WO2014085523A1 - Methods of modulating follicle stimulating hormone activity - Google Patents

Methods of modulating follicle stimulating hormone activity Download PDF

Info

Publication number
WO2014085523A1
WO2014085523A1 PCT/US2013/072131 US2013072131W WO2014085523A1 WO 2014085523 A1 WO2014085523 A1 WO 2014085523A1 US 2013072131 W US2013072131 W US 2013072131W WO 2014085523 A1 WO2014085523 A1 WO 2014085523A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
pathway
subject
inhibitor
fsh
Prior art date
Application number
PCT/US2013/072131
Other languages
French (fr)
Inventor
John STRASSWIMMER
Steven ORY
Original Assignee
Strasspharma Llc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Strasspharma Llc filed Critical Strasspharma Llc
Priority to US14/648,300 priority Critical patent/US9844541B2/en
Priority to EP13858461.0A priority patent/EP2925363A4/en
Priority to AU2013352256A priority patent/AU2013352256A1/en
Priority to CA2893133A priority patent/CA2893133A1/en
Publication of WO2014085523A1 publication Critical patent/WO2014085523A1/en

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/4418Non condensed pyridines; Hydrogenated derivatives thereof having a carbocyclic group directly attached to the heterocyclic ring, e.g. cyproheptadine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • A61P15/08Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • A61P15/16Masculine contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • A61P15/18Feminine contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/689Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to pregnancy or the gonads
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/36Gynecology or obstetrics

