WO2014090948A1 - Serpin spn4a and biologically active derivatives thereof for use in the treatment of cancer - Google Patents
Serpin spn4a and biologically active derivatives thereof for use in the treatment of cancer Download PDFInfo
- Publication number
- WO2014090948A1 WO2014090948A1 PCT/EP2013/076389 EP2013076389W WO2014090948A1 WO 2014090948 A1 WO2014090948 A1 WO 2014090948A1 EP 2013076389 W EP2013076389 W EP 2013076389W WO 2014090948 A1 WO2014090948 A1 WO 2014090948A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- spn4a
- cells
- polypeptide
- cancer
- metastases
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/55—Protease inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
Definitions
- the invention relates to the field of oncology. More particularly, the invention relates to an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof for use in the prevention or treatment of cancer and related metastases.
- PCs Proprotein convertases located along the constitutive secretory pathway
- PACE4, PC5 and PC7 are involved in the proteolytic cleavage and/or expression of various neoplasia-related mediators, making them promising targets in cancer therapy.
- PCs play a key role in cancer progression and metastasis (1-8).
- these substrates and/or downstream effectors comprise growth factors and receptors, adhesion receptors and proteases.
- proteolytic processing by PCs of VEGF-C, -D (3, 4), PDGF A, -B (5, 6), IGF-1 receptor (7) and MTl-MMP (8) was found to be required for their ability to mediate tumor cell proliferation and/or invasion.
- hepatic cytokine and E- selectin induction by metastatic colon cancer cells during liver colonization was reported to require functional PCs in invading tumor cells (9).
- This conversion is mediated by one or more of the PC family members.
- PCI and PC2 found within dense core secretory granules that process proteins secreted by the regulated secretory pathway, and Furin, PC4, PC5, PACE4 and PC7 that are involved in protein precursors processing secreted via the constitutive secretory pathway (1-9).
- PC4 found within dense core secretory granules that process proteins secreted by the regulated secretory pathway
- Furin PC4, PC5, PACE4 and PC7 that are involved in protein precursors processing secreted via the constitutive secretory pathway (1-9).
- PC4 found within dense core secretory granules that process proteins secreted by the regulated secretory pathway
- Furin PC4, PC5, PACE4 and PC7
- Serpins belong to a superfamily of protease inhibitors that play a regulatory role in blood coagulation, and inflammation. Mutations in these proteins were found to cause diseases including blood coagulation disorders, cirrhosis, emphysema, and dementia (16-18). To date, more than 800 serpins have been identified in plants, animals, viruses and prokaryotes (16-18). In Drosophila melanogaster, 29 serpin genes are known, a high number as compared to human. They are involved in maintaining enzymatic homeostasis of various proteases (18-21).
- the present invention relates to an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof for use in the prevention or treatment of cancer and related metastases.
- the present invention also relates to a nucleic acid encoding a polypeptide of the invention, or an expression vector comprising a nucleic acid of the invention, or a host cell comprising an expression vector for use in the prevention or treatment of cancer and related metastases.
- the present invention further relates to a pharmaceutical composition comprising an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof, or a nucleic acid encoding thereof, or an expression vector comprising thereof, or a host cell comprising thereof and a pharmaceutically acceptable carrier.
- the present invention relates to a kit-of-part composition
- a kit-of-part composition comprising an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof, or a nucleic acid encoding thereof, or an expression vector comprising thereof, or a host cell comprising thereof and an additional therapeutic agent.
- the present invention relates to a pharmaceutical composition or a kit-of-part composition for use in the prevention or treatment of cancer and related metastases.
- the invention is based on the discovery that Drosophila melanogaster serpin Spn4A, which is not conserved in human genome, inhibits the entire constitutive secretory pathway PCs (Furin, PC4, PC5, PACE4 and PC7), the proliferation as well as the metastatic potential of cancer cells (e.g. colon cancer cells).
- the serpin Spn4A is able, when expressed in colon carcinoma cells, to inhibit processing of PC substrates and reduced anchorage-independent growth, invasiveness and enhanced chemosensitivity. The latter is associated with reduced expression of Bcl-2 and increased Caspase-3 activity.
- Spn4A repressed in vivo tumor development and formation of liver metastases in response to intrasplenic/portal inoculation of colon cancer cells. Furthermore, the tumor- suppressor function of Spn4A was linked to increased expression of molecules with anti- metastatic functions and inhibited expression of pro-tumorigenic molecules. Thus, blocking tumor growth, tumorigenesis and increasing chemosensitivity by using
- Spn4A can be effective for prevention or treatment of cancer and tumor metastasis.
- the invention provides methods and compositions (such as pharmaceutical compositions) for preventing or treating cancer and related metastasis.
- the invention also provides methods and compositions for inhibiting or preventing proliferation, migration and invasion of cancer cells.
- the invention further provides methods and compositions for increasing chemosensitivity to chemotherapeutic compound such as tyrosine kinase inhibitors.
- a first aspect of the invention relates to an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof for use in the prevention or treatment of cancer and related metastases.
- Serpin Spn4A refers to a Serine Proteinase
- Serpin Spn4A refers to any native or variant (whether native or synthetic) polypeptide of 392 amino acids provided in the GenBank database under accession number NM_165496.2 and is shown as follows (SEQ ID NO: 1): MADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAEN ETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQL LSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAI HFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELP YKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELS EVFQKLGMSKMFSDQAEFGKMLQSPEPLKVSA
- polypeptide refers to a polymer of amino acid residues joined by peptide bonds, whether produced naturally or synthetically, having no specific length.
- peptides, oligopeptides and proteins are included in the definition of “polypeptide” and these terms are used interchangeably throughout the specification, as well as in the claims.
- polypeptide does not exclude post-translational modifications that include but are not limited to phosphorylation, acetylation, glycosylation and the like.
- the term also applies to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
- an isolated polypeptide it is intended that the polypeptide is not present within a living organism, e.g. within human body.
- the isolated polypeptide may be part of a composition or a kit.
- the isolated polypeptide is preferably purified. Such polypeptide is essentially free from contaminating cellular components, such as carbohydrate, lipid, or other proteinaceous impurities associated with the polypeptide in nature.
- a preparation of isolated polypeptide contains the polypeptide in a highly purified form, i.e., at least about 80% pure, at least about 90% pure, at least about 95% pure, greater than 95% pure, such as 96%, 97%, or 98% or more pure, or greater than 99% pure.
- One way to show that a particular protein preparation contains an isolated polypeptide is by the appearance of a single band following SDS-polyacrylamide gel electrophoresis of the protein preparation and Coomassie Brilliant Blue staining of the gel.
- a “native sequence” polypeptide refers to a polypeptide having the same amino acid sequence as a polypeptide derived from nature.
- a native sequence polypeptide can have the amino acid sequence of naturally-occurring polypeptide from Drosophila melanogaster.
- Such native sequence polypeptide can be isolated from nature or can be produced by recombinant or synthetic means.
- the term "native sequence” polypeptide specifically encompasses naturally-occurring forms of the polypeptide (e. g., a proprotein), naturally- occurring variant forms (e. g., alternatively spliced forms) and naturally-occurring allelic variants of the polypeptide.
- Serpin Spn4A variants disclosed herein include, but are not limited to, those described in Briining et al., 2007 (27).
- polypeptide having an amino acid sequence at least, for example, 95% "identical" to a query amino acid sequence of the present invention it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
- up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid.
- the percentage of identity is calculated using a global alignment (i.e., the two sequences are compared over their entire length).
- Methods for comparing the identity and homology of two or more sequences are well known in the art.
- the "needle" program which uses the Needleman-Wunsch global alignment algorithm (Needleman and Wunsch, 1970 J. Mol. Biol. 48:443-453) to find the optimum alignment (including gaps) of two sequences when considering their entire length, may for example be used.
- the needle program is for example available on the ebi.ac.uk world wide web site.
- the percentage of identity in accordance with the invention is preferably calculated using the EMBOSS ::needle (global) program with a "Gap Open” parameter equal to 10.0, a "Gap Extend” parameter equal to 0.5, and a Blosum62 matrix.
- Polypeptides consisting of an amino acid sequence "at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical" to a reference sequence may comprise mutations such as deletions, insertions and/or substitutions compared to the reference sequence.
- the polypeptide consisting of an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference sequence may correspond to an allelic variant of the reference sequence. It may for example only comprise substitutions compared to the reference sequence. The substitutions preferably correspond to conservative substitutions as indicated in the table below. Conservative substitutions Type of Amino Acid
- biologically active derivatives of the Serpin Spn4A polypeptide includes the variants and the fragments of the polypeptide to which it refers (i.e. the Serpin Spn4A polypeptide) and that retain the biological activity and the specificity of the parent polypeptide. Therefore, the "derivatives of the Serpin Spn4A polypeptide” include variants and fragments of the polypeptide represented by SEQ ID NO: 1.
- a polypeptide "fragment”, as used herein, refers to a biologically active polypeptide that is shorter than a reference polypeptide (e.g. a fragment of the Serpin Spn4A polypeptide).
- the polypeptide according to the invention encompasses polypeptides comprising or consisting of fragments of Spn4A, provided the fragments are biologically active.
- the biologically active fragment may for example comprise at least 15, 25, 50, 75, 100, 150 200, 250, 300 or 350 consecutive amino acids of the Spn4A polypeptide.
- a “biologically active derivative polypeptide" of the Serpin Spn4A polypeptide refers to a polypeptide exhibiting at least one, preferably all, of the biological activities of the reference polypeptide, provided the biologically active derivative retains the capacity of reducing malignant phenotype of cancer cells and/or reducing the tumor growth and/or increasing the chemosensitivity.
- the biologically active derivative may for example be characterized in that it is capable of inhibiting the proteolytic activity of PCs such as Furin, PACE4, PC5A, PC5B and/or PC7 (see Example "Measurement of proprotein convertases activity").
- proteolytic activity may for instance be assessed in vitro by conventional techniques such as activity assays using fluorogenic substrates (e.g.
- said inhibition of proteolytic activity has to be of at least 50%, preferably at least 70%, more preferably at least 80%, and even more preferably at least 90% of the proteolytic activity of the parent polypeptide.
- a proteolytic activity assay see in Example
- a cell proliferation assay see in Example
- a cell migration assay see in Example
- a cell invasion assay see in Example
- an apoptosis assay may be performed with each polypeptide.
- a time-course and a dose-response performed in vitro or in vivo e.g. by using a liver metastasis assay as described in the Examples section
- the polypeptides of the invention may comprise a tag.
- a tag is an epitope-containing sequence which can be useful for the purification of the polypeptides. It is attached to by a variety of techniques such as affinity chromatography, for the localization of said polypeptide within a cell or a tissue sample using immunolabeling techniques, the detection of said polypeptide by immunoblotting etc.
- tags commonly employed in the art are the GST (glutathion-S-transferase)-tag, the FLAGTM-tag, the Strep-tagTM, V5 tag, myc tag, His tag (which typically consists of six histidine residues), etc.
- the polypeptides of the invention may comprise chemical modifications improving their stability and/or their biodisponibility.
- Such chemical modifications aim at obtaining polypeptides with increased protection of the polypeptides against enzymatic degradation in vivo, and/or increased capacity to cross membrane barriers, thus increasing its half-life and maintaining or improving its biological activity.
- Any chemical modification known in the art can be employed according to the present invention. Such chemical modifications include but are not limited to:
- N-terminal and/or C-terminal ends of the peptides such as e.g. N- terminal acylation (preferably acetylation) or desamination, or modification of the C- terminal carboxyl group into an amide or an alcohol group;
- acylation preferably acetylation
- alkylation preferably methylation
- acylation preferably acetylation
- alkylation preferably methylation
- adding dipeptides can improve the penetration of a circulating agent in the eye through the blood retinal barrier by using endogenous transporters.
- water-soluble polymers Another strategy for improving drug viability is the utilization of water-soluble polymers.
- Various water-soluble polymers have been shown to modify biodistribution, improve the mode of cellular uptake, change the permeability through physiological barriers; and modify the rate of clearance from the body.
- water-soluble polymers have been synthesized that contain drug moieties as terminal groups, as part of the backbone, or as pendent groups on the polymer chain.
- PEG Polyethylene glycol
- Attachment to various drugs, proteins, and liposomes has been shown to improve residence time and decrease toxicity.
- PEG can be coupled to active agents through the hydroxyl groups at the ends of the chain and via other chemical methods; however, PEG itself is limited to at most two active agents per molecule.
- copolymers of PEG and amino acids were explored as novel biomaterials which would retain the biocompatibility properties of PEG, but which would have the added advantage of numerous attachment points per molecule (providing greater drug loading), and which could be synthetically designed to suit a variety of applications.
- PEGylation techniques for the effective modification of drugs.
- drug delivery polymers that consist of alternating polymers of PEG and tri-functional monomers such as lysine have been used by VectraMed (Plainsboro, N.J.).
- the PEG chains typically 2000 daltons or less
- Such copolymers retain the desirable properties of PEG, while providing reactive pendent groups (the carboxylic acid groups of lysine) at strictly controlled and predetermined intervals along the polymer chain.
- the reactive pendent groups can be used for derivatization, cross -linking, or conjugation with other molecules.
- These polymers are useful in producing stable, long-circulating pro-drugs by varying the molecular weight of the polymer, the molecular weight of the PEG segments, and the cleavable linkage between the drug and the polymer.
- the molecular weight of the PEG segments affects the spacing of the drug/linking group complex and the amount of drug per molecular weight of conjugate (smaller PEG segments provides greater drug loading).
- increasing the overall molecular weight of the block co-polymer conjugate will increase the circulatory half-life of the conjugate. Nevertheless, the conjugate must either be readily degradable or have a molecular weight below the threshold-limiting glomular filtration (e.g., less than 60 kDa).
- linkers may be used to maintain the therapeutic agent in a pro-drug form until released from the backbone polymer by a specific trigger, typically enzyme activity in the targeted tissue.
- a specific trigger typically enzyme activity in the targeted tissue.
- tissue activated drug delivery is particularly useful where delivery to a specific site of biodistribution is required and the therapeutic agent is released at or near the site of pathology.
- Linking group libraries for use in activated drug delivery are known to those of skill in the art and may be based on enzyme kinetics, prevalence of active enzyme, and cleavage specificity of the selected disease-specific enzymes. Such linkers may be used in modifying the polypeptides described herein for therapeutic delivery.
- polypeptides of the invention may be fused to a heterologous polypeptide (i.e. polypeptide derived from an unrelated protein, for example, from an immunoglobulin protein).
- a heterologous polypeptide i.e. polypeptide derived from an unrelated protein, for example, from an immunoglobulin protein.
- fusion refers to the joining together of two more elements or components, by whatever means including chemical conjugation or recombinant means.
- An "in-frame fusion” refers to the joining of two or more polynucleotide open reading frames (ORFs) to form a continuous longer ORF, in a manner that maintains the correct translational reading frame of the original ORFs.
- ORFs polynucleotide open reading frames
- a recombinant fusion protein is a single protein containing two or more segments that correspond to polypeptides encoded by the original ORFs (which segments are not normally so joined in nature. Although the reading frame is thus made continuous throughout the fused segments, the segments may be physically or spatially separated by, for example, in- frame linker sequence.
- fusion protein means a protein comprising a first polypeptide linearly connected, via peptide bonds, to a second, polypeptide.
- Spn4A fusion protein refers to a polypeptide comprising the Spn4A polypeptide or a derivative thereof fused to heterologous polypeptide.
- the Spn4A fusion protein will generally share at least one biological property in common with the Spn4A polypeptide (as described above).
- Spn4A fusion protein is a Spn4A immunoadhesin.
- immunoadhesin designates antibody-like molecules which combine the binding specificity of a heterologous protein (an “adhesin”) with the effector functions of immunoglobulin constant domains.
- the immunoadhesins comprise a fusion of an amino acid sequence with the desired binding specificity which is other than the antigen recognition and binding site of an antibody (i.e., is “heterologous"), and an immunoglobulin constant domain sequence.
- the adhesin part of an immunoadhesin molecule typically is a contiguous amino acid sequence comprising at least the binding site of a receptor or a ligand.
- the immunoglobulin constant domain sequence in the immunoadhesin may be obtained from any immunoglobulin, such as IgG-1, IgG-2, IgG-3, or IgG-4 subtypes, IgA (including IgA-1 and IgA-2), IgE, IgD or IgM.
- immunoglobulin such as IgG-1, IgG-2, IgG-3, or IgG-4 subtypes, IgA (including IgA-1 and IgA-2), IgE, IgD or IgM.
- the immunoglobulin sequence preferably, but not necessarily, is an immunoglobulin constant domain (Fc region).
- Immunoadhesins can possess many of the valuable chemical and biological properties of human antibodies. Since immunoadhesins can be constructed from a human protein sequence with a desired specificity linked to an appropriate human immunoglobulin hinge and constant domain (Fc) sequence, the binding specificity of interest can be achieved using entirely human components. Such immunoadhesins are minimally immunogenic to the patient, and are safe for chronic or repeated use.
- the Fc region is a native sequence Fc region.
- the Fc region is a variant Fc region.
- the Fc region is a functional Fc region.
- the Spn4A portion and the immunoglobulin sequence portion of the Spn4A immunoadhesin may be linked by a minimal linker.
- the immunoglobulin sequence preferably, but not necessarily, is an immunoglobulin constant domain.
- the immunoglobulin moiety in the chimeras of the present invention may be obtained from IgGl, IgG2, IgG3 or IgG4 subtypes, IgA, IgE, IgD or IgM, but preferably IgGl or IgG3.
- the term "Fc region” is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
- a “functional Fc region” possesses an “effector function” of a native sequence Fc region.
- effector functions include Clq binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor; BCR), etc.
- a “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgGi Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
- a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, preferably one or more amino acid substitution(s).
- the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g. from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
- the variant Fc region herein will preferably possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably at least about 90% homology therewith, more preferably at least about 95% homology therewith.
- a Spn4A fusion protein is a fusion of the Spn4A polypeptide with human serum albumin -binding domain antibodies (AlbudAbs) according to the AlbudAbTM Technology Platform as described in Konterman et al. 2012 AlbudAbTM Technology Platform- Versatile Albumin Binding Domains for the Development of Therapeutics with Tunable Half-Lives
- polypeptides of the invention may be produced by any suitable means, as will be apparent to those of skill in the art.
- expression may conveniently be achieved by culturing under appropriate conditions recombinant host cells containing the polypeptide of the invention.
- the polypeptide is produced by recombinant means, by expression from an encoding nucleic acid molecule.
- the polypeptide When expressed in recombinant form, the polypeptide is preferably generated by expression from an encoding nucleic acid in a host cell.
