced fc regions
PL217128B1 (en) 2010-08-02 2014-06-30 Inst Biochemii I Biofizyki Polskiej Akademii Nauk Synthetic genes encoding peptide fragments of natural myelin proteins intended to evoke the effect of food tolerance, DNA fragments containing these genes, process for the preparation of these peptides in a microbial (bacterial) system and their medical application
WO2012019041A2 (en) 2010-08-04 2012-02-09 Duke University Regulatory b cells and their uses
US8901074B2 (en) 2010-08-04 2014-12-02 Ramot At Tel-Aviv University Methods of treating autoimmune diseases of the central nervous system (CNS) and neurodegenerative diseases
US9492404B2 (en) 2010-08-12 2016-11-15 Revalesio Corporation Compositions and methods for treatment of taupathy
JP6027969B2 (en) 2010-09-03 2016-11-16 オレゴン ヘルス アンド サイエンス ユニバーシティ Recombinant T cell receptor ligand having a covalent peptide
WO2012036214A1 (en) 2010-09-16 2012-03-22 国立大学法人大阪大学 Therapeutic agents and prophylactic agents for symptoms accompanying autoimmune diseases, inflammatory diseases, allergy diseases and organ transplants
EP2621522A2 (en) 2010-09-27 2013-08-07 China Agricultural University Combined antigen and dna vaccine for preventing and treating autoimmune diseases
WO2012045324A1 (en) 2010-10-07 2012-04-12 Mediagnost Gesellschaft Fur Forschung Und Herstellung Von Diagnostika Gmbh Method for detecting a parkinson's disease and test system
US20140170168A1 (en) 2010-10-26 2014-06-19 Yoram Reiter Antibodies which bind soluble t-cell receptor ligands
AU2011352036A1 (en) 2010-12-31 2013-07-18 Anthrogenesis Corporation Enhancement of placental stem cell potency using modulatory RNA molecules
EP2667888A4 (en) 2011-01-28 2015-11-11 Univ Oregon Health & Science Recombinant t cell ligands and antibodies that bind b cells for the treatment of autoimmune diseases
US8685404B2 (en) * 2011-01-31 2014-04-01 Oregon Health & Science University Recombinant T-cell receptor ligand for the treatment of cognitive and neuropsychiatric impairment induced by substance addiction
CN103596562B (en) 2011-03-01 2016-06-01 法耐斯特公司 Based on the neurological disorder therapy of baclofen and acamprosate
JP5878447B2 (en) 2012-09-12 2016-03-08 富士フイルム株式会社 Base makeup cosmetics
GB201300684D0 (en) 2013-01-15 2013-02-27 Apitope Int Nv Peptide

Non-Patent Citations (13)

* Cited by examiner, † Cited by third party
Title
AKDIS ET AL., J. CLIN. INVEST., vol. 102, 1998, pages 98 - 106
ANDERTON ET AL., IMMUNOLOGICAL REVIEWS, vol. 169, 1999, pages 123 - 137
ANDERTON; WRAITH, EUR. J. IMMUNOL., vol. 28, 1998, pages 1251 - 1261
BURKHART ET AL., INT. IMMUNOL., vol. 11, 1999, pages 1625 - 1634
CREIGHTON: "Proteins Structures And Molecular Principles", 1983, WH FREEMAN AND CO
FAIRCHILD ET AL., INT. IMMUNOL., vol. 8, 1996, pages 1035 - 1043
LIU; WRAITH, INT. IMMUNOL., vol. 7, 1995, pages 1255 - 1263
MCFARLIN; MCFARLAND, NEW ENGLAND J. MEDICINE, vol. 307, 1982, pages 1183 - 1188,1246-1251
METZLER; WRAITH, IMMUNOLOGY, vol. 97, 1999, pages 257 - 263
METZLER; WRAITH, INT. IMMUNOL., vol. 5, 1993, pages 1159 - 1165
MULLER ET AL., J. ALLERGY CLIN IMMUNOL., vol. 101, 1998, pages 747 - 754
ROBERGE JY ET AL., SCIENCE, vol. 269, 1995, pages 202 - 204
SUMMERS ET AL., AM. J. PATHOL., vol. 159, 2001, pages 285 - 295

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019034862A1 (en) * 2017-08-14 2019-02-21 Apitope Technology (Bristol) Limited Method
GB201909774D0 (en) 2019-07-08 2019-08-21 Apitope Tech Bristol Limited Method
WO2021005357A1 (en) 2019-07-08 2021-01-14 Apitope Technology (Bristol) Limited Method
EP4155734A2 (en) 2019-07-08 2023-03-29 Worg Pharmaceuticals (Zhejiang) Co., Ltd. Method

Also Published As

Publication number Publication date
BR112015016780A2 (en) 2017-08-15
CN105121463B (en) 2020-11-27
CA2897655A1 (en) 2014-07-24
MX369414B (en) 2019-11-07
JP6347065B2 (en) 2018-06-27
US20180086802A1 (en) 2018-03-29
EP2945966A2 (en) 2015-11-25
MX2015009085A (en) 2016-02-16
AU2014206592A1 (en) 2015-07-23
US10377800B2 (en) 2019-08-13
JP2016505008A (en) 2016-02-18
AU2014206592B2 (en) 2018-01-04
SG11201505526TA (en) 2015-08-28
EP2945966B1 (en) 2019-07-03
RU2015134356A (en) 2017-02-22
WO2014111840A3 (en) 2014-10-30
IL239871A0 (en) 2015-08-31
KR20150105365A (en) 2015-09-16
CN105121463A (en) 2015-12-02
GB201300684D0 (en) 2013-02-27
RU2675479C2 (en) 2018-12-19
IL239871B (en) 2018-12-31
CA2897655C (en) 2023-04-04
US9862751B2 (en) 2018-01-09
US20150353616A1 (en) 2015-12-10
KR102169902B1 (en) 2020-10-26
ZA201504987B (en) 2017-11-29
HK1211596A1 (en) 2016-05-27

Similar Documents

Publication Publication Date Title
US8961986B2 (en) Peptide composition
US10377800B2 (en) Myelin oligodendrocyte glycoprotein (MOG) peptide
US20240148843A1 (en) Peptide
AU2013207489A1 (en) Partial MHC constructs and methods of use
EP1474443B1 (en) Tolerogenic peptides from myelin basic protein
AU2003202701A1 (en) Tolerogenic peptides from myelin basic protein
US5958416A (en) Heat shock protein peptides and methods for modulating autoimmune central nervous system disease
EP4249062A1 (en) Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo
WO2023180546A1 (en) Mho ib-mediated myelin-specific immunosuppression as a novel treatment for multiple sclerosis and mog antibody disease
ZA200300881B (en) Peptide selection method.

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14703175

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2897655

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 239871

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2015552188

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14760493

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/009085

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2014206592

Country of ref document: AU

Date of ref document: 20140113

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20157020496

Country of ref document: KR

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015016780

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2014703175

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2015134356

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112015016780

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150713