Definitions

  • the gonadotropin Follicle Stimulating Hormone is released from the anterior pituitary under the influence of gonadotropin-releasing hormone and estrogens, and from the placenta during pregnancy.
  • FSH acts on the ovaries promoting development of follicles and is the major hormone regulating secretion of estrogens.
  • FSH is responsible for the integrity of the seminiferous tubules and acts on Sertoli cells to support gametogenesis.
  • the actions of the FSH hormone are mediated by a specific plasma membrane receptor that is a member of the large family of G-protein coupled receptors. Modulation of FSH signaling can affect reproductive functions in both females and males.
  • the present disclosure encompasses the discovery that the Hedgehog (Hh) pathway is involved in signaling through the FSH receptor. Specifically, the present disclosure encompasses the discovery that inhibition of the Hh pathway inhibits FSH binding to the FSH receptor.
  • the present disclosure therefore provides hedgehog pathway modulators (e.g., activators or inhibitors) for use in medicine, and specifically in treatment and/or prevention (e.g., delay of onset) of certain disorders, e.g., gynecologic disorders.
  • Combination therapy refers to those situations in which two or more different pharmaceutical agents are administered in overlapping regimens so that the subject is simultaneously exposed to both agents.
  • two or more different agents may be administered simultaneously or separately.
  • This administration in combination can include simultaneous administration of the two or more agents in the same dosage form, simultaneous administration in separate dosage forms, and separate administration. That is, two or more agents can be formulated together in the same dosage form and administered simultaneously. Alternatively, two or more agents can be simultaneously administered, wherein the agents are present in separate formulations.
  • a first agent can be administered just followed by one or more additional agents. In the separate administration protocol, two or more agents may be administered a few minutes apart, or a few hours apart, or a few days apart.
  • Characteristic portion As used herein, the term a "characteristic portion" of a substance, in the broadest sense, is one that shares some degree of sequence or structural identity with respect to the whole substance. In certain embodiments, a characteristic portion shares at least one functional characteristic with the intact substance.
  • a "characteristic portion" of a polypeptide or protein is one that contains a continuous stretch of amino acids, or a collection of continuous stretches of amino acids, that together are characteristic of a polypeptide or protein. In some embodiments, each such continuous stretch generally contains at least 2, 5, 10, 15, 20, 50, or more amino acids.
  • a characteristic portion of a substance is one that, in addition to the sequence and/or structural identity specified above, shares at least one functional characteristic with the relevant intact substance.
  • a characteristic portion may be biologically active.
  • Characteristic sequence is a sequence that is found in all members of a family of polypeptides or nucleic acids, and therefore can be used by those of ordinary skill in the art to define members of the family.
  • Hedgehog pathway As used herein, the terms "hedgehog pathway” and
  • Hh pathway activation transmits an Hh signal in cells and/or tissues. In some embodiments, Hh pathway activation results in changes in degree of downstream gene expression level and/or phenotypic changes.
  • Hedgehog pathway activator refers to any substance that activates or increases the activity of an Hh signaling pathway.
  • an Hh pathway activator is an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, an Smo polypeptide, a Gli polypeptide, and/or a nucleic acid encoding such polypeptide.
  • an Hh pathway activator is a substance that activates the transcription, binding, activity or stability of an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, an Smo polypeptide, a Gli polypeptide, and/or a nucleic acid encoding such polypeptide.
  • an Hh pathway activator is a substance that inhibits the transcription, binding, activity or stability of a Ptc polypeptide, an Hhip polypeptide, an SuFu polypeptide, and/or a nucleic acid encoding such polypeptide.
  • Hedgehog pathway inhibitor refers to any substance that inhibits or reduces the activity of an Hh signaling pathway.
  • an Hh pathway inhibitor is a Ptc polypeptide, an Hhip polypeptide, an SuFu polypeptide, and/or a nucleic acid encoding such polypeptide.
  • an Hh pathway inhibitor is a substance that inhibits the transcription, binding, activity or stability of an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, an Smo polypeptide, a Gli polypeptide, and/or a nucleic acid encoding such polypeptide.
  • an Hh pathway inhibitor is a substance that activates the transcription, binding, activity or stability of a Ptc polypeptide, an Hhip polypeptide, an SuFu polypeptide, and/or a nucleic acid encoding such polypeptide.
  • Hedgehog (Hh) pathway modulator refers to any substance that modulates activity of an Hh pathway.
  • a hedgehog pathway modulator modulates the transcription, binding, activity and/or stability of an Hh pathway polypeptide and/or a nucleic acid encoding such polypeptide.
  • an Hh pathway modulator is an Hh pathway activator.
  • an Hh pathway modulator is an Hh pathway inhibitor.
  • Hedgehog pathway polypeptide refers to a polypeptide whose amino acid sequence includes at least one characteristic sequence of and/or shows at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% identity with a protein involved in a Hh pathway (e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu polypeptide).
  • a protein involved in a Hh pathway e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu polypeptide.
  • an Hh pathway polypeptide shares at least one characteristic sequence of and/or shows the specified degree of overall sequence identity with one of the Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu sequences set forth herein (each of which may be considered a "reference" Hh pathway polypeptide).
  • an Hh pathway polypeptide as described herein shares at least one biological activity with a reference Hh pathway polypeptide as set forth herein. In some such embodiments, the shared biological activity relates to Hh signaling pathway activation or inhibition.
  • Hedgehog (Hh) polypeptide As used herein, the term "hedgehog polypeptide"
  • Hh polypeptide refers to a polypeptide whose amino acid sequence includes at least one characteristic sequence of and/or shows at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% identity with a hedgehog polypeptide (e.g., Desert (Dhh), Sonic (Shh) or Indian (Ihh)).
  • a hedgehog polypeptide e.g., Desert (Dhh), Sonic (Shh) or Indian (Ihh)
  • Hh sequences from flies, vertebrates, and mammals are known in the art, such as those described herein; in some embodiments, a Hh polypeptide shares at least one characteristic sequence of and/or shows the specified degree of overall sequence identity with one of the Dhh, Shh, or Ihh sequences set forth herein (each of which may be considered a "reference" Hh polypeptide). In some embodiments, an Hh polypeptide as described herein shares at least one biological activity with a reference Hh polypeptide as set forth herein. In some such embodiments, the shared biological activity relates to Hh signaling pathway activation.
  • homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or R A molecules) and/or between polypeptide molecules.
  • polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
  • polymeric molecules are considered to be "homologous" to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar.
  • Identity refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two nucleic acid sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
  • the length of a sequence aligned for comparison purposes is at least 30%>, at least 40%>, at least 50%>, at least 60%>, at least 70%>, at least 80%>, at least 90%), at least 95%, or substantially 100%) of the length of the reference sequence.
  • the nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4: 11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two nucleotide sequences can,
  • Polypeptide As used herein, a "polypeptide", generally speaking, is a string of at least two amino acids attached to one another by a peptide bond. In some embodiments, a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond. Those of ordinary skill in the art will appreciate that polypeptides sometimes include "non-natural" amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain, optionally.
  • Protein refers to a polypeptide (i.e., a string of at least two amino acids linked to one another by peptide bonds). Proteins may include moieties other than amino acids (e.g., may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a
  • protein can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof. Those of ordinary skill will appreciate that a protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means.
  • Polypeptides may contain L-amino acids, D- amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc.
  • proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof.
  • the term "peptide” is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
  • Reference sample may include, but is not limited to, any or all of the following: a cell or cells, a portion of tissue, blood, serum, ascites, urine, saliva, and other body fluids, secretions, or excretions.
  • sample also includes any material derived by processing such a sample. Derived samples may include nucleotide molecules or polypeptides extracted from the sample or obtained by subjecting the sample to techniques such as amplification or reverse transcription of mR A, etc.
  • Subject refers to any organism upon which embodiments of the invention may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.).
  • animals e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.
  • a disease, disorder, or condition e.g., a gynecologic condition
  • a disease, disorder, or condition e.g., a gynecologic condition
  • an individual who is suffering from gynecologic condition has a gynecologic condition, but does not display any symptoms of a gynecologic condition and/or has not been diagnosed with a gynecologic condition.
  • Susceptible to An individual who is "susceptible to" a disease, disorder, or condition (e.g., a gynecologic condition) is at risk for developing the disease, disorder, or condition.
  • a disease, disorder, or condition e.g., a gynecologic condition
  • an individual who is susceptible to a disease, disorder, or condition does not display any symptoms of the disease, disorder, or condition.
  • an individual who is susceptible to a disease, disorder, or condition has not been diagnosed with the disease, disorder, and/or condition.
  • an individual who is susceptible to a disease, disorder, or condition is an individual who displays conditions associated with development of the disease, disorder, or condition.
  • a risk of developing a disease, disorder, and/or condition is a population-based risk.
  • Symptoms are reduced: According to the present invention, "symptoms are reduced” when one or more symptoms of a particular disease, disorder or condition is reduced in magnitude (e.g., intensity, severity, etc.) or frequency. For purposes of clarity, a delay in the onset of a particular symptom is considered one form of reducing the frequency of that symptom. It is not intended that the present invention be limited only to cases where the symptoms are eliminated. The present invention specifically contemplates treatment such that one or more symptoms is/are reduced (and the condition of the subject is thereby "improved"), albeit not completely eliminated.
  • Target cell or target tissue refers to any cell, tissue, or organism that is affected by a condition described herein and to be treated, or any cell, tissue, or organism in which a protein involved in a condition described herein is expressed.
  • target cells, target tissues, or target organisms include those cells, tissues, or organisms in which there is a detectable or abnormally high amount of FSH signaling (e.g., comparable to that observed in subjects suffering from or susceptible to a gynecologic condition).
  • target cells, target tissues, or target organisms include those cells, tissues or organisms that display a disease-associated pathology, symptom, or feature.
  • therapeutic regimen refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of and/or reduce incidence of one or more symptoms or features of a particular disease, disorder, and/or condition. It may include a treatment or series of treatments designed to achieve a particular effect, e.g., reduction or elimination of a detrimental condition or disease such as a gynecologic disorder.
  • the treatment may include administration of one or more compounds either simultaneously, sequentially or at different times, for the same or different amounts of time.
  • the treatment may include exposure to radiation, chemotherapeutic agents, hormone therapy, or surgery.
  • a “treatment regimen” may include genetic methods such as gene therapy, gene ablation or other methods known to reduce expression of a particular gene or translation of a gene-derived mRNA.
  • Therapeutic agent refers to any agent that, when administered to a subject, has a therapeutic effect and/or elicits a desired biological and/or pharmacological effect.
  • therapeutically effective amount refers to an amount of an agent (e.g., a hedgehog modulator) that confers a therapeutic effect on the treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment.
  • the therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect).
  • the "therapeutically effective amount” refers to an amount of a therapeutic agent or composition effective to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease.
  • a therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses.
  • a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents.
  • the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the subject; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
  • treatment refers to any administration of a substance (e.g., provided compositions) that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms, features, and/or causes of a particular disease, disorder, and/or condition (e.g., a gynecologic disorder).
  • a substance e.g., provided compositions
  • Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
  • treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
  • treatment may be of a subject who has been diagnosed as suffering from the relevant disease, disorder, and/or condition.
  • treatment may be of a subject known to have one or more susceptibility factors that are statistically correlated with increased risk of development of the relevant disease, disorder, and/or condition.
  • the present disclosure encompasses the surprising discovery that FSH activity can be modulated using hedgehog pathway modulators (e.g., hedgehog pathway activators or inhibitors). Accordingly, the disclosure provides, among other things, use of the hedgehog pathway as a diagnostic, prognostic and/or therapeutic target for modulating FSH activity, e.g., for gynecologic disorders.
  • hedgehog pathway modulators e.g., hedgehog pathway activators or inhibitors.
  • hedgehog (Hh) pathway is well known (see, e.g., U.S. Pat. No. 6,277,566 Bl;
  • the vertebrate family of Hh genes includes three members that exist in mammals, known as Desert (Dhh), Sonic (Shh) and Indian (Ihh) Hedgehogs, all of which encode secreted proteins. These various Hh proteins consist of a signal peptide, a highly conserved N-terminal region, and a more divergent C-terminal domain. Biochemical studies have shown that autoproteolytic cleavage of the Hh precursor protein proceeds through an internal thioester intermediate which subsequently is cleaved in a nucleophilic substitution. It is likely that the nucleophile is a small lipophilic molecule that becomes covalently bound to the C-terminal end of the N-peptide, tethering it to the cell surface.
  • N-terminal Hh peptide As a result of the tethering, a high local concentration of N-terminal Hh peptide is generated on the surface of Hh producing cells. It is this N-terminal peptide which is both necessary and sufficient for short- and long-range Hh signaling activities.
  • Smoothened (Smo) encodes a transmembrane protein of 1024 amino acids, which acts as a transducer of the Hh signal.
  • Smo protein has 7 hydrophobic membrane-spanning domains, an extracellular amino-terminal region, and an intracellular carboxy-terminal region.
  • Smo bears some similarity to G protein-coupled receptors and is most homologous to the Frizzled (Fz) family of serpentine proteins (Alcedo et al., Cell 86: 221 (1996)).
  • Hh binding to Ptc alters the interaction of Smo and Ptc, reversing the repression of Smo by Ptc (see Zhu et al., Genes Dev. 17: 1240 (2003)).
  • Gli proteins known in vertebrates are Glil, Gli2 and Gli3 (Kinzler et al, Science 236:70-73 (1987); Bai et al, Dev. Cell 6: 103-115 (2004); Motoyama et al, Dev. Biol. 259: 150-161 (2003)). Gli proteins share high homology in the zinc finger domain, but have limited homology outside of this region (Matise et al.,
  • Glil is a transcriptional activator, while Gli2 and Gli3 are bifunctional and can function as a transcriptional activator or, when proteolytically processed, a transcriptional repressor (Dai et al., J. Biol. Chem. 12:8143-8152 (1999)).
  • a transcriptional repressor Dai et al., J. Biol. Chem. 12:8143-8152 (1999)
  • Gli is prevented from entering the nucleus through interactions with cytoplasmic proteins, including Fused (Fu) and Suppressor of fused (Sufu) (see Methot et al, Dev. 127:4001- 4010 (2000)); Chen et al, Mol. Cell. Biol.
  • Hh pathway proteins include Gasl, Cdo, and Boc, which promote Hh pathway signaling (see Allen et al, Dev. Cell 20:775-787 (2011)), and Hhip, which inhibits Hh pathway signaling (see Beachy et al, Genes Dev. 24:2001-2012 (2010)).
  • Hh pathway is best studied in cell proliferation and differentiation during embryo development. While the Hh pathway is thought to be inactive in most normal adult tissues, it appears to be active in two areas: hair follicles and taste papillae of the tongue. In addition, Hh pathway polypeptides are identified in some areas of adult gastrointestinal tract, but their function is unclear. There is no published evidence implicating the Hh pathway in the reproductive tract physiology or reproduction.
  • Hh pathway activation has been well documented in the pathogenesis of Basal Cell Carcinoma (BCC). This activation can occur at several levels in the signaling pathway, most commonly in patched (Ptc) or smoothened (Smo) gene products.
  • BCC Basal Cell Carcinoma
  • Ptc patched
  • Smo smoothened
  • Patients with BCC are usually treated with surgical, topical, or radiotherapy techniques.
  • Vismodegib (ErivedgeTM, Genentech, Inc., San Francisco, CA) is approved for this situation. Vismodegib binds to Smo, preventing further downstream signaling and preventing cell division.
  • Major side effects include dysgeusia, alopecia, leg cramping, and gastrointestinal disturbances.
  • Methods and compositions described herein include, for example, modulators of a hedgehog signaling pathway (e.g., modulators of one or more Hh pathway polypeptides).
  • Nucleic acids encoding Hh pathway polypeptides are known. According to the present disclosure, modulators of such nucleic acids (and polypeptides) are useful in the treatment of gynecologic disorders.
  • such nucleic acids have or include nucleotide sequences as set forth in SEQ ID NO: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27, or characteristic sequence elements thereof or therein.
  • useful nucleic acids show at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82% ,81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% overall sequence identity with one or more of SEQ ID NO: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27.
  • useful nucleic acids include at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more contiguous residues found in SEQ ID NO: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27.
  • useful nucleic acids are generated in vitro; in some embodiments, useful nucleic acids are generated in vivo. In some embodiments, useful nucleic acids are generated using genetic engineering techniques (e.g., for production and/or mutagenesis of a reference sequence). To give but a few examples, in some
  • nucleic acid variants are generated using techniques such as site directed mutagenesis, random chemical mutagenesis, Exonuclease III deletion procedures, and standard cloning techniques.
  • useful nucleic acids are generating using chemical synthesis and/or modification procedures.
  • nucleic acids that are "variants" with respect to a reference nucleic acid are well known in the art. These include, for example, procedures in which nucleic acid sequences obtained from natural isolates are modified to generate nucleic acids that encode polypeptides having characteristics that enhance their value in industrial or laboratory applications. In such some embodiments of such procedures, a large number of variant sequences having one or more nucleotide differences with respect to the sequence obtained from the natural isolate are generated and characterized. Typically, these nucleotide differences result in amino acid changes with respect to the polypeptides encoded by the nucleic acids from the natural isolates.
  • a reference nucleic acid e.g., a naturally-occurring or other reference nucleic acid
  • variants can be created using error prone PCR (see, e.g., Leung et al, Technique 1 : 11-15, 1989; and Caldwell et al, PCR Methods Applic. 2:28-33, 1992).
  • error prone PCR PCR is performed under conditions where the copying fidelity of the DNA polymerase is low, such that a high rate of point mutations is obtained along the entire length of the PCR product.
  • nucleic acids to be mutagenized are mixed with PCR primers, reaction buffer, MgCl 2 , MnCl 2 , Taq polymerase, and an appropriate concentration of dNTPs for achieving a high rate of point mutation along the entire length of the PCR product.
  • the reaction can be performed using 20 fmoles of nucleic acid to be mutagenized, 30 pmole of each PCR primer, a reaction buffer comprising 50 mM KC1, 10 mM Tris HC1 (pH 8.3), and 0.01% gelatin, 7 mM MgCl 2 , 0.5 mM MnCl 2 , 5 units of Taq polymerase, 0.2 mM dGTP, 0.2 mM dATP, 1 mM dCTP, and 1 mM dTTP.
  • PCR can be performed for 30 cycles of 94 °C for 1 min, 45 °C for 1 min, and 72 °C for 1 min. However, it will be appreciated that these parameters can be varied as appropriate.
  • the mutagenized nucleic acids are then cloned into an appropriate vector and the activities of the polypeptides encoded by the mutagenized nucleic acids are evaluated.
  • Variants can also be created using oligonucleotide directed mutagenesis to generate site-specific mutations in any cloned DNA of interest.
  • Oligonucleotide mutagenesis is described in, for example, Reidhaar-Olson et al, Science 241 :53-57 (1988). Briefly, in such procedures a plurality of double stranded oligonucleotides bearing one or more mutations to be introduced into the cloned DNA are synthesized and inserted into the cloned DNA to be mutagenized. Clones containing the mutagenized DNA are recovered, and the activities of the polypeptides they encode are assessed.
  • Assembly PCR involves the assembly of a PCR product from a mixture of small DNA fragments. A large number of different PCR reactions occur in parallel in the same vial, with the products of one reaction priming the products of another reaction. Assembly PCR is described in, for example, U.S. Pat. No. 5,965,408.
  • Still another method of generating variants is sexual PCR mutagenesis. In sexual PCR mutagenesis, forced homologous recombination occurs between DNA molecules of different, but highly related, DNA sequence in vitro as a result of random fragmentation of the DNA molecule based on sequence homology. This is followed by fixation of the crossover by primer extension in a PCR reaction.
  • Sexual PCR mutagenesis is described in, for example, Stemmer, Proc. Natl. Acad. Sci., USA 91 : 10747-10751 (1994).
  • Variants can also be created by in vivo mutagenesis.
  • random mutations in a nucleic acid sequence are generated by propagating the sequence in a bacterial strain, such as an E. coli strain, which carries mutations in one or more of the DNA repair pathways.
  • a bacterial strain such as an E. coli strain
  • Such "mutator" strains have a higher random mutation rate than that of a wild- type strain. Propagating a DNA sequence in one of these strains will generate random mutations within the DNA.
  • Mutator strains suitable for use for in vivo mutagenesis are described in, for example, PCT Publication No. WO 91/16427.
  • Variants can also be generated using cassette mutagenesis.
  • cassette mutagenesis In cassette mutagenesis.
  • mutagenesis a small region of a double stranded DNA molecule is replaced with a synthetic oligonucleotide "cassette" that differs from the native sequence.
  • the oligonucleotide often contains a completely and/or partially randomized native sequence.
  • Recursive ensemble mutagenesis can also be used to generate variants.
  • Recursive ensemble mutagenesis is an algorithm for protein engineering (i.e., protein mutagenesis) developed to produce diverse populations of phenotypically related mutants whose members differ in amino acid sequence. This method uses a feedback mechanism to control successive rounds of combinatorial cassette mutagenesis.
  • Recursive ensemble mutagenesis is described in, for example, Arkin et al, Proc. Natl. Acad. Sci., USA 89:7811-7815 (1992).
  • variants are created using exponential ensemble mutagenesis.
  • Exponential ensemble mutagenesis is a process for generating combinatorial libraries with a high percentage of unique and functional mutants, wherein small groups of residues are randomized in parallel to identify, at each altered position, amino acids which lead to functional proteins.
  • Exponential ensemble mutagenesis is described in, for example,
  • variants are created using shuffling procedures wherein portions of a plurality of nucleic acids that encode distinct polypeptides are fused together to create chimeric nucleic acid sequences that encode chimeric polypeptides as described in, for example, U.S. Pat. Nos.
  • nucleic acids for use in accordance with the present disclosure comprise naturally-occurring nucleotide residues.
  • nucleic acids for use in accordance with the present disclosure include one or more nucleotide "analogs".
  • a nucleotide analog is a nucleotide (i.e., an entity that is incorporated into a nucleic acid polymer without significantly disrupting the structure and/or function of that polymer) whose chemical structure differs from that of reference naturally-occurring ribonucleic or deoxyribonucleic acid residues adenine, guanine, cytosine, thymine, and uracil.
  • a nucleotide analog differs from its reference nucleotide at the base moiety, sugar moiety, and/or phosphate backbone.
  • a nucleotide analog contributes to one or more altered features in a nucleic acid polymer into which it is incorporated as compared with a comparable nucleic acid polymer containing its reference nucleotide rather than the analog.
  • such analog-containing polymer shows improved , stability, hybridization, and/or solubility.
  • base moiety alterations found in nucleotide analogs include deoxyuridine for deoxythymidine and 5-methyl-2'-deoxycytidine or 5-bromo-2'- deoxycytidine for deoxycytidine.
  • sugar moiety alterations found in nucleotide analogs include modification of the 2' hydroxyl of the ribose sugar to form 2'-0- methyl or 2'-0-allyl sugars.
  • deoxyribose phosphate backbone alterations found in nucleotide analogs include morpholino nucleic acids, in which each base moiety is linked to a six-membered, morpholino ring, or peptide nucleic acids, in which the
  • nucleotide analogs may have a phosphorothioate or phosphorodithioate backbone, a phosphoroamidite, or an alkyl phosphotriester backbone.
  • a Hh pathway polynucleotide or variant for use in accordance with the present disclosure includes alterations to codon(s) to optimize for expression in a particular host cell.
  • a Hh pathway polynucleotide or variant can include one or more altered codons as described in, e.g., Grosjean et al, Gene 18: 199-209 (1982).
  • methods and compositions described utilize a modulator of one or more Hh pathway polypeptides (e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu polypeptides).
  • Hh pathway polypeptides e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu polypeptides.
  • such polypeptides are useful in the treatment of gynecologic disorders.
  • such polypeptides useful in the practice of the present disclosure have or include amino acid sequences as set forth in SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, or 28, or characteristic sequence elements thereof or therein.
  • useful polypeptides show at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82% ,81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% overall sequence identity with one or more of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, or 28.
  • useful polypeptides include at least about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, or 150 or more contiguous amino acid residues found in SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, or 28.
  • a useful polypeptide differs from its reference polypeptide
  • the difference is a conservative or nonconservative substitution of one or more amino acid residues.
  • Conservative substitutions are those that substitute a given amino acid in a polypeptide by another amino acid of similar characteristics. Typical conservative substitutions are the following replacements: replacement of an aliphatic amino acid, such as alanine, valine, leucine, and isoleucine, with another aliphatic amino acid; replacement of a serine with a threonine or vice versa; replacement of an acidic residue, such as aspartic acid and glutamic acid, with another acidic residue; replacement of a residue bearing an amide group, such as asparagine and glutamine, with another residue bearing an amide group; exchange of a basic residue, such as lysine and arginine, with another basic residue; and replacement of an aromatic residue, such as phenylalanine and tyrosine, with another aromatic residue.
  • an aliphatic amino acid such as alanine, valine, leucine, and isoleucine
  • useful Hh pathway polypeptides include a substituent group on one or more amino acid residues. Still other useful polypeptides are associated with (e.g., fused, linked, or coupled to) another moiety (e.g., a peptide or molecule). For example, useful Hh pathway polypeptides can be fused, linked, or coupled to an amino acid sequence (e.g., a leader sequence, a secretory sequence, a proprotein sequence, a second polypeptide, or a sequence that facilitates purification, enrichment, or stabilization of the polypeptide).
  • a polypeptide includes a targeting agent, e.g., a targeting agent described herein.
  • Hh pathway polypeptides can be recombinantly produced by utilizing a host cell system engineered to express a nucleic acid encoding a Hh pathway polypeptide (e.g., a nucleic acid described herein).
  • a Hh pathway polypeptide can be produced by activating an endogenous gene (e.g., a nucleic acid encoding a Hh pathway polypeptide present endogenous ly in a cell).
  • a Hh pathway polypeptide can be partially or fully prepared by chemical synthesis.
  • a Hh pathway polypeptide can be purified from natural sources.
  • Hh pathway polypeptide is recombinantly produced
  • any expression system can be used.
  • Known expression systems include, without limitation, for example, egg, baculovirus, plant, yeast, or mammalian cells.
  • a Hh pathway polypeptide suitable for use in methods described herein are produced in mammalian cells.
  • mammalian cells that can be used include BALB/c mouse myeloma line (NSO/1, ECACC No: 85110503); human retinoblasts (PER.C6, CruCell, Leiden, The Netherlands); monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al, J.
  • human fibrosarcoma cell line e.g., HT1080
  • baby hamster kidney cells BHK, ATCC CCL 10
  • Chinese hamster ovary cells +/-DHFR CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216, 1980
  • mouse Sertoli cells TM4, Mather, Biol.
  • monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al, Annals N.Y. Acad. Sci., 383:44-68, 1982); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
  • Hh pathway activators useful in the methods described herein include an Hh, Cdo,
  • Boc, Gasl, Smo, or Gli polypeptide a nucleic acid encoding an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide; any substance that increases level and/or activity of an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide; any substance that increases level and/or activity of a nucleic acid encoding a Cdo, Boc, Gasl, Smo, or Gli polypeptide; any substance that decreases level or activity of a Ptc, Hhip, and/or SuFu polypeptide; and/or any substance that decreases level or activity of a nucleic acid encoding a Ptc, Hhip, and/or SuFu polypeptide.
  • an Hh pathway activator is or includes an Hh, Cdo, Boc,
  • an Hh pathway activator is or includes a Ptc, Hhip, and/or SuFu polypeptide having an inhibiting mutation (e.g., a difference of one or more amino acid residues relative to a reference Ptc, Hhip, and/or SuFu polypeptide and having a lower level of expression and/or activity as compared to such reference polypeptide).
  • Hedgehog Pathway Inhibitors e.g., a difference of one or more amino acid residues relative to a reference Hh, Cdo, Boc, Gasl, Smo, and/or Gli polypeptide and a higher level of expression and/or activity as compared to such reference polypeptide.
  • an Hh pathway activator is or includes a Ptc, Hhip, and/or SuFu polypeptide having an inhibiting mutation (e.g., a difference of one or more amino acid residues relative to a reference Ptc, Hhip, and/or SuFu polypeptide and having a lower level of expression and/or activity
  • Hh pathway inhibitors useful in the methods described herein include a Ptc, Hhip, or SuFu polypeptide; a nucleic acid encoding a Ptc, Hhip, or SuFu polypeptide; any substance that increases level and/or activity of a Ptc, Hhip, and/or SuFu polypeptide, any substance that increases level and/or activity of a nucleic acid encoding a Ptc, Hhip, and/or SuFu polypeptide; any substance that decreases level or activity of an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide; and/or any substance the decreases level of activity of a nucleic acid encoding an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide.
  • an Hh pathway inhibitor is or includes a Ptc, Hhip, and/or
  • an Hh pathway inhibitor is or includes an Hh, Cdo, Boc, Gasl , Smo, and/or Gli polypeptide having an inhibiting mutation (e.g., a difference of one or more amino acid residues relative to a reference Hh, Cdo, Boc, Gasl, Smo, and/or Gli polypeptide and a lower level of expression and/or activity as compared to such reference polypeptide).
  • Exemplary, nonlimiting Hh pathway inhibitors useful in the methods described herein include steroidal alkaloids, such as cyclopamine, and derivatives thereof; other small molecules such as SANT-1, SANT-2, SANT-3, and SANT-4 (Chen et al, Proc. Natl. Acad. Sci., USA 99: 14071-14076 (2002)); arsenical agents such as arsenic trioxide (ATO); steroidal alkaloids and derivatives thereof, including, for example, cyclopamine and jervine (see, e.g., Chen et al, Genes Devel. 16:2743-2748 (2002); and U.S. Pat. No. 6,432,970); and triparanol (see, e.g., U.S. Pat. No. 6,432,970).
  • steroidal alkaloids such as cyclopamine, and derivatives thereof
  • other small molecules such as SANT-1, SANT-2, SANT-3, and SANT-4 (Chen
  • Additional nonlimiting Hh pathway inhibitors include those described and disclosed in U.S. Pat. No. 7,230,004, U.S. Publ. Nos. 2008/0293754; 2008/0287420;
  • Hh pathway inhibitors useful in the methods described herein include vismodegib (ErivedgeTM, Genentech, Inc., San Francisco, CA); BMS- 833923 (also known as XL139; Siu et al, J. Clin. Oncol. 28: 15s suppl abstr 2501 (2010), and National Institute of Health Clinical Trial Identifier No. NCT006701891); LDE-225 (Pan et al, ACS Med. Chem. Lett. 1 : 130-134 (2010)); LEQ-506 (National Institute of Health Clinical Trial Identifier No. NCT01106508); PF-04449913 (National Institute of Health Clinical Trial Identifier No. NCT00953758); and l-piperazinyl-4-arylphthalazines or analogues thereof (Lucas et al, Bioorg. Med. Chem. Lett. 20:3618-22 (2010)).
  • vismodegib EdedgeTM, Genentech, Inc., San Francisco, CA
  • Hh pathway modulators described herein can be used to modulate FSH binding to the FSH receptor, e.g., to treat or prevent disorders or conditions mediated by or involving FSH signaling.
  • Follicle stimulating hormone is a gonadotrophin hormone synthesized and secreted by gonadotropes in the anterior pituitary gland.
  • FSH is a heterodimeric glycoprotein hormone consisting of two noncovalently linked subunits designated alpha and beta.
  • the subunits are 92 amino acids and 111 amino acids, respectively, and each has two N- linked glycosylation sites.
  • FSH has several biological functions in mammals. In males, for example, FSH, in combination with testosterone is required for the initiation and maintenance of qualitatively and quantitatively normal spermatogenesis. In females, FSH is necessary for selection and growth of ovarian follicles and for the production of estrogens from androgen substrate.
  • FSH is part of the hypothalamo-pituitary-ovarian axis, a classic endocrine closed loop biofeedback system, in which the gonadotrophins (e.g., follicle-stimulating hormone (FSH) and luteinizing hormone (LH)) stimulate ovarian hormone production (e.g., estrogen), which in turn exerts a negative feedback effect on the gonadotrophins, to maintain a regulated system.
  • Gonadotrophins include hormones produced by the pituitary gland that regulate the gonads, such as follicle-stimulating hormone (FSH) and luteinizing hormone (LH). In women, gonadotropins regulate the development of the ovaries and eggs.
  • gonadotropins regulate the development of testes.
  • the secretion of FSH is stimulated by gonadotropin releasing hormone (GnRH).
  • GnRH gonadotropin releasing hormone
  • FSH stimulates the growth and recruitment of immature ovarian follicles in the ovary.
  • one dominant follicle begins to develop more rapidly.
  • the outer theca and inner granulosa cells of the follicle multiply and under the influence of FSH and LH begin to secrete estrogen and the peptide hormone inhibin.
  • the increase in serum estrogen levels inhibits GnRH, which in turn leads to a decrease in FSH production.
  • inhibin inhibits the synthesis and secretion of FSH.
  • Estrogens and inhibin secreted by the ovary inhibit the activity of FSH leading to regression of the smaller, less mature follicles.
  • the estrogen levels peak just before midcycle, and the granulosa cells begin to secrete progesterone. These relative changes in estrogen and progesterone stimulate a brief surge in FSH and LH release that precedes and initiates ovulation.
  • FSH acts by binding to specific FSH receptors localized primarily in Sertoli cells of the testis and in granulosa cells of the ovary.
  • the FSH receptor belongs to the family of G protein-coupled receptors (GPCR), which are complex membrane-associated receptors characterized by seven-transmembrane spanning domains. The intracellular portion of the FSH receptor is coupled to the G protein Gs and adenylyl cyclase.
  • GPCR G protein-coupled receptors
  • an Hh pathway modulator described herein is provided to a female subject to modulate one or more ovarian function.
  • an Hh pathway activator is provided to a female subject lacking or having a low level of ovarian function (e.g., relative to a control female subject).
  • an Hh pathway activator can be provided to a female subject to increase level of fertility relative to a control subject.
  • an Hh pathway activator is provided to a female subject to activate and/or increase ovarian function (e.g., a female subject in need thereof).
  • an Hh pathway inhibitor is provided to a female subject having a normal or high level of ovarian function (e.g., relative to a control female subject).
  • an Hh pathway inhibitor can be provided to a female subject to decrease level of fertility relative to a control subject.
  • an Hh pathway inhibitor is provided to a female subject to reduce and/or inhibit ovarian function (e.g., a female subject in need thereof).
  • ovarian function refers to ovulation and/or reproductive functions.
  • ovarian function is measured by determining levels of one or more hormones involved in ovulation and/or reproduction (e.g., determining levels of one or more hormones in blood serum).
  • hormones include, without limitation, progesterone, estrogen, FSH, anti mullerian hormone (AMH), inhibin (e.g., inhibin B), and/or androgen (e.g., testosterone).
  • hormones include, without limitation, progesterone, estrogen, FSH, anti mullerian hormone (AMH), inhibin (e.g., inhibin B), and/or androgen (e.g., testosterone).
  • ovarian function can be measured by determining preservation of oocytes and/or by ultrasound imaging of the ovary.
  • an Hh pathway inhibitor described herein is provided to a subject, e.g., a subject suffering from or susceptible to a gynecologic condition.
  • Gynecologic conditions that can be treated using an Hh pathway modulator described herein include, e.g., endometriosis and leiomyomata.
  • an Hh pathway inhibitor is provided to one or more of target cells or tissues of the ovaries.
  • target cells or tissues include those cells or tissues that display a disease-associated pathology, symptom, or feature.
  • one or more symptoms of endometriosis and/or leiomyomata are reduced in a subject following provision of (e.g., administration of) an Hh pathway inhibitor described herein.
  • provision of (e.g., administration of) an Hh pathway inhibitor can decrease size of diseased tissue and/or lesions (e.g., measured by imaging, e.g., ultrasound, laparoscopy, or MRI), decrease pain (e.g., cyclical dysmennorhea and/or static pain), reduce bleeding, reduce impingement on adjacent organs (e.g., bowel, bladder, or ureter), result in regularizations of menses, and/or improve infertility.
  • an Hh pathway activator described herein is provided to a subject, e.g., a subject having a defective level of FSH signaling (e.g., a level of FSH signaling that is lower than a control subject), e.g., in one or more target cells or tissues.
  • a subject having a defective level of FSH signaling has a reduced level of fertility, e.g., compared to a control subject, and an Hh pathway activator can increase level of fertility.
  • an Hh pathway inhibitor described herein is provided to a male subject, e.g., to decrease levels of one or more hormones (e.g., testosterone or
  • an Hh pathway inhibitor reduces spermatogenesis (e.g., as a male contraceptive).
  • an Hh pathway activator described herein is provided to a male subject, e.g., to increase levels of one or more hormones (e.g., testosterone or dehydroepiandrosterone (DHEA)).
  • an Hh pathway activator increases spermatogenesis (e.g., to increase level of fertility).
  • a suitable control is a baseline measurement, such as a measurement in the same individual prior to initiation of a treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of a treatment described herein.
  • a “control individual” is an individual afflicted with a gynecologic condition, who is about the same age and/or gender as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
  • the individual (also referred to as "patient” or “subject”) being treated is an individual having a condition described herein or having the potential to develop such condition.
  • a subject to be treated is genetically predisposed to developing a condition described herein.
  • An Hh pathway modulator e.g., an Hh pathway activator or inhibitor
  • a targeting agent such as an agent to localize an Hh pathway modulator to a specific target cell or target tissue (e.g., reproductive tissue).
  • targeting agents include, but are not limited to, nucleic acids (e.g., R A and DNA), polypeptides (e.g., receptor ligands, signal peptides, avidin, Protein A, and antigen binding proteins), polysaccharides, biotin, hydrophobic groups, hydrophilic groups, drugs, and any organic molecules that bind to target cells or target tissues (e.g., receptors on target cells or target tissues).
  • nucleic acids e.g., R A and DNA
  • polypeptides e.g., receptor ligands, signal peptides, avidin, Protein A, and antigen binding proteins
  • polysaccharides e.g., biotin, hydrophobic groups, hydrophilic groups, drugs, and any organic molecules that bind to target cells or target tissues (e.g., receptors on target cells or target tissues).
  • Targeting agents can be associated with Hh pathway modulators in any of a number of ways.
  • polypeptide targeting agents can be coupled to or fused to an Hh pathway polypeptide.
  • a targeting agent is associated (e.g., covalently or noncovalently bound) to an Hh pathway modulator with either short (e.g., direct coupling), medium (e.g., using small-molecule bifunctional linkers such as SPDP (Pierce Biotechnology, Inc., Rockford, 111.)), or long (e.g., PEG bifunctional linkers (Nektar Therapeutics, Inc., San Carlos, Calif.)) linkages.
  • short e.g., direct coupling
  • medium e.g., using small-molecule bifunctional linkers such as SPDP (Pierce Biotechnology, Inc., Rockford, 111.)
  • long e.g., PEG bifunctional linkers (Nektar Therapeutics, Inc., San Carlos, Calif.) linkages.
  • targeting agents are or comprise antigen binding proteins or antibodies or binding portions thereof.
  • Antibodies can be generated to allow for specific targeting of antigens or immunogens (e.g., target cell or target tissue specific antigens).
  • Such antibodies include, but are not limited to, polyclonal antibodies; monoclonal antibodies or antigen binding fragments thereof; modified antibodies such as chimeric antibodies, reshaped antibodies, humanized antibodies, or fragments thereof (e.g., Fv, Fab', Fab, F(ab')2); or biosynthetic antibodies, e.g., single chain antibodies, single domain antibodies (DAB), Fvs, or single chain Fvs (scFv) (see, e.g., in Harlow et al, Using Antibodies: A Laboratory Manual: Portable Protocol I. Cold Spring Harbor Laboratory (Dec. 1, 1998); Zola, Monoclonal
  • Antibodies Preparation and Use of Monoclonal Antibodies and Engineered Antibody
  • Antibody attachment can be performed by any known method e.g., through standard covalent binding to free amine groups (see, e.g., Torchilin et al., Hybridoma 6:229-240 (1987); Torchilin et al, Biochim. Biophys. Acta 1511 :397-411 (2001); Masuko et al, Biomacromol. 6:800-884 (2005)).
  • a targeting agent is or comprises a nucleic acid (e.g., R A or
  • nucleic acid targeting agents are designed to hybridize by base pairing to a particular nucleic acid (e.g., chromosomal DNA, mRNA, or ribosomal RNA).
  • nucleic acid targeting agents bind a ligand on a target cell or target tissue.
  • a nucleic acid can bind human nerve growth factor (Binkley et al., Nuc. Acids Res. 23:3198-205 (1995)).
  • Nucleic acids that bind ligands can be identified by known methods, such as SELEX procedures (see, e.g., U.S. Pat. Nos.
  • targeting agents can be or comprise aptamers, for example that bind to particular sequences.
  • Hh pathway modulators e.g., Hh pathway activators or inhibitors
  • a gynecologic condition e.g., subjects suffering from or susceptible to a gynecologic condition.
  • the route and/or mode of administration of an Hh pathway modulator described herein can vary depending upon the desired results.
  • dosage regimens can be adjusted to provide the desired response, e.g., a therapeutic response.
  • Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, oral, sublingual, intracerebral, intrathecal, intravaginal, transdermal, rectal, by inhalation, or topical, particularly to the ears, nose, eyes, or skin.
  • the mode of administration is left to the discretion of the practitioner.
  • Hh pathway modulator described herein can be formulated as a
  • physiologically acceptable excipients can be, e.g., liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
  • physiologically acceptable excipients can be saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea and the like.
  • physiologically acceptable excipients are sterile when administered to an animal.
  • the physiologically acceptable excipient should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid excipients, particularly for injectable solutions.
  • suitable physiologically acceptable excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
  • suitable physiologically acceptable excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
  • Other examples of suitable excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour
  • compositions if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • Liquid carriers can be used in preparing solutions, suspensions, emulsions, syrups, and elixirs.
  • An Hh pathway modulator described herein can be suspended in a pharmaceutically acceptable liquid carrier such as water, an organic solvent, a mixture of both, or
  • liquid carrier can contain other suitable ingredients
  • liquid carriers for oral and parenteral administration include water (particular containing additives described herein, e.g., cellulose derivatives, including sodium carboxymethyl cellulose solution), alcohols (including monohydric alcohols and polyhydric alcohols, e.g., glycols) and their derivatives, and oils (e.g., fractionated coconut oil and arachis oil).
  • the carrier can also be an oily ester such as ethyl oleate and isopropyl myristate.
  • the liquid carriers can be in sterile liquid form for administration.
  • the liquid carrier for pressurized compositions can be halogenated hydrocarbon or other pharmaceutically acceptable propellant.
  • an Hh pathway modulator described herein is formulated for intravenous administration.
  • Compositions for intravenous administration can comprise a sterile isotonic aqueous buffer.
  • the compositions can also include a solubilizing agent.
  • Compositions for intravenous administration can optionally include a local anesthetic such as lidocaine to lessen pain at the site of the injection.
  • the ingredients can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water- free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent.
  • a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent.
  • an Hh pathway modulator described herein is administered by infusion, it can be dispensed, for example, with an infusion bottle containing sterile pharmaceutical grade water or saline.
  • an ampule of sterile water for injection or saline can be provided so that the ingredients can be mixed prior to administration.
  • An Hh pathway modulator described herein can be administered rectally or vaginally in the form of a conventional suppository.
  • Suppository formulations can be made using methods known to those in the art from traditional materials, including cocoa butter, with or without the addition of waxes to alter the suppository's melting point, and glycerin.
  • Water- soluble suppository bases such as polyethylene glycols of various molecular weights, can also be used.
  • an Hh pathway modulator described herein that is effective for treating a gynecologic condition can be determined using standard clinical techniques known to those with skill in the art.
  • in vitro or in vivo assays can optionally be employed to help identify optimal dosage ranges.
  • the precise dose to be employed can also depend on the route of administration, the condition, the seriousness of the condition being treated, as well as various physical factors related to the individual being treated, and can be decided according to the judgment of a health-care practitioner.
  • compositions described herein can be administered as single administrations or as multiple administrations. Such compositions can be administered at regular intervals, depending on the nature, severity and extent of the subject's condition (e.g., gynecologic condition).
  • a therapeutically effective amount of a therapeutic agent e.g., an Hh pathway modulator
  • is administered periodically at regular intervals e.g., once every year, once every six months, once every five months, once every three months, bimonthly (once every two months), monthly (once every month), biweekly (once every two weeks), or weekly).
  • a therapeutically effective amount is largely determined based on the total amount of the therapeutic agent contained in pharmaceutical compositions described herein. Generally, a therapeutically effective amount is sufficient to achieve a meaningful benefit to a subject (e.g., treating, modulating, curing, preventing and/or ameliorating a gynecologic condition). For example, a therapeutically effective amount can be an amount sufficient to achieve a desired therapeutic and/or prophylactic effect, such as an amount sufficient to treat a gynecologic condition or the symptoms thereof. Generally, the amount of a therapeutic agent (e.g., an Hh pathway modulator) administered to a subject in need thereof will depend upon the characteristics of the subject.
  • a therapeutic agent e.g., an Hh pathway modulator
  • Such characteristics include the condition, disease severity, general health, age, sex and body weight of the subject.
  • One of ordinary skill in the art will be readily able to determine appropriate dosages depending on these and other related factors.
  • both objective and subjective assays can optionally be employed to identify optimal dosage ranges.
  • a therapeutically effective amount can be administered in a dosing regimen that can include multiple unit doses.
  • a pharmaceutical composition described herein is in unit dosage form, e.g., as a tablet, capsule, powder, solution, suspension, emulsion, granule, or suppository.
  • the pharmaceutical composition can be sub-divided into unit doses containing appropriate quantities of an Hh pathway modulator described herein.
  • the unit dosage form can be a packaged pharmaceutical composition, for example, packeted powders, vials, ampoules, pre-filled syringes or sachets containing liquids.
  • the unit dosage form can be, for example, a capsule or tablet itself, or it can be the appropriate number of any such compositions in package form.
  • Such unit dosage form can contain from about 1 mg/kg to about 250 mg/kg, and can be given in a single dose or in two or more divided doses.
  • an Hh pathway modulator consists of or comprises a nucleic acid encoding an Hh pathway polypeptide
  • the present disclosure includes methods of administering such nucleic acid to a subject.
  • a nucleic acid encoding an Hh pathway inhibitor e.g., Ptc, Hhip, or SuFu polypeptide
  • a subject to treat a gynecologic condition.
  • a nucleic acid encoding an Hh pathway polypeptide is inserted into a viral vector for delivery to a subject.
  • retrovirus vectors can be used as a recombinant delivery system for transferring nucleic acids encoding Hh pathway polypeptides in vivo (see, e.g., Dropulic, Hum. Gene Ther. 22:649-57 (2011); and Kumar et al, Curr. Gene Ther. 11 : 144-53 (2011)).
  • Retroviruses useful in methods of the present disclosure include, but are not limited to, murine leukemia virus (MLV), human immunodeficiency virus (HIV), equine infectious anaemia virus (EIAV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), Avian myelocytomatosis virus-29 (MC29), Avian erythroblastosis virus (AEV) and all other retroviridiae including lentiviruses (see, e.g., Coffin et al, "Retroviruses", 1997 Cold Spring Harbor Laboratory Press Eds: J M Coffin, S M Hughes, H E Varmus, pp 758-763)).
  • a replication defective retrovirus can be packaged into virions that can be used to infect a target cell through the use of a helper virus by standard techniques (see, e.g., Current Protocols in Molecular Biology, Ausubel, F. M. et al. (eds.) Greene Publishing Associates, (1989), Sections 9.10-9.14).
  • adenovirus-derived vectors are used to deliver nucleic acids encoding Hh pathway polypeptides.
  • the genome of an adenovirus can be manipulated such that it encodes and expresses an Hh pathway polypeptide, but is inactivated in terms of its ability to replicate in a normal lytic viral life cycle (see, e.g., Berkner et al. (1988) BioTechniques 6:616; Rosenfeld et al. (1991) Science 252:431-434; and Rosenfeld et al. (1992) Cell 68: 143-155).
  • Suitable adenoviral vectors useful in the methods of the present disclosure include those derived from the adenovirus strain Ad type 5 dl324 or other strains of adenovirus (e.g., Ad2, Ad3, Ad7 etc.).
  • an adeno-associated virus is used to deliver a nucleic acid encoding an Hh pathway polypeptide (see, e.g., Muzyczka et al. (1992) Curr.
  • AAV vectors include those that normally infect humans (e.g., serotypes 1, 2, 3A, 3B, 4, 5, and 6) or primates (e.g., serotypes 1 and 4).
  • non-viral methods are useful to deliver a nucleic acid encoding an Hh pathway polypeptide to a subject.
  • Such nonviral methods of gene transfer can exploit mechanisms normally used by mammalian cells for uptake and intracellular transport of macromolecules.
  • liposomal delivery systems, poly-lysine conjugates, and artificial viral envelopes can be used.
  • a nucleic acid encoding an Hh pathway polypeptide is entrapped in liposomes bearing positive charges on their surface (e.g., lipofectins).
  • a liposome can be conjugated to a targeting agent described herein (see, e.g., Mizuno et al. (1992) No Shinkei Geka 20:547-551).
  • Certain cationic polymers known to spontaneously bind to and condense nucleic acids into nanoparticles can also be used including, e.g., naturally occurring proteins, peptides, or derivatives, as well as synthetic cationic polymers such as polyethylenimine (PEI), polylysine (PLL), etc.
  • PKI polyethylenimine
  • PLL polylysine
  • Many useful polymers contain both chargeable amino groups, to allow for ionic interaction with negatively charged DNA phosphate, and a degradable region, such as a hydro lyzable ester linkage.
  • complexation agents can protect DNA against degradation, e.g., by nucleases, serum components, etc., and create a less negative surface charge, which may facilitate passage through hydrophobic membranes (e.g., cytoplasmic, lysosomal, endosomal, nuclear) of the cell.
  • Certain complexation agents facilitate intracellular trafficking events such as endosomal escape, cytoplasmic transport, and nuclear entry, and can dissociate from the nucleic acid.
  • Hh pathway polynucleotide can also be advantageously provided to a cell ex vivo, followed by administration of the living cell to the subject.
  • primary or secondary cells are genetically engineered to express an Hh pathway polypeptide.
  • Such cells can be obtained from a variety of tissues and include cell types which can be maintained propagated in culture.
  • primary and secondary cells include fibroblasts, endothelial cells, glial cells, and neural cells.
  • primary cells are obtained from an individual to whom a genetically engineered primary or secondary cells is to be administered.
  • Primary cells can also be obtained from a donor (other than the recipient) of the same species or another species (e.g., mouse, rat, rabbit, cat, dog, pig, cow, bird, sheep, goat, horse).
  • Primary or secondary cells can be transfected with a nucleic acid encoding an Hh pathway polypeptide.
  • a cell is transfected with an exogenous nucleic acid sequence that includes a nucleic acid encoding an Hh pathway polypeptide and an additional nucleic acid sequence (e.g., a regulatory sequence, e.g., a promoter, which causes expression, e.g., inducible expression or upregulation, of an endogenous Hh pathway sequence).
  • Transfected primary or secondary cells may also include DNA encoding a selectable marker that confers a selectable phenotype upon them, facilitating their identification and isolation.
  • Methods for treating disease by implanting a cell that has been modified to express a recombinant protein are also well known. See, for example, U.S. Pat. No. 5,399,346. Although use of human cells for ex vivo therapy is preferred in some embodiments, other cells such as bacterial cells may be implanted in a subject's vasculature, continuously releasing a therapeutic agent. See, for example, U.S. Pat. Nos. 4,309,776 and 5,704,910. Combination Therapy
  • an Hh pathway modulator described herein is administered to a subject in combination with one or more additional therapies, e.g., to treat a gynecologic condition or one or more symptoms of a gynecologic condition.
  • an Hh pathway modulator can be administered in combination with vismodegib (ErivedgeTM, Genentech, San Francisco, CA).
  • combined administration of an Hh pathway modulator and a second agent results in an improvement in a gynecologic condition or a symptom thereof to an extent that is greater than one produced by either the Hh pathway modulator or the second agent alone.
  • the difference between the combined effect and the effect of each agent alone can be a statistically significant difference.
  • combined administration of an Hh pathway modulator and a second agent allows administration of the second agent at a reduced dose, at a reduced number of doses, and/or at a reduced frequency of dosage compared to a standard dosing regimen approved for the second agent.
  • approved standard regimen for ErivedgeTM is 150 mg once daily.
  • a therapeutically effective amount of ErivedgeTM can be a dosage of less than about 150 mg and/or a frequency of greater than about once daily.
  • kits can be provided in a kit.
  • the kit includes (a) a container that contains an Hh pathway modulator described herein (e.g., a pharmaceutical composition comprising an Hh pathway modulator) and, optionally (b) informational material.
  • the informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of an Hh pathway modulator, e.g., for therapeutic benefit.
  • the informational material of the kits is not limited in its form.
  • the informational material can include information about production of an Hh pathway modulator, molecular weight of an Hh pathway modulator, concentration, date of expiration, batch or production site information, and so forth.
  • the informational material relates to methods of administering an Hh pathway modulator, e.g., in a suitable amount, manner, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein).
  • the method can be a method of treating a subject having a gynecologic condition.
  • the informational material e.g., instructions
  • the informational material can also be provided in other formats, such as Braille, computer readable material, video recording, or audio recording.
  • the informational material of the kit is contact information, e.g., a physical address, email address, website, or telephone number, where a user of the kit can obtain substantive information about an Hh pathway modulator therein and/or their use in the methods described herein.
  • the informational material can also be provided in any combination of formats.
  • kits can include other ingredients, such as a solvent or buffer, a stabilizer, or a preservative.
  • a kit can also include other agents, e.g., a second or third agent, e.g., other therapeutic agents.
  • the components can be provided in any form, e.g., liquid, dried or lyophilized form.
  • the components can be substantially pure (although they can be combined together or delivered separate from one another) and/or sterile.
  • the liquid solution can be an aqueous solution, such as a sterile aqueous solution.
  • reconstitution generally is by the addition of a suitable solvent.
  • the solvent e.g., sterile water or buffer, can optionally be provided in the kit.
  • a kit can include one or more containers for an Hh pathway modulator and/or other agents.
  • a kit contains separate containers, dividers or compartments for an Hh pathway modulator and informational material.
  • an Hh pathway modulator can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet.
  • the separate elements of a kit are contained within a single, undivided container.
  • an Hh pathway modulator can be contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label.
  • a kit can include a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of an Hh pathway modulator.
  • Containers can include a unit dosage, e.g., a unit that includes an Hh pathway modulator.
  • a kit can include a plurality of syringes, ampules, foil packets, blister packs, or medical devices, e.g., each containing a unit dose.
  • the containers of kits can be air tight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.
  • a kit can optionally include a device suitable for administration of an Hh pathway modulator, e.g., a syringe or other suitable delivery device.
  • a device can be provided preloaded with an Hh pathway modulator, e.g., in a unit dose, or can be empty, but suitable for loading.
  • Hh pathway polypeptides described herein e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip,
  • Ptc, Smo, or SuFu polypeptides are useful for identifying agents that can be potentially used to treat a disorder described herein, e.g., a gynecologic disorder.
  • a disorder described herein e.g., a gynecologic disorder.
  • an agent that increases expression or activity of a Ptc, Hhip, and/or SuFu polypeptide, or an agent that decreases expression or activity of an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide can be identified as an agent that can be used to treat a gynecologic disorder.
  • the ability of a test agent to modulate (e.g., increase or decrease) (e.g., permanently or temporarily) expression from an Hh pathway polynucleotide promoter is evaluated by e.g., routine reporter (e.g., LacZ, luciferase, or GFP) transcription assay.
  • routine reporter e.g., LacZ, luciferase, or GFP
  • a cell or transgenic animal whose genome comprises a reporter gene operably linked to an Hh pathway polynucleotide promoter can be contacted with a test agent, and the ability of the test agent to increase or decrease reporter activity is indicative of the ability of the agent to modulate an Hh pathway polypeptide.
  • effects of a test agent on Hh pathway polypeptide expression or Hh pathway polypeptide activity or level can be evaluated in a cell, cell lysate, or subject, preferably a non-human experimental mammal, and more preferably a rodent (e.g., a rat, mouse, rabbit), or explant thereof.
  • a rodent e.g., a rat, mouse, rabbit
  • Methods of assessing Hh pathway polypeptide expression are well known in the art, e.g., Northern analysis, ribonuclease protection assay, reverse transcription-polymerase chain reaction (RT-PCR) or RNA in situ hybridization (see, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual (3rd ed. 2001)).
  • the level of Hh pathway polypeptide can be monitored by, e.g., Western analysis, immunoassay, or in situ hybridization.
  • a DNA construct encoding an Hh pathway e.g.,
  • polypeptide/GFP fusion protein is transfected into cells, and level of GFP fluorescence in the presence or absence of a test agent is determined. An increase in fluorescence in the presence of the test agent is indicative of the ability of the test agent to increase Hh pathway polypeptide level.
  • the effect of a test agent on Hh pathway polypeptide expression or Hh pathway polypeptide activity or level is confirmed in a second assay, e.g., is observed as a change, in the presence of the test agent, in the ability of the Hh pathway polypeptide to activate or inhibit an Hh signaling pathway.
  • Agents and test agents to be used in the methods described herein include crude or partially or substantially purified extracts of organic sources, e.g., botanical (e.g., herbal) and algal extracts, inorganic elements or compounds, as well as partially or substantially purified or synthetic agents, e.g., small molecules, polypeptides, antibodies, and polynucleotides, and libraries of these.
  • organic sources e.g., botanical (e.g., herbal) and algal extracts, inorganic elements or compounds
  • partially or substantially purified or synthetic agents e.g., small molecules, polypeptides, antibodies, and polynucleotides, and libraries of these.
  • combinatorial chemical libraries can be produced or obtained that sample chemical compounds that are structurally or chemically related or unrelated. Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Pat. No. 5,010,175; Furka, Int. J. Pept. Prot. Res. 37:487-493 (1991); and Houghton et al, Nature 354:84-88 (1991)). Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (e.g., PCT Publication No.
  • Base cell carcinoma nevus syndrome Online Mendelian Inheritance in Man #109400
  • ultrasonography revealed a small, retroflexed uterus with a small pedunculated leiomyoma and normal ovaries, bilaterally containing multiple pre-antral follicles.
  • ovarian failure follicle depletion or menopause
  • high gonadotropins which may be induced by radiation and/or medication such as chemotherapy.
  • This patient's prior lymphoma therapy could have produced such a scenario, but onset 23 years after completing treatment and the abrupt occurrence of amenorrhea after years of regular menses following initiation of vismodegib suggested this was unlikely.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Reproductive Health (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Immunology (AREA)
  • Hematology (AREA)
  • Gynecology & Obstetrics (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pregnancy & Childbirth (AREA)
  • Endocrinology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Hedgehog pathway modulators, such as hedgehog pathway activators or inhibitors, and the use of such modulators to modulate FSH signaling are described.