- a host cell Any host cell may be used, depending upon the individual requirements of a particular system. Suitable host cells include bacteria mammalian cells, plant cells, yeast and baculovirus systems. Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary cells. HeLa cells, baby hamster kidney cells and many others. Bacteria are also preferred hosts for the production of recombinant protein, due to the ease with which bacteria may be manipulated and grown. A common, preferred bacterial host is E coli.
- Protein glycosylation represents the most common modification (about 50% of human proteins are glycosylated). Glycosylation can introduce considerable heterogeneity into a protein composition through the generation of different glycan structures on the proteins within the composition. Such glycan structures are made by the action of diverse enzymes of the glycosylation machinery as the glycoprotein transits the Endoplasmatic Reticulum (ER) and the Golgi-Complex (glycosylation cascade).
- ER Endoplasmatic Reticulum
- Golgi-Complex glycosylation cascade
- the nature of the glycan structure(s) of a protein has impact on the protein's folding, stability, life time, trafficking, pharmaco-dynamics, pharmacokinetics and immunogenicity.
- the glycan structure has great impact on the protein's primary functional activity. Glycosylation can affect local protein structure and may help to direct the folding of the polypeptide chain.
- One important kind of glycan structures are the so called N-glycans. They are generated by covalent linkage of an oligosaccharide to the amino (N)-group of asparagin residues in the consensus sequence NXS/T of the nascent polypeptide chain.
- N-glycans may further participate in the sorting or directing of a protein to its final target: the N-glycan of an antibody, for example, may interact with complement components.
- N-glycans also serve to stabilize a glycoprotein, for example, by enhancing its solubility, shielding hydrophobic patches on its surface, protecting from proteolysis, and directing intra-chain stabilizing interactions. Glycosylation may regulate protein half-life, for example, in humans the presence of terminal sialic acids in N-glycans may increase the half-life of proteins, circulating in the blood stream.
- glycoprotein refers to any protein having one or more N- glycans attached thereto.
- the term refers both to proteins that are generally recognized in the art as a glycoprotein and to proteins which have been genetically engineered to contain one or more N-linked glycosylation sites.
- N-glycan and glycoform are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine-N- acetylglucosamine linkage to an asparagine residue of a polypeptide.
- N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein.
- the predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N- acetylglucosamine (GlcNAc) and sialic acid (e.g., N- acetyl-neuraminic acid (NANA)).
- the processing of the sugar groups occurs co-translationally in the lumen of the ER and continues post-translationally in the Golgi apparatus for N-linked glycoproteins.
- yeasts for example, Pichia pastoris, Yarrowia lipolytica and Saccharomyces cerevisiae are recently under development to use the advantages of such systems but to eliminate the disadvantages in respect to glycosylation.
- Several strains are under genetical development to produce defined, human-like glycan structures on a protein. Methods for genetically engineering yeast to produce human-like N- glycans are described in U.S. Patent Nos. 7,029,872 and 7,449,308 along with methods described in U.S. Published Application Nos. 20040230042, 20050208617, 20040171826, 20050208617, and 20060286637.
- yeasts that can produce therapeutic glycoproteins that have predominantly human-like complex or hybrid N- glycans thereon instead of yeast type N-glycans.
- human-like glycosylation is primarily characterized by "complex" N-glycan structures containing N-acetylglusosamine, galactose, fucose and/or N-acetylneuraminic acid.
- yeasts have been genetically engineered to produce glycoproteins comprising one or more human-like complex or human-like hybrid N-glycans such as GlcNAcMan3GlcNAc2.
- nucleic acid encoding a polypeptide of the invention (such as the Serpin Spn4A polypeptide as shown in SEQ ID NO: 1) or a vector comprising such nucleic acid or a host cell comprising such expression vector may be used in the prevention or treatment of cancer and related metastases.
- Another aspect of the invention relates to a nucleic acid encoding an amino acids sequence comprising SEQ ID NO: 1 as described here above for use in the prevention or treatment of cancer and related metastases.
- nucleic acid encoding an amino acid sequence consisting on SEQ ID NO: 1.
- Nucleic acids of the invention may be produced by any technique known per se in the art, such as, without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination(s).
- Another aspect of the invention is an expression vector comprising a nucleic acid sequence encoding an amino sequence comprising SEQ ID NO: 1 as described here above for use in the prevention or treatment of cancer and related metastases.
- a "vector” is any vehicle capable of facilitating the transfer of a nucleic acid to the cells and preferably to cancerous cells.
- the vector transports the nucleic acid to cells with reduced degradation relative to the extent of degradation that would result in the absence of the vector.
- the vectors useful in the invention include, but are not limited to, plasmids, phagemids, viruses, other vehicles derived from viral or bacterial sources that have been manipulated by the insertion or incorporation of the nucleic acid sequences of interest.
- Viral vectors are a preferred type of vector and include, but are not limited to nucleic acid sequences from the following viruses: retrovirus, such as moloney murine leukemia virus, harvey murine sarcoma virus, murine mammary tumor virus, and rouse sarcoma virus; adenovirus, adeno-associated virus; SV40-type viruses; polyoma viruses; Epstein-Barr viruses; papilloma viruses; herpes virus; vaccinia virus; polio virus; and RNA virus such as a retrovirus.
- retrovirus such as moloney murine leukemia virus, harvey murine sarcoma virus, murine mammary tumor virus, and rouse sarcoma virus
- retrovirus such as moloney murine leukemia virus, harvey murine sarcoma virus, murine mammary tumor virus, and rouse sarcoma virus
- adenovirus adeno
- Non-cytopathic viruses include retroviruses (e.g., lentivirus), the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA. Retroviruses have been approved for human gene therapy trials. Most useful are those retroviruses that are replication-deficient (i.e., capable of directing synthesis of the desired proteins, but incapable of manufacturing an infectious particle). Such genetically altered retroviral expression vectors have general utility for the high-efficiency transduction of genes in vivo.
- adeno-viruses and adeno-associated viruses are double-stranded DNA viruses that have already been approved for human use in gene therapy.
- the adeno-associated virus can be engineered to be replication deficient and is capable of infecting a wide range of cell types and species. It further has advantages such as, heat and lipid solvent stability; high transduction frequencies in cells of diverse lineages, including hemopoietic cells; and lack of superinfection inhibition thus allowing multiple series of transductions.
- the adeno-associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression characteristic of retroviral infection.
- adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that the adeno-associated virus genomic integration is a relatively stable event.
- the adeno- associated virus can also function in an extrachromosomal fashion.
- Plasmid vectors have been extensively described in the art and are well known to those of skill in the art. See e.g., SANBROOK et al., "Molecular Cloning: A Laboratory Manual," Second Edition, Cold Spring Harbor Laboratory Press, 1989.
- plasmid vectors have been used as DNA vaccines for delivering antigen-encoding genes to cells in vivo. They are particularly advantageous for this because they do not have the same safety concerns as with many of the viral vectors.
- These plasmids however, having a promoter compatible with the host cell, can express a peptide from a gene operatively encoded within the plasmid.
- Plasmids may be delivered by a variety of parenteral, mucosal and topical routes.
- the DNA plasmid can be injected by intramuscular, intradermal, subcutaneous, or other routes. It may also be administered by intranasal sprays or drops, rectal suppository and orally.
- the plasmids may be given in an aqueous solution, dried onto gold particles or in association with another DNA delivery system including but not limited to liposomes, dendrimers, cochleate and microencapsulation.
- Another aspect of the invention is a host cell comprising an expression vector as described here above for use in the prevention or treatment of cancer and related metastases.
- examples of host cells that may be used are human dendritic cells or monocytes (particularly those obtained from the subject to be treated).
- the means by which the vector carrying the gene may be introduced into the cells include, but are not limited to, microinjection, electroporation, transduction, or transfection using DEAE-dextran, lipofection, calcium phosphate or other procedures known to one skilled in the art.
- polypeptides, nucleic acids, expression vector or host cells of the invention are used advantageously for the prevention or treatment of cancers and related metastases including, but not limited to, carcinoma, including that of the bladder, breast, colon, kidney, liver, lung, ovary, prostate, pancreas, stomach, cervix, thyroid and skin, including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T- cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma and Burketts lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyos
- Metastasis or “tumor metastasis” is meant the spread of cancer from its primary site to other places in the body. Cancer cells can break away from a primary tumor, penetrate into lymphatic and blood vessels, circulate through the bloodstream, and grow in a distant focus (metastasize) in normal tissues elsewhere in the body. Metastasis can be local or distant. Metastasis is a sequential process, contingent on tumor cells breaking off from the primary tumor, traveling through the bloodstream or lymphatics, and stopping at a distant site. At the new site, the cells establish a blood supply and can grow to form a life-threatening mass.
- metastatic tumor refers to a tumor that is capable of metastasizing, but has not yet metastasized to tissues or organs elsewhere in the body. In certain embodiments, the term metastatic tumor refers to a tumor that has metastasized to tissues or organs elsewhere in the body.
- primary tumor or “primary cancer” is meant the original cancer and not a metastatic lesion located in another tissue, organ, or location in the subject's body.
- the cancer is a colorectal cancer. Accordingly, in one preferred embodiment, the related metastases are liver colorectal metastases. In another particular embodiment, the cancer is a skin cancer (e.g. melanoma). Accordingly, in one preferred embodiment, the related metastases are pulmonary melanoma metastases. In still another particular embodiment, the cancer is a breast cancer. Accordingly, in one preferred embodiment, the related metastases are pulmonary breast metastases.
- Another aspect of the invention relates to a method for preventing or treating cancer and related metastases comprising administering to a subject in need thereof a therapeutically effective amount of a polypeptide or a derivative thereof as described above, or a nucleic acid of the invention, or an expression vector of the invention or a host cell of the invention.
- the invention relates to a method for preventing or treating cancer and related metastases comprising administering to a subject in need thereof a therapeutically effective amount of a polypeptide of SEQ ID NO: 1 as above described.
- the cancer is a colorectal cancer.
- the related metastases are liver colorectal metastases.
- a “therapeutically effective amount” is intended for a minimal amount of active agent, which is necessary to impart therapeutic benefit to a subject.
- a “therapeutically effective amount of the active agent” to a subject is an amount of the active agent that induces, ameliorates or causes an improvement in the pathological symptoms, disease progression, or physical conditions associated with the disease affecting the subject.
- the term “treating" a disorder or a condition refers to reversing, alleviating or inhibiting the process of one or more symptoms of such disorder or condition.
- preventing a disorder or a condition refers to keeping from occurring, or to hinder, defend from, or protect from the occurrence of a disorder or a condition or phenotype, including a symptom.
- a subject denotes a mammal, such as a rodent, a feline, a canine, and a primate.
- a subject according to the invention is a human.
- the subject in need thereof may have developed or be at risk for developing metastasis (e.g. affected with a cancer such as a colorectal cancer).
- metastasis e.g. affected with a cancer such as a colorectal cancer.
- Another aspect of the invention is a pharmaceutical composition
- a pharmaceutical composition comprising:
- said pharmaceutical composition comprises an isolated Serpin Spn4A polypeptide having the sequence SEQ ID NO: 1.
- Any therapeutic agent of the invention as above described may be combined with pharmaceutically acceptable excipients, and optionally sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions.
- “Pharmaceutically” or “pharmaceutically acceptable” refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to a mammal, especially a human, as appropriate.
- a pharmaceutically acceptable carrier or excipient refers to a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
- compositions for example, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and sex of the patient, etc.
- compositions of the invention can be formulated for a topical, oral, intranasal, intraocular, intravenous, intramuscular or subcutaneous administration and the like.
- the pharmaceutical compositions contain vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.
- the doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment.
- the daily dosage of the products may be varied over a wide range from 0.01 to 1,000 mg per adult per day.
- the compositions contain 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100, 250 and 500 mg of the active ingredient for the symptomatic adjustment of the dosage to the subject to be treated.
- a medicament typically contains from about 0.01 mg to about 500 mg of the active ingredient, preferably from 1 mg to about 100 mg of the active ingredient.
- An effective amount of the drug is ordinarily supplied at a dosage level from 0.0002 mg/kg to about 20 mg/kg of body weight per day, especially from about 0.001 mg/kg to 7 mg/kg of body weight per day.
- an effective amount of a polypeptide or a nucleic acid according to the invention may be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- the polypeptides thereof or the nucleic acid according to the invention can be formulated into a composition in a neutral or salt form.
- Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- the carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminium monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with several of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
- the solution may be suitably buffered and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, "Remington's Pharmaceutical Sciences" 15th Edition, pages 1035-1038 and 1570-1580).
- Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
- other pharmaceutically acceptable forms include, e.g. tablets or other solids for oral administration; time release capsules; and any other form currently used.
- compositions of the invention may comprise an additional therapeutic agent.
- said additional therapeutic active agent is a chemotherapeutic agent.
- Non-limiting examples of chemotherapeutic compounds which can be used in combination treatments of the present invention include, for example, conventional chemotherapeutic, radiotherapeutic and anti-angiogenic agents.
- said chemotherapeutic agent is a tyrosine kinase inhibitor (TKI).
- TKI tyrosine kinase inhibitor
- Examplary TKIs include, but are not limited to: BAY 43-9006 (sorafenib, Nexavar®) and SU11248 (sunitinib, Sutent®), Imatinib mesylate (Gleevec®, Novartis); Gefitinib (Iressa®, AstraZeneca); Erlotinib hydrochloride (Tarceva®, Genentech); Vandetanib (Zactima®, AstraZeneca), Tipifarnib (Zarnestra®, Janssen-Cilag); Dasatinib (Sprycel®, Bristol Myers Squibb); Lonafarnib (Sarasar®, Schering Plough); Vatalanib succinate (Novartis, Schering AG); Lapatinib (Tykerb®, GlaxoSmithKline); Nilotinib (Novartis); Lesta
- Chemo therapeutic agents have different modes of actions, for example, by influencing either DNA or RNA and interfering with cell cycle replication.
- chemotherapeutic agents that act at the DNA level or on the RNA level are anti-metabolites (such as Azathioprine, Cytarabine, Fludarabine phosphate, Fludarabine, Gemcitabine, cytarabine, Cladribine, capecitabine 6-mercaptopurine, 6-thioguanine, methotrexate, 5-fluoroouracil and hyroxyurea; alkylating agents (such as Melphalan, Busulfan, Cis-platin, Carboplatin, Cyclophosphamide, Ifosphamide, dacarabazine, Procarbazine, Chlorambucil, Thiotepa, Lomustine, Temozolamide); anti-mitotic agents (such as Vinorelbine, Vincristine, Vinblastine, Docetaxel, Paclitaxel); topo
- Additional chemotherapeutic agent may be selected from, but are not limited to, cytokines, chemokines, growth factors, growth inhibitory factors, hormones, soluble receptors, decoy receptors, monoclonal or polyclonal antibodies, mono-specific, bi-specific or multi- specific antibodies, monobodies, polybodies.
- Exemplary biologies drugs include, but are not limited to: anti- angiogenic agents such as Bevacuzimab (mAb, inhibiting VEGF-A, Genentech); IMC-1121B (mAb, inhibiting VEGFR-2, ImClone Systems); CDP-791 (Pegylated DiFab,VEGFR-2, Celltech); 2C3 (mAb, VEGF-A, Peregrine Pharmaceuticals); VEGF-trap (soluble hybrid receptor VEGF-A, P1GF (placenta growth factor) Aventis/Regeneron).
- the invention also relates to a kit-of-part composition comprising a polypeptide or a derivative thereof, or a nucleic acid, or a vector, or a host cell according to the invention and an additional therapeutic active agent.
- said additional therapeutic active agent is a chemotherapeutic agent as described above (e.g. a tyrosine kinase inhibitor).
- Another aspect of the invention is a pharmaceutical composition for use in the prevention or treatment of cancer and related metastases comprising an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof according to the invention; or an acid nucleic according to the invention; or an expression vector according to the invention; or an host cell according to the invention and a pharmaceutically acceptable carrier.
- the invention also relates to a kit-of-part composition
- a kit-of-part composition comprising an isolated Serpin Spn4A polypeptide or a derivative thereof, or a nucleic acid, or a vector, or a host cell according to the invention and a further therapeutic active agent for simultaneous, separate or sequential use in the prevention or treatment of cancer and related metastases.
- kit means especially a “kit of parts” in the sense that the combination partners as defined above can be dosed independently or by use of different fixed combinations with distinguished amounts of the combination partners, i.e. simultaneously or at different time points.
- the parts of the kit of parts can then, e.g., be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts.
- the ratio of the total amounts of the combination partners to be administered in the combined preparation can be varied.
- the combination partners can be administered by the same route or by different routes. When the administration is sequential, the first partner may be for instance administered 1, 2, 3, 4, 5, 6, 12, 18 or 24 h before the second partner.
- FIG. 1 Inhibition by Spn4A of cellular Furin, PACE4, PC5A, PC5B and PC7 activity.
- A Effect of PCs expression on PDGF-A precursor (ProPDGF-A) processing in PC-deficient CHOFDl l cells.
- ProPDGF-A processing was analyzed by Western blotting of conditioned media obtained from CHOFDl l transfected with either empty vectors (lane 1), empty pIRES2-EGFP vector and pIRES2-EGFP vector containing proPDGF-A (lane 2), or with pIRES2-EGFP vector containing proPDGF-A and pIRES2-EGFP vector that expresses full-length PCs (Lanes 3-7).
- An anti-V5 antibody was used for detection.
- Figure 2 Inhibition of endogenous PCs activity in colon cancer cells by Spn4A.
- FIG. 3 Inhibition of anchorage-independent growth and proliferation of colon cancer cells by Spn4A.
- A-B Control (CTL) and tumor cells stably expressing Spn4A (Spn4A) were seeded in triplicate in six-well plates in soft agar as described under "Experimental Procedures". After 2 weeks, colonies >100 ⁇ in diameter were counted. Results are shown as means + S.D. of three experiments performed in triplicate.
- C-D Starved control or Spn4A-expressing cells were cultured for 6 days under standard conditions and cell proliferation was assessed using Cell Titer96 non-radioactive cell proliferation assay. Each value results are shown as means + S.D. of three experiments performed in triplicate. *P
- FIG. 4 Inhibition of PCs by Spn4A alters tumor cells survival and chemosensitivity.
- A Percentages of apoptotic cells, under these conditions are indicated.
- B tumor cells were incubated for 6 h with H 2 0 2 (5 mM) or staurosporin (1 ⁇ ) and caspase-3 activity was evaluated using the Caspase-3 Fluorescence assay Kit. Note that H 2 0 2 and staurosporin caused an increased in the percentage of apoptotic cells that are associated with increased caspase-3 activity. This effect was exacerbated in cells-expressing Spn4A. Data shown represents the mean+SD from at least three independent experiments.
- C-D Data derived from analysis of total RNA analyzed by RT Profiler PCR array PAHS-502C for oncogenes and tumor suppressor genes that contains probes for BCL2 and TNF genes. For each well, the results are expressed relative to control cells transfected with empty vector which was assigned a value of 1. Values are shown as means + S.D. *P ⁇ 0.05; **P ⁇ 0.001. *** P ⁇ 0.0001.
- FIG. 5 Inhibition of tumor growth by Spn4A is associated with reduced PCs activity and induced apoptosis in developed tumors.
- A-B Control
- CTL Control
- Spn4A colon tumor cells stably expressing Spn4A
- lxlO 6 colon tumor cells stably expressing Spn4A
- C-D Subcutaneously developed tumors were removed and lysed in lysis buffer. Protein extracts were incubated with the fluorogenic peptide PC substrate pERTKR-MCA. Substrate cleavage was evaluated as raw fluorescence intensity (RFI) at indicated time periods. Results shown in the bar graph represent PCs activity after 2 hours of incubation.
- E- F Developed tumors derived from control and Spn4A-expressing tumor cells were analyzed for apoptosis using TumorTACSTM in situ apoptosis detection Kit (Trivigen). The number of intra-tumoral apoptotic cells was counted in ten different fields for each tumor. Percentages of apoptotic populations are shown. Data are presented as mean + SD. ***P ⁇ 0.0001. Original magnification x 360.
- FIG. 6 Effect of Spn4A on tumor cell migration and invasion.
- Cells were stably transfected with empty pIRES2-EGFP-V5 vector (HT-29/CTL, CT-26/CTL and CHOFD11/CTL) or with pIRES2-EGFP-V5 vector containing full-length Spn4A cDNA (HT- 29/Spn4A, CT-26/Spn4A and CHOFDl l/Spn4A).
- pIRES2-EGFP-V5 vector containing full-length Spn4A cDNA HT- 29/Spn4A, CT-26/Spn4A and CHOFDl l/Spn4A.
- HT-29/Spn4A and CT-26/Spn4A cells were cultured in presence of Pseudomonas exotoxin A. This toxin induces cells death only after its cleavage by PCs (26).
- Spn4A-V5 The expression of Spn4A-V5 was assessed by immunoblotting and cells were grown in their adequate media supplemented with 200 ⁇ g/ml G418.
- CHOFD11 cells were stably transfected with Furin, PACE4, PC5A, PC5B or PC7.
- CHOFD11, HT-29, CT-26, HT-29/Spn4A and CT-26/Spn4A cells were transiently transfected with empty pIRES2-EGFP-V5 vector or with the same vector containing full- length PDGF-A cDNA to study proPDGF-A processing. All transfections were carried out using Lipofectamine reagent (Invitrogen), as recommended by the manufacturer.
- RT 2 Profiler PCR Array The RT 2 Profiler PCR Array was used as a method of combining real-time PCR performance with a simultaneous analysis of a panel of genes related to human oncogenes and tumor suppressor genes (Array PAHS-502C) and to human extracellular matrix and adhesion molecules (array PAHS-013C). Preparation and analysis of samples were carried out in accordance with the manufacturer's recommendations (SABiosciences).
- cancer cells, and tumor tissues extracts were incubated with pERTKR-MCA (100 ⁇ ) during the indicated time periods in the presence of 25 mM Tris (pH 7.4), 25 mM methyl-ethane-sulfonic acid, and 2.5 mM CaC12, at 37°C, and the fluorometric measurements were performed using a spectrofluorometer (Tecan Infinite® F200 PRO, Tecan Group Ltd. France).
- Proliferation assay Tumor cells were plated in triplicate on 96 wells plate (2xl07well) under serum free conditions for 24 h. The starved cells were then cultured during the indicated periods. Proliferation levels of cells was evaluated every two days using the Cell Titer96 non-radioactive cell proliferation assay kit (Promega) according to the manufacture's protocol.
- Soft agar assay To assay anchorage-independent colony formation, HT-29/CTL, CT- 26/CTL, HT-29/Spn4A or CT-26/Spn4A cells (4 x 10 3 cells/well) were suspended in complete medium containing 0.8% agar and seeded in triplicate in six-well plates onto a basal layer of complete medium containing 3% agar. Complete medium was added every three days. After two weeks of cell growth, colonies >100 ⁇ in diameter were counted using inverted microscopy and the results were represented as number of colonies formed, as previously described (7).
- Apoptosis assays and caspase-3 activity measurement For apoptosis assays, tumor cells were grown to 70% confluency and cells were washed repeatedly to remove serum and then incubated for 6 h in media containing or not 5 mM ⁇ 2 0 2 or 1 ⁇ staurosporin. Cells were washed and stained with Phycoerythrin (PE)-labeled annexin V (AN) and 7-amino- actinomycin D (7AAD) using the PE Annexin V Apoptosis Detection Kit I (BD PharmingenTM) as instructed by the manufacturer. Cells were analyzed by flow cytometry (FACS CamptoII).
- PE Phycoerythrin
- AN Phycoerythrin
- 7AAD 7-amino- actinomycin D
- Caspase-3 activity was determined in control and Spn4A-expressing cells following incubation for 6 h in media containing or not 5 mM ⁇ 2 0 2 or 1 ⁇ staurosporin, using the Caspase-3 Fluorescence assay Kit, as described by the manufacture (Cayman Chemical Company).
- Cell migration and invasion assays were determined using 24-well microchemotaxis chambers alone or precoated with 7.5 ⁇ g collagen type IV (Becton Dickinson Labware), respectively (7, 25). Control tumor cells or cells expressing Spn4A cDNA were resuspended in serum-free media and loaded into upper chamber of each well. Cells were incubated at 37°C for 24 h, after which, the filters were fixed and stained with Diff-Quik (Medion Diagnostic). Cell migration and invasion were quantified by determination of the number of cells that migrated directly through the membrane toward the medium containing 10% serum that was used as a chemoattractant.
- Tumorigenicity assay Ethical approval for all animal studies was obtained from the Institutional Animal Care and Use Committee of the INSERM Institute in accordance with the National Advisory Committee for Laboratory Animal Research Guidelines licensed by the French Authority. Female 4- to 6-week-old nu/nu mice from Janvier Laboratories, housed in a pathogen-free facility, were used for all of the experiments. To assess the effect of PCs inhibition by Spn4A on tumor growth, lxlO 6 HT-29, CT-26, HT-29/Spn4A, or CT-26/ Spn4A cells were injected subcutaneously into nude mice, tumor formation was monitored every 2-3 days, and mice were sacrificed in the end of the experiments. Tumor volume was calculated as previously described (7, 9).
- Liver metastasis assay Experimental liver metastases were generated by intrasplenic/portal injection of HT-29/CTL, HT-29/ Spn4A, CT-26/CTL or CT-26/Spn4A cells, as previously described (9). Because of high aggressiveness of CT-26 colon cancer cells, CT-26/CTL and CT-26/Spn4A cells-injected nude mice were sacrificed two weeks after the injection, whereas HT-29- and HT-29/Spn4A cells-injected mice were sacrificed four weeks later. Livers were removed and metastases were enumerated, without prior fixation.
- TdT deoxynucleotidyl transferase
- the inventors then analyzed mRNA expression of these MMPs and of their naturally occurring inhibitors TIMP-1 and TIMP-2, using real-time PCR. They found that while expression of MMP-2 and MMP-9 was reduced in Spn4A-expressing tumor cells, mRNA expression levels of TIMP-1 and TIMP-2 was significantly increased. Evaluation of MMPs/TIMPs ratios indicated that compared to control cells, these ratios were significantly decreased in Spn4A-expressing tumor cells. Similarly, since the uPA/uPAR/PAI- 1 system is also involved in cell invasion, they analyzed the effect of PCs inhibition by Spn4A on expression levels of these molecules by real-time PCR.
- PCs blockade by Spn4A prevents experimental colorectal liver metastasis: To evaluate the effect of PCs inhibition by Spn4A on the ability of colon cancer cells to colonize the liver, HT-29/CTL, CT-26/CTL, HT-29/Spn4A, and CT-26/Spn4A cells, were injected in mice through the intrasplenic/portal route. At 2 weeks after injection of CT-26/CTL and CT- 26/Spn4A cells, and 4 weeks after injection of HT-29/CTL and HT-29/Spn4A cells, livers were removed and the number of metastases was determined.
- mice inoculated with tumor cells the number of hepatic metastases was reduced by up to 75% (P ⁇ 0.001) in HT- 29/Spn4A- and CT-26/Spn4A-injected mice relative to control animals (Mann- Whitney test, Table 1).
- PCR Array analysis of ECM proteins and adhesion molecules known to be involved in invasion and metastasis revealed their reduced expression in Spn4A-expressing cells. These include COL6A1, CTNND2, TNC, HAS1, ITGA4, ICAM1, NCAM1, VCAM1, CLEC3B and LAMA3 (Table 2).
- PC activity in colon cancer cells-derived hepatic metastases To evaluate the effect of PCs activity in metastatic livers, tumor cells were injected in mice through the intrasplenic/portal route. After 2 or 4 weeks, the livers were removed and lysed. PCs activity was analyzed by assessing their ability to digest pERTKR-MCA (24). It was shown that PCs activity in HT-29/Spn4A- and CT-26/Spn4A-derived metastases were reduced as compared to HT-29/CTL- and CT-26/CTL-derived metastatic livers. Table 2: List of genes regulated by Spn4A in the colon carcinoma cells.
- Genes listed are those differentially regulated after expression of Spn4A in colon cancer cells HT-29 as compared to control HT-29 cell
- the cut-off limit in the analysis was set to two-fold for both induced (+) and repressed (-) genes.
- the Gene Bank accession numbers ar indicated.
- Collagen, type XVI, alpha Extramolecular Matrix Proteins Involved in cell invasiveness
- Extramolecular Matrix Proteins in colorectal cancer. It MMP13 NM_002427 13 -9.2
- Extramolecular Matrix Proteins Seems to be up-regulate MMP15 NM_002428 15 -3.4
- Loss-of-function enhances th progression of melanom
- Neural cell adhesion Cell adhesion molecules mediate cell-cell cohesio
- TIMP metallopeptidase Extramolecular Matrix Proteins Inhibits tumor growth and cel
- Vascular cell adhesion Cell adhesion molecules Implicated in cell adhesio
- neoplasia I leads to cell proliferation
- V-rel reticuloendotheliosis Overexpression contribute t
- Proteolytic processing of vascular endothelial growth factor-D is essential for its capacity to promote the growth and spread of cancer. FASEB J 2011; 25:2615-2625.
- IGF-1 insulin-like growth factor- 1
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention relates to an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof for use in the prevention or treatment of cancer and related metastases. The invention also relates to a pharmaceutical composition for use in the prevention or treatment of cancer and related metastases comprising at least one polypeptide according to the invention, or at least one acid nucleic according to the invention, or at least one expression vector according to the invention, or at least one host cell according to the invention and a pharmaceutically acceptable carrier.
Description
SERPIN SPN4A AND BIOLOGICALLY ACTIVE DERIVATIVES THEREOF
FOR USE IN THE TREATMENT OF CANCER
FIELD OF THE INVENTION:
The invention relates to the field of oncology. More particularly, the invention relates to an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof for use in the prevention or treatment of cancer and related metastases.
BACKGROUND OF THE INVENTION:
Proprotein convertases (PCs) located along the constitutive secretory pathway (Furin,
PACE4, PC5 and PC7) are involved in the proteolytic cleavage and/or expression of various neoplasia-related mediators, making them promising targets in cancer therapy.
Indeed, by inducing cleavage and/or expression of various protein precursors, PCs play a key role in cancer progression and metastasis (1-8). To date, a wide range of these substrates and/or downstream effectors comprise growth factors and receptors, adhesion receptors and proteases. For example, proteolytic processing by PCs of VEGF-C, -D (3, 4), PDGF A, -B (5, 6), IGF-1 receptor (7) and MTl-MMP (8) was found to be required for their ability to mediate tumor cell proliferation and/or invasion. Similarly, hepatic cytokine and E- selectin induction by metastatic colon cancer cells during liver colonization was reported to require functional PCs in invading tumor cells (9). The PCs activate their substrates by cleavage at the consensus sequence (K/R)-(X)n-(K/R)J,, where n = 0, 2, 4, or 6 and X is any amino acid except Cys (1, 2). This conversion is mediated by one or more of the PC family members. These include PCI and PC2 found within dense core secretory granules that process proteins secreted by the regulated secretory pathway, and Furin, PC4, PC5, PACE4 and PC7 that are involved in protein precursors processing secreted via the constitutive secretory pathway (1-9). Previously, altered levels of PCs were reported to be associated with enhanced invasion and proliferation of colon cancer cells (10, 11). Conversely, inhibition of PCs by the bioengineered inhibitor al-PDX in colon carcinoma cells resulted in PC substrates processing blockade (7, 9, 11).
Maturation of protein precursors by PCs was described in various organisms and species including plants and eukaryotes, ranging from Hydra to mammals (12). However, although the distribution and conservation of PCs within the secretory pathway predicts the existence of endogenous inhibitors and/or mechanisms able to regulate their activity (1, 2), to date only three naturally occurring inhibitors have been identified; including 7B2 (13),
proSAAS (14), and CRES (15). All of these inhibitors are directed against regulated secretory pathway convertases PC2 and PCl/3, but they do not exhibit a direct effect on secretory pathway PCs (13-15).
Unfortunately until now, no naturally occurring inhibitor is known that efficiently inhibits all secretory pathway PCs, because such inhibitor would be of great interest for preventing or treating cancer, tumoregenesis and related metastasis (e.g. by inhibiting proliferation, migration and invasion of cancer cells).
Serpins belong to a superfamily of protease inhibitors that play a regulatory role in blood coagulation, and inflammation. Mutations in these proteins were found to cause diseases including blood coagulation disorders, cirrhosis, emphysema, and dementia (16-18). To date, more than 800 serpins have been identified in plants, animals, viruses and prokaryotes (16-18). In Drosophila melanogaster, 29 serpin genes are known, a high number as compared to human. They are involved in maintaining enzymatic homeostasis of various proteases (18-21).
SUMMARY OF THE INVENTION:
In a first aspect, the present invention relates to an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof for use in the prevention or treatment of cancer and related metastases.
In a second aspect, the present invention also relates to a nucleic acid encoding a polypeptide of the invention, or an expression vector comprising a nucleic acid of the invention, or a host cell comprising an expression vector for use in the prevention or treatment of cancer and related metastases. In a third aspect, the present invention further relates to a pharmaceutical composition comprising an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof, or a nucleic acid encoding thereof, or an expression vector comprising thereof, or a host cell comprising thereof and a pharmaceutically acceptable carrier.
In another aspect, the present invention relates to a kit-of-part composition comprising an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof, or a nucleic acid encoding thereof, or an expression vector comprising thereof, or a host cell comprising thereof and an additional therapeutic agent.
In still another aspect, the present invention relates to a pharmaceutical composition or a kit-of-part composition for use in the prevention or treatment of cancer and related metastases.
DETAILED DESCRIPTION OF THE INVENTION:
The invention is based on the discovery that Drosophila melanogaster serpin Spn4A, which is not conserved in human genome, inhibits the entire constitutive secretory pathway PCs (Furin, PC4, PC5, PACE4 and PC7), the proliferation as well as the metastatic potential of cancer cells (e.g. colon cancer cells). As disclosed herein, the serpin Spn4A is able, when expressed in colon carcinoma cells, to inhibit processing of PC substrates and reduced anchorage-independent growth, invasiveness and enhanced chemosensitivity. The latter is associated with reduced expression of Bcl-2 and increased Caspase-3 activity. As also shown herein, Spn4A repressed in vivo tumor development and formation of liver metastases in response to intrasplenic/portal inoculation of colon cancer cells. Furthermore, the tumor- suppressor function of Spn4A was linked to increased expression of molecules with anti- metastatic functions and inhibited expression of pro-tumorigenic molecules. Thus, blocking tumor growth, tumorigenesis and increasing chemosensitivity by using
Spn4A can be effective for prevention or treatment of cancer and tumor metastasis.
Therapeutic methods and uses: The invention provides methods and compositions (such as pharmaceutical compositions) for preventing or treating cancer and related metastasis. The invention also provides methods and compositions for inhibiting or preventing proliferation, migration and invasion of cancer cells. The invention further provides methods and compositions for increasing chemosensitivity to chemotherapeutic compound such as tyrosine kinase inhibitors.
A first aspect of the invention relates to an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof for use in the prevention or treatment of cancer and related metastases. As used herein, the term "Serpin Spn4A" (Spn4a) refers to a Serine Proteinase
Inhibitor of Drosophila melanogaster. Serpin Spn4A refers to any native or variant (whether native or synthetic) polypeptide of 392 amino acids provided in the GenBank database under accession number NM_165496.2 and is shown as follows (SEQ ID NO: 1):
MADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAEN ETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQL LSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAI HFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELP YKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELS EVFQKLGMSKMFSDQAEFGKMLQSPEPLKVSAFIHKAFIEVNEEGTEAAAATGMAV RRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSVVRLEENTFASSEHDEL
As used herein, the term "polypeptide" refers to a polymer of amino acid residues joined by peptide bonds, whether produced naturally or synthetically, having no specific length. Thus, peptides, oligopeptides and proteins are included in the definition of "polypeptide" and these terms are used interchangeably throughout the specification, as well as in the claims. The term "polypeptide" does not exclude post-translational modifications that include but are not limited to phosphorylation, acetylation, glycosylation and the like. The term also applies to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
By an "isolated" polypeptide, it is intended that the polypeptide is not present within a living organism, e.g. within human body. However, the isolated polypeptide may be part of a composition or a kit. The isolated polypeptide is preferably purified. Such polypeptide is essentially free from contaminating cellular components, such as carbohydrate, lipid, or other proteinaceous impurities associated with the polypeptide in nature. Typically, a preparation of isolated polypeptide contains the polypeptide in a highly purified form, i.e., at least about 80% pure, at least about 90% pure, at least about 95% pure, greater than 95% pure, such as 96%, 97%, or 98% or more pure, or greater than 99% pure. One way to show that a particular protein preparation contains an isolated polypeptide is by the appearance of a single band following SDS-polyacrylamide gel electrophoresis of the protein preparation and Coomassie Brilliant Blue staining of the gel.