Description

METHODS OF MODULATING FOLLICLE STIMULATING HORMONE ACTIVITY
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] The present application claims the benefit of U.S. provisional application Serial
No. 61/731,343, filed on November 29, 2012, the contents of which are herein incorporated by reference in their entirety.
BACKGROUND
[0002] The gonadotropin Follicle Stimulating Hormone (FSH) is released from the anterior pituitary under the influence of gonadotropin-releasing hormone and estrogens, and from the placenta during pregnancy. In the female, FSH acts on the ovaries promoting development of follicles and is the major hormone regulating secretion of estrogens. In the male, FSH is responsible for the integrity of the seminiferous tubules and acts on Sertoli cells to support gametogenesis. The actions of the FSH hormone are mediated by a specific plasma membrane receptor that is a member of the large family of G-protein coupled receptors. Modulation of FSH signaling can affect reproductive functions in both females and males.
SUMMARY OF THE INVENTION
[0003] The present disclosure encompasses the discovery that the Hedgehog (Hh) pathway is involved in signaling through the FSH receptor. Specifically, the present disclosure encompasses the discovery that inhibition of the Hh pathway inhibits FSH binding to the FSH receptor. The present disclosure therefore provides hedgehog pathway modulators (e.g., activators or inhibitors) for use in medicine, and specifically in treatment and/or prevention (e.g., delay of onset) of certain disorders, e.g., gynecologic disorders.
Definitions
[0004] In order for the present invention to be more readily understood, certain terms are first defined below. Additional definitions for the following terms and other terms are set forth throughout the specification. [0005] Combination therapy: The term "combination therapy", as used herein, refers to those situations in which two or more different pharmaceutical agents are administered in overlapping regimens so that the subject is simultaneously exposed to both agents. When used in combination therapy, two or more different agents may be administered simultaneously or separately. This administration in combination can include simultaneous administration of the two or more agents in the same dosage form, simultaneous administration in separate dosage forms, and separate administration. That is, two or more agents can be formulated together in the same dosage form and administered simultaneously. Alternatively, two or more agents can be simultaneously administered, wherein the agents are present in separate formulations. In another alternative, a first agent can be administered just followed by one or more additional agents. In the separate administration protocol, two or more agents may be administered a few minutes apart, or a few hours apart, or a few days apart.
[0006] Characteristic portion: As used herein, the term a "characteristic portion" of a substance, in the broadest sense, is one that shares some degree of sequence or structural identity with respect to the whole substance. In certain embodiments, a characteristic portion shares at least one functional characteristic with the intact substance. For example, a "characteristic portion" of a polypeptide or protein is one that contains a continuous stretch of amino acids, or a collection of continuous stretches of amino acids, that together are characteristic of a polypeptide or protein. In some embodiments, each such continuous stretch generally contains at least 2, 5, 10, 15, 20, 50, or more amino acids. In general, a characteristic portion of a substance (e.g., of a polypeptide or protein) is one that, in addition to the sequence and/or structural identity specified above, shares at least one functional characteristic with the relevant intact substance. In some embodiments, a characteristic portion may be biologically active.
[0007] Characteristic sequence: A "characteristic sequence" is a sequence that is found in all members of a family of polypeptides or nucleic acids, and therefore can be used by those of ordinary skill in the art to define members of the family.
[0008] Hedgehog pathway: As used herein, the terms "hedgehog pathway" and
"hedgehog signaling pathway" are used interchangeably and refer to a chain of events (or a subset of events) normally mediated by binding of an Hh polypeptide to an appropriate receptor, such as a Ptc polypeptide. Hh pathway activation transmits an Hh signal in cells and/or tissues. In some embodiments, Hh pathway activation results in changes in degree of downstream gene expression level and/or phenotypic changes.
[0009] Hedgehog pathway activator. The term "hedgehog pathway activator", as used herein, refers to any substance that activates or increases the activity of an Hh signaling pathway. In some embodiments, an Hh pathway activator is an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, an Smo polypeptide, a Gli polypeptide, and/or a nucleic acid encoding such polypeptide. In some embodiments, an Hh pathway activator is a substance that activates the transcription, binding, activity or stability of an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, an Smo polypeptide, a Gli polypeptide, and/or a nucleic acid encoding such polypeptide. In some embodiments, an Hh pathway activator is a substance that inhibits the transcription, binding, activity or stability of a Ptc polypeptide, an Hhip polypeptide, an SuFu polypeptide, and/or a nucleic acid encoding such polypeptide.
[0010] Hedgehog pathway inhibitor. The term "hedgehog pathway inhibitor", as used herein, refers to any substance that inhibits or reduces the activity of an Hh signaling pathway. In some embodiments, an Hh pathway inhibitor is a Ptc polypeptide, an Hhip polypeptide, an SuFu polypeptide, and/or a nucleic acid encoding such polypeptide. In some embodiments, an Hh pathway inhibitor is a substance that inhibits the transcription, binding, activity or stability of an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, an Smo polypeptide, a Gli polypeptide, and/or a nucleic acid encoding such polypeptide. In some embodiments, an Hh pathway inhibitor is a substance that activates the transcription, binding, activity or stability of a Ptc polypeptide, an Hhip polypeptide, an SuFu polypeptide, and/or a nucleic acid encoding such polypeptide.
[0011] Hedgehog (Hh) pathway modulator. The term "hedgehog pathway modulator", as used herein, refers to any substance that modulates activity of an Hh pathway. In some embodiments, a hedgehog pathway modulator modulates the transcription, binding, activity and/or stability of an Hh pathway polypeptide and/or a nucleic acid encoding such polypeptide. In some embodiments, an Hh pathway modulator is an Hh pathway activator. In some embodiments, an Hh pathway modulator is an Hh pathway inhibitor. [0012] Hedgehog (Hh) pathway polypeptide: As used herein, the term "hedgehog pathway polypeptide" refers to a polypeptide whose amino acid sequence includes at least one characteristic sequence of and/or shows at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% identity with a protein involved in a Hh pathway (e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu polypeptide). A wide variety of Hh pathway sequences from flies, vertebrates, and mammals are known in the art, such as those described herein; in some embodiments, an Hh pathway polypeptide shares at least one characteristic sequence of and/or shows the specified degree of overall sequence identity with one of the Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu sequences set forth herein (each of which may be considered a "reference" Hh pathway polypeptide). In some embodiments, an Hh pathway polypeptide as described herein shares at least one biological activity with a reference Hh pathway polypeptide as set forth herein. In some such embodiments, the shared biological activity relates to Hh signaling pathway activation or inhibition.
[0013] Hedgehog (Hh) polypeptide: As used herein, the term "hedgehog polypeptide"
(or "Hh polypeptide") refers to a polypeptide whose amino acid sequence includes at least one characteristic sequence of and/or shows at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% identity with a hedgehog polypeptide (e.g., Desert (Dhh), Sonic (Shh) or Indian (Ihh)). A wide variety of Hh sequences from flies, vertebrates, and mammals are known in the art, such as those described herein; in some embodiments, a Hh polypeptide shares at least one characteristic sequence of and/or shows the specified degree of overall sequence identity with one of the Dhh, Shh, or Ihh sequences set forth herein (each of which may be considered a "reference" Hh polypeptide). In some embodiments, an Hh polypeptide as described herein shares at least one biological activity with a reference Hh polypeptide as set forth herein. In some such embodiments, the shared biological activity relates to Hh signaling pathway activation.
[0014] Homology: As used herein, the term "homology" refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or R A molecules) and/or between polypeptide molecules. In some embodiments, polymeric molecules are considered to be "homologous" to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical. In some embodiments, polymeric molecules are considered to be "homologous" to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar.
[0015] Identity: As used herein, the term "identity" refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two nucleic acid sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%>, at least 40%>, at least 50%>, at least 60%>, at least 70%>, at least 80%>, at least 90%), at least 95%, or substantially 100%) of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4: 11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The percent identity between two nucleotide sequences can,
alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix. [0016] Polypeptide: As used herein, a "polypeptide", generally speaking, is a string of at least two amino acids attached to one another by a peptide bond. In some embodiments, a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond. Those of ordinary skill in the art will appreciate that polypeptides sometimes include "non-natural" amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain, optionally.
[0017] Protein: As used herein, the term "protein" refers to a polypeptide (i.e., a string of at least two amino acids linked to one another by peptide bonds). Proteins may include moieties other than amino acids (e.g., may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a
"protein" can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof. Those of ordinary skill will appreciate that a protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means. Polypeptides may contain L-amino acids, D- amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc. In some embodiments, proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof. The term "peptide" is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
[0018] Reference sample: As used herein, a reference sample may include, but is not limited to, any or all of the following: a cell or cells, a portion of tissue, blood, serum, ascites, urine, saliva, and other body fluids, secretions, or excretions. The term "sample" also includes any material derived by processing such a sample. Derived samples may include nucleotide molecules or polypeptides extracted from the sample or obtained by subjecting the sample to techniques such as amplification or reverse transcription of mR A, etc.
[0019] Subject: As used herein, the term "subject" or "patient" refers to any organism upon which embodiments of the invention may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.).
[0020] Suffering from: An individual who is "suffering from" a disease, disorder, or condition (e.g., a gynecologic condition) has been diagnosed with and/or exhibits one or more symptoms of the disease, disorder, or condition. In some embodiments, an individual who is suffering from gynecologic condition has a gynecologic condition, but does not display any symptoms of a gynecologic condition and/or has not been diagnosed with a gynecologic condition.
[0021] Susceptible to: An individual who is "susceptible to" a disease, disorder, or condition (e.g., a gynecologic condition) is at risk for developing the disease, disorder, or condition. In some embodiments, an individual who is susceptible to a disease, disorder, or condition does not display any symptoms of the disease, disorder, or condition. In some embodiments, an individual who is susceptible to a disease, disorder, or condition has not been diagnosed with the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, or condition is an individual who displays conditions associated with development of the disease, disorder, or condition. In some embodiments, a risk of developing a disease, disorder, and/or condition is a population-based risk.
[0022] Symptoms are reduced: According to the present invention, "symptoms are reduced" when one or more symptoms of a particular disease, disorder or condition is reduced in magnitude (e.g., intensity, severity, etc.) or frequency. For purposes of clarity, a delay in the onset of a particular symptom is considered one form of reducing the frequency of that symptom. It is not intended that the present invention be limited only to cases where the symptoms are eliminated. The present invention specifically contemplates treatment such that one or more symptoms is/are reduced (and the condition of the subject is thereby "improved"), albeit not completely eliminated.
[0023] Target cell or target tissue: As used herein, the terms "target cell" or "target tissue" refer to any cell, tissue, or organism that is affected by a condition described herein and to be treated, or any cell, tissue, or organism in which a protein involved in a condition described herein is expressed. In some embodiments, target cells, target tissues, or target organisms include those cells, tissues, or organisms in which there is a detectable or abnormally high amount of FSH signaling (e.g., comparable to that observed in subjects suffering from or susceptible to a gynecologic condition). In some embodiments, target cells, target tissues, or target organisms include those cells, tissues or organisms that display a disease-associated pathology, symptom, or feature.
[0024] Therapeutic regimen: As used herein, the term "therapeutic regimen" refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of and/or reduce incidence of one or more symptoms or features of a particular disease, disorder, and/or condition. It may include a treatment or series of treatments designed to achieve a particular effect, e.g., reduction or elimination of a detrimental condition or disease such as a gynecologic disorder. The treatment may include administration of one or more compounds either simultaneously, sequentially or at different times, for the same or different amounts of time. Alternatively, or additionally, the treatment may include exposure to radiation, chemotherapeutic agents, hormone therapy, or surgery. In addition, a "treatment regimen" may include genetic methods such as gene therapy, gene ablation or other methods known to reduce expression of a particular gene or translation of a gene-derived mRNA.
[0025] Therapeutic agent: As used herein, the phrase "therapeutic agent" refers to any agent that, when administered to a subject, has a therapeutic effect and/or elicits a desired biological and/or pharmacological effect.
[0026] Therapeutically effective amount: As used herein, the term "therapeutically effective amount" refers to an amount of an agent (e.g., a hedgehog modulator) that confers a therapeutic effect on the treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment. The therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect). In particular, the "therapeutically effective amount" refers to an amount of a therapeutic agent or composition effective to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying the onset of the disease, and/or also lessening the severity or frequency of symptoms of the disease. A therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses. For any particular therapeutic agent, a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents. Also, the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the subject; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
[0027] Treatment: As used herein, the term "treatment" (also "treat" or "treating") refers to any administration of a substance (e.g., provided compositions) that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms, features, and/or causes of a particular disease, disorder, and/or condition (e.g., a gynecologic disorder). Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition. Alternatively or additionally, such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition. In some embodiments, treatment may be of a subject who has been diagnosed as suffering from the relevant disease, disorder, and/or condition. In some
embodiments, treatment may be of a subject known to have one or more susceptibility factors that are statistically correlated with increased risk of development of the relevant disease, disorder, and/or condition.
DETAILED DESCRIPTION
[0028] The present disclosure encompasses the surprising discovery that FSH activity can be modulated using hedgehog pathway modulators (e.g., hedgehog pathway activators or inhibitors). Accordingly, the disclosure provides, among other things, use of the hedgehog pathway as a diagnostic, prognostic and/or therapeutic target for modulating FSH activity, e.g., for gynecologic disorders. Hedgehog Pathway
[0029] The hedgehog (Hh) pathway is well known (see, e.g., U.S. Pat. No. 6,277,566 Bl;
U.S. Pat. No. 6,432,970 B2; Lum et al, Science 304: 1755-1759 (2004); and Bale et al, Hum. Mol. Genet. 10:757-762 (2001)). During growth, human cells need to communicate to neighboring cells whether it is time to divide or stop dividing. The Hh signaling pathway is a key regulator of this messaging.
[0030] The vertebrate family of Hh genes includes three members that exist in mammals, known as Desert (Dhh), Sonic (Shh) and Indian (Ihh) Hedgehogs, all of which encode secreted proteins. These various Hh proteins consist of a signal peptide, a highly conserved N-terminal region, and a more divergent C-terminal domain. Biochemical studies have shown that autoproteolytic cleavage of the Hh precursor protein proceeds through an internal thioester intermediate which subsequently is cleaved in a nucleophilic substitution. It is likely that the nucleophile is a small lipophilic molecule that becomes covalently bound to the C-terminal end of the N-peptide, tethering it to the cell surface. As a result of the tethering, a high local concentration of N-terminal Hh peptide is generated on the surface of Hh producing cells. It is this N-terminal peptide which is both necessary and sufficient for short- and long-range Hh signaling activities.
[0031] Smoothened (Smo) encodes a transmembrane protein of 1024 amino acids, which acts as a transducer of the Hh signal. Smo protein has 7 hydrophobic membrane-spanning domains, an extracellular amino-terminal region, and an intracellular carboxy-terminal region. Smo bears some similarity to G protein-coupled receptors and is most homologous to the Frizzled (Fz) family of serpentine proteins (Alcedo et al., Cell 86: 221 (1996)).
[0032] In an inactive Hh signaling pathway, the transmembrane protein receptor Patched
(Ptc) inhibits the stabilization, phosphorylation, and/or activity of Smoothened (Smo).
Activation of the pathway is initiated through binding of Hh polypeptide to Ptc. Hh binding to Ptc alters the interaction of Smo and Ptc, reversing the repression of Smo by Ptc (see Zhu et al., Genes Dev. 17: 1240 (2003)).
[0033] Smo activation initates a cascade that leads to the translocation of an active form of the transcription factor Gli to the nucleus of the cell. Three Gli proteins known in vertebrates are Glil, Gli2 and Gli3 (Kinzler et al, Science 236:70-73 (1987); Bai et al, Dev. Cell 6: 103-115 (2004); Motoyama et al, Dev. Biol. 259: 150-161 (2003)). Gli proteins share high homology in the zinc finger domain, but have limited homology outside of this region (Matise et al.,
Oncogene 18:7852-7859 (1999)). Glil is a transcriptional activator, while Gli2 and Gli3 are bifunctional and can function as a transcriptional activator or, when proteolytically processed, a transcriptional repressor (Dai et al., J. Biol. Chem. 12:8143-8152 (1999)). In the inactive Hh pathway, Gli is prevented from entering the nucleus through interactions with cytoplasmic proteins, including Fused (Fu) and Suppressor of fused (Sufu) (see Methot et al, Dev. 127:4001- 4010 (2000)); Chen et al, Mol. Cell. Biol. 25:7042-7053 (2005)); Preat, Genetics 132:725-736 (1992)). As a consequence, transcriptional activation of Hh target genes is repressed. The activation of Smo leads to translocation of Gli to the nucleus, which activates Hh pathway target gene expression, including of Wnts, TGF-beta, and Ptc and Gli themselves.
[0034] Additional Hh pathway proteins include Gasl, Cdo, and Boc, which promote Hh pathway signaling (see Allen et al, Dev. Cell 20:775-787 (2011)), and Hhip, which inhibits Hh pathway signaling (see Beachy et al, Genes Dev. 24:2001-2012 (2010)).
[0035] The Hh pathway is best studied in cell proliferation and differentiation during embryo development. While the Hh pathway is thought to be inactive in most normal adult tissues, it appears to be active in two areas: hair follicles and taste papillae of the tongue. In addition, Hh pathway polypeptides are identified in some areas of adult gastrointestinal tract, but their function is unclear. There is no published evidence implicating the Hh pathway in the reproductive tract physiology or reproduction.
[0036] When cellular division occurs uncontrolled, cancer appears. Hh pathway activation has been well documented in the pathogenesis of Basal Cell Carcinoma (BCC). This activation can occur at several levels in the signaling pathway, most commonly in patched (Ptc) or smoothened (Smo) gene products. Patients with BCC are usually treated with surgical, topical, or radiotherapy techniques. In situations where BCC has metastasized or become locally advanced to the point where traditional options are not optimal, oral therapy with an inhibitor of the Hh pathway is an option. Vismodegib (Erivedge™, Genentech, Inc., San Francisco, CA) is approved for this situation. Vismodegib binds to Smo, preventing further downstream signaling and preventing cell division. Major side effects include dysgeusia, alopecia, leg cramping, and gastrointestinal disturbances.
Nucleic Acids Encoding Hedgehog Pathway Polypeptides
[0037] Methods and compositions described herein include, for example, modulators of a hedgehog signaling pathway (e.g., modulators of one or more Hh pathway polypeptides).
Nucleic acids encoding Hh pathway polypeptides (e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu) are known. According to the present disclosure, modulators of such nucleic acids (and polypeptides) are useful in the treatment of gynecologic disorders. In some embodiments, such nucleic acids have or include nucleotide sequences as set forth in SEQ ID NO: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27, or characteristic sequence elements thereof or therein. In some embodiments, useful nucleic acids show at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82% ,81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% overall sequence identity with one or more of SEQ ID NO: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27. Alternatively or additionally, in some embodiments, useful nucleic acids include at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more contiguous residues found in SEQ ID NO: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27. In some embodiments, useful nucleic acids are generated in vitro; in some embodiments, useful nucleic acids are generated in vivo. In some embodiments, useful nucleic acids are generated using genetic engineering techniques (e.g., for production and/or mutagenesis of a reference sequence). To give but a few examples, in some
embodiments, nucleic acid variants (e.g., of SEQ ID NO: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27) are generated using techniques such as site directed mutagenesis, random chemical mutagenesis, Exonuclease III deletion procedures, and standard cloning techniques. In some embodiments, useful nucleic acids are generating using chemical synthesis and/or modification procedures.
[0038] A variety of methods of making nucleic acids that are "variants" with respect to a reference nucleic acid (e.g., a naturally-occurring or other reference nucleic acid) are well known in the art. These include, for example, procedures in which nucleic acid sequences obtained from natural isolates are modified to generate nucleic acids that encode polypeptides having characteristics that enhance their value in industrial or laboratory applications. In such some embodiments of such procedures, a large number of variant sequences having one or more nucleotide differences with respect to the sequence obtained from the natural isolate are generated and characterized. Typically, these nucleotide differences result in amino acid changes with respect to the polypeptides encoded by the nucleic acids from the natural isolates.
[0039] For example, variants can be created using error prone PCR (see, e.g., Leung et al, Technique 1 : 11-15, 1989; and Caldwell et al, PCR Methods Applic. 2:28-33, 1992). In error prone PCR, PCR is performed under conditions where the copying fidelity of the DNA polymerase is low, such that a high rate of point mutations is obtained along the entire length of the PCR product. Briefly, in such procedures, nucleic acids to be mutagenized are mixed with PCR primers, reaction buffer, MgCl2, MnCl2, Taq polymerase, and an appropriate concentration of dNTPs for achieving a high rate of point mutation along the entire length of the PCR product. For example, the reaction can be performed using 20 fmoles of nucleic acid to be mutagenized, 30 pmole of each PCR primer, a reaction buffer comprising 50 mM KC1, 10 mM Tris HC1 (pH 8.3), and 0.01% gelatin, 7 mM MgCl2, 0.5 mM MnCl2, 5 units of Taq polymerase, 0.2 mM dGTP, 0.2 mM dATP, 1 mM dCTP, and 1 mM dTTP. PCR can be performed for 30 cycles of 94 °C for 1 min, 45 °C for 1 min, and 72 °C for 1 min. However, it will be appreciated that these parameters can be varied as appropriate. The mutagenized nucleic acids are then cloned into an appropriate vector and the activities of the polypeptides encoded by the mutagenized nucleic acids are evaluated.
[0040] Variants can also be created using oligonucleotide directed mutagenesis to generate site-specific mutations in any cloned DNA of interest. Oligonucleotide mutagenesis is described in, for example, Reidhaar-Olson et al, Science 241 :53-57 (1988). Briefly, in such procedures a plurality of double stranded oligonucleotides bearing one or more mutations to be introduced into the cloned DNA are synthesized and inserted into the cloned DNA to be mutagenized. Clones containing the mutagenized DNA are recovered, and the activities of the polypeptides they encode are assessed.
[0041] Another method for generating variants is assembly PCR. Assembly PCR involves the assembly of a PCR product from a mixture of small DNA fragments. A large number of different PCR reactions occur in parallel in the same vial, with the products of one reaction priming the products of another reaction. Assembly PCR is described in, for example, U.S. Pat. No. 5,965,408. Still another method of generating variants is sexual PCR mutagenesis. In sexual PCR mutagenesis, forced homologous recombination occurs between DNA molecules of different, but highly related, DNA sequence in vitro as a result of random fragmentation of the DNA molecule based on sequence homology. This is followed by fixation of the crossover by primer extension in a PCR reaction. Sexual PCR mutagenesis is described in, for example, Stemmer, Proc. Natl. Acad. Sci., USA 91 : 10747-10751 (1994).
[0042] Variants can also be created by in vivo mutagenesis. In some embodiments, random mutations in a nucleic acid sequence are generated by propagating the sequence in a bacterial strain, such as an E. coli strain, which carries mutations in one or more of the DNA repair pathways. Such "mutator" strains have a higher random mutation rate than that of a wild- type strain. Propagating a DNA sequence in one of these strains will generate random mutations within the DNA. Mutator strains suitable for use for in vivo mutagenesis are described in, for example, PCT Publication No. WO 91/16427.
[0043] Variants can also be generated using cassette mutagenesis. In cassette
mutagenesis, a small region of a double stranded DNA molecule is replaced with a synthetic oligonucleotide "cassette" that differs from the native sequence. The oligonucleotide often contains a completely and/or partially randomized native sequence. Recursive ensemble mutagenesis can also be used to generate variants. Recursive ensemble mutagenesis is an algorithm for protein engineering (i.e., protein mutagenesis) developed to produce diverse populations of phenotypically related mutants whose members differ in amino acid sequence. This method uses a feedback mechanism to control successive rounds of combinatorial cassette mutagenesis. Recursive ensemble mutagenesis is described in, for example, Arkin et al, Proc. Natl. Acad. Sci., USA 89:7811-7815 (1992).
[0044] In some embodiments, variants are created using exponential ensemble mutagenesis. Exponential ensemble mutagenesis is a process for generating combinatorial libraries with a high percentage of unique and functional mutants, wherein small groups of residues are randomized in parallel to identify, at each altered position, amino acids which lead to functional proteins. Exponential ensemble mutagenesis is described in, for example,
Delegrave et al., Biotech. Res. 11 : 1548-1552 (1993). Random and site-directed mutagenesis are described in, for example, Arnold, Curr. Opin. Biotech. 4:450-455 (1993). In some
embodiments, variants are created using shuffling procedures wherein portions of a plurality of nucleic acids that encode distinct polypeptides are fused together to create chimeric nucleic acid sequences that encode chimeric polypeptides as described in, for example, U.S. Pat. Nos.
5,965,408 and 5,939,250.
[0045] In some embodiments, nucleic acids for use in accordance with the present disclosure comprise naturally-occurring nucleotide residues. In some embodiments, nucleic acids for use in accordance with the present disclosure include one or more nucleotide "analogs". A nucleotide analog is a nucleotide (i.e., an entity that is incorporated into a nucleic acid polymer without significantly disrupting the structure and/or function of that polymer) whose chemical structure differs from that of reference naturally-occurring ribonucleic or deoxyribonucleic acid residues adenine, guanine, cytosine, thymine, and uracil. In some embodiments, a nucleotide analog differs from its reference nucleotide at the base moiety, sugar moiety, and/or phosphate backbone. In some embodiments, a nucleotide analog contributes to one or more altered features in a nucleic acid polymer into which it is incorporated as compared with a comparable nucleic acid polymer containing its reference nucleotide rather than the analog. For example, in some embodiments, such analog-containing polymer shows improved , stability, hybridization, and/or solubility..
[0046] In some embodiments, base moiety alterations found in nucleotide analogs include deoxyuridine for deoxythymidine and 5-methyl-2'-deoxycytidine or 5-bromo-2'- deoxycytidine for deoxycytidine. In some embodiments, sugar moiety alterations found in nucleotide analogs include modification of the 2' hydroxyl of the ribose sugar to form 2'-0- methyl or 2'-0-allyl sugars. In some embodiments, deoxyribose phosphate backbone alterations found in nucleotide analogs include morpholino nucleic acids, in which each base moiety is linked to a six-membered, morpholino ring, or peptide nucleic acids, in which the
deoxyphosphate backbone is replaced by a pseudopeptide backbone and the four bases are retained (see, e.g., Summerton et al, Antisense Nucleic Acid Drug Dev. 7: 187-195 (1997); Hyrup et al., Bioorgan. Med. Chem. 4:5-23(1996)). Alternatively or additionally, nucleotide analogs may have a phosphorothioate or phosphorodithioate backbone, a phosphoroamidite, or an alkyl phosphotriester backbone.
[0047] In certain instances, a Hh pathway polynucleotide or variant for use in accordance with the present disclosure includes alterations to codon(s) to optimize for expression in a particular host cell. For example, for expression in E. coli, a Hh pathway polynucleotide or variant can include one or more altered codons as described in, e.g., Grosjean et al, Gene 18: 199-209 (1982).
Hedgehog Pathway Polypeptides
[0048] In some embodiments, methods and compositions described utilize a modulator of one or more Hh pathway polypeptides (e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip, Ptc, Smo, or SuFu polypeptides). According to the present disclosure, such polypeptides are useful in the treatment of gynecologic disorders. In some embodiments, such polypeptides useful in the practice of the present disclosure have or include amino acid sequences as set forth in SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, or 28, or characteristic sequence elements thereof or therein. In some embodiments, useful polypeptides show at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82% ,81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% overall sequence identity with one or more of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, or 28. Alternatively or additionally, in some embodiments, useful polypeptides include at least about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, or 150 or more contiguous amino acid residues found in SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, or 28.
[0049] In some embodiments, a useful polypeptide differs from its reference polypeptide
(e.g., a polypeptide having or including an amino acid sequence as set forth in SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, or 28, or characteristic sequence elements thereof or therein) by one or more amino acid residues. For example, in some embodiments, the difference is a conservative or nonconservative substitution of one or more amino acid residues.
Conservative substitutions are those that substitute a given amino acid in a polypeptide by another amino acid of similar characteristics. Typical conservative substitutions are the following replacements: replacement of an aliphatic amino acid, such as alanine, valine, leucine, and isoleucine, with another aliphatic amino acid; replacement of a serine with a threonine or vice versa; replacement of an acidic residue, such as aspartic acid and glutamic acid, with another acidic residue; replacement of a residue bearing an amide group, such as asparagine and glutamine, with another residue bearing an amide group; exchange of a basic residue, such as lysine and arginine, with another basic residue; and replacement of an aromatic residue, such as phenylalanine and tyrosine, with another aromatic residue.
[0050] In some embodiments, useful Hh pathway polypeptides include a substituent group on one or more amino acid residues. Still other useful polypeptides are associated with (e.g., fused, linked, or coupled to) another moiety (e.g., a peptide or molecule). For example, useful Hh pathway polypeptides can be fused, linked, or coupled to an amino acid sequence (e.g., a leader sequence, a secretory sequence, a proprotein sequence, a second polypeptide, or a sequence that facilitates purification, enrichment, or stabilization of the polypeptide). In certain other embodiments, a polypeptide includes a targeting agent, e.g., a targeting agent described herein.
[0051] A variety of methods of making polypeptides are known in the art and can be used to make Hh pathway polypeptides. For example, Hh pathway polypeptides can be recombinantly produced by utilizing a host cell system engineered to express a nucleic acid encoding a Hh pathway polypeptide (e.g., a nucleic acid described herein). Alternatively or additionally, a Hh pathway polypeptide can be produced by activating an endogenous gene (e.g., a nucleic acid encoding a Hh pathway polypeptide present endogenous ly in a cell). Alternatively or additionally, a Hh pathway polypeptide can be partially or fully prepared by chemical synthesis. Alternatively or additionally, a Hh pathway polypeptide can be purified from natural sources.
[0052] Where a Hh pathway polypeptide is recombinantly produced, any expression system can be used. Known expression systems include, without limitation, for example, egg, baculovirus, plant, yeast, or mammalian cells.
[0053] In some embodiments, a Hh pathway polypeptide suitable for use in methods described herein are produced in mammalian cells. Non-limiting examples of mammalian cells that can be used include BALB/c mouse myeloma line (NSO/1, ECACC No: 85110503); human retinoblasts (PER.C6, CruCell, Leiden, The Netherlands); monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al, J. Gen Virol, 36:59,1977); human fibrosarcoma cell line (e.g., HT1080); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells +/-DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216, 1980); mouse Sertoli cells (TM4, Mather, Biol. Reprod., 23:243-251, 1980); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al, Annals N.Y. Acad. Sci., 383:44-68, 1982); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
Hedgehog Pathway Activators
[0054] Hh pathway activators useful in the methods described herein include an Hh, Cdo,
Boc, Gasl, Smo, or Gli polypeptide; a nucleic acid encoding an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide; any substance that increases level and/or activity of an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide; any substance that increases level and/or activity of a nucleic acid encoding a Cdo, Boc, Gasl, Smo, or Gli polypeptide; any substance that decreases level or activity of a Ptc, Hhip, and/or SuFu polypeptide; and/or any substance that decreases level or activity of a nucleic acid encoding a Ptc, Hhip, and/or SuFu polypeptide.
[0055] In some embodiments, an Hh pathway activator is or includes an Hh, Cdo, Boc,
Gasl, Smo, and/or Gli polypeptide having an activating mutation (e.g., a difference of one or more amino acid residues relative to a reference Hh, Cdo, Boc, Gasl, Smo, and/or Gli polypeptide and a higher level of expression and/or activity as compared to such reference polypeptide). In some embodiments, an Hh pathway activator is or includes a Ptc, Hhip, and/or SuFu polypeptide having an inhibiting mutation (e.g., a difference of one or more amino acid residues relative to a reference Ptc, Hhip, and/or SuFu polypeptide and having a lower level of expression and/or activity as compared to such reference polypeptide). Hedgehog Pathway Inhibitors
[0056] Hh pathway inhibitors useful in the methods described herein include a Ptc, Hhip, or SuFu polypeptide; a nucleic acid encoding a Ptc, Hhip, or SuFu polypeptide; any substance that increases level and/or activity of a Ptc, Hhip, and/or SuFu polypeptide, any substance that increases level and/or activity of a nucleic acid encoding a Ptc, Hhip, and/or SuFu polypeptide; any substance that decreases level or activity of an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide; and/or any substance the decreases level of activity of a nucleic acid encoding an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide.
[0057] In some embodiments, an Hh pathway inhibitor is or includes a Ptc, Hhip, and/or
SuFu polypeptide having an activating mutation (e.g., a difference of one or more amino acid residues relative to a reference Ptc, Hhip, and/or SuFu polypeptide and having a higher level of expression and/or activity as compared to such reference polypeptide). In some embodiments, an Hh pathway inhibitor is or includes an Hh, Cdo, Boc, Gasl , Smo, and/or Gli polypeptide having an inhibiting mutation (e.g., a difference of one or more amino acid residues relative to a reference Hh, Cdo, Boc, Gasl, Smo, and/or Gli polypeptide and a lower level of expression and/or activity as compared to such reference polypeptide).
[0058] Exemplary, nonlimiting Hh pathway inhibitors useful in the methods described herein include steroidal alkaloids, such as cyclopamine, and derivatives thereof; other small molecules such as SANT-1, SANT-2, SANT-3, and SANT-4 (Chen et al, Proc. Natl. Acad. Sci., USA 99: 14071-14076 (2002)); arsenical agents such as arsenic trioxide (ATO); steroidal alkaloids and derivatives thereof, including, for example, cyclopamine and jervine (see, e.g., Chen et al, Genes Devel. 16:2743-2748 (2002); and U.S. Pat. No. 6,432,970); and triparanol (see, e.g., U.S. Pat. No. 6,432,970).
[0059] Additional nonlimiting Hh pathway inhibitors include those described and disclosed in U.S. Pat. No. 7,230,004, U.S. Publ. Nos. 2008/0293754; 2008/0287420;
2008/0293755; 2002/0006931; 2007/0021493; US 2007/0060546; and International Application Publication Nos. WO 2001/19800, WO 2001/26644, WO 2001/27135, WO 2001/49279, WO 2001/74344, WO 2003/011219, WO 2003/088970, WO 2004/020599, WO 2005/013800, WO 2005/033288, WO 2005/032343, WO 2005/042700, WO 2006/028958, WO 2006/050351, WO 2006/078283, WO 2007/054623, WO 2007/059157, WO 2007/120827, WO 2007/131201, WO 2008/070357, WO 2008/110611, WO 2008/112913, and WO 2008/131354.
[0060] Additional nonlimiting examples of Hh pathway inhibitors useful in the methods described herein include vismodegib (Erivedge™, Genentech, Inc., San Francisco, CA); BMS- 833923 (also known as XL139; Siu et al, J. Clin. Oncol. 28: 15s suppl abstr 2501 (2010), and National Institute of Health Clinical Trial Identifier No. NCT006701891); LDE-225 (Pan et al, ACS Med. Chem. Lett. 1 : 130-134 (2010)); LEQ-506 (National Institute of Health Clinical Trial Identifier No. NCT01106508); PF-04449913 (National Institute of Health Clinical Trial Identifier No. NCT00953758); and l-piperazinyl-4-arylphthalazines or analogues thereof (Lucas et al, Bioorg. Med. Chem. Lett. 20:3618-22 (2010)).
Treatment of Disorders and Conditions
[0061] The present disclosure encompasses the finding that the Hh pathway is involved in signaling through the FSH receptor. Specifically, inhibition of the Hh pathway inhibits FSH binding to the FSH receptor. Accordingly, Hh pathway modulators described herein can be used to modulate FSH binding to the FSH receptor, e.g., to treat or prevent disorders or conditions mediated by or involving FSH signaling.
Follicle Stimulating Hormone and Follicle Stimulating Hormone Receptor
[0062] Follicle stimulating hormone (FSH) is a gonadotrophin hormone synthesized and secreted by gonadotropes in the anterior pituitary gland. FSH is a heterodimeric glycoprotein hormone consisting of two noncovalently linked subunits designated alpha and beta. In human FSH, the subunits are 92 amino acids and 111 amino acids, respectively, and each has two N- linked glycosylation sites. FSH has several biological functions in mammals. In males, for example, FSH, in combination with testosterone is required for the initiation and maintenance of qualitatively and quantitatively normal spermatogenesis. In females, FSH is necessary for selection and growth of ovarian follicles and for the production of estrogens from androgen substrate. [0063] FSH is part of the hypothalamo-pituitary-ovarian axis, a classic endocrine closed loop biofeedback system, in which the gonadotrophins (e.g., follicle-stimulating hormone (FSH) and luteinizing hormone (LH)) stimulate ovarian hormone production (e.g., estrogen), which in turn exerts a negative feedback effect on the gonadotrophins, to maintain a regulated system. Gonadotrophins include hormones produced by the pituitary gland that regulate the gonads, such as follicle-stimulating hormone (FSH) and luteinizing hormone (LH). In women, gonadotropins regulate the development of the ovaries and eggs. In men, gonadotropins regulate the development of testes. The secretion of FSH is stimulated by gonadotropin releasing hormone (GnRH). At the beginning of each menstrual cycle, FSH stimulates the growth and recruitment of immature ovarian follicles in the ovary. After 5-6 days, one dominant follicle begins to develop more rapidly. The outer theca and inner granulosa cells of the follicle multiply and under the influence of FSH and LH begin to secrete estrogen and the peptide hormone inhibin. The increase in serum estrogen levels inhibits GnRH, which in turn leads to a decrease in FSH production. Similarly, inhibin inhibits the synthesis and secretion of FSH. Estrogens and inhibin secreted by the ovary inhibit the activity of FSH leading to regression of the smaller, less mature follicles. The estrogen levels peak just before midcycle, and the granulosa cells begin to secrete progesterone. These relative changes in estrogen and progesterone stimulate a brief surge in FSH and LH release that precedes and initiates ovulation.
[0064] FSH acts by binding to specific FSH receptors localized primarily in Sertoli cells of the testis and in granulosa cells of the ovary. The FSH receptor belongs to the family of G protein-coupled receptors (GPCR), which are complex membrane-associated receptors characterized by seven-transmembrane spanning domains. The intracellular portion of the FSH receptor is coupled to the G protein Gs and adenylyl cyclase. Upon receptor activation by binding of FSH within the extracellular domain of the receptor, a cascade of cAMP -protein kinase A mediated signaling events is initiated that ultimately leads to specific biological effects of FSH (see, e.g., Simoni et al, Endocr. Rev. 18:739-773 (1997)). Disorders and Conditions
[0065] In some embodiments, an Hh pathway modulator described herein is provided to a female subject to modulate one or more ovarian function. In some embodiments, an Hh pathway activator is provided to a female subject lacking or having a low level of ovarian function (e.g., relative to a control female subject). For example, an Hh pathway activator can be provided to a female subject to increase level of fertility relative to a control subject. In some embodiments, an Hh pathway activator is provided to a female subject to activate and/or increase ovarian function (e.g., a female subject in need thereof).
[0066] In some embodiments, an Hh pathway inhibitor is provided to a female subject having a normal or high level of ovarian function (e.g., relative to a control female subject). For example, an Hh pathway inhibitor can be provided to a female subject to decrease level of fertility relative to a control subject. In some embodiments, an Hh pathway inhibitor is provided to a female subject to reduce and/or inhibit ovarian function (e.g., a female subject in need thereof).
[0067] In some embodiments, ovarian function refers to ovulation and/or reproductive functions. In some embodiments, ovarian function is measured by determining levels of one or more hormones involved in ovulation and/or reproduction (e.g., determining levels of one or more hormones in blood serum). Such hormones include, without limitation, progesterone, estrogen, FSH, anti mullerian hormone (AMH), inhibin (e.g., inhibin B), and/or androgen (e.g., testosterone). Additionally or alternatively, ovarian function can be measured by determining preservation of oocytes and/or by ultrasound imaging of the ovary.
[0068] In some embodiments, an Hh pathway inhibitor described herein is provided to a subject, e.g., a subject suffering from or susceptible to a gynecologic condition. Gynecologic conditions that can be treated using an Hh pathway modulator described herein include, e.g., endometriosis and leiomyomata. In some embodiments, an Hh pathway inhibitor is provided to one or more of target cells or tissues of the ovaries. In some embodiments, target cells or tissues include those cells or tissues that display a disease-associated pathology, symptom, or feature.
[0069] In some embodiments, one or more symptoms of endometriosis and/or leiomyomata are reduced in a subject following provision of (e.g., administration of) an Hh pathway inhibitor described herein. For example, provision of (e.g., administration of) an Hh pathway inhibitor can decrease size of diseased tissue and/or lesions (e.g., measured by imaging, e.g., ultrasound, laparoscopy, or MRI), decrease pain (e.g., cyclical dysmennorhea and/or static pain), reduce bleeding, reduce impingement on adjacent organs (e.g., bowel, bladder, or ureter), result in regularizations of menses, and/or improve infertility.
[0070] In some embodiments, an Hh pathway activator described herein is provided to a subject, e.g., a subject having a defective level of FSH signaling (e.g., a level of FSH signaling that is lower than a control subject), e.g., in one or more target cells or tissues. In some embodiments, a subject having a defective level of FSH signaling has a reduced level of fertility, e.g., compared to a control subject, and an Hh pathway activator can increase level of fertility.
[0071] In some embodiments, an Hh pathway inhibitor described herein is provided to a male subject, e.g., to decrease levels of one or more hormones (e.g., testosterone or
dehydroepiandrosterone (DHEA)). In some embodiments, an Hh pathway inhibitor reduces spermatogenesis (e.g., as a male contraceptive). In some embodiments, an Hh pathway activator described herein is provided to a male subject, e.g., to increase levels of one or more hormones (e.g., testosterone or dehydroepiandrosterone (DHEA)). In some embodiments, an Hh pathway activator increases spermatogenesis (e.g., to increase level of fertility).
[0072] The term "improve," "increase" or "reduce," as used herein, indicates values that are relative to a control. In some embodiments, a suitable control is a baseline measurement, such as a measurement in the same individual prior to initiation of a treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of a treatment described herein. A "control individual" is an individual afflicted with a gynecologic condition, who is about the same age and/or gender as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
[0073] The individual (also referred to as "patient" or "subject") being treated is an individual having a condition described herein or having the potential to develop such condition. In some instances, a subject to be treated is genetically predisposed to developing a condition described herein. Targeting Agents
[0074] An Hh pathway modulator (e.g., an Hh pathway activator or inhibitor) described herein can be provided in association with and/or can include a targeting agent, such as an agent to localize an Hh pathway modulator to a specific target cell or target tissue (e.g., reproductive tissue).
[0075] The present disclosure is not limited to any particular targeting agent, and a variety of targeting agents can be used. Examples of such targeting agents include, but are not limited to, nucleic acids (e.g., R A and DNA), polypeptides (e.g., receptor ligands, signal peptides, avidin, Protein A, and antigen binding proteins), polysaccharides, biotin, hydrophobic groups, hydrophilic groups, drugs, and any organic molecules that bind to target cells or target tissues (e.g., receptors on target cells or target tissues).
[0076] Targeting agents can be associated with Hh pathway modulators in any of a number of ways. For example, polypeptide targeting agents can be coupled to or fused to an Hh pathway polypeptide. In other embodiments, a targeting agent is associated (e.g., covalently or noncovalently bound) to an Hh pathway modulator with either short (e.g., direct coupling), medium (e.g., using small-molecule bifunctional linkers such as SPDP (Pierce Biotechnology, Inc., Rockford, 111.)), or long (e.g., PEG bifunctional linkers (Nektar Therapeutics, Inc., San Carlos, Calif.)) linkages.
[0077] In some instances, targeting agents are or comprise antigen binding proteins or antibodies or binding portions thereof. Antibodies can be generated to allow for specific targeting of antigens or immunogens (e.g., target cell or target tissue specific antigens). Such antibodies include, but are not limited to, polyclonal antibodies; monoclonal antibodies or antigen binding fragments thereof; modified antibodies such as chimeric antibodies, reshaped antibodies, humanized antibodies, or fragments thereof (e.g., Fv, Fab', Fab, F(ab')2); or biosynthetic antibodies, e.g., single chain antibodies, single domain antibodies (DAB), Fvs, or single chain Fvs (scFv) (see, e.g., in Harlow et al, Using Antibodies: A Laboratory Manual: Portable Protocol I. Cold Spring Harbor Laboratory (Dec. 1, 1998); Zola, Monoclonal
Antibodies: Preparation and Use of Monoclonal Antibodies and Engineered Antibody
Derivatives, Springer Verlag (Dec. 15, 2000; 1st edition)). Antibody attachment can be performed by any known method e.g., through standard covalent binding to free amine groups (see, e.g., Torchilin et al., Hybridoma 6:229-240 (1987); Torchilin et al, Biochim. Biophys. Acta 1511 :397-411 (2001); Masuko et al, Biomacromol. 6:800-884 (2005)).
[0078] In some instances, a targeting agent is or comprises a nucleic acid (e.g., R A or
DNA). In some examples, nucleic acid targeting agents are designed to hybridize by base pairing to a particular nucleic acid (e.g., chromosomal DNA, mRNA, or ribosomal RNA). In some situations, nucleic acid targeting agents bind a ligand on a target cell or target tissue. For example, a nucleic acid can bind human nerve growth factor (Binkley et al., Nuc. Acids Res. 23:3198-205 (1995)). Nucleic acids that bind ligands can be identified by known methods, such as SELEX procedures (see, e.g., U.S. Pat. Nos. 5,475,096; 5,270,163; and 5,475,096; and WO 97/38134; WO 98/33941; and WO 99/07724). In some embodiments, targeting agents can be or comprise aptamers, for example that bind to particular sequences.
Therapeutic Administration
[0079] Hh pathway modulators (e.g., Hh pathway activators or inhibitors) described herein can be used to treat a gynecologic condition, e.g., subjects suffering from or susceptible to a gynecologic condition. The route and/or mode of administration of an Hh pathway modulator described herein can vary depending upon the desired results. One with skill in the art, i.e., a physician, is aware that dosage regimens can be adjusted to provide the desired response, e.g., a therapeutic response.
[0080] Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, oral, sublingual, intracerebral, intrathecal, intravaginal, transdermal, rectal, by inhalation, or topical, particularly to the ears, nose, eyes, or skin. The mode of administration is left to the discretion of the practitioner.