A "native sequence" polypeptide refers to a polypeptide having the same amino acid sequence as a polypeptide derived from nature. Thus, a native sequence polypeptide can have the amino acid sequence of naturally-occurring polypeptide from Drosophila melanogaster. Such native sequence polypeptide can be isolated from nature or can be produced by
recombinant or synthetic means. The term "native sequence" polypeptide specifically encompasses naturally-occurring forms of the polypeptide (e. g., a proprotein), naturally- occurring variant forms (e. g., alternatively spliced forms) and naturally-occurring allelic variants of the polypeptide. Serpin Spn4A variants disclosed herein include, but are not limited to, those described in Briining et al., 2007 (27).
By a polypeptide having an amino acid sequence at least, for example, 95% "identical" to a query amino acid sequence of the present invention, it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence. In other words, to obtain a polypeptide having an amino acid sequence at least 95% identical to a query amino acid sequence, up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid.
In the frame of the present application, the percentage of identity is calculated using a global alignment (i.e., the two sequences are compared over their entire length). Methods for comparing the identity and homology of two or more sequences are well known in the art. The "needle" program, which uses the Needleman-Wunsch global alignment algorithm (Needleman and Wunsch, 1970 J. Mol. Biol. 48:443-453) to find the optimum alignment (including gaps) of two sequences when considering their entire length, may for example be used. The needle program is for example available on the ebi.ac.uk world wide web site. The percentage of identity in accordance with the invention is preferably calculated using the EMBOSS ::needle (global) program with a "Gap Open" parameter equal to 10.0, a "Gap Extend" parameter equal to 0.5, and a Blosum62 matrix.
Polypeptides consisting of an amino acid sequence "at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical" to a reference sequence may comprise mutations such as deletions, insertions and/or substitutions compared to the reference sequence. The polypeptide consisting of an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference sequence may correspond to an allelic variant of the reference sequence. It may for example only comprise substitutions compared to the reference sequence. The substitutions preferably correspond to conservative substitutions as indicated in the table below.
Conservative substitutions Type of Amino Acid
Ala, Val, Leu, lie, Met, Pro, Phe, Trp Amino acids with aliphatic hydrophobic side chains
Ser, Tyr, Asn, Gin, Cys Amino acids with uncharged but polar side chains
Asp, Glu Amino acids with acidic side chains
Lys, Arg, His Amino acids with basic side chains
Gly Neutral side chain
As used herein, the term "biologically active derivatives of the Serpin Spn4A polypeptide" includes the variants and the fragments of the polypeptide to which it refers (i.e. the Serpin Spn4A polypeptide) and that retain the biological activity and the specificity of the parent polypeptide. Therefore, the "derivatives of the Serpin Spn4A polypeptide" include variants and fragments of the polypeptide represented by SEQ ID NO: 1.
A polypeptide "fragment", as used herein, refers to a biologically active polypeptide that is shorter than a reference polypeptide (e.g. a fragment of the Serpin Spn4A polypeptide). Thus, the polypeptide according to the invention encompasses polypeptides comprising or consisting of fragments of Spn4A, provided the fragments are biologically active. In the frame of the invention, the biologically active fragment may for example comprise at least 15, 25, 50, 75, 100, 150 200, 250, 300 or 350 consecutive amino acids of the Spn4A polypeptide. A "biologically active derivative polypeptide" of the Serpin Spn4A polypeptide refers to a polypeptide exhibiting at least one, preferably all, of the biological activities of the reference polypeptide, provided the biologically active derivative retains the capacity of reducing malignant phenotype of cancer cells and/or reducing the tumor growth and/or increasing the chemosensitivity. The biologically active derivative may for example be characterized in that it is capable of inhibiting the proteolytic activity of PCs such as Furin, PACE4, PC5A, PC5B and/or PC7 (see Example "Measurement of proprotein convertases activity"). Such proteolytic activity may for instance be assessed in vitro by conventional techniques such as activity assays using fluorogenic substrates (e.g. the fluorogeneic peptide pERTKR-MCA) as previously described in Lalou et al. 2010). Preferably, said inhibition of proteolytic activity has to be of at least 50%, preferably at least 70%, more preferably at least
80%, and even more preferably at least 90% of the proteolytic activity of the parent polypeptide.
The skilled in the art can easily determine whether a derivative of the Serpin Spn4A polypeptide is biologically active. To check whether the newly generated polypeptides reduce the tumorigenicity of cancer cells and/or increase the chemosensitivity in the same way than the initially characterized polypeptide Spn4A, a proteolytic activity assay (see in Example), a cell proliferation assay (see in Example), a cell migration assay (see in Example), a cell invasion assay (see in Example), an apoptosis assay (see in Example) may be performed with each polypeptide. Additionally, a time-course and a dose-response performed in vitro or in vivo (e.g. by using a liver metastasis assay as described in the Examples section) will determine the optimal conditions for each polypeptide.
In one embodiment, the polypeptides of the invention may comprise a tag. A tag is an epitope-containing sequence which can be useful for the purification of the polypeptides. It is attached to by a variety of techniques such as affinity chromatography, for the localization of said polypeptide within a cell or a tissue sample using immunolabeling techniques, the detection of said polypeptide by immunoblotting etc. Examples of tags commonly employed in the art are the GST (glutathion-S-transferase)-tag, the FLAG™-tag, the Strep-tag™, V5 tag, myc tag, His tag (which typically consists of six histidine residues), etc.
In another embodiment, the polypeptides of the invention may comprise chemical modifications improving their stability and/or their biodisponibility. Such chemical modifications aim at obtaining polypeptides with increased protection of the polypeptides against enzymatic degradation in vivo, and/or increased capacity to cross membrane barriers, thus increasing its half-life and maintaining or improving its biological activity. Any chemical modification known in the art can be employed according to the present invention. Such chemical modifications include but are not limited to:
- replacement(s) of an amino acid with a modified and/or unusual amino acid, e.g. a replacement of an amino acid with an unusual amino acid like Nle, Nva or Orn; and/or
- modifications to the N-terminal and/or C-terminal ends of the peptides such as e.g. N- terminal acylation (preferably acetylation) or desamination, or modification of the C- terminal carboxyl group into an amide or an alcohol group;
- modifications at the amide bond between two amino acids: acylation (preferably
acetylation) or alkylation (preferably methylation) at the nitrogen atom or the alpha carbon of the amide bond linking two amino acids;
- modifications at the alpha carbon of the amide bond linking two amino acids such as e.g. acylation (preferably acetylation) or alkylation (preferably methylation) at the alpha carbon of the amide bond linking two amino acids.
- chirality changes such as e.g. replacement of one or more naturally occurring amino acids (L enantiomer) with the corresponding D-enantiomers;
- retro-inversions in which one or more naturally-occurring amino acids (L-enantiomer) are replaced with the corresponding D-enantiomers, together with an inversion of the amino acid chain (from the C-terminal end to the N-terminal end);
- azapeptides, in which one or more alpha carbons are replaced with nitrogen atoms; and/or
- betapeptides, in which the amino group of one or more amino acid is bonded to the β carbon rather than the a carbon. In another embodiment, adding dipeptides can improve the penetration of a circulating agent in the eye through the blood retinal barrier by using endogenous transporters.
Another strategy for improving drug viability is the utilization of water-soluble polymers. Various water-soluble polymers have been shown to modify biodistribution, improve the mode of cellular uptake, change the permeability through physiological barriers; and modify the rate of clearance from the body. To achieve either a targeting or sustained- release effect, water-soluble polymers have been synthesized that contain drug moieties as terminal groups, as part of the backbone, or as pendent groups on the polymer chain.
Polyethylene glycol (PEG) has been widely used as a drug carrier, given its high degree of biocompatibility and ease of modification. Attachment to various drugs, proteins, and liposomes has been shown to improve residence time and decrease toxicity. PEG can be coupled to active agents through the hydroxyl groups at the ends of the chain and via other chemical methods; however, PEG itself is limited to at most two active agents per molecule. In a different approach, copolymers of PEG and amino acids were explored as novel biomaterials which would retain the biocompatibility properties of PEG, but which would have the added advantage of numerous attachment points per molecule (providing greater drug loading), and which could be synthetically designed to suit a variety of applications.
Those of skill in the art are aware of PEGylation techniques for the effective modification of drugs. For example, drug delivery polymers that consist of alternating polymers of PEG and tri-functional monomers such as lysine have been used by VectraMed (Plainsboro, N.J.). The PEG chains (typically 2000 daltons or less) are linked to the a- and e- amino groups of lysine through stable urethane linkages. Such copolymers retain the desirable properties of PEG, while providing reactive pendent groups (the carboxylic acid groups of lysine) at strictly controlled and predetermined intervals along the polymer chain. The reactive pendent groups can be used for derivatization, cross -linking, or conjugation with other molecules. These polymers are useful in producing stable, long-circulating pro-drugs by varying the molecular weight of the polymer, the molecular weight of the PEG segments, and the cleavable linkage between the drug and the polymer. The molecular weight of the PEG segments affects the spacing of the drug/linking group complex and the amount of drug per molecular weight of conjugate (smaller PEG segments provides greater drug loading). In general, increasing the overall molecular weight of the block co-polymer conjugate will increase the circulatory half-life of the conjugate. Nevertheless, the conjugate must either be readily degradable or have a molecular weight below the threshold-limiting glomular filtration (e.g., less than 60 kDa).
In addition, to the polymer backbone being important in maintaining circulatory half- life, and biodistribution, linkers may be used to maintain the therapeutic agent in a pro-drug form until released from the backbone polymer by a specific trigger, typically enzyme activity in the targeted tissue. For example, this type of tissue activated drug delivery is particularly useful where delivery to a specific site of biodistribution is required and the therapeutic agent is released at or near the site of pathology. Linking group libraries for use in activated drug delivery are known to those of skill in the art and may be based on enzyme kinetics, prevalence of active enzyme, and cleavage specificity of the selected disease-specific enzymes. Such linkers may be used in modifying the polypeptides described herein for therapeutic delivery.
In still another embodiment, the polypeptides of the invention may be fused to a heterologous polypeptide (i.e. polypeptide derived from an unrelated protein, for example, from an immunoglobulin protein).
As used herein, the terms "fused" and "fusion" are used interchangeably. These terms refer to the joining together of two more elements or components, by whatever means
including chemical conjugation or recombinant means. An "in-frame fusion" refers to the joining of two or more polynucleotide open reading frames (ORFs) to form a continuous longer ORF, in a manner that maintains the correct translational reading frame of the original ORFs. Thus, a recombinant fusion protein is a single protein containing two or more segments that correspond to polypeptides encoded by the original ORFs (which segments are not normally so joined in nature. Although the reading frame is thus made continuous throughout the fused segments, the segments may be physically or spatially separated by, for example, in- frame linker sequence.
As used herein, the term "fusion protein" means a protein comprising a first polypeptide linearly connected, via peptide bonds, to a second, polypeptide.
As used herein, the term "Spn4A fusion protein" refers to a polypeptide comprising the Spn4A polypeptide or a derivative thereof fused to heterologous polypeptide. The Spn4A fusion protein will generally share at least one biological property in common with the Spn4A polypeptide (as described above).
An example of a Spn4A fusion protein is a Spn4A immunoadhesin.
As used herein, the term "immunoadhesin" designates antibody-like molecules which combine the binding specificity of a heterologous protein (an "adhesin") with the effector functions of immunoglobulin constant domains. Structurally, the immunoadhesins comprise a fusion of an amino acid sequence with the desired binding specificity which is other than the antigen recognition and binding site of an antibody (i.e., is "heterologous"), and an immunoglobulin constant domain sequence. The adhesin part of an immunoadhesin molecule typically is a contiguous amino acid sequence comprising at least the binding site of a receptor or a ligand. The immunoglobulin constant domain sequence in the immunoadhesin may be obtained from any immunoglobulin, such as IgG-1, IgG-2, IgG-3, or IgG-4 subtypes, IgA (including IgA-1 and IgA-2), IgE, IgD or IgM.
The immunoglobulin sequence preferably, but not necessarily, is an immunoglobulin constant domain (Fc region). Immunoadhesins can possess many of the valuable chemical and biological properties of human antibodies. Since immunoadhesins can be constructed from a human protein sequence with a desired specificity linked to an appropriate human immunoglobulin hinge and constant domain (Fc) sequence, the binding specificity of interest can be achieved using entirely human components. Such
immunoadhesins are minimally immunogenic to the patient, and are safe for chronic or repeated use. In one embodiment, the Fc region is a native sequence Fc region. In another embodiment, the Fc region is a variant Fc region. In still another embodiment, the Fc region is a functional Fc region. The Spn4A portion and the immunoglobulin sequence portion of the Spn4A immunoadhesin may be linked by a minimal linker. The immunoglobulin sequence preferably, but not necessarily, is an immunoglobulin constant domain. The immunoglobulin moiety in the chimeras of the present invention may be obtained from IgGl, IgG2, IgG3 or IgG4 subtypes, IgA, IgE, IgD or IgM, but preferably IgGl or IgG3. As used herein, the term "Fc region" is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
A "functional Fc region" possesses an "effector function" of a native sequence Fc region. Exemplary "effector functions" include Clq binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor; BCR), etc.
A "native sequence Fc region" comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature. Native sequence human Fc regions include a native sequence human IgGi Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
A "variant Fc region" comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, preferably one or more amino acid substitution(s). Preferably, the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g. from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide. The variant Fc region herein will preferably possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably at least about 90% homology therewith, more preferably at least about 95% homology therewith.
Another example of a Spn4A fusion protein is a fusion of the Spn4A polypeptide with human serum albumin -binding domain antibodies (AlbudAbs) according to the AlbudAb™ Technology Platform as described in Konterman et al. 2012 AlbudAb™ Technology Platform- Versatile Albumin Binding Domains for the Development of Therapeutics with Tunable Half-Lives
The polypeptides of the invention may be produced by any suitable means, as will be apparent to those of skill in the art. In order to produce sufficient amounts of a Spn4a or functional equivalents thereof, or a Spn4A fusion protein such as a Spn4A immunoadhesin for use in accordance with the invention, expression may conveniently be achieved by culturing under appropriate conditions recombinant host cells containing the polypeptide of the invention. Preferably, the polypeptide is produced by recombinant means, by expression from an encoding nucleic acid molecule. Systems for cloning and expression of a polypeptide in a variety of different host cells are well known.
When expressed in recombinant form, the polypeptide is preferably generated by expression from an encoding nucleic acid in a host cell. Any host cell may be used, depending upon the individual requirements of a particular system. Suitable host cells include bacteria mammalian cells, plant cells, yeast and baculovirus systems. Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary cells. HeLa cells, baby hamster kidney cells and many others. Bacteria are also preferred hosts for the production of recombinant protein, due to the ease with which bacteria may be manipulated and grown. A common, preferred bacterial host is E coli.
Moreover, it should be noted that the majority of protein-based biopharmaceuticals bare some form of post-translational modification which can profoundly affect protein properties relevant to their therapeutic application. Protein glycosylation represents the most common modification (about 50% of human proteins are glycosylated). Glycosylation can introduce considerable heterogeneity into a protein composition through the generation of different glycan structures on the proteins within the composition. Such glycan structures are made by the action of diverse enzymes of the glycosylation machinery as the glycoprotein transits the Endoplasmatic Reticulum (ER) and the Golgi-Complex (glycosylation cascade). The nature of the glycan structure(s) of a protein has impact on the protein's folding, stability,
life time, trafficking, pharmaco-dynamics, pharmacokinetics and immunogenicity. The glycan structure has great impact on the protein's primary functional activity. Glycosylation can affect local protein structure and may help to direct the folding of the polypeptide chain. One important kind of glycan structures are the so called N-glycans. They are generated by covalent linkage of an oligosaccharide to the amino (N)-group of asparagin residues in the consensus sequence NXS/T of the nascent polypeptide chain. N-glycans may further participate in the sorting or directing of a protein to its final target: the N-glycan of an antibody, for example, may interact with complement components. N-glycans also serve to stabilize a glycoprotein, for example, by enhancing its solubility, shielding hydrophobic patches on its surface, protecting from proteolysis, and directing intra-chain stabilizing interactions. Glycosylation may regulate protein half-life, for example, in humans the presence of terminal sialic acids in N-glycans may increase the half-life of proteins, circulating in the blood stream.
As used herein, the term "glycoprotein" refers to any protein having one or more N- glycans attached thereto. Thus, the term refers both to proteins that are generally recognized in the art as a glycoprotein and to proteins which have been genetically engineered to contain one or more N-linked glycosylation sites. As used herein, the terms "N-glycan" and "glycoform" are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine-N- acetylglucosamine linkage to an asparagine residue of a polypeptide. N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein. The predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N- acetylglucosamine (GlcNAc) and sialic acid (e.g., N- acetyl-neuraminic acid (NANA)). The processing of the sugar groups occurs co-translationally in the lumen of the ER and continues post-translationally in the Golgi apparatus for N-linked glycoproteins.
A number of yeasts, for example, Pichia pastoris, Yarrowia lipolytica and Saccharomyces cerevisiae are recently under development to use the advantages of such systems but to eliminate the disadvantages in respect to glycosylation. Several strains are under genetical development to produce defined, human-like glycan structures on a protein. Methods for genetically engineering yeast to produce human-like N- glycans are described in U.S. Patent Nos. 7,029,872 and 7,449,308 along with methods described in U.S. Published Application Nos. 20040230042, 20050208617, 20040171826, 20050208617, and
20060286637. These methods have been used to construct recombinant yeast that can produce therapeutic glycoproteins that have predominantly human-like complex or hybrid N- glycans thereon instead of yeast type N-glycans. As previously described, human-like glycosylation is primarily characterized by "complex" N-glycan structures containing N-acetylglusosamine, galactose, fucose and/or N-acetylneuraminic acid. Thus, several strains of yeasts have been genetically engineered to produce glycoproteins comprising one or more human-like complex or human-like hybrid N-glycans such as GlcNAcMan3GlcNAc2.
Alternatively, a nucleic acid encoding a polypeptide of the invention (such as the Serpin Spn4A polypeptide as shown in SEQ ID NO: 1) or a vector comprising such nucleic acid or a host cell comprising such expression vector may be used in the prevention or treatment of cancer and related metastases.
Accordingly, another aspect of the invention relates to a nucleic acid encoding an amino acids sequence comprising SEQ ID NO: 1 as described here above for use in the prevention or treatment of cancer and related metastases.
In one embodiment, said nucleic acid encoding an amino acid sequence consisting on SEQ ID NO: 1. Nucleic acids of the invention may be produced by any technique known per se in the art, such as, without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination(s).
Another aspect of the invention is an expression vector comprising a nucleic acid sequence encoding an amino sequence comprising SEQ ID NO: 1 as described here above for use in the prevention or treatment of cancer and related metastases.
In its broadest sense, a "vector" is any vehicle capable of facilitating the transfer of a nucleic acid to the cells and preferably to cancerous cells. Preferably, the vector transports the nucleic acid to cells with reduced degradation relative to the extent of degradation that would result in the absence of the vector. In general, the vectors useful in the invention include, but are not limited to, plasmids, phagemids, viruses, other vehicles derived from viral or bacterial sources that have been manipulated by the insertion or incorporation of the nucleic acid sequences of interest. Viral vectors are a preferred type of vector and include, but are not
limited to nucleic acid sequences from the following viruses: retrovirus, such as moloney murine leukemia virus, harvey murine sarcoma virus, murine mammary tumor virus, and rouse sarcoma virus; adenovirus, adeno-associated virus; SV40-type viruses; polyoma viruses; Epstein-Barr viruses; papilloma viruses; herpes virus; vaccinia virus; polio virus; and RNA virus such as a retrovirus. One can readily employ other vectors not named but known to the art.
Preferred viral vectors are based on non-cytopathic eukaryotic viruses in which nonessential genes have been replaced with the gene of interest. Non-cytopathic viruses include retroviruses (e.g., lentivirus), the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA. Retroviruses have been approved for human gene therapy trials. Most useful are those retroviruses that are replication-deficient (i.e., capable of directing synthesis of the desired proteins, but incapable of manufacturing an infectious particle). Such genetically altered retroviral expression vectors have general utility for the high-efficiency transduction of genes in vivo. Standard protocols for producing replication-deficient retroviruses (including the steps of incorporation of exogenous genetic material into a plasmid, transfection of a packaging cell lined with plasmid, production of recombinant retroviruses by the packaging cell line, collection of viral particles from tissue culture media, and infection of the target cells with viral particles) are provided in KRIEGLER (A Laboratory Manual," W.H. Freeman CO., New York, 1990) and in MURRY ("Methods in Molecular Biology," vol.7, Humana Press, Inc., Cliffton, N.J., 1991).
Preferred viruses for certain applications are the adeno-viruses and adeno-associated viruses, which are double-stranded DNA viruses that have already been approved for human use in gene therapy. The adeno-associated virus can be engineered to be replication deficient and is capable of infecting a wide range of cell types and species. It further has advantages such as, heat and lipid solvent stability; high transduction frequencies in cells of diverse lineages, including hemopoietic cells; and lack of superinfection inhibition thus allowing multiple series of transductions. Reportedly, the adeno-associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression characteristic of retroviral infection. In addition, wild-type adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that
the adeno-associated virus genomic integration is a relatively stable event. The adeno- associated virus can also function in an extrachromosomal fashion.
Other vectors include plasmid vectors. Plasmid vectors have been extensively described in the art and are well known to those of skill in the art. See e.g., SANBROOK et al., "Molecular Cloning: A Laboratory Manual," Second Edition, Cold Spring Harbor Laboratory Press, 1989. In the last few years, plasmid vectors have been used as DNA vaccines for delivering antigen-encoding genes to cells in vivo. They are particularly advantageous for this because they do not have the same safety concerns as with many of the viral vectors. These plasmids, however, having a promoter compatible with the host cell, can express a peptide from a gene operatively encoded within the plasmid. Some commonly used plasmids include pBR322, pUC18, pUC19, pRC/CMV, SV40, and pBlueScript. Other plasmids are well known to those of ordinary skill in the art. Additionally, plasmids may be custom designed using restriction enzymes and ligation reactions to remove and add specific fragments of DNA. Plasmids may be delivered by a variety of parenteral, mucosal and topical routes. For example, the DNA plasmid can be injected by intramuscular, intradermal, subcutaneous, or other routes. It may also be administered by intranasal sprays or drops, rectal suppository and orally. It may also be administered into the epidermis or a mucosal surface using a gene-gun. The plasmids may be given in an aqueous solution, dried onto gold particles or in association with another DNA delivery system including but not limited to liposomes, dendrimers, cochleate and microencapsulation.
Another aspect of the invention is a host cell comprising an expression vector as described here above for use in the prevention or treatment of cancer and related metastases.
According to the invention, examples of host cells that may be used are human dendritic cells or monocytes (particularly those obtained from the subject to be treated).
The means by which the vector carrying the gene may be introduced into the cells include, but are not limited to, microinjection, electroporation, transduction, or transfection using DEAE-dextran, lipofection, calcium phosphate or other procedures known to one skilled in the art.
In a particular embodiment, polypeptides, nucleic acids, expression vector or host cells of the invention are used advantageously for the prevention or treatment of cancers and related metastases including, but not limited to, carcinoma, including that of the bladder, breast, colon, kidney, liver, lung, ovary, prostate, pancreas, stomach, cervix, thyroid and skin, including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T- cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma and Burketts lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyoscarcoma; other tumors, including neuroblastoma and glioma; tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, and schwannomas; tumors of mesenchymal origin, including fibrosarcoma, rhabdomyoscaroma, and osteosarcoma; and other tumors, including melanoma, xeroderma pigmentosum, keratoacanthoma, seminoma, thyroid follicular cancer and teratocarcinoma.
By "metastasis" or "tumor metastasis" is meant the spread of cancer from its primary site to other places in the body. Cancer cells can break away from a primary tumor, penetrate into lymphatic and blood vessels, circulate through the bloodstream, and grow in a distant focus (metastasize) in normal tissues elsewhere in the body. Metastasis can be local or distant. Metastasis is a sequential process, contingent on tumor cells breaking off from the primary tumor, traveling through the bloodstream or lymphatics, and stopping at a distant site. At the new site, the cells establish a blood supply and can grow to form a life-threatening mass. In certain embodiments, the term metastatic tumor refers to a tumor that is capable of metastasizing, but has not yet metastasized to tissues or organs elsewhere in the body. In certain embodiments, the term metastatic tumor refers to a tumor that has metastasized to tissues or organs elsewhere in the body.
By "primary tumor" or "primary cancer" is meant the original cancer and not a metastatic lesion located in another tissue, organ, or location in the subject's body.
In one particular embodiment, the cancer is a colorectal cancer. Accordingly, in one preferred embodiment, the related metastases are liver colorectal metastases.
In another particular embodiment, the cancer is a skin cancer (e.g. melanoma). Accordingly, in one preferred embodiment, the related metastases are pulmonary melanoma metastases. In still another particular embodiment, the cancer is a breast cancer. Accordingly, in one preferred embodiment, the related metastases are pulmonary breast metastases.
Another aspect of the invention relates to a method for preventing or treating cancer and related metastases comprising administering to a subject in need thereof a therapeutically effective amount of a polypeptide or a derivative thereof as described above, or a nucleic acid of the invention, or an expression vector of the invention or a host cell of the invention.
In one embodiment, the invention relates to a method for preventing or treating cancer and related metastases comprising administering to a subject in need thereof a therapeutically effective amount of a polypeptide of SEQ ID NO: 1 as above described. In one embodiment, the cancer is a colorectal cancer. Accordingly, in one particular embodiment, the related metastases are liver colorectal metastases.
As used herein, the term "therapeutically effective amount" is intended for a minimal amount of active agent, which is necessary to impart therapeutic benefit to a subject. For example, a "therapeutically effective amount of the active agent" to a subject is an amount of the active agent that induces, ameliorates or causes an improvement in the pathological symptoms, disease progression, or physical conditions associated with the disease affecting the subject. As used herein, the term "treating" a disorder or a condition refers to reversing, alleviating or inhibiting the process of one or more symptoms of such disorder or condition.
As used herein, the term "preventing" a disorder or a condition refers to keeping from occurring, or to hinder, defend from, or protect from the occurrence of a disorder or a condition or phenotype, including a symptom.
As used herein, the term "subject" denotes a mammal, such as a rodent, a feline, a canine, and a primate. Preferably, a subject according to the invention is a human.
In one embodiment, the subject in need thereof may have developed or be at risk for developing metastasis (e.g. affected with a cancer such as a colorectal cancer).
Pharmaceutical compositions:
Another aspect of the invention is a pharmaceutical composition comprising:
a) an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof according to the invention; or
b) an acid nucleic according to the invention; or
c) an expression vector according to the invention; or
d) an host cell according to the invention;
e) and a pharmaceutically acceptable carrier.
In one embodiment, said pharmaceutical composition comprises an isolated Serpin Spn4A polypeptide having the sequence SEQ ID NO: 1. Any therapeutic agent of the invention as above described may be combined with pharmaceutically acceptable excipients, and optionally sustained-release matrices, such as biodegradable polymers, to form therapeutic compositions.
"Pharmaceutically" or "pharmaceutically acceptable" refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to a mammal, especially a human, as appropriate. A pharmaceutically acceptable carrier or excipient refers to a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
The form of the pharmaceutical compositions, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and sex of the patient, etc.
The pharmaceutical compositions of the invention can be formulated for a topical, oral, intranasal, intraocular, intravenous, intramuscular or subcutaneous administration and the like.
Preferably, the pharmaceutical compositions contain vehicles which are pharmaceutically acceptable for a formulation capable of being injected. These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry,
especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.
The doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment. For example, it is well within the skill of the art to start doses of the compound at levels lower than those required to achieve the desired therapeutic effect and to gradually increase the dosage until the desired effect is achieved. However, the daily dosage of the products may be varied over a wide range from 0.01 to 1,000 mg per adult per day. Preferably, the compositions contain 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100, 250 and 500 mg of the active ingredient for the symptomatic adjustment of the dosage to the subject to be treated. A medicament typically contains from about 0.01 mg to about 500 mg of the active ingredient, preferably from 1 mg to about 100 mg of the active ingredient. An effective amount of the drug is ordinarily supplied at a dosage level from 0.0002 mg/kg to about 20 mg/kg of body weight per day, especially from about 0.001 mg/kg to 7 mg/kg of body weight per day.
To prepare pharmaceutical compositions, an effective amount of a polypeptide or a nucleic acid according to the invention may be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases, the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
The polypeptides thereof or the nucleic acid according to the invention can be formulated into a composition in a neutral or salt form. Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or
such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
The carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminium monostearate and gelatin.
Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with several of the other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
The preparation of more, or highly concentrated solutions for direct injection is also contemplated, where the use of DMSO as solvent is envisioned to result in extremely rapid penetration, delivering high concentrations of the active agents to a small tumor area.
Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
For parenteral administration in an aqueous solution, for example, the solution may be suitably buffered and the liquid diluent first rendered isotonic with sufficient saline or glucose. These particular aqueous solutions are especially suitable for intravenous,
intramuscular, subcutaneous and intraperitoneal administration. In this connection, sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure. For example, one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, "Remington's Pharmaceutical Sciences" 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
In addition to the compounds formulated for parenteral administration, such as intravenous or intramuscular injection, other pharmaceutically acceptable forms include, e.g. tablets or other solids for oral administration; time release capsules; and any other form currently used.
Pharmaceutical compositions of the invention may comprise an additional therapeutic agent.
In one embodiment, said additional therapeutic active agent is a chemotherapeutic agent.
Non-limiting examples of chemotherapeutic compounds which can be used in combination treatments of the present invention include, for example, conventional chemotherapeutic, radiotherapeutic and anti-angiogenic agents.
In one particular embodiment, said chemotherapeutic agent is a tyrosine kinase inhibitor (TKI).
A number of other TKIs are in late and early stage development for treatment of various types of cancer. Examplary TKIs include, but are not limited to: BAY 43-9006 (sorafenib, Nexavar®) and SU11248 (sunitinib, Sutent®), Imatinib mesylate (Gleevec®, Novartis); Gefitinib (Iressa®, AstraZeneca); Erlotinib hydrochloride (Tarceva®, Genentech); Vandetanib (Zactima®, AstraZeneca), Tipifarnib (Zarnestra®, Janssen-Cilag); Dasatinib (Sprycel®, Bristol Myers Squibb); Lonafarnib (Sarasar®, Schering Plough); Vatalanib succinate (Novartis, Schering AG); Lapatinib (Tykerb®, GlaxoSmithKline); Nilotinib (Novartis); Lestaurtinib (Cephalon); Pazopanib hydrochloride (GlaxoSmithKline); Axitinib (Pfizer); Canertinib dihydrochloride (Pfizer); Pelitinib (National Cancer Institute, Wyeth); Tandutinib (Millennium); Bosutinib (Wyeth); Semaxanib (Sugen, Taiho); AZD-2171
(AstraZeneca); VX-680 (Merck, Vertex); EXEL-0999 (Exelixis); ARRY-142886 (Array BioPharma, AstraZeneca); PD-0325901 (Pfizer); AMG-706 (Amgen); BIBF-1120 (Boehringer Ingelheim); SU-6668 (Taiho); CP-547632 (OSI); (AEE-788 (Novartis); BMS- 582664 (Bristol-Myers Squibb); JNK-401 (Celgene); R-788 (Rigel); AZD-1152 HQPA (AstraZeneca); NM-3 (Genzyme Oncology); CP-868596 (Pfizer); BMS-599626 (Bristol- Myers Squibb); PTC-299 (PTC Therapeutics); ABT-869 (Abbott); EXEL-2880 (Exelixis); AG-024322 (Pfizer); XL-820 (Exelixis); OSI-930 (OSI); XL- 184 (Exelixis); KRN-951 (Kirin Brewery); CP-724714 (OSI); E-7080 (Eisai); HKI-272 (Wyeth); CHIR-258 (Chiron); ZK- 304709 (Schering AG); EXEL-7647 (Exelixis); BAY-57-9352 (Bayer); BIBW-2992 (Boehringer Ingelheim); AV-412 (AVEO); YN-968D1 (Advenchen Laboratories); Staurosporin, Midostaurin (P C412, Novartis); Perifosine (AEterna Zentaris, Keryx, National Cancer Institute); AG-024322 (Pfizer); AZD-1152 (AstraZeneca); ON-01910Na (Onconova); and AZD-0530 (AstraZeneca).
Chemo therapeutic agents have different modes of actions, for example, by influencing either DNA or RNA and interfering with cell cycle replication. Examples of chemotherapeutic agents that act at the DNA level or on the RNA level are anti-metabolites (such as Azathioprine, Cytarabine, Fludarabine phosphate, Fludarabine, Gemcitabine, cytarabine, Cladribine, capecitabine 6-mercaptopurine, 6-thioguanine, methotrexate, 5-fluoroouracil and hyroxyurea; alkylating agents (such as Melphalan, Busulfan, Cis-platin, Carboplatin, Cyclophosphamide, Ifosphamide, Dacarabazine, Procarbazine, Chlorambucil, Thiotepa, Lomustine, Temozolamide); anti-mitotic agents (such as Vinorelbine, Vincristine, Vinblastine, Docetaxel, Paclitaxel); topoisomerase inhibitors (such as Doxorubicin, Amsacrine, Irinotecan, Daunorubicin, Epirubicin, Mitomycin, Mitoxantrone, Idarubicin, Teniposide, Etoposide, Topotecan); antibiotics (such as actinomycin and bleomycin); asparaginase; anthracyclines or taxanes.
Additional chemotherapeutic agent may be selected from, but are not limited to, cytokines, chemokines, growth factors, growth inhibitory factors, hormones, soluble receptors, decoy receptors, monoclonal or polyclonal antibodies, mono-specific, bi-specific or multi- specific antibodies, monobodies, polybodies.
Exemplary biologies drugs include, but are not limited to: anti- angiogenic agents such as Bevacuzimab (mAb, inhibiting VEGF-A, Genentech); IMC-1121B (mAb, inhibiting
VEGFR-2, ImClone Systems); CDP-791 (Pegylated DiFab,VEGFR-2, Celltech); 2C3 (mAb, VEGF-A, Peregrine Pharmaceuticals); VEGF-trap (soluble hybrid receptor VEGF-A, P1GF (placenta growth factor) Aventis/Regeneron). In another aspect, the invention also relates to a kit-of-part composition comprising a polypeptide or a derivative thereof, or a nucleic acid, or a vector, or a host cell according to the invention and an additional therapeutic active agent.
In one embodiment, said additional therapeutic active agent is a chemotherapeutic agent as described above (e.g. a tyrosine kinase inhibitor).
Another aspect of the invention is a pharmaceutical composition for use in the prevention or treatment of cancer and related metastases comprising an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof according to the invention; or an acid nucleic according to the invention; or an expression vector according to the invention; or an host cell according to the invention and a pharmaceutically acceptable carrier.
In another aspect, the invention also relates to a kit-of-part composition comprising an isolated Serpin Spn4A polypeptide or a derivative thereof, or a nucleic acid, or a vector, or a host cell according to the invention and a further therapeutic active agent for simultaneous, separate or sequential use in the prevention or treatment of cancer and related metastases.
The terms "kit", "product" or "combined preparation", as used herein, define especially a "kit of parts" in the sense that the combination partners as defined above can be dosed independently or by use of different fixed combinations with distinguished amounts of the combination partners, i.e. simultaneously or at different time points. The parts of the kit of parts can then, e.g., be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts. The ratio of the total amounts of the combination partners to be administered in the combined preparation can be varied. The combination partners can be administered by the same route or by different routes. When the administration is sequential, the first partner may be for instance administered 1, 2, 3, 4, 5, 6, 12, 18 or 24 h before the second partner.
The invention will be further illustrated by the following figures and examples. However, these examples and figures should not be interpreted in any way as limiting the scope of the present invention. FIGURES:
Figure 1: Inhibition by Spn4A of cellular Furin, PACE4, PC5A, PC5B and PC7 activity. (A), Effect of PCs expression on PDGF-A precursor (ProPDGF-A) processing in PC-deficient CHOFDl l cells. ProPDGF-A processing was analyzed by Western blotting of conditioned media obtained from CHOFDl l transfected with either empty vectors (lane 1), empty pIRES2-EGFP vector and pIRES2-EGFP vector containing proPDGF-A (lane 2), or with pIRES2-EGFP vector containing proPDGF-A and pIRES2-EGFP vector that expresses full-length PCs (Lanes 3-7). An anti-V5 antibody was used for detection. Note that all indicated PCs are able to rescue proPDGF-A processing in these PC-deficient cells. (B) Effect of Spn4A on PC-mediated proPDGF-A processing. CHOFDl l cells stably transfected with each of the indicated PCs were transiently transfected with either the empty vectors (lane 1), empty pIRES2-EGFP vector and pIRES2-EGFP vector containing proPDGF-A (lanes 2, 4, 6, 8, 10) or with the pIRES2-EGFP vector containing proPDGF-A and pIRES2-EGFP-V5 vector that expresses full-length Spn4A (Lanes 3, 5, 7, 9, 11). Note that Spn4A expression inhibited proPDGF-A processing mediated by PCs. Bars denote the corresponding percentages of pro- PDGF-A processing. Values are mean + SD (n = 3 per group). (C). Effect of Spn4A on human recombinant Furin was assessed by evaluating Furin (0.2x10-4 U) ability to digest the fluorogenic peptide pERTKR-MCA at the indicated time points. (D) Results shown in the bar graph represent Furin activity after 20 min of incubation. Results are representative of three experiments and data are mean + S.D performed in triplicate. **P < 0.001. *** P < 0.0001.