[0081] An Hh pathway modulator described herein can be formulated as a
pharmaceutical composition that includes a suitable amount of a physiologically acceptable excipient (see, e.g., Remington's Pharmaceutical Sciences pp. 1447-1676 (Alfonso R. Gennaro, ed., 19th ed. 1995)). Such physiologically acceptable excipients can be, e.g., liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. The physiologically acceptable excipients can be saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea and the like. In addition, auxiliary, stabilizing, thickening, lubricating, and coloring agents can be used. In one situation, the physiologically acceptable excipients are sterile when administered to an animal. The physiologically acceptable excipient should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of
microorganisms. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid excipients, particularly for injectable solutions. Suitable physiologically acceptable excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Other examples of suitable
physiologically acceptable excipients are described in Remington's Pharmaceutical Sciences pp. 1447-1676 (Alfonso R. Gennaro, ed., 19th ed. 1995). The pharmaceutical compositions, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
[0082] Liquid carriers can be used in preparing solutions, suspensions, emulsions, syrups, and elixirs. An Hh pathway modulator described herein can be suspended in a pharmaceutically acceptable liquid carrier such as water, an organic solvent, a mixture of both, or
pharmaceutically acceptable oils or fat. The liquid carrier can contain other suitable
pharmaceutical additives including solubilizers, emulsifiers, buffers, preservatives, sweeteners, flavoring agents, suspending agents, thickening agents, colors, viscosity regulators, stabilizers, or osmo-regulators. Suitable examples of liquid carriers for oral and parenteral administration include water (particular containing additives described herein, e.g., cellulose derivatives, including sodium carboxymethyl cellulose solution), alcohols (including monohydric alcohols and polyhydric alcohols, e.g., glycols) and their derivatives, and oils (e.g., fractionated coconut oil and arachis oil). For parenteral administration the carrier can also be an oily ester such as ethyl oleate and isopropyl myristate. The liquid carriers can be in sterile liquid form for administration. The liquid carrier for pressurized compositions can be halogenated hydrocarbon or other pharmaceutically acceptable propellant. [0083] In other instances, an Hh pathway modulator described herein is formulated for intravenous administration. Compositions for intravenous administration can comprise a sterile isotonic aqueous buffer. The compositions can also include a solubilizing agent. Compositions for intravenous administration can optionally include a local anesthetic such as lidocaine to lessen pain at the site of the injection. The ingredients can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water- free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent. Where an Hh pathway modulator described herein is administered by infusion, it can be dispensed, for example, with an infusion bottle containing sterile pharmaceutical grade water or saline. Where an Hh pathway modulator described herein is administered by injection, an ampule of sterile water for injection or saline can be provided so that the ingredients can be mixed prior to administration.
[0084] An Hh pathway modulator described herein can be administered rectally or vaginally in the form of a conventional suppository. Suppository formulations can be made using methods known to those in the art from traditional materials, including cocoa butter, with or without the addition of waxes to alter the suppository's melting point, and glycerin. Water- soluble suppository bases, such as polyethylene glycols of various molecular weights, can also be used.
[0085] The amount of an Hh pathway modulator described herein that is effective for treating a gynecologic condition can be determined using standard clinical techniques known to those with skill in the art. In addition, in vitro or in vivo assays can optionally be employed to help identify optimal dosage ranges. The precise dose to be employed can also depend on the route of administration, the condition, the seriousness of the condition being treated, as well as various physical factors related to the individual being treated, and can be decided according to the judgment of a health-care practitioner.
[0086] Compositions described herein (e.g., therapeutically effective amounts of compositions described herein) can be administered as single administrations or as multiple administrations. Such compositions can be administered at regular intervals, depending on the nature, severity and extent of the subject's condition (e.g., gynecologic condition). In some embodiments, a therapeutically effective amount of a therapeutic agent (e.g., an Hh pathway modulator) is administered periodically at regular intervals (e.g., once every year, once every six months, once every five months, once every three months, bimonthly (once every two months), monthly (once every month), biweekly (once every two weeks), or weekly).
[0087] As used herein, the term "therapeutically effective amount" is largely determined based on the total amount of the therapeutic agent contained in pharmaceutical compositions described herein. Generally, a therapeutically effective amount is sufficient to achieve a meaningful benefit to a subject (e.g., treating, modulating, curing, preventing and/or ameliorating a gynecologic condition). For example, a therapeutically effective amount can be an amount sufficient to achieve a desired therapeutic and/or prophylactic effect, such as an amount sufficient to treat a gynecologic condition or the symptoms thereof. Generally, the amount of a therapeutic agent (e.g., an Hh pathway modulator) administered to a subject in need thereof will depend upon the characteristics of the subject. Such characteristics include the condition, disease severity, general health, age, sex and body weight of the subject. One of ordinary skill in the art will be readily able to determine appropriate dosages depending on these and other related factors. In addition, both objective and subjective assays can optionally be employed to identify optimal dosage ranges. A therapeutically effective amount can be administered in a dosing regimen that can include multiple unit doses.
[0088] It is to be further understood that for any particular subject, specific dosage regimens can be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of an Hh pathway modulator and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed invention.
[0089] In some instances, a pharmaceutical composition described herein is in unit dosage form, e.g., as a tablet, capsule, powder, solution, suspension, emulsion, granule, or suppository. In such form, the pharmaceutical composition can be sub-divided into unit doses containing appropriate quantities of an Hh pathway modulator described herein. The unit dosage form can be a packaged pharmaceutical composition, for example, packeted powders, vials, ampoules, pre-filled syringes or sachets containing liquids. The unit dosage form can be, for example, a capsule or tablet itself, or it can be the appropriate number of any such compositions in package form. Such unit dosage form can contain from about 1 mg/kg to about 250 mg/kg, and can be given in a single dose or in two or more divided doses.
Gene Therapy
[0090] In embodiments in which an Hh pathway modulator consists of or comprises a nucleic acid encoding an Hh pathway polypeptide, the present disclosure includes methods of administering such nucleic acid to a subject. In some embodiments, a nucleic acid encoding an Hh pathway inhibitor (e.g., Ptc, Hhip, or SuFu polypeptide) is administered to a subject to treat a gynecologic condition.
[0091] In some embodiments, a nucleic acid encoding an Hh pathway polypeptide is inserted into a viral vector for delivery to a subject. For example, retrovirus vectors can be used as a recombinant delivery system for transferring nucleic acids encoding Hh pathway polypeptides in vivo (see, e.g., Dropulic, Hum. Gene Ther. 22:649-57 (2011); and Kumar et al, Curr. Gene Ther. 11 : 144-53 (2011)). Retroviruses useful in methods of the present disclosure include, but are not limited to, murine leukemia virus (MLV), human immunodeficiency virus (HIV), equine infectious anaemia virus (EIAV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), Avian myelocytomatosis virus-29 (MC29), Avian erythroblastosis virus (AEV) and all other retroviridiae including lentiviruses (see, e.g., Coffin et al, "Retroviruses", 1997 Cold Spring Harbor Laboratory Press Eds: J M Coffin, S M Hughes, H E Varmus, pp 758-763)). A replication defective retrovirus can be packaged into virions that can be used to infect a target cell through the use of a helper virus by standard techniques (see, e.g., Current Protocols in Molecular Biology, Ausubel, F. M. et al. (eds.) Greene Publishing Associates, (1989), Sections 9.10-9.14).
[0092] In other embodiments, adenovirus-derived vectors are used to deliver nucleic acids encoding Hh pathway polypeptides. The genome of an adenovirus can be manipulated such that it encodes and expresses an Hh pathway polypeptide, but is inactivated in terms of its ability to replicate in a normal lytic viral life cycle (see, e.g., Berkner et al. (1988) BioTechniques 6:616; Rosenfeld et al. (1991) Science 252:431-434; and Rosenfeld et al. (1992) Cell 68: 143-155). Suitable adenoviral vectors useful in the methods of the present disclosure include those derived from the adenovirus strain Ad type 5 dl324 or other strains of adenovirus (e.g., Ad2, Ad3, Ad7 etc.).
[0093] In some embodiments, an adeno-associated virus (AAV) is used to deliver a nucleic acid encoding an Hh pathway polypeptide (see, e.g., Muzyczka et al. (1992) Curr.
Topics in Micro, and Immunol. 158:97-129). A variety of nucleic acids have been introduced into different cell types using AAV vectors (see, e.g., Hermonat et al. (1984) Proc. Natl. Acad. Sci. USA 81 :6466-6470; Tratschin et al. (1985) Mol. Cell. Biol. 4:2072-2081; Wondisford et al. (1988) Mol. Endocrinol. 2:32-39; Tratschin et al. (1984) J. Virol. 51 :611-619; and Flotte et al. (1993) J. Biol. Chem. 268:3781-3790). Particularly useful AAVs include those that normally infect humans (e.g., serotypes 1, 2, 3A, 3B, 4, 5, and 6) or primates (e.g., serotypes 1 and 4).
[0094] In other embodiments, non-viral methods are useful to deliver a nucleic acid encoding an Hh pathway polypeptide to a subject. Such nonviral methods of gene transfer can exploit mechanisms normally used by mammalian cells for uptake and intracellular transport of macromolecules. For example, liposomal delivery systems, poly-lysine conjugates, and artificial viral envelopes can be used. In some embodiments, a nucleic acid encoding an Hh pathway polypeptide is entrapped in liposomes bearing positive charges on their surface (e.g., lipofectins). In some embodiments, a liposome can be conjugated to a targeting agent described herein (see, e.g., Mizuno et al. (1992) No Shinkei Geka 20:547-551).
[0095] Certain cationic polymers ("complexation agents") known to spontaneously bind to and condense nucleic acids into nanoparticles can also be used including, e.g., naturally occurring proteins, peptides, or derivatives, as well as synthetic cationic polymers such as polyethylenimine (PEI), polylysine (PLL), etc. Many useful polymers contain both chargeable amino groups, to allow for ionic interaction with negatively charged DNA phosphate, and a degradable region, such as a hydro lyzable ester linkage. Examples of these include, without limitation, poly(alpha-(4-aminobutyl)-L-glycolic acid), network poly(amino ester), and poly (beta-amino esters). Such complexation agents can protect DNA against degradation, e.g., by nucleases, serum components, etc., and create a less negative surface charge, which may facilitate passage through hydrophobic membranes (e.g., cytoplasmic, lysosomal, endosomal, nuclear) of the cell. Certain complexation agents facilitate intracellular trafficking events such as endosomal escape, cytoplasmic transport, and nuclear entry, and can dissociate from the nucleic acid.
Cell-based Therapy
[0096] An Hh pathway polynucleotide can also be advantageously provided to a cell ex vivo, followed by administration of the living cell to the subject. In some embodiments, primary or secondary cells are genetically engineered to express an Hh pathway polypeptide. Such cells can be obtained from a variety of tissues and include cell types which can be maintained propagated in culture. For example, primary and secondary cells include fibroblasts, endothelial cells, glial cells, and neural cells. In some embodiments, primary cells are obtained from an individual to whom a genetically engineered primary or secondary cells is to be administered. Primary cells can also be obtained from a donor (other than the recipient) of the same species or another species (e.g., mouse, rat, rabbit, cat, dog, pig, cow, bird, sheep, goat, horse).
[0097] Primary or secondary cells (e.g., of vertebrate or mammalian origin) can be transfected with a nucleic acid encoding an Hh pathway polypeptide. In some embodiments, a cell is transfected with an exogenous nucleic acid sequence that includes a nucleic acid encoding an Hh pathway polypeptide and an additional nucleic acid sequence (e.g., a regulatory sequence, e.g., a promoter, which causes expression, e.g., inducible expression or upregulation, of an endogenous Hh pathway sequence). Transfected primary or secondary cells may also include DNA encoding a selectable marker that confers a selectable phenotype upon them, facilitating their identification and isolation.
[0098] Methods for treating disease by implanting a cell that has been modified to express a recombinant protein are also well known. See, for example, U.S. Pat. No. 5,399,346. Although use of human cells for ex vivo therapy is preferred in some embodiments, other cells such as bacterial cells may be implanted in a subject's vasculature, continuously releasing a therapeutic agent. See, for example, U.S. Pat. Nos. 4,309,776 and 5,704,910. Combination Therapy
[0099] In some embodiments, an Hh pathway modulator described herein is administered to a subject in combination with one or more additional therapies, e.g., to treat a gynecologic condition or one or more symptoms of a gynecologic condition. For example, an Hh pathway modulator can be administered in combination with vismodegib (Erivedge™, Genentech, San Francisco, CA).
[0100] In some embodiments, combined administration of an Hh pathway modulator and a second agent results in an improvement in a gynecologic condition or a symptom thereof to an extent that is greater than one produced by either the Hh pathway modulator or the second agent alone. The difference between the combined effect and the effect of each agent alone can be a statistically significant difference.
[0101] In some embodiments, combined administration of an Hh pathway modulator and a second agent allows administration of the second agent at a reduced dose, at a reduced number of doses, and/or at a reduced frequency of dosage compared to a standard dosing regimen approved for the second agent. For example, approved standard regimen for Erivedge™ is 150 mg once daily. Accordingly, for administration in combination with an Hh pathway modulator, a therapeutically effective amount of Erivedge™ can be a dosage of less than about 150 mg and/or a frequency of greater than about once daily.
Kits
[0102] An Hh pathway modulator described herein (e.g., a pharmaceutical composition comprising an Hh pathway modulator) can be provided in a kit. In some instances, the kit includes (a) a container that contains an Hh pathway modulator described herein (e.g., a pharmaceutical composition comprising an Hh pathway modulator) and, optionally (b) informational material. The informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of an Hh pathway modulator, e.g., for therapeutic benefit.
[0103] The informational material of the kits is not limited in its form. In some instances, the informational material can include information about production of an Hh pathway modulator, molecular weight of an Hh pathway modulator, concentration, date of expiration, batch or production site information, and so forth. In other situations, the informational material relates to methods of administering an Hh pathway modulator, e.g., in a suitable amount, manner, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein). The method can be a method of treating a subject having a gynecologic condition.
[0104] In some cases, the informational material, e.g., instructions, is provided in printed matter, e.g., a printed text, drawing, and/or photograph, e.g., a label or printed sheet. The informational material can also be provided in other formats, such as Braille, computer readable material, video recording, or audio recording. In other instances, the informational material of the kit is contact information, e.g., a physical address, email address, website, or telephone number, where a user of the kit can obtain substantive information about an Hh pathway modulator therein and/or their use in the methods described herein. The informational material can also be provided in any combination of formats.
[0105] In addition to an Hh pathway modulator, a kit can include other ingredients, such as a solvent or buffer, a stabilizer, or a preservative. A kit can also include other agents, e.g., a second or third agent, e.g., other therapeutic agents. The components can be provided in any form, e.g., liquid, dried or lyophilized form. The components can be substantially pure (although they can be combined together or delivered separate from one another) and/or sterile. When the components are provided in a liquid solution, the liquid solution can be an aqueous solution, such as a sterile aqueous solution. When the components are provided as a dried form, reconstitution generally is by the addition of a suitable solvent. The solvent, e.g., sterile water or buffer, can optionally be provided in the kit.
[0106] A kit can include one or more containers for an Hh pathway modulator and/or other agents. In some cases, a kit contains separate containers, dividers or compartments for an Hh pathway modulator and informational material. For example, an Hh pathway modulator can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet. In other situations, the separate elements of a kit are contained within a single, undivided container. For example, an Hh pathway modulator can be contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label. In some cases, a kit can include a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of an Hh pathway modulator. Containers can include a unit dosage, e.g., a unit that includes an Hh pathway modulator. For example, a kit can include a plurality of syringes, ampules, foil packets, blister packs, or medical devices, e.g., each containing a unit dose. The containers of kits can be air tight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.
[0107] A kit can optionally include a device suitable for administration of an Hh pathway modulator, e.g., a syringe or other suitable delivery device. A device can be provided preloaded with an Hh pathway modulator, e.g., in a unit dose, or can be empty, but suitable for loading.
Methods of Identifying Modulators of Hh Pathway Polypeptide Expression or Activity
[0108] Hh pathway polypeptides described herein (e.g., Boc, Cdo, Gasl, Gli, Hh, Hhip,
Ptc, Smo, or SuFu polypeptides) are useful for identifying agents that can be potentially used to treat a disorder described herein, e.g., a gynecologic disorder. For example, an agent that increases expression or activity of a Ptc, Hhip, and/or SuFu polypeptide, or an agent that decreases expression or activity of an Hh, Cdo, Boc, Gasl, Smo, or Gli polypeptide can be identified as an agent that can be used to treat a gynecologic disorder. Numerous methods exist for evaluating whether an agent alters Hh pathway polypeptide expression or Hh pathway polypeptide activity or level. In one embodiment, the ability of a test agent to modulate (e.g., increase or decrease) (e.g., permanently or temporarily) expression from an Hh pathway polynucleotide promoter is evaluated by e.g., routine reporter (e.g., LacZ, luciferase, or GFP) transcription assay. For example, a cell or transgenic animal whose genome comprises a reporter gene operably linked to an Hh pathway polynucleotide promoter, can be contacted with a test agent, and the ability of the test agent to increase or decrease reporter activity is indicative of the ability of the agent to modulate an Hh pathway polypeptide.
[0109] In some embodiments, effects of a test agent on Hh pathway polypeptide expression or Hh pathway polypeptide activity or level can be evaluated in a cell, cell lysate, or subject, preferably a non-human experimental mammal, and more preferably a rodent (e.g., a rat, mouse, rabbit), or explant thereof. Methods of assessing Hh pathway polypeptide expression are well known in the art, e.g., Northern analysis, ribonuclease protection assay, reverse transcription-polymerase chain reaction (RT-PCR) or RNA in situ hybridization (see, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual (3rd ed. 2001)). The level of Hh pathway polypeptide can be monitored by, e.g., Western analysis, immunoassay, or in situ hybridization. In some embodiments, a DNA construct encoding an Hh pathway
polypeptide/GFP fusion protein is transfected into cells, and level of GFP fluorescence in the presence or absence of a test agent is determined. An increase in fluorescence in the presence of the test agent is indicative of the ability of the test agent to increase Hh pathway polypeptide level.
[0110] In some embodiments, the effect of a test agent on Hh pathway polypeptide expression or Hh pathway polypeptide activity or level is confirmed in a second assay, e.g., is observed as a change, in the presence of the test agent, in the ability of the Hh pathway polypeptide to activate or inhibit an Hh signaling pathway.
[0111] Agents and test agents to be used in the methods described herein include crude or partially or substantially purified extracts of organic sources, e.g., botanical (e.g., herbal) and algal extracts, inorganic elements or compounds, as well as partially or substantially purified or synthetic agents, e.g., small molecules, polypeptides, antibodies, and polynucleotides, and libraries of these.
[0112] In one example, combinatorial chemical libraries can be produced or obtained that sample chemical compounds that are structurally or chemically related or unrelated. Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Pat. No. 5,010,175; Furka, Int. J. Pept. Prot. Res. 37:487-493 (1991); and Houghton et al, Nature 354:84-88 (1991)). Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (e.g., PCT Publication No. WO 91/19735), encoded peptides (e.g., PCT Publication No. WO 93/20242), random bio-oligomers (e.g., PCT Publication No. WO 92/00091), benzodiazepines (e.g., U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al, Proc. Nat. Acad. Sci. USA 90:6909-6913 (1993)), vinylogous polypeptides (Hagihara et al, J. Amer. Chem. Soc. 114:6568 (1992)), nonpeptidal peptidomimetics with glucose scaffolding (Hirschmann et al, J. Amer. Chem. Soc. 114:9217-9218 (1992)), analogous organic syntheses of small compound libraries (Chen et al., J. Amer. Chem. Soc. 116:2661 (1994)), oligocarbamates (Cho et al., Science 261 : 1303 (1993)), and/or peptidyl phosphonates (Campbell et al, J. Org. Chem. 59:658 (1994)), nucleic acid libraries, peptide nucleic acid libraries (see, e.g., U.S. Pat. No. 5,539,083), antibody libraries (see, e.g., Vaughn et al, Nature Biotechnology, 14(3):309-314 (1996) and PCT/US96/10287), carbohydrate libraries (see, e.g., Liang et al, Science, 274:1520-1522 (1996) and U.S. Pat. No. 5,593,853), and small organic molecule libraries (see, e.g., benzodiazepines, Baum C&EN, January 18, page 33 (1993); isoprenoids, U.S. Pat. No. 5,569,588; thiazolidinones and metathiazanones, U.S. Pat. No. 5,549,974; pyrrolidines, U.S. Pat. Nos. 5,525,735 and 5,519,134; morpholino compounds, U.S. Pat. No. 5,506,337; benzodiazepines, U.S. Pat. No. 5,288,514, and the like).
[0113] All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described herein.
[0114] The disclosure is further illustrated by the following examples. The examples are provided for illustrative purposes only. They are not to be construed as limiting the scope or content of the disclosure in any way.
EXAMPLES
Example 1 - Case Study of Patient Treated with Vismodegib (Erivedge™)
[0115] A 34 year old nulliparous woman with a known diagnosis of Gorlin syndrome
(Basal cell carcinoma nevus syndrome: Online Mendelian Inheritance in Man #109400) presented with more than 100 discrete BCC papules on the upper trunk and head, and neck regions. She was diagnosed and treated for lymphoma in 1988, prior to the BCCNS diagnosis and received chemotherapy and radiation therapy to the mantle zone, followed by radical neck dissection. She has remained in remission and her therapy had no apparent effect on menstrual function. She experienced menarche at age 13 and had regular menses at 30 to 35 day intervals until starting the current therapy. Medications included synthroid 0.15 mg for longstanding hypothyroidism.
[0116] On exam, she demonstrated prominent sclerosis of the lateral neck areas, consistent with chronic surgery and radiation changes. Several of her BCC lesions, while not clinically large, appeared in this area of combined radiation and surgical sclerosis overlying the carotid sheath. Multidisciplinary consultation recommended against further surgery. She commenced therapy with vismodegib (Erivedge™ Genentech, Inc., San Francisco, CA) 150 mg daily. One month later, she became amenorrheic. Approximately four months later, she developed hair loss, slight dysgeusia, and minor leg cramping. Six months after commencing therapy, she had near complete clinical resolution of all lesions. Shortly thereafter she underwent a reproductive endocrinology evaluation. Pertinent exam findings included evidence of moderate atrophic vaginal changes suggesting hypoestrogenism. Transvaginal
ultrasonography revealed a small, retroflexed uterus with a small pedunculated leiomyoma and normal ovaries, bilaterally containing multiple pre-antral follicles.
[0117] Results of reproductive endocrine testing were unique and novel (Table 1). Her elevated FSH and low estrogen level were indicative of a markedly diminished ovarian reserve. However, the presence of preantral follicles and the high AMH value indicated preservation of normal ovarian potential and possible reversal of effect following cessation of therapy. These findings suggest that the hedgehog pathway may be involved in FSH cell signaling action at the ovarian follicle level wherein normal FSH action is blocked interrupting the negative feedback mechanism of FSH suppression via estradiol and inhibin. Table 1.
Figure imgf000039_0001
Conclusion