Figure 2: Inhibition of endogenous PCs activity in colon cancer cells by Spn4A.
(A-B), Using specific primers, the expression of Furin, PACE4, PC5A, PC5B and PC7, was assessed by Real time-PCR analysis on RNA extracted from the colon cancer cell line HT-29 (A) and CT-26 (B). All these PCs were present in HT-29 cells, whereas CT-26 cells lacked the expression of PC5 and PACE4. (C-F), Endogenous PCs activity was assessed by ability of indicated cells to process the PC substrates proPDGF-A and pro IGF- 1 receptor. proPDGF- A and proIGF-lR processing was analyzed by Western blotting using an anti-V5 (C and D) and anti-IGF-lR antibody (E and F), respectively. Note that in HT-29 and CT-26 cells expressing Spn4A, the processing of these PC substrates is inhibited. Bars denote the
corresponding percentages of pro-PDGF-A and pro-IGF-lR processing. Values are mean + SD (n = 3 per group). *P < 0.05; **P < 0.001. *** P < 0.0001.
Figure 3: Inhibition of anchorage-independent growth and proliferation of colon cancer cells by Spn4A. (A-B), Control (CTL) and tumor cells stably expressing Spn4A (Spn4A) were seeded in triplicate in six-well plates in soft agar as described under "Experimental Procedures". After 2 weeks, colonies >100 μιη in diameter were counted. Results are shown as means + S.D. of three experiments performed in triplicate. (C-D), Starved control or Spn4A-expressing cells were cultured for 6 days under standard conditions and cell proliferation was assessed using Cell Titer96 non-radioactive cell proliferation assay. Each value results are shown as means + S.D. of three experiments performed in triplicate. *P
< 0.05; **P < 0.001. *** P < 0.0001.
Figure 4: Inhibition of PCs by Spn4A alters tumor cells survival and chemosensitivity. (A) Percentages of apoptotic cells, under these conditions are indicated. (B), tumor cells were incubated for 6 h with H202 (5 mM) or staurosporin (1 μΜ) and caspase-3 activity was evaluated using the Caspase-3 Fluorescence assay Kit. Note that H202 and staurosporin caused an increased in the percentage of apoptotic cells that are associated with increased caspase-3 activity. This effect was exacerbated in cells-expressing Spn4A. Data shown represents the mean+SD from at least three independent experiments. (C-D), Data derived from analysis of total RNA analyzed by RT Profiler PCR array PAHS-502C for oncogenes and tumor suppressor genes that contains probes for BCL2 and TNF genes. For each well, the results are expressed relative to control cells transfected with empty vector which was assigned a value of 1. Values are shown as means + S.D. *P < 0.05; **P < 0.001. *** P < 0.0001.
Figure 5: Inhibition of tumor growth by Spn4A is associated with reduced PCs activity and induced apoptosis in developed tumors. (A-B), Control (CTL) and colon tumor cells stably expressing Spn4A (Spn4A) (lxlO6) were injected subcutaneously into 4- week-old nude mice. The animals were monitored for tumor formation every 2-3 days. Note the smaller size of tumors induced by tumor cells expressing Spn4A. Results are representative of three experiments. Values are mean + SD (n = 6 per group). *P < 0.05; **P
< 0.001. (C-D), Subcutaneously developed tumors were removed and lysed in lysis buffer. Protein extracts were incubated with the fluorogenic peptide PC substrate pERTKR-MCA.
Substrate cleavage was evaluated as raw fluorescence intensity (RFI) at indicated time periods. Results shown in the bar graph represent PCs activity after 2 hours of incubation. (E- F), Developed tumors derived from control and Spn4A-expressing tumor cells were analyzed for apoptosis using TumorTACS™ in situ apoptosis detection Kit (Trivigen). The number of intra-tumoral apoptotic cells was counted in ten different fields for each tumor. Percentages of apoptotic populations are shown. Data are presented as mean + SD. ***P < 0.0001. Original magnification x 360.
Figure 6: Effect of Spn4A on tumor cell migration and invasion. (A-B), Control tumor cells and cells expressing Spn4A were incubated for 24 hours in a microchemo taxis chamber alone (A) or pre-coated with collagen Γ (B), for cell migration and invasion, respectively. Three independents experiments were done (n = 3) and the results are represented as the percentage of migrating and invading cells. (C), Serum-free media derived from the indicated cells were collected and analyzed for gelatinase enzymatic activity. The corresponding percentage of MMP-2 cleavage calculated from the ratio of band intensities of MMP-2/(proMMP-2+MMP-2) is indicated. Note that Spn4A expression inhibited the activity of MMP-2 and reduced processing of pro-MMP-2. Values are mean + SD (n = 3 per group). **P < 0.001. *** P < 0.0001. EXAMPLE:
Material & Methods
Cell culture and transfection: The human HT-29 colon adenocarcinoma cell line, murine CT-26 colon adenocarcinoma cells and PC-deficient CHOFD11 cells were maintained in DMEM, RPMI and DMEM/F12 media, respectively, supplemented with 10% FCS, 100 units/ml penicillin, and 100 μg/ml streptomycin (Invitrogen). Prior cell transfection, Spn4A cDNA was cloned into SacII/EcoRI-digested pIRES2-EGFP-V5 (6, 7). Cells were stably transfected with empty pIRES2-EGFP-V5 vector (HT-29/CTL, CT-26/CTL and CHOFD11/CTL) or with pIRES2-EGFP-V5 vector containing full-length Spn4A cDNA (HT- 29/Spn4A, CT-26/Spn4A and CHOFDl l/Spn4A). To generate single-mixture cells expressing Spn4A, HT-29/Spn4A and CT-26/Spn4A cells were cultured in presence of Pseudomonas exotoxin A. This toxin induces cells death only after its cleavage by PCs (26). The expression of Spn4A-V5 was assessed by immunoblotting and cells were grown in their adequate media supplemented with 200 μg/ml G418. To evaluate the effect of Spn4A on PC substrates, processing by each of individual PC found in the secretary pathway, CHOFD11
cells were stably transfected with Furin, PACE4, PC5A, PC5B or PC7. In other experiments, CHOFD11, HT-29, CT-26, HT-29/Spn4A and CT-26/Spn4A cells were transiently transfected with empty pIRES2-EGFP-V5 vector or with the same vector containing full- length PDGF-A cDNA to study proPDGF-A processing. All transfections were carried out using Lipofectamine reagent (Invitrogen), as recommended by the manufacturer.
Real-time PCR: Total RNA was extracted using Trizol reagent (Invitrogen) according to the manufacturer's instructions. One μg of total RNA was subjected to cDNA synthesis using the high capacity cDNA reverse transcription kit (Applied Biosystems, Courtaboeuf, France). The relative quantification of specific mRNAs was performed by real-time PCR using the StepOnePlus™ Real-Time PCR System and PCR Master Mix (Applied Biosystems, Courtaboeuf, France) according to the manufacturer's instructions. Briefly, the reaction mixture (20 μΐ) contained 2 μΐ of cDNA resulting of 5-fold dilution of RT mixture product, 2 x TaqMan Universal PCR Master Mix, 0.3 μΜ of the probe and 0.9 μΜ of the forward and reverse primers. PCR reactions were performed at 94°C for 15 s and at 60°C for 1 min during 40 cycles. hsB2m and mHPTRTl transcriptions levels evaluated in each sample, were used as endogenous controls for human and mouse cells, respectively.
RT2Profiler PCR Array: The RT2 Profiler PCR Array was used as a method of combining real-time PCR performance with a simultaneous analysis of a panel of genes related to human oncogenes and tumor suppressor genes (Array PAHS-502C) and to human extracellular matrix and adhesion molecules (array PAHS-013C). Preparation and analysis of samples were carried out in accordance with the manufacturer's recommendations (SABiosciences).
Immunoblotting: Cells were lysed in Triton buffer (50 mmol/1 Tris-HCl (pH=7.4), 250 mmol/1 NaCl, 1 mmol/1 EDTA (pH=8), 0.1% Triton) containing protease inhibitors (Roche). Media or lysates were subjected to SDS-polyacrylamide gel electrophoresis and proteins were blotted onto nitrocellulose membranes. The primary antibodies used were anti- IGF-I receptor (Santa Cruz Biotechnology) and anti-V5, for detection of PDGF-A- V5 and Spn4A-V5 (Invitrogen), respectively. Primary antibodies were revealed by horseradish peroxidase-conjugated secondary antibodies (Amersham, Pharmacia Biotech) and Enhanced Chemiluminescence (ECL+Plus, Amersham Pharmacia Biotech) according to the manufacturers' instructions.
Measurement of proprotein convertases activity: The effect of Spn4A on PCs activity in cells and tissues was assessed by the evaluation of the enzymes ability to digest the universal PC substrate, the fluorogenic peptide pERTKR-MCA, as previously described (24). In brief, cancer cells, and tumor tissues extracts were incubated with pERTKR-MCA (100 μΜ) during the indicated time periods in the presence of 25 mM Tris (pH 7.4), 25 mM methyl-ethane-sulfonic acid, and 2.5 mM CaC12, at 37°C, and the fluorometric measurements were performed using a spectrofluorometer (Tecan Infinite® F200 PRO, Tecan Group Ltd. France).
Proliferation assay: Tumor cells were plated in triplicate on 96 wells plate (2xl07well) under serum free conditions for 24 h. The starved cells were then cultured during the indicated periods. Proliferation levels of cells was evaluated every two days using the Cell Titer96 non-radioactive cell proliferation assay kit (Promega) according to the manufacture's protocol.
Soft agar assay: To assay anchorage-independent colony formation, HT-29/CTL, CT- 26/CTL, HT-29/Spn4A or CT-26/Spn4A cells (4 x 103 cells/well) were suspended in complete medium containing 0.8% agar and seeded in triplicate in six-well plates onto a basal layer of complete medium containing 3% agar. Complete medium was added every three days. After two weeks of cell growth, colonies >100 μιη in diameter were counted using inverted microscopy and the results were represented as number of colonies formed, as previously described (7). Apoptosis assays and caspase-3 activity measurement: For apoptosis assays, tumor cells were grown to 70% confluency and cells were washed repeatedly to remove serum and then incubated for 6 h in media containing or not 5 mM Η202 or 1 μΜ staurosporin. Cells were washed and stained with Phycoerythrin (PE)-labeled annexin V (AN) and 7-amino- actinomycin D (7AAD) using the PE Annexin V Apoptosis Detection Kit I (BD Pharmingen™) as instructed by the manufacturer. Cells were analyzed by flow cytometry (FACS CamptoII). The populations AN-/7AAD-, AN+/7AAD-, AN-/7AAD+, and AN+/7AAD+ that correspond to live cells, early apoptotic cells, necrotic cells and late apoptotic cells, respectively, were enumerated. Caspase-3 activity was determined in control and Spn4A-expressing cells following incubation for 6 h in media containing or not 5 mM
Η202 or 1 μΜ staurosporin, using the Caspase-3 Fluorescence assay Kit, as described by the manufacture (Cayman Chemical Company).
Cell migration and invasion assays: Cell migration and invasion were determined using 24-well microchemotaxis chambers alone or precoated with 7.5 μg collagen type IV (Becton Dickinson Labware), respectively (7, 25). Control tumor cells or cells expressing Spn4A cDNA were resuspended in serum-free media and loaded into upper chamber of each well. Cells were incubated at 37°C for 24 h, after which, the filters were fixed and stained with Diff-Quik (Medion Diagnostic). Cell migration and invasion were quantified by determination of the number of cells that migrated directly through the membrane toward the medium containing 10% serum that was used as a chemoattractant. Cells detected in each well were counted and the results were represented as (number of migrated cells/number of total cells) x 100%. Gelatin zymography: Zymography assay was done as previously described (25), on serum-free conditioned media derived from control cells or cells stably transfected with Spn4A cDNA. SDS-PAGE gels were copolymerized with gelatin and samples were loaded onto gels without boiling. The gels were washed at room temperature in renaturing solution and in 10 mM of Tris-HCl (pH 8). For enzymatic reaction to take place, gels were incubated at 37°C in a solution of 50 mM of Tris-HCl (pH 8) containing 10 mM of CaC12. The gels were then stained in Coomassie blue R250 solution and regions without staining were indicative of gelatin lysis.
Tumorigenicity assay: Ethical approval for all animal studies was obtained from the Institutional Animal Care and Use Committee of the INSERM Institute in accordance with the National Advisory Committee for Laboratory Animal Research Guidelines licensed by the French Authority. Female 4- to 6-week-old nu/nu mice from Janvier Laboratories, housed in a pathogen-free facility, were used for all of the experiments. To assess the effect of PCs inhibition by Spn4A on tumor growth, lxlO6 HT-29, CT-26, HT-29/Spn4A, or CT-26/ Spn4A cells were injected subcutaneously into nude mice, tumor formation was monitored every 2-3 days, and mice were sacrificed in the end of the experiments. Tumor volume was calculated as previously described (7, 9).
Liver metastasis assay: Experimental liver metastases were generated by intrasplenic/portal injection of HT-29/CTL, HT-29/ Spn4A, CT-26/CTL or CT-26/Spn4A cells, as previously described (9). Because of high aggressiveness of CT-26 colon cancer cells, CT-26/CTL and CT-26/Spn4A cells-injected nude mice were sacrificed two weeks after the injection, whereas HT-29- and HT-29/Spn4A cells-injected mice were sacrificed four weeks later. Livers were removed and metastases were enumerated, without prior fixation.
Immunohistochemical analyses: Developed tumors derived from injection of HT- 29/CTL, HT-29/Spn4A, CT-26/CTL or CT-26/Spn4A cells, were analyzed for in vivo apoptosis using TumorTACS™ In Situ Apoptosis Detection Kit (Trivigen), as instructed by the manufacturer. The assay allows detection of chromosomal DNA fragments in the presence of deoxynucleotidyl transferase (TdT) that incorporated biotinylated nucleotides. The latter are visualised as dark brown precipitate through their biding to streptavidin-horseradish peroxydase and interaction with diaminobenzidine (DAB).
Statistics: Unless otherwise indicated, Student's t test was used to determine the statistical significance of differences between the means of several experiments. A probability value less than 0.05 was considered to be statistically significant. Results
Inactivation of cellular Furin, PACE4, PC5A, PC5B and PC7 by Spn4A: In contrast to the regulated secretory pathway enzymes PCI and PC2, to date, there is no naturally occurring inhibitor known that regulates the activity of PCs found in the constitutive secretory pathway (Furin, PACE4, PC5 and PC7). Interestingly, in Drosophila melanogaster that encodes two Furin homologs (12, 21), and one PC2-like enzyme (17), the use of in vitro enzymatic digestion assays revealed that recombinant Drosophila melanogaster Spn4A was able to efficiently inactivate Furin in vitro (19, 20). To evaluate the effect of Spn4A on enzymatic activity of all constitutive secretory pathway PCs in vivo, the inventors first assessed in cells stably expressing Spn4A, the ability of Furin, PACE4, PC5A, PC5B and PC7 to convert human PDGF-A (tagged with V5 epitope) into the mature form (6). Previously, proPDGF-A was reported to be processed by these PCs (6). Thereby, inhibition of proPDGF- A processing is a good indicator of lack of PCs activity. Using an anti-V5 antibody, immunoblotting analysis revealed that media derived from PC-deficient CHOFD11 cells (23) cotransfected with a vector encoding proPDGF-A and control vector, showed only one band
(-24 kDa) corresponding to the intact proPDGF-A precursor (Figure 1A, Lane 2). Transfection of CHOFD11 cells that stably express Furin, PC5A, PC5B, PC7 or PACE4 with vector encoding proPDGF-A demonstrated reduction of the precursor protein, and the appearance of a -16 kDa product, corresponding to mature form of PDGF-A (Figure 1A, Lanes 3-7). In contrast, when Spn4 was cotransfected together with pro-PDGF-A processing of pro-PDGF-A was inhibited (Figure IB, lanes 3, 5, 7, 9, 11). These data revealed that Spn4A is able to repress all PCs found in the constitutive secretory pathway when expressed in cells. Using an in vitro enzymatic digestion assay with the fluorogenic peptide pERTKR- MCA as substrate (24), they confirmed inhibition of PCs by Spn4A. The enzymatic activity of recombinant human Furin (0.2x10-4 U) (Figures 1C, ID) and of media derived from PC deficient CHOFD11 cells, stably transfected with a vector expressing Furin (FDl l/Furin), PACE4 (FD11/PACE4), PC5A (FD11/PC5A), PC5B (FD11/PC5B) or PC7 (FD11/PC7) was inhibited by recombinant Spn4A. Inhibition of endogenous PCs activity in colon cancer cells by Spn4A: To assess the possibility that the endogenous proteolytic activity of PCs is inhibited by Spn4A, they analysed in colon carcinoma cells HT-29 and CT-26 stably transfected with Spn4A ability to mediate maturation of PC substrates. HT29 cells express all convertases while CT-26 lacks PACE4 and PC5 (Figures 2A, 2B). They next analysed the processing of two PC substrates, PDGF-A (Figures 2C, 2D) and IGF-IR (Figures 2E, 2F). Both cell lines express IGF-IR while lacking PDGF-A expression. Immunoblotting of media derived from cells transfected with proPDGF-A cDNA revealed that proPDGF-A was significantly processed (Figures 2C lane 3, 2D lane 3). In contrast, when Spn4A is expressed, in addition, in these cells, the maturation of proPDGF-A was inhibited, as demonstrated by the accumulation of its unprocessed form (-24 kDa) and a reduction of its mature form (-16 kDa) (Figures 2C lane 4, 2D lanes 4). Similarly, using a specific IGF-IR antibody, they found that the processing of the endogenous pro IGF-IR β-subunit was also blocked in HT-29 and CT26 cells expressing Spn4A (Figure 2E-F), as evidenced by the accumulation of the precursor form (-250 kDa) and the reduction of the mature form (-105 kDa) of IGF-IR.
Inhibition of anchorage-independent growth and proliferation of colon cancer cells by Spn4A: They first investigated whether anchorage-independent growth of colon cancer cells was inhibited by Spn4A. Tumor cells expressing Spn4A exhibited more than 80% reduction in their anchorage-independent growth in comparison to control cells (Figures 3A,
3B). Furthermore, control cells but not Spn4 transfected cells grew well in presence of serum. This indicates that cell proliferation is inhibited by Spn4 (Figures. 3C, 3D).
Inhibition of PCs activity by Spn4A alters survival of colon cancer cells and chemosensitivity: The inventors then investigated the effect of Spn4 on apoptosis by flow cytometry in colon cancer cells HT-29 under normal conditions, and after treatment with H202 (5 mM) or staurosporin (1 μΜ). Using annexin V and 7AAD as markers, flow cytometric analysis, identified four cell populations: viable (negative for both dyes), early apoptotic (Annexin+/7AAD-), necrotic (Annexin-/7AAD+), and late apoptotic cells (Annexin+/7AAD+). The percentages of these populations under normal condition or after treatment with H202 or staurosporin, are shown in Figure 4A. As illustrated, incubation of control cells with H202 or staurosporin for 6h caused an increase in apoptotic cells which was associated with increased Caspase-3 activity (Figure 4B). This effect was exacerbated in tumor cells-expressing Spn4A, indicating a higher chemosensitivity. Similar results were obtained with the colon carcinoma cells CT-26. Real-time PCR array revealed a downregulated expression of the anti-apoptotic gene BCL2 in Spn4A-expressing tumor cells and an increased expression of the pro-apoptotic gene TNF (Figure 4D, Table 2).
Tumorigenicity of Spn4A-expressing colon cancer cells: To assess the effect of PCs inhibition by Spn4A on tumorigenicity of colon cancer cells, four groups of nude mice (n=6) were subcutaneously inoculated with HT-29/CTL, CT-26/CTL, HT-29/Spn4A or CT- 26/Spn4A cells. Tumors size was measured at various intervals, and data are summarized in Figures 5A, 5B. Animals injected with Spn4A-expressing tumor cells exhibited a delay in tumor appearance (day 7 for HT-29/Spn4A as compared with day 2 for HT-29/CTL and day 12 for CT-26/Spn4A, as compared with day 5 for CT-26/CTL). Tumor volume, measured at the end of the experiment, was significantly smaller for HT-29/Spn4A and CT-26/Spn4A- derived tumors than for control tumors. In agreement with these finding, the expression of several genes associated with tumor initiation and/or progression including FOXD3, MEN1, and S100a4 was upregulated in Spn4A-expressing cells. However, the expression of some other genes involved in tumorigenesis such as c-REL and JUNB was down regulated in these cells (Table 2).
Reduced PCs activity in colon cancer cells expressing Spn4A-derived tumors: To evaluate the effect of Spn4A on PCs activity in tumors derived from colon cancer cells,
control and Spn4A-expressing colon cancer cells were subcutaneously injected in mice. Tumors were removed 2-4 weeks later. PCs activity was analyzed by assessing the ability of tumor-derived protein extracts to cleave the PCs substrate pERTKR-MCA (24). The results in Figures 5C and 5D revealed that the extent of substrate cleavage by protein extracts of HT- 29/CTL- or CT-26/CTL-derived tumors was higher than that of HT-29/Spn4A- or CT- 26/Spn4A-derived tumors. A significant reduction of up to 50% of total PCs activity in tumor cells expressing Spn4A-derived tumors was observed.
Immunohistochemical analysis of tumor apoptosis: Apoptotic cells in control and Spn4A-expressing cells-derived tumors were analyzed using TumorTACS™ in situ apoptosis detection assay. A marked increase (>5-fold) in apoptotic cells in HT-29/Spn4A- and CT- 26/Spn4A cell-derived tumors was observed, as revealed by the increased dark brown precipitate within the cells (Figures 5E, 5F). Effect of PCs inhibition by Spn4A on migration and invasion of colon cancer cells: To evaluate whether inhibition of PCs in tumor cells can affect cell migration and invasion, cells were incubated for 24 hours in a microchemotaxis chamber alone (Figures 6A), or in a chamber pre-coated with collagen IV (Figure 6B). Expression of Spn4A in these cells clearly decreased their ability to migrate and to invade. Furthermore, gelatinase activity in 48h-conditionned serum free media revealed that media derived from control tumor cells presented high MMP-2 and MMP-9 activity. Expression of Spn4A in these cells resulted in decreased MMP-2 and MMP-9 activity. In Spn4A-expressing cells, processing of MMP-2 was also reduced, as revealed by the accumulation of pro-MMP-2 (Figure 6C). The inventors then analyzed mRNA expression of these MMPs and of their naturally occurring inhibitors TIMP-1 and TIMP-2, using real-time PCR. They found that while expression of MMP-2 and MMP-9 was reduced in Spn4A-expressing tumor cells, mRNA expression levels of TIMP-1 and TIMP-2 was significantly increased. Evaluation of MMPs/TIMPs ratios indicated that compared to control cells, these ratios were significantly decreased in Spn4A-expressing tumor cells. Similarly, since the uPA/uPAR/PAI- 1 system is also involved in cell invasion, they analyzed the effect of PCs inhibition by Spn4A on expression levels of these molecules by real-time PCR. In Spn4A-expressing cells, the level of uPA was reduced significantly; PAI-1 in contrast was increased, whereas the level of uPAR mRNA remained unchanged. Evaluation of uPA/PAI-1 ratios indicated that, compared to control cells, these ratios were significantly decreased in Spn4A-expressing tumor cells. Similarly, further analysis revealed
that the expression of other genes involved in extracellular matrix (ECM) degradation including MMP11, MMP12, MMP13, MMP15 and ADAMTS1 was reduced. MMP-8 expression in contrast was increased (Table 2), suggesting the contribution of this global effect of PCs inhibition by Spn4A on cell migration and invasion.
PCs blockade by Spn4A prevents experimental colorectal liver metastasis: To evaluate the effect of PCs inhibition by Spn4A on the ability of colon cancer cells to colonize the liver, HT-29/CTL, CT-26/CTL, HT-29/Spn4A, and CT-26/Spn4A cells, were injected in mice through the intrasplenic/portal route. At 2 weeks after injection of CT-26/CTL and CT- 26/Spn4A cells, and 4 weeks after injection of HT-29/CTL and HT-29/Spn4A cells, livers were removed and the number of metastases was determined. In mice inoculated with tumor cells, the number of hepatic metastases was reduced by up to 75% (P < 0.001) in HT- 29/Spn4A- and CT-26/Spn4A-injected mice relative to control animals (Mann- Whitney test, Table 1). Similarly, PCR Array analysis of ECM proteins and adhesion molecules, known to be involved in invasion and metastasis revealed their reduced expression in Spn4A-expressing cells. These include COL6A1, CTNND2, TNC, HAS1, ITGA4, ICAM1, NCAM1, VCAM1, CLEC3B and LAMA3 (Table 2).
Table 1: Metastasis incidence and prevalence and liver weight
„„,. »„ ^ ^ . . . , No metastases per liver ,. . . .
Cell line Metastasis incidence , liver weight (g)
(range) " fe
HT-29/CTL 100% 36-185 25 1
HT-29/Spn4A 25 % 2-3 1.6 03
CT-26/CTL 100% 54-535 3.7 12
CT-26/Spn4A 25 % 7-20 1.9 0.6
PC activity in colon cancer cells-derived hepatic metastases: To evaluate the effect of PCs activity in metastatic livers, tumor cells were injected in mice through the intrasplenic/portal route. After 2 or 4 weeks, the livers were removed and lysed. PCs activity was analyzed by assessing their ability to digest pERTKR-MCA (24). It was shown that PCs activity in HT-29/Spn4A- and CT-26/Spn4A-derived metastases were reduced as compared to HT-29/CTL- and CT-26/CTL-derived metastatic livers.
Table 2: List of genes regulated by Spn4A in the colon carcinoma cells.
Genes listed are those differentially regulated after expression of Spn4A in colon cancer cells HT-29 as compared to control HT-29 cell The cut-off limit in the analysis was set to two-fold for both induced (+) and repressed (-) genes. The Gene Bank accession numbers ar indicated.
Gene Gene banque Fold
Name Fonction Relevance in cancer Symbol reference regulation
ADAM metallopeptidase
Extramolecular Matrix Involved in cell invasion an ADAMTS1 NM_006988 with thrombospondin type -7.5
Proteins:ECM Protease tumor progression
1 motif, 1
Extramolecular Matrix Proteins:
Collagens and ECM
COL11A1 NM_080629 Collagen, type XI, alpha 1 +2.7 Involved in cell invasion structural constituants;
protumoral properties
Extramolecular Matrix Proteins:
Collagens and ECM Marker of tumor invasio
COL12A1 NM_004370 Collagen, type XII, alpha 1 +3.8
structural constituants; fronts
protumoral properties
Collagen, type XVI, alpha Extramolecular Matrix Proteins: Involved in cell invasiveness
COL16A1 NM_001856 ■1.8
1 Collagens and ECM
structural constituants;
protumoral properties
Catenin (cadherin- Extramolecular Matrix Proteins:
Involved in malignan associated protein), delta 2 Collagens and ECM
CTNND2 NM 001332 progression and promotes cel
(neural plakophilin-related structural constituants;
invasion
arm-repeat protein) protumoral properties
Extramolecular Matrix Proteins ; Implicated in cel
Extracellular matrix
ECM1 NM 004425 protumoral and prometastatic proliferation, angiogenesis an protein 1
properties differentiation
Facilitate tumor progressio
Extramolecular Matrix Proteins ;
by enhancing invasio
HAS1 NM_001523 Hyaluronan synthase 1 protumoral and prometastatic -13
growth, angiogenesis an propertises
metastasis
Intercellular adhesion Cell adhesion molecules:
ICAM1 NM 000201 -4.8 Prometastatic effect
molecule 1 protumoral propertises
Implicated in cell adhesio
Cell-Matrix adhesion molecules:
ITGA1 NM_181501 Integrin, alpha 1 Have a high metastati protumoral properties
abilities
Integrin, alpha 4 (antigen
Cell-Matrix adhesion molecules: Involved in cell spreading an ITGA4 NM_000885 CD49D, -9.4
protumoral properties migration
alpha 4 subunit of VLA-4
receptor)
Extramolecular Matrix Proteins:
Play role in tumo
LAMA3 NM_000227 Laminin, alpha 3 basement membrane constituent -13.5
progression and metastasis protumoral properties
Associated with tumo
Matrix metallopeptidase Extramolecular Matrix Proteins:
MMP11 NM 005940 progression and poo
11 (stromelysin 3) ECM Protease
prognosis
no Overexpression correlate wit
Matrix metallopeptidase expression presence of venou
Extramolecular Matrix Proteins:
MMP12 NM_002426 12 in Spn4A infiltration, high serum AF
ECM Protease
(macrophage elastase) expressing level, early tumor recurrenc cells and poor overall survival
Frequently present and activ
Matrix metallopeptidase
Extramolecular Matrix Proteins: in colorectal cancer. It MMP13 NM_002427 13 -9.2
ECM Protease activity is associated wit
(collagenase 3)
poorer survival
Matrix metallopeptidase
Extramolecular Matrix Proteins: Seems to be up-regulate MMP15 NM_002428 15 -3.4
ECM Protease during tumorogenesis
(membrane-inserted)
Loss-of-function enhances th progression of melanom
Matrix metallopeptidase 8 Extramolecular Matrix Proteins:
MMP8 NM. .002424 +11.1 Expression in breast cance
(neutrophil collagenase) ECM Protease
associated with diminishe risk of lymph node metastasis
Has anti apoptotic propertie
Neural cell adhesion Cell adhesion molecules: mediate cell-cell cohesio
NCAM1 NM. .000615 -10.1
molecule 1 protumoral properties enabling the formation of cel aggregates
Secreted protein, acidic, Cell-Matrix adhesion molecules: Inhibits cell proliferatio
SPARC NM. .003118 -2.1
cysteine-rich (osteonectin) anti-tumoral properties spreading and migration
TIMP metallopeptidase Extramolecular Matrix Proteins: Inhibits tumor growth and cel
TIMP3 NM. .000362 -12.8
inhibitor 3 ECM Protease inhibitor invasion
C-type lectin domain Extramolecular Matrix Proteins: Promote invasion, have
CLEC3B NM. .003278 -117.3
family 3, member B protumoral properties potential role in cell survival
Promote cancer cell growt
Cell adhesion molecules:
TNC NM. .002160 Tenascin C -5.8 migration, adhesion, invasio protumoral properties
and metastasis
Vascular cell adhesion Cell adhesion molecules: Implicated in cell adhesio
VCAM1 NM. .001078 -20.2
molecule 1 protumoral properties and metastasis
Tumor suppressor, Anti-apoptotic early expresse
BCL2 NM_000633 B-cell CLL/lymphoma 2 -3.9
anti apoptotic properties in colon carcinoma
Hypermethylation i
Both oncogene
ESR1 NM_000125 Estrogen receptor 1 colorectal cancer associate and tumor suppressor properties
with risk of recurrence
Down regule migration an invasion; Required for cel
FOXD3 NM_012183 Forkhead box D3 Tumor suppressor +6.5
differentiation; Negative cel cycle regulator
Increase cell proliferation Induce morphological an
JUNB NM_002229 Jun B proto-oncogene Oncogene anchorage-independant cel growth consistent with transformation like phenotype
Multiple endocrine Tumor suppressor. Mutatio
MEN1 NM 000244 Tumor suppressor +2.4
neoplasia I leads to cell proliferation
V-myb myeloblastosis Blok differentiation. Regulato
Noth oncogene
NM_005375 viral oncogene homolog of stem and progenitor cells i and tumor suppressor propertises
(avian) born marrow
V-rel reticuloendotheliosis Overexpression contribute t
REL NM 002908 Oncogene
viral oncogene homolog inhibition of growth arrest an
(avian) apoptosis of tumor cells
Interact with p53 tumo
SI 00 calcium binding
S100A4 NM 002961 Tumor suppressor suppressor protein and induc protein A4
apoptosis
Expression is down regulate
Both oncogene and tumor suppressor in high stage colorecta
TNF NM 000594 Tumor necrosis factor +9.88
properties, anti apoptotic properties tumors. Stimulate cel death/apoptosis
REFERENCES:
Throughout this application, various references describe the state of the art to which this invention pertains. The disclosures of these references are hereby incorporated by reference into the present disclosure.
1. Thomas G. Furin at the cutting edge: from protein traffic to embryogenesis and disease. Nat Rev Mol Cell Biol 2002; 3:753-766.
2. Couture F, D'Anjou F, Day R. On the cutting edge of proprotein convertase pharmacology: from molecular concepts to clinical applications. Biomol Concepts 2011; 2:421-438.
3. Siegfried G, Basak A, Cromlish JA, Benjannet S, Marcinkiewicz J, Chretien M, Seidah NG, et al. The secretory proprotein convertases furin, PC5, and PC7 activate VEGF-C to induce tumorigenesis. / Clin Invest 2003;111: 1723-1732.
4. Harris NC, Paavonen K, Davydova N, Roufail S, Sato T, Zhang YF, Karnezis T, et al.
Proteolytic processing of vascular endothelial growth factor-D is essential for its capacity to promote the growth and spread of cancer. FASEB J 2011; 25:2615-2625.
5. Siegfried G, Basak A, Prichett-Pejic W, Scamuffa N, Ma L, Benjannet S, Veinot JP, et al. Regulation of the stepwise proteolytic cleavage and secretion of PDGF-B by the proprotein convertases. Oncogene 2005; 24:6925-6935.
6. Siegfried G, Khatib AM, Benjannet S, Chretien M, Seidah NG.The proteolytic processing of pro-platelet-derived growth factor-A at RRKR(86) by members of the proprotein convertase family is functionally correlated to platelet-derived growth factor- A-induced functions and tumorigenicity. Cancer Res 2003; 63: 1458-1463.
7. Khatib AM, Siegfried G, Prat A, Luis J, Chretien M, Metrakos P, Seidah NG.
Inhibition of proprotein convertases is associated with loss of growth and tumorigenicity of HT-29 human colon carcinoma cells: importance of insulin-like growth factor- 1 (IGF-1) receptor processing in IGF- 1 -mediated functions. / Biol Chem 2001; 276:30686-30693.
8. Golubkov VS, Chernov AV, Strongin AY. Intradomain cleavage of inhibitory prodomain is essential to protumorigenic function of membrane type-1 matrix metalloproteinase (MT1-MMP) in vivo. J Biol Chem 2011; 286:34215-34223.
Scamuffa N, Siegfried G, Bontemps Y, Ma L, Basak A, Cherel G, Calvo F, et al. Selective inhibition of proprotein convertases represses the metastatic potential of human colorectal tumor cells. J Clin Invest 2008; 118:352-363.
Tzimas GN, Chevet E, Jenna S, Nguyen DT, Khatib AM, Marcus V, Zhang Y, et al. Abnormal expression and processing of the proprotein convertases PCI and PC2 in human colorectal liver metastases. BMC Cancer 2005; 5: 149.
Khatib AM, Siegfried G, Chretien M, Metrakos P, Seidah N.G. Proprotein convertases in tumor progression and malignancy: novel targets in cancer therapy. Am J Pathol 2002; 160: 1921-1935.
Rockwell, N.C., Krysan, D.J., Komiyama, T., and Fuller, R.S. 2002. Precursor processing by kex2/furin proteases. Chem Rev 102:4525-4548.
Mbikay M, Seidah N.G, Chretien M. Neuroendocrine secretory protein 7B2: structure, expression and functions. Biochem J 2001; 357:329-342.
Fortenberry Y, Hwang JR, Apletalina EV, Lindberg I. Functional characterization of ProSAAS: similarities and differences with 7B2. J Biol Chem 2002; 277:5175-5186. Cornwall GA, Cameron A, Lindberg I, Hardy DM, Cormier N, Hsia N. The cystatin- related epididymal spermatogenic protein inhibits the serine protease prohormone convertase 2. Endocrinology 2003; 144:901-908.
Gettins PG. Serpin structure, mechanism, and function. Chem Rev 2002; 102:4751- 4804.
van Gent D, Sharp P, Morgan K, Kalsheker N.. Serpins: structure, function and molecular evolution. Int J Biochem Cell Biol 2003; 35: 1536-1547.
Kruger O, Ladewig J, Koster K, Ragg H. Widespread occurrence of serpin genes with multiple reactive centre-containing exon cassettes in insects and nematodes. Gene 2002; 293:97-105.
Oley M, Letzel MC, Ragg H. Inhibition of furin by serpin Spn4A from Drosophila melanogaster. FEBS Lett 2004; 577: 165-169.
Richer MJ, Keays CA, Waterhouse J, Minhas J, Hashimoto C, Jean F. The Spn4 gene of Drosophila encodes a potent furin-directed secretory pathway serpin. Proc Natl Acad Sci U S A 2004; 101: 10560-10565.