[0118] The endocrine profile of a patient who developed amenorrhea while taking vismodegib (Erivedge™) was determined. Endocrine testing of this patient suggested the ovary was in a senescent state, resulting in secondary amenorrhea. Secondary amenorrhea, absence of established menses, may result from a variety of conditions, including suppression of the pituitary release of FSH or its hypothalamic control via gonadotropin releasing hormone GnRH. This can be drug induced, but patients presenting in this manner typically have very low or non- detectable gonadotropin (FSH and LH) levels and low estrogen levels. Alternatively, patients with ovarian failure (follicle depletion or menopause) present with high gonadotropins, which may be induced by radiation and/or medication such as chemotherapy. This patient's prior lymphoma therapy could have produced such a scenario, but onset 23 years after completing treatment and the abrupt occurrence of amenorrhea after years of regular menses following initiation of vismodegib suggested this was unlikely. [0119] Most extraordinary, the paradoxical evidence suggesting a diminished ovarian reserve with elevated FSH and LH levels and low estradiol level, contrasted with a normal anti- mullerian hormone (AMH) level and ultrasound evidence of a normal ovarian preantral follicle count implying normal reproductive potential, provided strong evidence of a unique effect of vismodegib on the FSH receptor and its ligand-dependent signaling. This led to the conclusion that the cause of ammenorrhea in at least this female patient treated with visomdegib was due to blockage of the follicle stimulating hormone (FSH) receptor (FSH-R) signaling. Thus, vismodegib blocked the action of FSH on the FSH-R, preventing FSH-R-mediated signal transduction.
EQUIVALENTS
[0120] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
SEQUENCES
Boc nucleotide sequence - NM 033254.2 (SEP ID NO: l
gtttctcatagttggcgtcttctaaaggaaaaacactaaaatgaggaactcagcggaccgggagcgacgcagcttgagggaagcat ccctagctgttggcgcagaggggcgaggctgaagccgagtggcccgaggtgtctgaggggctggggcaaaggtgaaagagtttcag aacaagcttcctggaacccatgacccatgaagtcttgtcgacatttataccgtctgagggtagcagctcgaaagtagaagaagtgg agtgttgccagggacggcagtatctctttgtgtgaccctggcggcttatgggacgttggcttcagacctttgtgatacaccatgct gcgtgggacgatgacggcgtggagaggaatgaggcctgaggtcacactggcttgcctcctcctagccacagcaggctgctttgctg acttgaacgaggtccctcaggtcaccgtccagcctgcgtccaccgtccagaagcccggaggcactgtgatcttgggctgcgtggtg gaacctccaaggatgaatgtaacctggcgcctgaatggaaaggagctgaatggctcggatgatgctctgggtgtcctcatcaccca cgggaccctcgtcatcactgcccttaacaaccacactgtgggacggtaccagtgtgtggcccggatgcctgcgggggctgtggcca gcgtgccagccactgtgacactagccaatctccaggacttcaagttagatgtgcagcacgtgattgaagtggatgagggaaacaca gcagtcattgcctgccacctgcctgagagccaccccaaagcccaggtccggtacagcgtcaaacaagagtggctggaggcctccag aggtaactacctgatcatgccctcagggaacctccagattgtgaatgccagccaggaggacgagggcatgtacaagtgtgcagcct acaacccagtgacccaggaagtgaaaacctccggctccagcgacaggctacgtgtgcgccgctccaccgctgaggctgcccgcatc atctaccccccagaggcccaaaccatcatcgtcaccaaaggccagagtctcattctggagtgtgtggccagtggaatcccaccccc acgggtcacctgggccaaggatgggtccagtgtcaccggctacaacaagacgcgcttcctgctgagcaacctcctcatcgacacca ccagcgaggaggactcaggcacctaccgctgcatggccgacaatggggttgggcagcccggggcagcggtcatcctctacaatgtc caggtgtttgaaccccctgaggtcaccatggagctatcccagctggtcatcccctggggccagagtgccaagcttacctgtgaggt gcgtgggaaccccccgccctccgtgctgtggctgaggaatgctgtgcccctcatctccagccagcgcctccggctctcccgcaggg ccctgcgcgtgctcagcatggggcctgaggacgaaggcgtctaccagtgcatggccgagaacgaggttgggagcgcccatgccgta gtccagctgcggacctccaggccaagcataaccccaaggctatggcaggatgctgagctggctactggcacacctcctgtatcacc ctccaaactcggcaaccctgagcagatgctgagggggcaaccggcgctccccagacccccaacgtcagtggggcctgcttccccgc agtgtccaggagagaaggggcagggggctcccgccgaggctcccatcatcctcagetcgccccgcacctccaagacagacteatat gaactggtgtggcggcctcggcatgagggcagtggccgggcgccaatcctctactatgtggtgaaacaccgcaaggtcacaaattc ctctgacgattggaccatctctggcattccagccaaccagcaccgcctgaccctcaccagacttgaccccgggagcttgtatgaag tggagatggcagcttacaactgtgcgggagagggccagacagccatggtcaccttccgaactggacggcggcccaaacccgagatc atggccagcaaagagcagcagatccagagagacgaccctggagccagtccccagagcagcagccagccagaccacggccgcctctc ccccccagaagctcccgacaggcccaccatctccacggcctccgagacctcagtgtacgtgacctggattccccgtgggaatggtg ggttcccaatccagtccttccgtgtggagtacaagaagctaaagaaagtgggagactggattctggccaccagcgccatcccccca tcgcggctgtccgtggagatcacgggcctagagaaaggcacctcctacaagtttcgagtccgggctctgaacatgctgggggagag cgagcccagcgccccctctcggccctacgtggtgtcgggctacagcggtcgcgtgtacgagaggcccgtggcaggtccttatatca ccttcacggatgcggtcaatgagaccaccatcatgctcaagtggatgtacatcccagcaagtaacaacaacaccccaatccatggc ttttatatctattatcgacccacagacagtgacaatgatagtgactacaagaaggatatggtggaaggggacaagtactggcactc catcagccacctgcagccagagacctcctacgacattaagatgcagtgcttcaatgaaggaggggagagcgagttcagcaacgtga tgatctgtgagaccaaagctcggaagtcttctggccagcctggtcgactgccacccccaactctggccccaccacagccgcccctt cctgaaaccatagagcggccggtgggcactggggccatggtggctcgctccagcgacctgccctatctgattgtcggggtcgtcct gggctccatcgttctcateatcgtcacctteatccccttctgcttgtggagggcctggtctaagcaaaaacatacaacagacctgg gttttcctcgaagtgcccttccaccctcctgcccgtatactatggtgccattgggaggactcccaggccaccaggccagtggacag ccctacctcagtggcatcagtggacgggcctgtgctaatgggatccacatgaataggggctgcccctcggctgcagtgggctaccc gggcatgaagccccagcagcactgcccaggcgagcttcagcagcagagtgacaccagcagcctgctgaggcagacccatcttggca atggatatgacccccaaagtcaccagatcacgaggggtcccaagtctagcccggacgagggctctttcttatacacactgcccgac gactccactcaccagctgctgcagccccatcacgactgctgccaacgccaggagcagcctgctgctgtgggccagtcaggggtgag gagagcccccgacagtcctgtcctggaagcagtgtgggaccctccatttcactcagggcccccatgctgcttgggccttgtgccag ttgaagaggtggacagtcctgactcctgccaagtgagtggaggagactggtgtccccagcaccccgtaggggcctacgtaggacag gaacctggaatgcagctctccccggggccactggtgcgtgtgtcttttgaaacaccacctctcacaatttaggcagaagctgatat cccagaaagactatatattgttttttttttaaaaaaaaaaagaagaaaaaagagacagagaaaattggtatttatttttctattat agccatatttatatatttatgcacttgtaaataaatgtatatgttttataattctggagagacataaggagtcctacccgttgagg ttggagagggaaaataaagaagctgccacctaacaggagtcacccaggaaagcaccgcacaggctggcgcgggacagactcctaac ctggggcctctgcagtggcaggcgaggctgcaggaggcccacagataagctggcaagaggaaggatcccaggcacatggttcatca cgagcatgagggaacagcaaggggcacggtatcacagcctggagacacccacacagatggctggatccggtgctacgggaaacatt ttcctaagatgcccatgagaacagaccaagatgtgtacagcactatgagcattaaaaaaccttccagaatcaataatccgtggcaa catatctctgtaaaaacaaacactgtaacttctaaataaatgtttagtcttccctgtaaccttcaaaaaaaaaaaaaaa
Boc amino acid sequence - NP 150279.1 (SEP ID NO:2
MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCWEPPRMNVTWRLNGKELNGSDDALGVLI THGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEA SRGNYLIMPSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARI IYPPEAQTIIVTKGQSLILECVASGIP PPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCMADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTC EVRGNPPPSVLWLRNAVPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQDAELATGTPPV SPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSSPRTSKTDSYELVWRPRHEGSGRAPILYYVVKHRKVT NSSDDWTISGIPANQHRLTLTRLDPGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPDHGR LSPPEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIPPSRLSVEITGLEKGTSYKFRVRALNMLG ESEPSAPSRPYWSGYSGRVYERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYW ΗΞΙSHLQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPLPETIERPVGTGAMVARSSDLPYLIVGV VLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPPSCPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVG YPGMKPQQHCPGELQQQSDTSSLLRQTHLGNGYDPQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDCCQRQEQPAAVGQSG VRRAPDSPVLEAVWDPPFHSGPPCCLGLVPVEEVDSPDSCQVSGGDWCPQHPVGAYVGQEPGMQLSPGPLVRVSFETPPLTI
Cdo nucleotide sequence - FB701823.1 (SEP ID NO:3
gtttctcatagttggcgtcttctaaaggaaaaacactaaaatgaggaactcagcggaccgggagcgacgcagcttgagggaagcat ccctagctgttggcgcagaggggcgaggctgaagccgagtggcccgaggtgtctgaggggctggggcaaaggtgaaagagtttcag aacaagcttcctggaacccatgacccatgaagtcttgtcgacatttataccgtctgagggtagcagctcgaaactagaagaagtgg agtgttgccagggacggcagtatctctttgtgtgaccctggcggcctatgggacgttggcttcagacctttgtgatacaccatgct gcgtgggacgatgacggcgtggagaggaatgaggcctgaggtcacactggcttgcctcctcctagccacagcaggctgctttgctg acttgaacgaggtccctcaggtcaccgtccagcctgcgtccaccgtccagaagcccggaggcactgtgatcttgggctgcgtggtg gaacctccaaggatgaatgtaacctggcgcctgaatggaaaggagctgaatggctcggatgatgctctgggtgtcctcatcaccca cgggaccctcgtcatcactgcccttaacaaccacactgtgggacggtaccagtgtgtggcccggatgcctgcgggggctgtggcca gcgtgccagccactgtgacactagccaatctccaggacttcaagttagatgtgcagcacgtgattgaagtggatgagggaaacaca gcagtcattgcctgccacctgcctgagagccaccccaaagcccaggtccggtacagcgtcaaacaagagtggctggaggcctccag aggtaactacctgatcatgccctcagggaacctccagattgtgaatgccagccaggaggacgagggcatgtacaagtgtgcagcct acaacccagtgacccaggaagtgaaaacctccggctccagcgacaggctacgtgtgcgccgctccaccgctgaggctgcccgcatc atctaccccccagaggcccaaaccatcatcgtcaccaaaggccagagtctcattctggagtgtgtggccagtggaatcccaccccc acgggtcacctgggccaaggatgggtccagtgtcaccggctacaacaagacgcgcttcctgctgagcaacctcctcatcgacacca ccagcgaggaggactcaggcacctaccgctgcatggccgacaatggggttgggcagcccggggcagcggtcatcctctacaatgtc caggtgtttgaaccccctgaggtcaccatggagctatcccagctggtcatcccctggggccagagtgccaagcttacctgtgaggt gcgtgggaaccccccgccctccgtgctgtggctgaggaatgctgtgcccctcatctccagccagcgcctccggctctcccgcaggg ccctgcgcgtgctcagcatggggcctgaggacgaaggcgtctaccagtgcatggccgagaacgaggttgggagcgcccatgccgta gtccagctgcggacctccaggccaagcataaccccaaggctatggcaggatgctgagctggctactggcacacctcctgtatcacc ctccaaactcggcaaccctgagcagatgctgagggggcaaccggcgctccccagacccccaacgtcagtggggcctgcttccccga agtgtccaggagagaaggggcagggggctcccgccgaggctcccatcatcctcagetcgccccgcacctccaagacagacteatat gaactggtgtggcggcctcggcatgagggcagtggccgggcgccaatcctctactatgtggtgaaacaccgcaagcaggtcacaaa ttcctctgacgattggaccatctctggcattccagccaaccagcaccgcctgaccctcaccagacttgaccccgggagcttgtatg aagtggagatggcagcttacaactgtgcgggagagggccagacagccatggtcaccttccgaactggacggcggcccaaacccgag atcatggccagcaaagagcagcagatccagagagacgaccctggagccagtccccagagcagcagccagccagaccacggccgcct ctcccccccagaagctcccgacaggcccaccatctccacggcctccgagacctcagtgtacgtgacctggattccccgtgggaatg gtgggttcccaatccagtccttccgtgtggagtacaagaagctaaagaaagtgggagactggattctggccaccagcgccatcccc ccatcgcggctgtccgtggagatcacgggcctagagaaaggcacctcctacaagtttcgagtccgggctctgaacatgctggggga gagcgagcccagcgccccctctcggccctacgtggtgtcgggctacagcggtcgcgtgtacgagaggcccgtggcaggtccttata tcaccttcaeggatgcggtcaatgagaccaccatcatgctcaagtggatgtacatcccagcaagtaacaacaacaccccaatccat ggcttttatatctattatcgacccacagacagtgacaatgatagtgactacaagaaggatatggtggaaggggacaagtactggca ctccatcagccacctgcagccagagacctcctacgacattaagatgcagtgcttcaatgaaggaggggagagcgagttcagcaacg tgatgatctgtgagaccaaagctcggaagtcttctggccagcctggtcgactgccacccccaactctggccccaccacagccgccc cttcctgaaaccatagagcggccggtgggcactggggccatggtggctcgctccagcgacctgccctatctgattgtcggggtcgt cctgggctccatcgttctcatcatcgtcaccttcatccccttctgcttgtggagggcctggtctaagcaaaaacatacaacagacc tgggttttcctcgaagtgcccttccaccctcctgcccgtatactatggtgccattgggaggactcccaggccaccaggccagtgga cagccctacctcagtggcatcagtggacgggcctgtgctaatgggatccacatgaataggggctgcccctcggctgcagtgggcta cccgggcatgaagccccagcagcactgcccaggcgagcttcagcagcagagtgacaccagcagcctgctgaggcagacccatcttg gcaatggatatgacccccaaagtcaccagatcacgaggggtcccaagtctagcccggacgagggctctttcttatacacactgccc gacgactccactcaccagctgctgcagccccatcacgactgctgccaacgccaggagcagcctgctgctgtgggccagtcaggggt gaggagagcccccgacagtcctgtcctggaagcagtgtgggaccctccatttcactcagggcccccatgctgcttgggccttgtgc cagttgaagaggtggacagtcctgactcctgccaagtgagtggaggagactggtgtccccagcaccccgtaggggcctacgtagga caggaacctggaatgcagctctccccggggccactggtgcgtgtgtcttttgaaacaccacctctcacaatttaggcagaagctga tatcccagaaagactatatattgttttttttttaaaaaaaaaagaagaaaaaagagacagagaaaattggtatttatttttctatt atagccatatttatatatttatgcacttgtaaataaatgtatatgttttataattctggagagacataaggagtcctacccgttga ggttggagagggaaaataaagaagctgccacctaacaggagtcacccaggaaagcaccgcacaggctggcgcgggacagactccta acctggggcctctgcagtggcaggcgaggctgcaggaggcccacagataagctggcaagaggaaggatcccaggcacatggttcat cacgagcatgagggaacagcaaggggcacggtatcacagcctggagacacccacacagatggctggatccggtgctacgggaaaca ttttcctaagatgcccatgagaacagaccaagatgtgtacagcactatgagcattaaaaaaccttccagaatcaataatccgtggc aacatatctctgtaaaaacaaacactgtaacttctaaataaatgtttagtcttccctgtaaaa
Cdo amino acid sequence - NP 001230526.1 (SEP ID NO:4
MHPDLGPLCTLLYVTLTILCSSVSSDLAPYFTSEPLSAVQKLGGPWLHCSAQPVTTRISWLHNGKTLDGNLEHVKIHQGTLTILS LNSSLLGYYQCLANNSIGAIVSGPATVSVAVLGDFGSSTKHVITAEEKSAGFIGCRVPESNPKAEVRYKIRGKWLEHSTENYLILP SGNLQILNVSLEDKGSYKCAAYNPVTHQLKVEPIGRKLLVSRPSSDDVHILHPTHSQALAVLSRSPVTLECWSGVPAPQVYWLKD GQDIAPGSNWRRLYSHLATDSVDPADSGNYSCMAGNKSGDVKYVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPNCT WFHNAQPIHPSARHLTAGNGLKISGVTVEDVGMYQCVADNGIGFMHSTGRLEIENDGGFKPVI ITAPVSAKVADGDFVTLSCNASG LPVPVIRWYDSHGLITSHPSQVLRSKSRKSQLSRPEGLNLEPVYFVLSQAGASSLHIQAVTQEHAGKYICEAANEHGTTQAEASLM VVPFETNTKAETVTLPDAAQNDDRSKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPI ILSPPQTHTPDTYNLVWRAGK DGGLPINAYFVKYRKLDDGVGMLGSWHTVRVPGSENELHLAELEPSSLYEVLMVARSAAGEGQPAMLTFRTSKEKTASSKNTQASS PPVGIPKYPVVSEAANNNFGVVLTDSSRHSGVPEAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRTSNWLVAAEDIP PSKLSVEVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVVGFPNRFSSRPITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQ GFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYDIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSL GSGGNVGPATSPARSSDMLYLIVGCVLGVMVLILMVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDMNGQMVDYTTLSGASQINGNV HGGFLTNGGLSSGYSHLHHKVPNAVNGIVNGSLNGGLYSGHSNSLTRTHVDFEHPHHLVNGGGMYTAVPQIDPLECVNCRNCRNNN RCFTKTNSTFSSSPPPVVPWAPYPQDGLEMKPLSHVKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSED PAEFSRGQEGMINLRIPDHLQLAKSCVWEGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRET
Gasl nucleotide sequence - BC136586.1 (SEP ID NO:5
caaacttttccaccggctccgcgtccgccgctccccgcgcctcgtctcctttcccctcctctcccggcggccgccgctgcccgcga tggtggccgcgctgctgggcggcggcggcgaggcccgcggggggacagtgccgggcgcctggctgtgcctgatggcgctgctgcag ctgctgggctcggcgccgcggggatcggggctggcgcacggccgccgcctcatctgctggcaggcgctgctgcagtgccaggggga gccggagtgcagctacgcctacaaccaatacgccgaggcgtgcgcgccggtgctggcgcagcacggcgggggcgacgcgcccgggg ccgccgccgccgctttcccggcctcggccgcctctttctcgtcgcgctggcgctgcccgagtcactgcatctcggccctcattcag ctcaaccacacgcgccgcgggcccgccctggaggactgtgactgcgcgcaggacgagaactgcaagtccaccaagcgcgccattga gccgtgcctgccccggacgagcggcggcggcgcgggcggccccggcgcgggcggggtcatgggctgcaccgaggcccggcggcgct gcgaccgcgacagccgctgcaacctggcgctgagccgctacctgacctactgcggcaaagtcttcaacgggctgcgctgcacggac gaatgccgcaccgtcattgaggacatgctggctatgcccaaggcggcgctgctcaacgactgcgtgtgcgacggcctcgagcggcc catctgcgagtcggtcaaggagaacatggcccgcctgtgcttcggcgccgagctgggcaacggccccggcagcagcggctcggacg ggggcctggacgactactacgatgaggactacgatgacgagcagcgcaccgggggcgcgggtggtgagcagccgctggacgacgac gacggcgtcccgcacccaccgcgcccgggcagcggcgctgctgcatcgggcggccgcggggacctgccctatgggcctgggcgcag gagcagcggcggcggcggccgcttggcgccccggggcgcctggaccccactcgcctccatcttgctgctgctgcttgggccgctct tttagccctcgcgccccccgccgttggctgcgggagagcccgcgtcccactcccgtgctcgcctcgaccccgcgccgggcacctgt ggcttgggacagatagaagggatggttggggatacttcccaaaactttttccaagtcaacttggtgtagccggttccccggccacg actctgggcacttcccctgaagctcctctccggagct
Gasl amino acid sequence - CAH71308.1 (SEP ID NO:6
MVAALLGGGGEARGGTVPGAWLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPECSYAYNQYAEACAPVLAQHGGGDAPG AAAAAFPASAASFSSRWRCPSHCISALIQLNHTRRGPALEDCDCAQDENCKSTKRAIEPCLPRTSGGGAGGPGAGGVMGCTEARRR CDRDSRCNLALSRYLTYCGKVFNGLRCTDECRTVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSD GGLDDYYDEDYDDEQRTGGAGGEQPLDDDDGVPHPPRPGSGAAASGGRGDLPYGPGRRSSGGGGRLAPRGAWTPLASILLLLLGPL F
Glil nucleotide sequence - NM 005269.2 (SEP ID NO:7
atgttcaactcgatgaccccaccaccaatcagtagctatggcgagccctgctgtctccggcccctccccagtcagggggcccccag tgtggggacagaaggactgtctggcccgcccttctgccaccaagctaacctcatgtccggcccccacagttatgggccagccagag agaccaacagctgcaccgagggcccactcttttcttctccccggagtgcagtcaagttgaccaagaagcgggcactgtccatctca cctctgtcggatgccagcctggacctgcagacggttatccgcacctcacccagctccctcgtagctttcatcaactcgcgatgcac atctccaggaggctcctacggtcatctctccattggcaccatgagcccatctctgggattcccagcccagatgaatcaccaaaaag ggccctcgccttcctttggggtccagccttgtggtccccatgactctgcccggggtgggatgatcccacatcctcagtcccgggga cccttcccaacttgccagetgaagtctgagetggacatgctggttggcaagtgccgggaggaacccttggaaggtgatatgtccag ccccaactccacaggcatacaggatcccctgttggggatgctggatgggcgggaggacctcgagagagaggagaagcgtgagcctg aatctgtgtatgaaactgactgccgttgggatggctgcagccaggaatttgactcccaagagcagctggtgcaccacatcaacagc gagcacatccacggggagcggaaggagttcgtgtgccactgggggggctgctccagggagctgaggcccttcaaagcccagtacat gctggtggttcacatgcgcagacacactggcgagaagccacacaagtgcacgtttgaagggtgccggaagtcatactcacgcctcg aaaacctgaagacgcacctgcggtcacacacgggtgagaagccatacatgtgtgagcacgagggctgcagtaaagccttcagcaat gccagtgaccgagccaagcaccagaatcggacccattccaatgagaagccgtatgtatgtaagctccctggctgcaccaaacgcta tacagatcctagctcgctgcgaaaacatgtcaagacagtgcatggtcctgacgcccatgtgaccaaacggcaccgtggggatggcc ccctgcctcgggcaccatccatttctacagtggagcccaagagggagcgggaaggaggtcccatcagggaggaaagcagactgact gtgccagagggtgccatgaagccacagccaagccctggggcccagtcatcctgcagcagtgaccactccccggcagggagtgcagc caatacagacagtggtgtggaaatgactggcaatgcagggggcagcactgaagacctctccagcttggacgagggaccttgcattg ctggcactggtctgtccactcttcgccgccttgagaacctcaggctggaccagctacatcaactccggccaatagggacccggggt ctcaaactgcccagcttgtcccacaccggtaccactgtgtcccgccgcgtgggccccccagtctctcttgaacgccgcagcagcag ctccagcagcatcagctctgcctatactgtcagccgccgctcctccctggcctctcctttcccccctggctccccaccagagaatg gagcatcctccctgcctggccttatgcctgcccagcactacctgcttcgggcaagatatgcttcagccagagggggtggtacttcg cccactgcagcatccagcctggatcggataggtggtcttcccatgcctccttggagaagccgagccgagtatccaggatacaaccc caatgcaggggtcacccggagggccagtgacccagcccaggctgctgaccgtcctgctccagctagagtccagaggttcaagagcc tgggctgtgtccataccccacccactgtggcagggggaggacagaactttgatccttacctcccaacctctgtctactcaccacag ccccccagcatcactgagaatgctgccatggatgctagagggctacaggaagagccagaagttgggacctccatggtgggcagtgg tctgaacccctatatggacttcccacctactgatactctgggatatgggggacctgaaggggcagcagctgagccttatggagcga ggggtccaggctctctgcctcttgggcctggtccacccaccaactatggccccaacccctgtccccagcaggcctcatatcctgac cccacccaagaaacatggggtgagttcccttcccactctgggctgtacccaggccccaaggctctaggtggaacctacagccagtg tcctcgacttgaacattatggacaagtgcaagtcaagccagaacaggggtgcccagtggggtctgactccacaggactggcaccct gcctcaatgcccaccccagtgaggggcccccacatccacagcctctcttttcccattacccccagccctctcctccccaatatctc cagtcaggcccctatacccagccaccccctgattatcttccttcagaacccaggccttgcctggactttgattcccccacccattc cacagggcagctcaaggctcagcttgtgtgtaattatgttcaatctcaacaggagctactgtgggagggtgggggcagggaagatg cccccgcccaggaaccttcctaccagagtcccaagtttctggggggttcccaggttagcccaagccgtgctaaagctccagtgaac acatatggacctggctttggacccaacttgcccaatcacaagtcaggttcctatcccaccccttcaccatgccatgaaaattttgt agtgggggcaaatagggcttcacatagggcagcagcaccacctcgacttctgcccccattgcccacttgctatgggcctctcaaag tgggaggcacaaaccccagctgtggtcatcctgaggtgggcaggctaggagggggtcctgccttgtaccctcctcccgaaggacag gtatgtaaccccctggactctcttgatcttgacaacactcagctggactttgtggctattctggatgagccccaggggctgagtcc tcctccttcccatgatcagcggggcagctctggacataccccacctccctctgggccccccaacatggctgtgggcaacatgagtg tcttactgagatccctacctggggaaacagaattcctcaactctagtgcctaa
Glil amino acid sequence - NP 005260.1 (SEP ID NO: 8)
MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLFSSPRSAVKLTKKRALSIS PLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGSYGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRG PFPTCQLKSELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINS EHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSN ASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREGGPIREESRLT VPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRG LKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTS PTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKSLGCVHTPPTVAGGGQNFDPYLPTSVYSPQ ΡΡΞITENAAMDARGLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPD PTQETWGEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFSHYPQPSPPQYL QSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVN TYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQ VCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
GH2 nucleotide sequence - NM 001081125 (SEP ID NO:9
atggagacttctgccccagcccctgcactggagaagaaagaagccaagagtggtctcttggaggacagcagcttccccgacccagg gaaaaaggcctgtcctctggcggtggccgcagctgtagccgcccacggagttcctcagcagctcctgccggctttccacgcgcctt tgccgattgacatgagacaccaggagggaaggtaccattatgaccctcactctgtccacagtgtacacgggcctcccaccctaagt ggcagccctgtcatctcagatatctccttgatacgactttctccacaccctgctggccctggagagtcacccttcagcgcccacca cccctacgtgaacccccatatggagcactacctccggtctgtgcacagcagccccacactctcaatgatctctgccgccaggggcc tcagccctgctgatgtggcccacgaacatctgaaagagaggggactctttagcctcgcagccccaggcaccaacccttcagactat taccaccagatgaccctcatggcaagccaccccaccccttatggggaccttctaatgcagagcgggggtgctgctagcgcacccca tctccatgactacctcaaccctgtggatgcatcacgattctctagtccacgtgtgaccccacgactgagccgcaagcgggctctgt ccatctccccgctctcagatgccagcctcgacctacaacgcatgattcggacctctcccaactcgctggtagcttacatcaacaac tccaggagcagctcagcagccagtggctcttatggacatctgtctgctggtgccctcagcccagccttcacttttccccaccccat caatcctgtggcctaccagcagatcctgagccagcagcggggcctgggctcagcctttggacacacaccacccctgatccagcctt cacccaccttcttggcccagcagcccatgactctcacctccatcagcaccatgcctacccaactcagcagcagtagcagcaactgt ctaaatgatgccaaccagaacaagcagaacagcgagtcagctgtgagcagcaccgtgaaccccatcaccattcataagcggagcaa ggtcaagactgaggctgagggcctgcgtccagcatccccgcttggactgacacaggagcagctggccgatctcaaggaagacctgg acagggatgactgtaagcaggaggccgaggtggtcatctacgagaccaactgccactgggcagactgcaccaaggagtatgacaca caggagcagctggtgcatcatatcaacaatgaacacatccacggggagaagaaggagttcgtgtgccgctggcaggcctgcacgag agagcagaagcccttcaaggcccagtacatgctggttgttcacatgcgcagacacacgggtgagaagccacacaagtgcacgttcg aaggctgttccaaggcctactctcgcctggagaacctgaagacacacctgcgttcacacacaggagagaagccatatgtgtgtgaa cacgaaggctgtaacaaagccttctccaatgcctcagaccgcgccaagcaccagaaccgcactcactccaatgagaaaccctacat ctgcaagatcccaggctgcaccaagaggtacacagaccccagctcactccgcaagcatgtgaagactgtccatgggccagacgccc atgtcaccaagaaacagcgtaatgatgtgcatgtccgtgctccactgctcaaggagaatggggataatgaggccagcgccgagcca ggtggccggggacctgaggagagtgtggaggccagtagcaccagccacactgtggaggactgcctacatatcaaagccatcaagac agagagctccgggctttgtcagtccagccccggggcccagtcatcctgcagcagcgagccctctcccctgggcagtgcccccaaca atgacagtggcatggagatgccggggacagggcctgggagtctgggagacctgacagcactggctgacacgtgtccaggagctgac acctcagccctggctgcaccctccactggtggcctgcagctgcgcaaacacatgagcaccgtgcatcgctttgagcagctgaagag agagaagctcaagtcactgaaggattcctgctcgtgggccggcccagctccacacacccgcaacaccaagctgcctccccttccag tcaatggttctgtcctggaaaacttcaacaatacagggggcggtggaccggcaggactgctgcccagccagcggctaccagagctg accgaagtgacgatgctgagecagetgcaggaacgaagagacagetccaccagcaccatgagetcggcctacactgtgagecgccg ctcctctggcatctccccatacttctctagccgtcgctccagcgaggcttcgcctctcggtggcctacgcccgcacaacgccagct cagcagactcctatgaccccatctccacagatgcctctcggcgctccagtgaagccagccagtgcagtggcggtggcccagggctg ctcaacctcacacctgcgcagcagtacaacctgcgtgccaagtacgcagcggccacaggtggaccaccgcccacgccactgccggg cctcgatcgtgtaagccttcgtacccgcctggccttgctggatgctcctgagcgtgcacttcctggtgcctgcccacatccactgg ggccacggcgtggcagcgatgggcctacctatagccatggtcatggccatggctacgcaggtgcggctccagcattcccccacgag gggccaaacagcagcacacggcgggccagcgaccctgtgcggcgccctgacccccttattctgcctcgagtgcaacgtttccacag tacccacaacatgaatccaggttcactgccaccctgcgctgatcggcgtggcctgcacgtacagagccaccccagcgtagacagca acctgacccgcaacgcctactctcccagaccccctagcatcaatgagaacgtggtgatggaggccgtggctgctggggtagacggc ccagggctagagtgcgacctggggctggtggaggatgagctggtgctgccagatgatgtggtacagtacatcaaggctcacaccgg tggtaccttggatgacggcattcggcaggggtatcccacagaaggtactggcttccccgagaactctaagctgcccagtcctgggc tacaaggccaccgcaggctagcagctgccgactccaacatgggtccttctgctcctggactcgggggctgccagctgagctacagc ccctcctccaacctcaacaagagcaacatgcctgtgcagtggaatgaggtgagttctggcaccgtggatgccctgcctacccaggt gaagccacctcctttccctcacagcaacctggctgtggtccaacagaagccagcctttggccagtatccaggatataatccacaat cegtgcagagcagctccggaggtctagacagcacccagecgcacctacagettcgaggagccccctctgcatcaagagggagctac acgcaacagcctcgacagecagetgcaggcagtcagtgcctgggtatgagtgcggccatgageccgcaggccagetacagecaagc ccacccccagctgagcccaaacattgtcagcggatctctgaaccagttttctccctcctgcagcaatatggcagccaagcccagcc acctgggactccctcagcaaatggaagttgtccccaatgccaccatcatgaatggccatcaacgggagcacggggtccccaattca tccctggctgcggtgtcacaacctcacccagtcctgagctatccccagcaggacagctaccaacagggctccaaccttctgtcatc ccatcagcctggcttcatggagtcccagcagaacgcgggctttggtctcatgcagcctcggccacccctggaacccaacacggcca gccgtcaccgtggagtacgttctgggcaacagcagttgtatgccaggaccactggccaagccatggtcacatcagccaaccaagag acagcagaagctatgcccaagggaccagcagggaccatggtatccctagctcctcagccatctcaggacacagggcgggcacaaga tcagaacacgctatactactatggccagatccacatgtatgaacagaatggaggctgcccageegtgcagccccagecgccacaac cacaagcttgctcagacagtatccagcctgagcctttgccttcaccgggagtcaaccaggtgtctagcaccgtggactcccagctc ctggagcccccccagattgactttgatgccatcatggatgatggtgatcactcgagtttgttttctggtgcactgagcccaaccct tctccacaatctctcccagaattcctcacgcctcaccacaccccggaattccttgacactgccctccatccctgcgggcatcagca acatggccgtgggcgacatgagttccatgctcaccagcctggctgaagagagcaagtttttaaacatgatgacctaa
GH2 amino acid sequence - NP 001074594 (SEP ID NO: 10)
METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAVAAHGVPQQLLPAFHAPLPIDMRHQEGRYHYDPHSVHSVHGPPTLS GSPVISDISLIRLSPHPAGPGESPFSAHHPYVNPHMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDY YHQMTLMASHPTPYGDLLMQSGGAASAPHLHDYLNPVDASRFSSPRVTPRLSRKRALSISPLSDASLDLQRMIRTSPNSLVAYINN SRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILSQQRGLGSAFGHTPPLIQPSPTFLAQQPMTLTSISTMPTQLSSSSSNC LNDANQNKQNSESAVSSTVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEWIYETNCHWADCTKEYDT QEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCE HEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHVRAPLLKENGDNEASAEP GGRGPEESVEASSTSHTVEDCLHIKAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGMEMPGTGPGSLGDLTALADTCPGAD TSALAAPSTGGLQLRKHMSTVHRFEQLKREKLKSLKDSCSWAGPAPHTRNTKLPPLPVNGSVLENFNNTGGGGPAGLLPSQRLPEL TEVTMLSQLQERRDSSTSTMSSAYTVSRRSSGISPYFSSRRSSEASPLGGLRPHNASSADSYDPISTDASRRSSEASQCSGGGPGL LNLTPAQQYNLRAKYAAATGGPPPTPLPGLDRVSLRTRLALLDAPERALPGACPHPLGPRRGSDGPTYSHGHGHGYAGAAPAFPHE GPNSSTRRASDPVRRPDPLILPRVQRFHSTHNMNPGSLPPCADRRGLHVQSHPSVDSNLTRNAYSPRPPSINENVVMEAVAAGVDG PGLECDLGLVEDELVLPDDWQYIKAHTGGTLDDGIRQGYPTEGTGFPENSKLPSPGLQGHRRLAAADSNMGPSAPGLGGCQLSYS PSSNLNKSNMPVQWNEVSSGTVDALPTQVKPPPFPHSNLAVVQQKPAFGQYPGYNPQSVQSSSGGLDSTQPHLQLRGAPSASRGSY TQQPRQPAAGSQCLGMSAAMSPQASYSQAHPQLSPNIVSGSLNQFSPSCSNMAAKPSHLGLPQQMEVVPNATIMNGHQREHGVPNS SLAAVSQPHPVLSYPQQDSYQQGSNLLSSHQPGFMESQQNAGFGLMQPRPPLEPNTASRHRGVRSGQQQLYARTTGQAMVTSANQE TAEAMPKGPAGTMVSLAPQPSQDTGRAQDQNTLYYYGQIHMYEQNGGCPAVQPQPPQPQACSDSIQPEPLPSPGVNQVSSTVDSQL LEPPQIDFDAIMDDGDHSSLFSGALSPTLLHNLSQNSSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT Gli3 nucleotide sequence - NM 000168.5 (SEP ID NO: 11)