De Bie I, Savaria D, Roebroek AJ, Day R, Lazure C, Van de Ven WJ, Seidah N.G. Processing specificity and biosynthesis of the Drosophila melanogaster convertases dfurinl, dfurinl-CRR, dfurinl-X, and dfurin2. J Biol Chem 1995; 270: 1020-1028.
Siekhaus DE, Fuller RS. A role for amontillado, the Drosophila homolog of the neuropeptide precursor processing protease PC2, in triggering hatching behavior. J Neurosci 1999; 19:6942-6954.
Gordon VM, Rehemtulla A, Leppla SH. A role for PACE4 in the proteolytic activation of anthrax toxin protective antigen. Infect Immun 1997; 65:3370-3375. Lalou C, Scamuffa N, Mourah S, Plassa F, Podgorniak MP, Soufir N, Dumaz N, et al. Inhibition of the proprotein convertases represses the invasiveness of human primary melanoma cells with altered p53, CDKN2A and N-Ras genes. PLoS One 2010; 5:e9992.
Lapierre M, Siegfried G, Scamuffa N, Bontemps Y, Calvo F, Seidah NG, Khatib AM. Opposing function of the proprotein convertases furin and PACE4 on breast cancer cells' malignant phenotypes: role of tissue inhibitors of metalloproteinase- 1. Cancer Res 2007; 67:9030-9034.
Gu M, Gordon VM, Fitzgerald DJ, Leppla SH.. Furin regulates both the activation of Pseudomonas exotoxin A and the Quantity of the toxin receptor expressed on target cells. Infect Immun 1996; 64:524-527.
Briining M, Lummer M, Bentele C, Smolenaars MM, Rodenburg KW, Ragg H; The Spn4 gene from Drosophila melanogaster is a multipurpose defence tool directed against proteases from three different peptidase families; Biochem J. 2007 Jan 1;401(1):325-31
Claims
1. An isolated Serpin Spn4A polypeptide or a biologically active derivative thereof for use in the prevention or treatment of cancer and related metastases.
2. A nucleic acid encoding a polypeptide according to claim 1 for use in the prevention or treatment of cancer and related metastases.
3. An expression vector comprising a nucleic acid according to claim 2 for use in the prevention or treatment of cancer and related metastases.
4. A host cell comprising an expression vector according to claim 3 for use in the prevention or treatment of cancer and associated metastases.
5. The polypeptide or the derivative thereof, the nucleic acid, the expression vector or the host cell for use according to any one claims 1 to 4, wherein the cancer is a colorectal cancer.
6. The polypeptide or the derivative thereof, the nucleic acid, the expression vector or the host cell for use according to claim 5, wherein the related metastases are liver colorectal metastases.
7. A pharmaceutical composition comprising an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof, or a nucleic acid encoding thereof, or an expression vector comprising thereof, or a host cell comprising thereof according to any one claims 1 to 6; and a pharmaceutically acceptable carrier.
8. The pharmaceutical composition according to claim 7, further comprising an additional chemotherapeutic agent.
9. A kit-of-part composition comprising an isolated Serpin Spn4A polypeptide or a biologically active derivative thereof, or a nucleic acid encoding thereof, or an expression vector comprising thereof, or a host cell comprising thereof according to any one claims 1 to 6; and an additional therapeutic agent.
10. The pharmaceutical composition according to claim 8 or the kit-of-part composition according to claim 9, wherein said additional therapeutic agent a chemotherapeutic compound.
11. The pharmaceutical composition or the kit-of-part composition according to claim 10, wherein said additional chemotherapeutic compound is a tyrosine kinase inhibitor.
12. The pharmaceutical composition according to any one claims 7 to 11 for use in the prevention or treatment of cancer and related metastases.
13. The kit-of-part composition according to any one claims 7 to 11 for simultaneous, separate or sequential use in the prevention or treatment of cancer and metastases.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12306580 | 2012-12-13 | ||
| EP12306580.7 | 2012-12-13 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014090948A1 true WO2014090948A1 (en) | 2014-06-19 |
Family
ID=47709785
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2013/076389 Ceased WO2014090948A1 (en) | 2012-12-13 | 2013-12-12 | Serpin spn4a and biologically active derivatives thereof for use in the treatment of cancer |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2014090948A1 (en) |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001018057A2 (en) * | 1999-09-07 | 2001-03-15 | Cambridge University Technical Services Limited | Serine protease inhibitors (spn43a) from drosophila |
| US20040171826A1 (en) | 2003-02-20 | 2004-09-02 | Stephen Hamilton | Endomannosidases in the modification of glycoproteins in eukaryotes |
| US20040230042A1 (en) | 2000-06-28 | 2004-11-18 | Stephen Hamilton | Expression of class 2 mannosidase and class III mannosidase in lower eukaryotic cells |
| US20050208617A1 (en) | 2000-06-28 | 2005-09-22 | Piotr Bobrowicz | N-acetylglucosamintransferase III expression in lower eukaryotes |
| US7029872B2 (en) | 2000-06-28 | 2006-04-18 | Glycofi, Inc | Methods for producing modified glycoproteins |
| US20060286637A1 (en) | 2000-06-28 | 2006-12-21 | Glycofi, Inc. | Production of sialylated N-glycans in lower eukaryotes |
| US7449308B2 (en) | 2000-06-28 | 2008-11-11 | Glycofi, Inc. | Combinatorial DNA library for producing modified N-glycans in lower eukaryotes |
-
2013
- 2013-12-12 WO PCT/EP2013/076389 patent/WO2014090948A1/en not_active Ceased
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001018057A2 (en) * | 1999-09-07 | 2001-03-15 | Cambridge University Technical Services Limited | Serine protease inhibitors (spn43a) from drosophila |
| US20040230042A1 (en) | 2000-06-28 | 2004-11-18 | Stephen Hamilton | Expression of class 2 mannosidase and class III mannosidase in lower eukaryotic cells |
| US20050208617A1 (en) | 2000-06-28 | 2005-09-22 | Piotr Bobrowicz | N-acetylglucosamintransferase III expression in lower eukaryotes |
| US7029872B2 (en) | 2000-06-28 | 2006-04-18 | Glycofi, Inc | Methods for producing modified glycoproteins |
| US20060286637A1 (en) | 2000-06-28 | 2006-12-21 | Glycofi, Inc. | Production of sialylated N-glycans in lower eukaryotes |
| US7449308B2 (en) | 2000-06-28 | 2008-11-11 | Glycofi, Inc. | Combinatorial DNA library for producing modified N-glycans in lower eukaryotes |
| US20040171826A1 (en) | 2003-02-20 | 2004-09-02 | Stephen Hamilton | Endomannosidases in the modification of glycoproteins in eukaryotes |
Non-Patent Citations (35)
| Title |
|---|
| "Remington's Pharmaceutical Sciences", pages: 1035 - 1038,157 |
| BRUNING M; LUMMER M; BENTELE C; SMOLENAARS MM; RODENBURG KW; RAGG H: "The Spn4 gene from Drosophila melanogaster is a multipurpose defence tool directed against proteases from three different peptidase families", BIOCHEM J., vol. 401, no. 1, 1 January 2007 (2007-01-01), pages 325 - 31 |
| CORNWALL GA; CAMERON A; LINDBERG I; HARDY DM; CORMIER N; HSIA N: "The cystatin- related epididymal spermatogenic protein inhibits the serine protease prohormone convertase 2", ENDOCRINOLOGY, vol. 144, 2003, pages 901 - 908 |
| COUTURE F; D'ANJOU F; DAY R.: "On the cutting edge of proprotein convertase pharmacology: from molecular concepts to clinical applications", BIOMOL CONCEPTS, vol. 2, 2011, pages 421 - 438 |
| DE BIE I; SAVARIA D; ROEBROEK AJ; DAY R; LAZURE C; VAN DE VEN WJ; SEIDAH N.G: "Processing specificity and biosynthesis of the Drosophila melanogaster convertases dfurin1, dfurinl-CRR, dfurinl-X, and dfurin2", J BIOL CHEM, vol. 270, 1995, pages 1020 - 1028 |
| FORTENBERRY Y; HWANG JR; APLETALINA EV; LINDBERG I: "Functional characterization of ProSAAS: similarities and differences with 7B2", J BIOL CHEM, vol. 277, 2002, pages 5175 - 5186 |
| GETTINS PG: "Serpin structure, mechanism, and function", CHEM REV, vol. 102, 2002, pages 4751 - 4804 |
| GOLUBKOV VS; CHERNOV AV; STRONGIN AY: "Intradomain cleavage of inhibitory prodomain is essential to protumorigenic function of membrane type-1 matrix metalloproteinase (MT1-MMP) in vivo", JBIOL CHEM, vol. 286, 2011, pages 34215 - 34223 |
| GORDON VM; REHEMTULLA A; LEPPLA SH: "A role for PACE4 in the proteolytic activation of anthrax toxin protective antigen", INFECT IMMUN, vol. 65, 1997, pages 3370 - 3375 |
| GU M; GORDON VM; FITZGERALD DJ; LEPPLA SH: "Furin regulates both the activation of Pseudomonas exotoxin A and the Quantity of the toxin receptor expressed on target cells", INFECT IMMUN, vol. 64, 1996, pages 524 - 527 |
| HARRIS NC; PAAVONEN K; DAVYDOVA N; ROUFAIL S; SATO T; ZHANG YF; KARNEZIS T ET AL.: "Proteolytic processing of vascular endothelial growth factor-D is essential for its capacity to promote the growth and spread of cancer", FASEB J, vol. 25, 2011, pages 2615 - 2625 |
| JEAN FRANCOIS ET AL: "Drosophila Spn4A, the first natural furin-directed secretory pathway serine protease inhibitor (SERPIN)", FASEB JOURNAL, FED. OF AMERICAN SOC. FOR EXPERIMENTAL BIOLOGY, US, vol. 18, no. 8, Suppl. S, 1 May 2004 (2004-05-01), pages C179, XP009169374, ISSN: 0892-6638 * |
| KHATIB AM; SIEGFRIED G; CHRETIEN M; METRAKOS P; SEIDAH N.G.: "Proprotein convertases in tumor progression and malignancy: novel targets in cancer therapy", AM J PATHOL, vol. 160, 2002, pages 1921 - 1935 |
| KHATIB AM; SIEGFRIED G; PRAT A; LUIS J; CHRETIEN M; METRAKOS P; SEIDAH NG: "Inhibition of proprotein convertases is associated with loss of growth and tumorigenicity of HT-29 human colon carcinoma cells: importance of insulin-like growth factor-1 (IGF-1) receptor processing in IGF-1-mediated functions", J BIOL CHEM, vol. 276, 2001, pages 30686 - 30693 |
| KRIEGLER: "A Laboratory Manual", 1990, W.H. FREEMAN C.O. |
| KRUGER O; LADEWIG J; KOSTER K; RAGG H: "Widespread occurrence of serpin genes with multiple reactive centre-containing exon cassettes in insects and nematodes", GENE, vol. 293, 2002, pages 97 - 105 |
| LALOU C; SCAMUFFA N; MOURAH S; PLASSA F; PODGORNIAK MP; SOUFIR N; DUMAZ N ET AL.: "Inhibition of the proprotein convertases represses the invasiveness of human primary melanoma cells with altered p53, CDKN2A and N-Ras genes", PLOS ONE, vol. 5, 2010, pages E9992 |
| LAPIERRE M; SIEGFRIED G; SCAMUFFA N; BONTEMPS Y; CALVO F; SEIDAH NG; KHATIB AM: "Opposing function of the proprotein convertases furin and PACE4 on breast cancer cells' malignant phenotypes: role of tissue inhibitors of metalloproteinase-1", CANCER RES, vol. 67, 2007, pages 9030 - 9034 |
| MBIKAY M; SEIDAH N.G; CHRETIEN M: "Neuroendocrine secretory protein 7B2: structure, expression and functions", BIOCHEM J, vol. 357, 2001, pages 329 - 342 |
| MURRY: "Methods in Molecular Biology", vol. 7, 1991, HUMANA PRESS, INC. |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 - 453 |
| OLEY M ET AL: "Inhibition of furin by serpin Spn4A from Drosophila melanogaster", FEBS LETTERS, ELSEVIER, AMSTERDAM, NL, vol. 577, no. 1-2, 5 November 2004 (2004-11-05), pages 165 - 169, XP004622746, ISSN: 0014-5793, DOI: 10.1016/J.FEBSLET.2004.10.003 * |
| OLEY M; LETZEL MC; RAGG H: "Inhibition of furin by serpin Spn4A from Drosophila melanogaster", FEBS LETT, vol. 577, 2004, pages 165 - 169 |
| RICHER MARTIN J ET AL: "The Spn4 gene of Drosophila encodes a potent furin-directed secretory pathway serpin", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 101, no. 29, 20 July 2004 (2004-07-20), pages 10560 - 10565, XP009169373, ISSN: 0027-8424, [retrieved on 20040709], DOI: 10.1073/PNAS.0401406101 * |
| RICHER MJ; KEAYS CA; WATERHOUSE J; MINHAS J; HASHIMOTO C; JEAN F: "The Spn4 gene of Drosophila encodes a potent furin-directed secretory pathway serpin", PROC NATL ACAD SCI U S A, vol. 101, 2004, pages 10560 - 10565 |
| ROCKWELL, N.C.; KRYSAN, D.J.; KOMIYAMA, T.; FULLER, R.S.: "Precursor processing by kex2/furin proteases", CHEM REV, vol. 102, 2002, pages 4525 - 4548 |
| SANBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCAMUFFA N; SIEGFRIED G; BONTEMPS Y; MA L; BASAK A; CHEREL G; CALVO F ET AL.: "Selective inhibition of proprotein convertases represses the metastatic potential of human colorectal tumor cells", J CLIN INVEST, vol. 118, 2008, pages 352 - 363 |
| SIEGFRIED G; BASAK A; CROMLISH JA; BENJANNET S; MARCINKIEWICZ J; CHRETIEN M; SEIDAH NG ET AL.: "The secretory proprotein convertases furin, PC5, and PC7 activate VEGF-C to induce tumorigenesis", J CLIN INVEST, vol. 111, 2003, pages 1723 - 1732 |
| SIEGFRIED G; BASAK A; PRICHETT-PEJIC W; SCAMUFFA N; MA L; BENJANNET S; VEINOT JP ET AL.: "Regulation of the stepwise proteolytic cleavage and secretion of PDGF-B by the proprotein convertases", ONCOGENE, vol. 24, 2005, pages 6925 - 6935 |
| SIEGFRIED G; KHATIB AM; BENJANNET S; CHRETIEN M; SEIDAH NG: "The proteolytic processing of pro-platelet-derived growth factor-A at RRKR(86) by members of the proprotein convertase family is functionally correlated to platelet-derived growth factor-A-induced functions and tumorigenicity", CANCER RES, vol. 63, 2003, pages 1458 - 1463 |
| SIEKHAUS DE; FULLER RS: "A role for amontillado, the Drosophila homolog of the neuropeptide precursor processing protease PC2, in triggering hatching behavior", J NEUROSCI, vol. 19, 1999, pages 6942 - 6954 |
| THOMAS G.: "Furin at the cutting edge: from protein traffic to embryogenesis and disease", NAT REV MOL CELL BIOL, vol. 3, 2002, pages 753 - 766 |
| TZIMAS GN; CHEVET E; JENNA S; NGUYEN DT; KHATIB AM; MARCUS V; ZHANG Y ET AL.: "Abnormal expression and processing of the proprotein convertases PC1 and PC2 in human colorectal liver metastases", BMC CANCER, vol. 5, 2005, pages 149 |
| VAN GENT D; SHARP P; MORGAN K, KALSHEKER N: "Serpins: structure, function and molecular evolution", INT J BIOCHEM CELL BIOL, vol. 35, 2003, pages 1536 - 1547 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9447166B2 (en) | Compositions and methods for the intracellular disruption of VEGF and VEGFR-2 by intraceptors | |
| Ghavami et al. | Apoptosis and cancer: mutations within caspase genes | |
| JP6348448B2 (en) | ALK1 receptor and ligand antagonist and use thereof | |
| RU2556822C2 (en) | Axl signalling inhibition in antimetastatic therapy | |
| Papenfuss et al. | Death receptors as targets for anti‐cancer therapy | |
| US20130202594A1 (en) | ALK1 Antagonists and Their Uses in Treating Renal Cell Carcinoma | |
| AU2020224137B2 (en) | CD80 extracellular domain-Fc fusion proteins for treating PD-L1 negative tumors | |
| HK1257234A1 (en) | Medicine for treating coronary atherosclerosis as well as complications of coronary atherosclerosis and use of the medicine | |
| Thorpe et al. | Proteasome inhibition blocks caspase‐8 degradation and sensitizes prostate cancer cells to death receptor‐mediated apoptosis | |
| Gregory-Ksander et al. | The FasLane to ocular pathology—metalloproteinase cleavage of membrane-bound FasL determines FasL function | |
| Griffith et al. | Sensitization of human bladder tumor cells to TNF-related apoptosis-inducing ligand (TRAIL)-induced apoptosis with a small molecule IAP antagonist | |
| WO2014090948A1 (en) | Serpin spn4a and biologically active derivatives thereof for use in the treatment of cancer | |
| HK1257586A1 (en) | Medicine for preventing and treating kidney fibrosis and use of the medicine | |
| KR20230147138A (en) | ADAMTS13 variants | |
| CN101384277A (en) | Novel anticancer cathepsin preparation and cancer combination therapy anticancer agent using same | |
| JPWO2006112451A1 (en) | Anticancer agent containing protein C inhibitor | |
| Guicciardi et al. | The death receptor pathway | |
| HK40062334A (en) | Cd80 extracellular domain-fc fusion proteins for treating pd-l1 negative tumors | |
| HK40062334B (en) | Cd80 extracellular domain-fc fusion proteins for treating pd-l1 negative tumors | |
| WO2013028740A1 (en) | Compositions and methods for treating inflammation | |
| HK40010872A (en) | Method and drug for preventing or treating osteoarthritis | |
| Nevařil | Characterization and regulation of TRAIL-induced apoptosis of tumor cells | |
| HK1257235A1 (en) | Medicine for treating atherosclerosis and complications of atherosclerosis and use of the medicine | |
| HK1240130A1 (en) | Method for preventing or treating radiative and chemical damage | |
| WO2003060075A2 (en) | USE OF SOLUBLE TYPE II TGF-β RECEPTOR TO SUPPRESS PANCREATIC CANCER GROWTH AND METASTASIS |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13803015 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 13803015 Country of ref document: EP Kind code of ref document: A1 |