atggaggcccagtcccacagctccacgaccactgaaaagaaaaaagttgagaattccatagtgaagtgctccactcgaacagatgt gagcgagaaagccgttgcctccagcaccacttctaatgaggatgaaagtcctggacagacttatcacagagagagaagaaacgcaa tcactatgcagccacagaatgtccaggggctcagcaaagtcagtgaggaaccttcaacatcgagtgacgagagggcctcattgatc aagaaagagatccatgggtccctgccacacgtggcggagccctctgtgccgtaccgcgggacggtgtttgccatggaccccaggaa tggttacatggagccccactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccagacatcatgagg gccgttaccattacgatccatctccgattcctccattgcatatgacttccgccttatctagtagccctacgtatccggacctgccc ttcattaggatctccccacaccggaaccccactgctgcttccgagtctcccttcagccctccacatccctacattaatccctacat ggactatatccgctccttgcacagcagcccatcgctctccatgatctcagcaacccgtgggctgagccctacagatgcgccccatg caggagtcageccagcagaatactateatcagatggccctgctaactggccagcgcagcccctatgcagacattattccctcaget gccaccgccggcacgggggccatccacatggaatatcttcatgctatggatagcaccagattctccagccccaggctgtcagccag gccgagccgaaaacgtacactgtccatatcaccactctccgatcatagctttgaccttcagaccatgataaggacgtctcccaact ccttggtcacgattctcaataattcccgtagcagctcttcagcaagtggctcctatggtcacttatctgcaagtgcaatcagccct gccttgagcttcacctactcttccgcgcccgtctctctccacatgcatcagcagatcctaagccgacaacagagcttaggttcagc ctttggacacagccctccactcatccaccctgccccaacttttccaacacagaggcctattccagggatccctacggttctgaacc ccgtccaggtcagctccggcccttctgagtcctcacagaacaagcccacgagtgagtctgcagtgagcagcactggtgacccgatg cacaacaagaggtccaagatcaaacccgatgaagacctccccageccaggggctcgggggcagcaggaacageccgaaggaacaac ccttgtcaaggaggaaggggacaaagatgaaagcaaacaggagcctgaagtcatctatgagacaaactgccactgggaaggctgcg cgagggagttcgacacccaagagcagcttgtgcaccatataaataacgaccatattcatggagagaagaaggagttcgtgtgcagg tggctggactgctcaagagagcagaaacccttcaaagcccagtatatgttggtagtgcatatgagaagacacacgggcgagaagcc tcacaaatgcacttttgaaggttgcacaaaggcctactcgagactagaaaacttgaaaacacacttgagatctcacactggagaga aaccatacgtctgtgagcacgaaggttgcaacaaggctttctcaaatgcctctgatcgcgccaaacaccaaaacagaacgcattcc aatgagaaaccatatgtgtgcaaaatcccaggctgcactaagcgttacacagacccaagctccctccggaaacatgtgaagacagt gcatggcccagaggctcatgtcaccaagaagcagcgaggggacatccatcctcggccgccacccccgagagattccggcagccatt cacagtccaggtcgcctggccgaccgactcagggagcccttggtgagcagcaggacctcagcaacactacctcaaagcgggaagaa tgcctccaggtgaaaaccgtcaaggcagagaagccaatgacatctcagccaagccctggtggtcagtcttcatgcagcagccaaca gtcccccatcagcaactattccaacagtgggctcgagcttcctctgaccgatggaggtagtataggagacctcagtgccatcgatg aaaccccaatcatggactcaaccatttccactgcaaccacagcccttgctttgcaagccaggagaaacccggcagggaccaaatgg atggagcacgtaaaactagaaaggctaaaacaagtgaatggaatgtttccgcgactgaaccccattctaccccctaaagcccctgc ggtctctcctctcataggaaatggcacacagtccaacaacacctgcagcttgggtgggcccatgacgcttctcccgggcagaagcg acctctctggggtggacgtcactatgctgaacatgctcaacagaagggacagcagcgccagcaccatcagctcggcctacctgagc agccgccgctcctcagggatctcgccctgcttctccagccgccgctccagcgaggcgtcacaggccgagggccggccgcagaacgt gagcgtggccgactcctacgaccccatctccaccgacgcctcgcgccgctccagcgaagccagccagagcgacggcctgcccagcc tgctcagcctcacgcccgcccagcagtaccgcctcaaggccaagtacgcggctgccacaggagggccgccgccgacgcccctgccc aacatggagaggatgagcctgaagacgcgcctggcgctgctcggggatgccctcgagcctggcgtggccctgcctccagttcatgc cccgaggaggtgcagcgacgggggagcccacggctacgggcggcgccacctgcagccgcacgatgcgccgggccacggcgtgagga gggccagcgacccggtgcggacaggctccgagggcctggccctgcctcgtgtgccgcgcttcagcagcctcagcagctgcaacccc ccggcgatggccacgtccgcggagaagcgcagtctcgtgcttcagaattacacgcggcccgagggcggccagtcccgaaacttcca ctcgtccccctgtcctcccagcatcaccgagaacgtcaccctggagtccctgaccatggacgctgatgccaacctgaacgatgagg atttcctgccggacgacgtggtgcagtatttaaattcccagaaccaagcagggtacgagcagcacttccccagcgccctcccggac gacagcaaagtgccccacgggcccggtgactttgacgcgcccgggctgccagacagccacgctggccagcagttccatgccctcga gcagccctgccccgagggcagcaaaaccgacctgcccattcagtggaacgaagtcagctccggaagcgccgacctgtcctcctcca agctcaagtgtgggccgcggcccgctgtgccgcagactcgcgcctttgggttctgcaacggcatggtcgtccacccgcagaacccc ttgaggagcgggcctgctgggggctatcagaccctcggggagaacagcaacccctacggtggcccagagcacttgatgctccacaa cagccccggaagtggcaccagtggaaacgccttccatgaacagccctgtaaggccccgcagtatgggaactgtctcaacaggcagc cagtggcccctggtgcactcgacggtgcctgtggtgccgggattcaagcctcaaagctgaagagcacccccatgcaagggagcggg ggccagctgaatttcggcctgccggtagcgccaaatgagtcagctggcagcatggtgaatggcatgcagaaccaggacccagtggg acaggggtacctggctcaccagctcctcggcgacagcatgcagcacccgggggcaggccgccccggtcagcagatgcttgggcaga ttagtgctacctcacacatcaacatctaccaagggccagagagctgcctgccaggggctcacggcatgggcagccagccgtcaagc ttggcagttgtcaggggctaccagccatgtgccagctttgggggcagcaggcgccaggctatgccgagggacagccttgctctgca gtcaggacagetcagtgacacaagtcagacctgcagggtgaatggtatcaagatggagatgaaagggcagccccatccgctgtget ctaatctgcagaattactctggtcagttctatgaccaaaccgtgggcttcagtcagcaagacacgaaagctggttcattctctatt tcagacgccagctgcctgctacaggggaccagcgccaaaaactctgagttactttccccaggtgctaatcaggtgacaagcacagt ggacagectcgacagccatgacctggaaggggtacagattgacttcgatgccatcatagacgatggggaccactccagectgatgt cgggggccctgagcccaagtatcattcagaacctttcccatagctcctcccgcctcaccacgcctcgggcgtccctcccattccca gcgctgtccatgagcaccaccaacatggctatcggggacatgagttctttgctgacctccctagcggaagaaagcaaattccttgc agttatgcaatag
Gli3 amino acid sequence - NP 000159.3 (SEP ID NO: 12)
MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLI KKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEPHYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLP FIRISPHRNPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQMALLTGQRSPYADIIPSA ATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISP ALSFTYSSAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSESAVSSTGDPM HNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCR WLDCSREQKPFKAQYMLWHMRRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHS NEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREE CLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKW MEHVKLERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTMLNMLNRRDSSASTISSAYLS SRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTDASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLP NMERMSLKTRLALLGDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPRVPRFSSLSSCNP PAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTMDADANLNDEDFLPDDWQYLNSQNQAGYEQHFPSALPD DSKVPHGPGDFDAPGLPDSHAGQQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMWHPQNP LRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNRQPVAPGALDGACGAGIQASKLKSTPMQGSG GQLNFGLPVAPNESAGSMVNGMQNQDPVGQGYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSS LAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSI SDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLEGVQIDFDAI IDDGDHSSLMSGALSPSI IQNLSHSSSRLTTPRASLPFP ALSMSTTNMAIGDMSSLLTSLAEESKFLAVMQ Sonic Hh nucleotide sequence - NM 000193.2 (SEP ID NO: 13)
atgctgctgctggcgagatgtctgctgctagtcctcgtctcctcgctgctggtatgctcgggactggcgtgcggaccgggcagggg gttcgggaagaggaggcaccccaaaaagctgacccctttagcctacaagcagtttatccccaatgtggccgagaagaccctaggcg ccagcggaaggtatgaagggaagatctccagaaactccgagcgatttaaggaactcacccccaattacaaccccgacatcatattt aaggatgaagaaaacaccggagcggacaggctgatgactcagaggtgtaaggacaagttgaacgctttggccatctcggtgatgaa ccagtggccaggagtgaaactgcgggtgaccgagggctgggacgaagatggccaccactcagaggagtctctgcactacgagggcc gcgcagtggacatcaccacgtctgaccgcgaccgcagcaagtacggcatgctggcccgcctggcggtggaggccggcttcgactgg gtgtactacgagtccaaggcacatatccactgctcggtgaaagcagagaactcggtggcggccaaatcgggaggctgcttcccggg ctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggacctgagccccggggaccgcgtgctggcggcggacgacc agggccggctgctctacagcgacttcctcactttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacgcgg gagccgcgcgagcgcctgctgctcaccgccgcgcacctgctctttgtggcgccgcacaacgactcggccaccggggagcccgaggc gtcctcgggctcggggccgccttccgggggcgcactggggcctcgggcgctgttcgccagccgcgtgcgcccgggccagcgcgtgt acgtggtggccgagcgtgacggggaccgccggctcctgcccgccgctgtgcacagcgtgaccctaagcgaggaggccgcgggcgcc tacgcgccgctcacggcccagggcaccattctcatcaaccgggtgctggcctcgtgctacgcggtcatcgaggagcacagctgggc gcaccgggccttcgcgcccttccgcctggcgcacgcgctcctggctgcactggcgcccgcgcgcacggaccgcggcggggacagcg gcggcggggaccgcgggggcggcggcggcagagtagccctaaccgctccaggtgctgccgacgctccgggtgcgggggccaccgcg ggcatccactggtactcgcagctgctctaccaaataggcacctggctcctggacagcgaggccctgcacccgctgggcatggcggt caagtccagctga
Sonic Hh amino acid sequence - NP 000184.1 (SEP ID NO: 14)
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIF KDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDW VYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETR EPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGA YAPLTAQGTILINRVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGAADAPGAGATA GIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS Indian Hh nucleotide sequence - NM 002181.3 (SEP ID NP: 15)
atgtctcccgcccggctccggccccgactgcacttctgcctggtcctgttgctgctgctggtggtgccggcggcatggggctgcgg gccgggtcgggtggtgggcagccgccggcgaccgccacgcaaactcgtgccgctcgcctacaagcagttcagccccaatgtgcccg agaagaccctgggcgccagcggacgctatgaaggcaagatcgctcgcagctccgagcgcttcaaggagctcacccccaattacaat ccagacatcatcttcaaggacgaggagaacacaggcgccgaccgcctcatgacccagcgctgcaaggaccgcctgaactcgctggc tatctcggtgatgaaccagtggcccggtgtgaagctgcgggtgaccgagggctgggacgaggacggccaccactcagaggagtccc tgcattatgagggccgcgcggtggacatcaccacatcagaccgcgaccgcaataagtatggactgctggcgcgcttggcagtggag gccggctttgactgggtgtattacgagtcaaaggcccacgtgcattgctccgtcaagtccgagcactcggccgcagccaagacggg cggctgcttccctgccggagcccaggtacgcctggagagtggggcgcgtgtggccttgtcagccgtgaggccgggagaccgtgtgc tggccatgggggaggatgggagccccaccttcagcgatgtgctcattttcctggaccgcgagcctcacaggctgagagccttccag gtcatcgagactcaggaccccccacgccgcctggcactcacacccgctcacctgctctttacggctgacaatcacacggagccggc agcccgcttccgggccacatttgccagccacgtgcagcctggccagtacgtgctggtggctggggtgccaggcctgcagcctgccc gcgtggcagctgtctctacacacgtggccctcggggcctacgccccgctcacaaagcatgggacactggtggtggaggatgtggtg gcatcctgcttcgcggccgtggctgaccaccacctggctcagttggccttctggcccctgagactctttcacagcttggcatgggg cagctggaccccgggggagggtgtgcattggtacccccagctgctctaccgcctggggcgtctcctgctagaagagggcagcttcc acccactgggcatgtccggggcagggagctga
Indian Hh amino acid sequence - NP 002172.2 (SEP ID NO: 16)
MSPARLRPRLHFCLVLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYN PDI IFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVE AGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQ VIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTKHGTLVVEDVV ASCFAAVADHHLAQLAFWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS
Desert Hh nucleotide sequence - NM 021044.2 (SEP ID NO: 17)
atggctctcctgaccaatctactgcccctgtgctgcttggcacttctggcgctgccagcccagagctgcgggccgggccgggggcc ggttggccggcgccgctatgcgcgcaagcagctcgtgccgctactctacaagcaatttgtgcccggcgtgccagagcggaccctgg gcgccagtgggccagcggaggggagggtggcaaggggctccgagcgcttccgggacctcgtgcccaactacaaccccgacatcatc ttcaaggatgaggagaacagtggagccgaccgcctgatgaccgagcgttgtaaggagcgggtgaacgctttggccattgccgtgat gaacatgtggcccggagtgcgcctacgagtgactgagggctgggacgaggacggccaccacgctcaggattcactccactacgaag gccgtgctttggacatcactacgtctgaccgcgaccgcaacaagtatgggttgctggcgcgcctcgcagtggaagccggcttcgac tgggtctactacgagtcccgcaaccacgtccacgtgtcggtcaaagctgataactcactggcggtccgggcgggcggctgctttcc gggaaatgcaactgtgcgcctgtggagcggcgagcggaaagggctgcgggaactgcaccgcggagactgggttttggcggccgatg cgtcaggccgggtggtgcccacgccggtgctgctcttcctggaccgggacttgcagcgccgggcttcatttgtggctgtggagacc gagtggcctccacgcaaactgttgctcacgccctggcacctggtgtttgccgctcgagggccggcgcccgcgccaggcgactttgc accggtgttcgcgcgccggctacgcgctggggactcggtgctggcgcccggcggggatgcgcttcggccagcgcgcgtggcccgtg tggcgcgggaggaagccgtgggcgtgttcgcgccgctcaccgcgcacgggacgctgctggtgaacgatgtcctggcctcttgctac gcggttctggagagtcaccagtgggcgcaccgcgcttttgcccccttgagactgctgcacgcgctaggggcgctgctccccggcgg ggccgtccagccgactggcatgcattggtactctcggctcctctaccgcttagcggaggagctactgggctga
Desert Hh amino acid sequence - NP 066382.1 (SEP ID NO: 18)
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDII FKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFD WVYYESRNHVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRWPTPVLLFLDRDLQRRASFVAVET EWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCY AVLESHQWAHRAFAPLRLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG
Hhip nucleotide sequence - NM 022475.2 (SEP ID NO: 19)
atgctgaagatgctctcctttaagctgctgctgctggccgtggctctgggcttctttgaaggagatgctaagtttggggaaagaaa cgaagggagcggagcaaggaggagaaggtgcctgaatgggaaccccccgaagcgcctgaaaaggagagacaggaggatgatgtccc agctggagctgctgagtgggggagagatgctgtgcggtggcttctaccctcggctgtcctgctgcctgcggagtgacagcccgggg ctagggcgcctggagaataagatattttctgttaccaacaacacagaatgtgggaagttactggaggaaatcaaatgtgcactttg ctctccacattctcaaagcctgttccactcacctgagagagaagtcttggaaagagacctagtacttcctctgctctgcaaagact attgcaaagaattcttttacacttgccgaggccatattccaggtttccttcaaacaactgcggatgagttttgcttttactatgca agaaaagatggtgggttgtgctttccagattttccaagaaaacaagtcagaggaccagcatctaactacttggaccagatggaaga atatgacaaagtggaagagatcagcagaaagcacaaacacaactgcttctgtattcaggaggttgtgagtgggctgcggcagcccg ttggtgccctgcatagtggggatggctcgcaacgtctctteattctggaaaaagaaggttatgtgaagatacttacccctgaagga gaaattttcaaggagccttatttggacattcacaaacttgttcaaagtggaataaagggaggagatgaaagaggactgctaagcct cgcattccatcccaattacaagaaaaatggaaagttgtatgtgtcctataccaccaaccaagaacggtgggctatcgggcctcatg accacattcttagggttgtggaatacacagtatccagaaaaaatccacaccaagttgatttgagaacagccagagtctttcttgaa gttgcagaactccacagaaagcatctgggaggacaactgctctttggccctgacggctttttgtacatcattcttggtgatgggat gattacactggatgatatggaagaaatggatgggttaagtgatttcacaggctcagtgctacggctggatgtggacacagacatgt gcaacgtgccttattccataccaaggagcaacccacacttcaacagcaccaaccagccccccgaagtgtttgctcatgggctccac gatccaggcagatgtgctgtggatagacatcccactgatataaacatcaatttaacgatactgtgttcagactccaatggaaaaaa cagatcatcagccagaattctacagataataaaggggaaagattatgaaagtgagccatcacttttagaattcaagccattcagta atggtcctttggttggtggatttgtataccggggctgccagtcagaaagattgtatggaagctacgtgtttggagatcgtaatggg aatttcctaactctccagcaaagtcctgtgacaaagcagtggcaagaaaaaccactctgtctcggcactagtgggtcctgtagagg ctacttttccggtcacatcttgggatttggagaagatgaactaggtgaagtttacattttatcaagcagtaaaagtatgacccaga ctcacaatggaaaactctacaaaattgtagatcccaaaagacctttaatgcctgaggaatgcagagccacggtacaacctgcacag acactgacttcagagtgctccaggctctgtcgaaacggctactgcacccccacgggaaagtgctgctgcagtccaggctgggaggg ggacttctgcagaactgcaaaatgtgagccagcatgtcgtcatggaggtgtctgtgttagaccgaacaagtgcctctgtaaaaaag gatatcttggtcctcaatgtgaacaagtggacagaaacatccgcagagtgaccagggcaggtattcttgatcagatcattgacatg acatcttacttgctggatctaacaagttacattgtatag
Hhip amino acid sequence - NP 071920.1 (SEP ID NO:20
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPG LGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYA RKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEWSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEG EIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLE VAELHRKHLGGQLLFGPDGFLYI ILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLH DPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNG NFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQ TLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDM TSYLLDLTSYIV
Ptcl nucleotide sequence - NM 001083602.1 (SEP ID NO:21)
tggggaaggctactggccggaaagcgccgctgtggctgagagcgaagtttcagagactcttatttaaactgggttgttacattcaa aaaaactgcggcaagttcttggttgtgggcctcctcatatttggggccttcgcggtgggattaaaagcagcgaacctcgagaccaa cgtggaggagctgtgggtggaagttggaggacgagtaagtcgtgaattaaattatactcgccagaagattggagaagaggctatgt ttaatcctcaactcatgatacagacccctaaagaagaaggtgctaatgtcctgaccacagaagcgctcctacaacacctggactcg gcactccaggccagccgtgtccatgtatacatgtacaacaggcagtggaaattggaacatttgtgttacaaatcaggagagcttat cacagaaacaggttacatggatcagataatagaatatctttacccttgtttgattattacacctttggactgcttctgggaagggg cgaaattacagtctgggacagcatacctcctaggtaaacctcctttgcggtggacaaacttcgaccctttggaattcctggaagag ttaaagaaaataaactatcaagtggacagctgggaggaaatgctgaataaggctgaggttggtcatggttacatggaccgcccctg cctcaatccggccgatccagactgccccgccacagcccccaacaaaaattcaaccaaacctcttgatatggcccttgttttgaatg gtggatgtcatggcttatccagaaagtatatgcactggcaggaggagttgattgtgggtggcacagtcaagaacagcactggaaaa ctcgtcagcgcccatgccctgcagaccatgttccagttaatgactcccaagcaaatgtacgagcacttcaaggggtacgagtatgt ctcacacatcaactggaacgaggacaaagcggcagccatcctggaggcctggcagaggacatatgtggaggtggttcatcagagtg tcgcacagaactccactcaaaaggtgctttccttcaccaccacgaccctggacgacatcctgaaatccttctctgacgtcagtgtc atccgcgtggccagcggctacttactcatgctcgcctatgcctgtctaaccatgctgcgctgggactgctccaagtcccagggtgc cgtggggctggctggcgtcctgctggttgcactgtcagtggctgcaggactgggcctgtgctcattgatcggaatttcctttaacg ctgcaacaactcaggttttgccatttctcgctcttggtgttggtgtggatgatgtttttcttctggcccacgccttcagtgaaaca ggacagaataaaagaatcccttttgaggacaggaccggggagtgcctgaagcgcacaggagccagcgtggccctcacgtccatcag caatgtcacagccttcttcatggccgcgttaatcccaattcccgctctgcgggcgttctccctccaggcagcggtagtagtggtgt tcaattttgccatggttctgctcatttttcctgcaattctcagcatggatttatatcgacgcgaggacaggagactggatattttc tgctgttttacaagcccctgcgtcagcagagtgattcaggttgaacctcaggcctacaccgacacacacgacaatacccgctacag ccccccacctccctacagcagccacagctttgcccatgaaacgcagattaccatgcagtccactgtccagctccgcacggagtacg acccccacacgcacgtgtactacaccaccgctgagccgcgctccgagatctctgtgcagcccgtcaccgtgacacaggacaccctc agctgccagagcccagagagcaccagctccacaagggacctgctctcccagttctccgactccagcctccactgcctcgagccccc ctgtacgaagtggacactctcatcttttgctgagaagcactatgctcctttcctcttgaaaccaaaagccaaggtagtggtgatct tcctttttctgggcttgctgggggtcagcctttatggcaccacccgagtgagagacgggctggaccttacggacattgtacctcgg gaaaccagagaatatgactttattgctgcacaattcaaatacttttctttctacaacatgtatatagtcacccagaaagcagacta cccgaatatccagcacttactttacgacctacacaggagtttcagtaacgtgaagtatgtcatgttggaagaaaacaaacagcttc ccaaaatgtggctgcactacttcagagactggcttcagggacttcaggatgcatttgacagtgactgggaaaccgggaaaatcatg ccaaacaattacaagaatggatcagacgatggagtccttgcctacaaactcctggtgcaaaccggcagccgcgataagcccatcga catcagccagttgactaaacagcgtctggtggatgcagatggcatcattaatcccagcgctttctacatctacctgacggcttggg tcagcaacgaccccgtcgcgtatgctgcctcccaggccaacatccggccacaccgaccagaatgggtccacgacaaagccgactac atgcctgaaacaaggctgagaatcccggcagcagagcccatcgagtatgcccagttccctttctacctcaacggcttgcgggacac ctcagactttgtggaggcaattgaaaaagtaaggaccatctgcagcaactatacgagcctggggctgtccagttaccccaacggct accccttcctcttctgggagcagtacatcggcctccgccactggctgctgctgttcatcagcgtggtgttggcctgcacattcctc gtgtgcgctgtcttccttctgaacccctggacggccgggatcattgtgatggtcctggcgctgatgacggtcgagctgttcggcat gatgggcctcatcggaatcaagctcagtgccgtgcccgtggtcatcctgatcgcttctgttggcataggagtggagttcaccgttc acgttgctttggcctttctgacggccatcggcgacaagaaccgcagggctgtgcttgccctggagcacatgtttgcacccgtcctg gatggcgccgtgtccactctgctgggagtgctgatgctggcgggatctgagttcgacttcattgtcaggtatttctttgctgtgct ggcgatcctcaccatcctcggcgttctcaatgggctggttttgcttcccgtgcttttgtctttctttggaccatatcctgaggtgt ctccagccaacggcttgaaccgcctgcccacaccctcccctgagccaccccccagcgtggtccgcttcgccatgccgcccggccac acgcacagcgggtctgattcctccgactcggagtatagttcccagacgacagtgtcaggcctcagcgaggagcttcggcactacga ggcccagcagggcgcgggaggccctgcccaccaagtgatcgtggaagccacagaaaaccccgtcttcgcccactccactgtggtcc atcccgaatccaggcatcacccaccctcgaacccgagacagcagccccacctggactcagggtccctgcctcccggacggcaaggc cagcagccccgcagggacccccccagagaaggcttgtggccacccccctacagaccgcgcagagacgcttttgaaatttctactga agggcattctggccctagcaatagggcccgctggggccctcgcggggcccgttctcacaaccctcggaacccagcgtccactgcca tgggcagctccgtgcccggctactgccagcccatcaccactgtgacggcttctgcctccgtgactgtcgccgtgcacccgccgcct gtccctgggcctgggcggaacccccgagggggactctgcccaggctaccctgagactgaccacggcctgtttgaggacccccacgt gcctttccacgtccggtgtgagaggagggattcgaaggtggaagtcattgagctgcaggacgtggaatgcgaggagaggccccggg gaagcagctccaactga Ptcl amino acid sequence - NP 001077071.1 (SEP ID NO:22
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAM FNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQI IEYLYPCLIITPLDCFWEG AKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLN GGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEWHQS VAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFN AATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVWV FNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEY DPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVWI FLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQL PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGI INPSAFYIYLTAW VSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNG YPFLFWEQYIGLRHWLLLFISWLACTFLVCAVFLLNPWTAGI IVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTV HVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEV SPANGLNRLPTPSPEPPPSWRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVV HPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTA MGSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEERPR GSSSN
Ptc2 nucleotide sequence - AF091501.1 (SEP ID NO:23
atgactcgatcgccgcccctcagagagctgcccccgagttacacacccccagctcgaaccgcagcaccccagatcctagctgggag cctgaaggctccactctggcttcgtgcttacttccagggcctgctcttctctctgggatgcgggatccagagacattgtggcaaag tgctctttctgggactgttggcctttggggccctggcattaggtctccgcatggccattattgagacaaacttggaacagctctgg gtagaagtgggcagccgggtgagccaggagctgcattacaccaaggagaagctgggggaggaggctgcatacacctctcagatgct gatacagaccgcacgccaggagggagagaacatcctcacacccgaagcacttggcctccacctccaggcagccctcactgccagta aagtccaagtatcactctatgggaagtcctgggatttgaacaaaatctgctacaagtcaggagttccccttattgaaaatggaatg attgagtggatgattgagaagctgtttccgtgcgtgatcctcacccccctcgactgcttctgggagggagccaaactccaaggggg ctccgcctacctgcccggccgcccggatatccagtggaccaacctggatccagagcagctgctggaggagctgggtccctttgcct cccttgagggcttccgggagctgctagacaaggcacaggtgggccaggcctacgtggggcggccctgtctgcaccctgatgacctc cactgcccacctagtgcccccaaccatcacagcaggcaggctcccaatgtggctcacgagctgagtgggggctgccatggcttctc ccacaaattcatgcactggcaggaggaattgctgctgggaggcatggccagagacccccaaggagagctgctgagggcagaggccc tgcagagcaccttcttgctgatgagtccccgccagctgtacgagcatttccggggtgactatcagacacatgacattggctggagt gaggagcaggccagcacagtgctacaagcctggcagcggcgctttgtgcagctggcccaggaggccctgcctgagaacgcttccca gcagatccatgccttctcctccaccaccctggatgacatcctgcatgcgttctctgaagtcagtgctgcccgtgtggtgggaggct atctgctcatgctggcctatgcctgtgtgaccatgctgcggtgggactgcgcccagtcccagggttccgtgggccttgccggggta ctgctggtggccctggcggtggcctcaggccttgggctctgtgccctgctcggcatcaccttcaatgctgccactacccaggtgct gcctttcttggctctgggaatcggcgtggatgacgtattcctgctggcgcatgccttcacagaggctctgcctggcacccctctcc aggagcgcatgggcgagtgtctgcagcgcacgggcaccagtgtcgtactcacatccatcaacaacatggccgccttcctcatggct gccctcgttcccatccctgcgctgcgagccttctccctacaggcggccatagtggttggctgcacctttgtagccgtgatgcttgt cttcccagccatcctcagcctggacctacggcggcgccactgccagcgccttgatgtgctctgctgcttctccagtccctgctctg ctcaggtgattcagatcctgccccaggagctgggggacgggacagtaccagtgggcattgcccacctcactgccacagttcaagcc tttacccactgtgaagccagcagccagcatgtggtcaccatcctgcctccccaagcccacctggtgcccccaccttctgacccact gggctctgagctcttcagccctggagggtccacacgggaccttctaggccaggaggaggagacaaggcagaaggcagcctgcaagt ccctgccctgtgcccgctggaatcttgcccatttcgcccgctatcagtttgccccgttgctgctccagtcacatgccaaggccatc gtgctggtgctctttggtgctcttctgggcctgagcctctacggagccaccttggtgcaagacggcctggccctgacggatgtggt gcctcggggcaccaaggagcatgccttcctgagcgcccagctcaggtacttctccctgtacgaggtggccctggtgacccagggtg gctttgactacgcccattcccaacgcgccctctttgatctgcaccagcgcttcagttccctcaaggcggtgctgcccccaccggcc acccaggcaccccgcacctggctgcactattaccgcaactggctacagggaatccaggctgcctttgaccaggactgggcttctgg gcgcatcacccgccactcgtaccgcaatggctctgaggatggggccctggcctacaagctgctcatccagactggagacgcccagg agcctctggatttcagccagctgaccacaaggaagctggtggacagagagggactgattccacccgagctcttctacatggggctg accgtgtgggtgagcagtgaccccctgggtctggcagcctcacaggccaacttctaccccccacctcctgaatggctgcacgacaa atacgacaccacgggggagaaccttcgcatcccgccagctcagcccttggagtttgcccagttccccttcctgctgcgtggcctcc agaagactgcagactttgtggaggccatcgagggggcccgggcagcatgcgcagaggccggccaggctggggtgcacgcctacccc agcggctcccccttcctcttctgggaacagtatctgggcctgcggcgctgcttcctgctggccgtctgcatcctgctggtgtgcac tttcctcgtctgtgctctgctgctcctcaacccctggacggctggcctcatagtgctggtcctggcgatgatgacagtggaactct ttggtatcatgggtttcctgggcatcaagctgagtgccatccccgtggtgatccttgtggcctctgtaggcattggcgttgagttc acagtccacgtggctctgggcttcctgaccacccagggcagccggaacctgcgggccgcccatgcccttgagcacacatttgcccc cgtgaccgatggggccatctccacattgctgggtctgctcatgcttgctggttcccactttgacttcattgtaaggtacttctttg cggcgctgacagtgctcacgctcctgggcctcctccatggactcgtgctgctgcctgtgctgctgtccatcctgggcccgccgcca gaggtgatacagatgtacaaggaaagcccagagatcctgagtccaccagctccacagggaggcgggcttaggtggggggcatcctc ctccctgccccagagctttgccagagtgactacctccatgaccgtggccatccacccaccccccctgcctggtgcctacatccatc cagcccctgatgagcccccttggtcccctgctgccactagctctggcaacctcagttccaggggaccaggtccagccactgggtga
Ptc2 amino acid sequence - AAC79847.1 (SEP ID NO:24
MTRSPPLRELPPSYTPPARTAAPQILAGSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLFLGLLAFGALALGLRMAI IETNLEQLW VEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTARQEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGM IEWMIEKLFPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEQLLEELGPFASLEGFRELLDKAQVGQAYVGRPCLHPDDL HCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLGGMARDPQGELLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWS EEQASTVLQAWQRRFVQLAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARWGGYLLMLAYACVTMLRWDCAQSQGSVGLAGV LLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDVFLLAHAFTEALPGTPLQERMGECLQRTGTSWLTSINNMAAFLMA ALVPIPALRAFSLQAAIWGCTFVAVMLVFPAILSLDLRRRHCQRLDVLCCFSSPCSAQVIQILPQELGDGTVPVGIAHLTATVQA FTHCEASSQHVVTILPPQAHLVPPPSDPLGSELFSPGGSTRDLLGQEEETRQKAACKSLPCARWNLAHFARYQFAPLLLQSHAKAI VLVLFGALLGLSLYGATLVQDGLALTDWPRGTKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPA TQAPRTWLHYYRNWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLTTRKLVDREGLIPPELFYMGL TVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIPPAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGVHAYP SGSPFLFWEQYLGLRRCFLLAVCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVVILVASVGIGVEF TVHVALGFLTTQGSRNLRAAHALEHTFAPVTDGAISTLLGLLMLAGSHFDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPP EVIQMYKESPEILSPPAPQGGGLRWGASSSLPQSFARVTTSMTVAIHPPPLPGAYIHPAPDEPPWSPAATSSGNLSSRGPGPATG Smo nucleotide sequence - NM 005631.4 (SEP ID NO:25
atggccgctgcccgcccagcgcgggggccggagctcccgctcctggggctgctgctgctgctgctgctgggggacccgggccgggg ggcggcctcgagcgggaacgcgaccgggcctgggcctcggagcgcgggcgggagcgcgaggaggagcgcggcggtgactggccctc cgccgccgctgagccactgcggccgggctgccccctgcgagccgctgcgctacaacgtgtgcctgggctcggtgctgccctacggg gccacctccacactgctggccggagactcggactcccaggaggaagcgcacggcaagctcgtgctctggtcgggcctccggaatgc cccccgctgctgggcagtgatccagcccctgctgtgtgccgtatacatgcccaagtgtgagaatgaccgggtggagctgcccagcc gtaccctctgccaggccacccgaggcccctgtgccatcgtggagagggagcggggctggcctgacttcctgcgctgcactcctgac cgcttccctgaaggctgcacgaatgaggtgcagaacatcaagttcaacagttcaggccagtgcgaagtgcccttggttcggacaga caaccccaagagctggtacgaggacgtggagggctgcggcatccagtgccagaacccgctcttcacagaggctgagcaccaggaca tgcacagctacatcgcggccttcggggccgtcacgggcctctgcacgctcttcaccctggccacattcgtggctgactggcggaac tcgaatcgctaccctgctgttattctcttctacgtcaatgcgtgcttctttgtgggcagcattggctggctggcccagttcatgga tggtgcccgccgagagatcgtctgccgtgcagatggcaccatgaggcttggggagcccacctccaatgagactctgtcctgcgtca tcatctttgtcatcgtgtactacgccctgatggctggtgtggtttggtttgtggtcctcacctatgcctggcacacttccttcaaa gccctgggcaccacctaccagcctctctcgggcaagacctcctacttccacctgctcacctggtcactcccctttgtcctcactgt ggcaatccttgctgtggcgcaggtggatggggactctgtgagtgggatttgttttgtgggctacaagaactaccgataccgtgcgg gettcgtgctggccccaatcggcctggtgctcatcgtgggaggctacttecteatccgaggagtcatgactctgttctccatcaag agcaaccaccccgggctgctgagtgagaaggctgccagcaagatcaacgagaccatgctgcgcctgggcatttttggcttcctggc ctttggctttgtgctcattaccttcagctgccacttctacgacttcttcaaccaggctgagtgggagcgcagcttccgggactatg tgctatgtcaggccaatgtgaccatcgggctgcccaccaagcagcccatccctgactgtgagatcaagaatcgcccgagccttctg gtggagaagatcaacctgtttgccatgtttggaactggcatcgccatgagcacctgggtctggaccaaggccacgctgctcatctg gaggcgtacctggtgcaggttgactgggcagagtgacgatgagccaaagcggatcaagaagagcaagatgattgccaaggccttct ctaagcggcacgagctcctgcagaacccaggccaggagctgtccttcagcatgcacactgtgtcccacgacgggcccgtggcgggc ttggcctttgacctcaatgagccctcagctgatgtctcctctgcctgggcccagcatgtcaccaagatggtggctcggagaggagc catactgccccaggatatttctgtcacccctgtggcaactccagtgcccccagaggaacaagccaacctgtggctggttgaggcag agatetccccagagctgcagaagcgcctgggccggaagaagaagaggaggaagaggaagaaggaggtgtgcccgctggcgccgccc cctgagcttcacccccctgcccctgcccccagtaccattcctcgactgcctcagctgccccggcagaaatgcctggtggctgcagg tgcctggggagctggggactcttgccgacagggagcgtggaccctggtctccaacccattctgcccagagcccagtccccctcagg atccatttctgcccagtgcaccggcccccgtggcatgggctcatggccgccgacagggcctggggcctattcactcccgcaccaac ctgatggacacagaactcatggatgcagactcggacttctga
Smo amino acid sequence - NP 005622.1 (SEP ID NO:26
MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYG ATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPD RFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRN SNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFK ALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIK SNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLL VEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAG LAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPP PELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTN LMDTELMDADSDF
SuFu nucleotide sequence - NM 016169.3 (SEP ID NO:27
atggcggagctgcggcctagcggcgcccccggccccaccgcgcccccggcccctggcccgactgcccccccggccttcgcttcgct ctttcccccgggactgcacgccatctacggagagtgccgccgcctttaccctgaccagccgaacccgctccaggttaccgctatcg tcaagtactggttgggtggcccagaccccttggactatgttagcatgtacaggaatgtggggagcccttctgctaacatccccgag cactggcactacatcagcttcggcctgagtgatctctatggtgacaacagagtccatgagtttacaggaacagatggacctagtgg ttttggctttgagttgacctttcgtctgaagagagaaactggggagtctgccccaccaacatggcccgcagagttaatgcagggct tggcacgatacgtgttccagtcagagaacaccttctgcagtggggaccatgtgtcctggcacagccctttggataacagtgagtca agaattcagcacatgctgctgacagaggacccacagatgcagcccgtgcagacaccctttggggtagttaccttcctccagatcgt tggtgtctgcactgaagagctacactcagcccagcagtggaacgggcagggcatcctggagctgctgcggacagtgcctattgctg gcggcccctggctgataactgacatgcggaggggagagaccatatttgagatcgatccacacctgcaagagagagttgacaaaggc atcgagacagatggctccaacctgagtggtgtcagtgccaagtgtgcctgggatgacctgagccggccccccgaggatgacgagga cagccggagcatctgcatcggcacacagccccggcgactctctggcaaagacacagagcagatccgggagaccctgaggagaggac tcgagatcaacagcaaacctgtccttccaccaatcaaccctcagcggcagaatggcctcgcccacgaccgggccccgagccgcaaa gacagcctggaaagtgacagctccacggccatcattccccatgagctgattcgcacgcggcagcttgagagcgtacatctgaaatt caaccaggagtccggagccctcattcctctctgcctaaggggcaggctcctgcatggacggcactttacatataaaagtatcacag gtgacatggccatcacgtttgtctccacgggagtggaaggcgcctttgccactgaggagcatccttacgcggctcatggaccctgg ttacaaattctgttgaccgaagagtttgtagagaaaatgttggaggatttagaagatttgacttctccagaggaattcaaacttcc caaagagtacagctggcctgaaaagaagctgaaggtctccatcctgcctgacgtggtgttcgacagtccgctacactag
SuFu amino acid sequence - NP 057253.2 (SEP ID NO:28
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPE HWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSES RIQHMLLTEDPQMQPVQTPFGWTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKG IETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRK DSLESDSSTAI IPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATEEHPYAAHGPW LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSPLH

Claims

1. A method of modulating FSH signaling in a subject, comprising:
administering to a subject in need of modulation of FSH signaling an effective amount of an Hh pathway modulator, thereby modulating FSH signaling.
2. The method of claim 1, further comprising identifying the subject as a subject in need of modulation of FSH signaling.
3. The method of any one of claims 1-2, wherein the subject has a gynecologic disorder.
4. The method of claim 3, wherein the gynecologic disorder is endometriosis or leiomyomata.
5. The method of any one of claims 1-4, wherein the Hh pathway modulator is an Hh pathway inhibitor.
6. The method of claim 5, wherein the Hh pathway inhibitor is an inhibitor of an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, a Smo polypeptide, or a Gli polypeptide.
7. The method of claim 5, wherein the Hh pathway inhibitor is an activator of a Ptc polypeptide, an Hhip polypeptide, or an SuFu polypeptide.
8. The method of claim 5, wherein the Hh pathway inhibitor is vismodegib.
9. A method of suppressing ovarian function in a subject, comprising: administering to a subject in need of ovarian suppression an effective amount of an Hh pathway inhibitor, thereby suppressing ovarian function in the subject.
10. The method of claim 9, wherein the subject has or is susceptible to a gynecologic condition.
11. The method of claim 10, wherein the gynecologic condition is endometriosis or leiomyomata.
12. The method of any one of claims 9-11, wherein the Hh pathway inhibitor is an inhibitor of an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, a Smo polypeptide, or a Gli polypeptide.
13. The method of any one of claims 9-11, wherein the Hh pathway inhibitor is an activator of a Ptc polypeptide, an Hhip polypeptide, or an SuFu polypeptide.
14. The method of any one of claims 9-11, wherein the Hh pathway inhibitor is an inhibitor of FSH signaling.
15. The method of any one of claims 9-11, wherein the Hh pathway inhibitor is vismodegib.
A method of inhibiting spermatogenesis, comprising administering to a male subject in need of spermatogenesis inhibition an Hh pathway inhibitor, thereby inhibiting spermatogenesis.
17. The method of claim 16, wherein the Hh pathway inhibitor is an inhibitor of an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, a Smo polypeptide, or a Gli polypeptide.
18. The method of claim 16, wherein the Hh pathway inhibitor is an activator of a Ptc polypeptide, an Hhip polypeptide, or an SuFu polypeptide.
19. The method of claim 16, wherein the Hh pathway inhibitor is an inhibitor of FSH signaling.
20. The method of claim 16, wherein the Hh pathway inhibitor is vismodegib.
21. A method of increasing fertility in a subject, comprising:
administering to a subject in need of an increase in fertility an Hh pathway activator, thereby increasing fertility in the subject.
22. The method of claim 21, wherein the Hh pathway activator is an activator of an Hh polypeptide, a Cdo polypeptide, a Boc polypeptide, a Gasl polypeptide, a Smo polypeptide, or a Gli polypeptide.
23. The method of claim 21 , wherein the Hh pathway activator is an inhibitor of a Ptc polypeptide, an Hhip polypeptide, or an SuFu polypeptide.
24. A method of inhibiting FSH signaling in a cell having a higher level of FSH signaling than a reference level, comprising:
providing to the cell a therapeutically effective amount of an Hh pathway inhibitor, thereby inhibiting FSH signaling in the cell.
25. The method of claim 24, wherein the reference level is a level of FSH signaling in a cell from a subject not having a gynecologic condition.
26. The method of claim 24, wherein the cell is an ovarian cell or a testicular cell.
27. A method of identifying an agent that suppresses ovarian function, comprising:
providing one or more Hh pathway polypeptides;
contacting the one or more Hh pathway polypeptides with a test agent; and determining a level of activity of an Hh signaling pathway in the presence and absence of the test agent, wherein a test agent that inhibits the Hh signaling pathway is identified as an agent that suppresses ovarian function.
PCT/US2013/072131 2012-11-29 2013-11-27 Methods of modulating follicle stimulating hormone activity WO2014085523A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US14/648,300 US9844541B2 (en) 2012-11-29 2013-11-27 Methods of modulating follicle stimulating hormone activity
EP13858461.0A EP2925363A4 (en) 2012-11-29 2013-11-27 Methods of modulating follicle stimulating hormone activity
AU2013352256A AU2013352256A1 (en) 2012-11-29 2013-11-27 Methods of modulating follicle stimulating hormone activity
CA2893133A CA2893133A1 (en) 2012-11-29 2013-11-27 Methods of modulating follicle stimulating hormone activity

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261731343P 2012-11-29 2012-11-29
US61/731,343 2012-11-29

Publications (1)

Publication Number Publication Date
WO2014085523A1 true WO2014085523A1 (en) 2014-06-05

Family

ID=50828438

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/072131 WO2014085523A1 (en) 2012-11-29 2013-11-27 Methods of modulating follicle stimulating hormone activity

Country Status (5)

Country Link
US (1) US9844541B2 (en)
EP (1) EP2925363A4 (en)
AU (1) AU2013352256A1 (en)
CA (1) CA2893133A1 (en)
WO (1) WO2014085523A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019122153A3 (en) * 2017-12-21 2019-08-01 Aarhus Universitet Compounds for use in regulating follicle maturation
US11066419B2 (en) 2016-12-30 2021-07-20 Frequency Therapeutics, Inc. 1H-pyrrole-2,5-dione compounds and methods of using same

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20230152945A (en) * 2022-04-28 2023-11-06 애니머스큐어 주식회사 A pharmaceutical composition comprising Cdon-Ig2 domain for treating vascular calcification
CN114854756B (en) * 2022-05-31 2023-08-29 华南农业大学 Application of miR-370 to regulation of GLI1 expression in porcine ovarian granulosa cells
CN114903996B (en) * 2022-06-22 2023-10-20 武汉大学中南医院 Application of specific inhibitor of Hedgehog pathway in preparation of medicine for treating intrauterine adhesion

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001098344A2 (en) * 2000-06-16 2001-12-27 Curis, Inc. Angiogenesis-modulating compositions and uses
US20070060546A1 (en) * 2003-01-22 2007-03-15 Centre National De La Recherche Scientif Novel use of mifepristone and derivatives therefor as hedgehog protein signaling pathway modulators and applications of same
WO2007126455A2 (en) * 2006-04-05 2007-11-08 Genentech, Inc. Method for using boc/cdo to modulate hedgehog signaling

Family Cites Families (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6277566B1 (en) 1998-02-13 2001-08-21 Phillip A. Beachy Method for identifying a hedgehog-mediated phosphorylation state dependent transcription factor
US6432970B2 (en) 1998-04-09 2002-08-13 Johns Hopkins University School Of Medicine Inhibitors of hedgehog signaling pathways, compositions and uses related thereto
US20070021493A1 (en) 1999-09-16 2007-01-25 Curis, Inc. Mediators of hedgehog signaling pathways, compositions and uses related thereto
AU780846B2 (en) 1999-09-16 2005-04-21 Curis, Inc. Mediators of hedgehog signaling pathways, compositions and uses related thereto
EP1728797A3 (en) 1999-10-13 2011-03-02 Johns Hopkins University School of Medicine Regulators of the hedgehog pathway, compositions and uses related thereto
EP1227805B2 (en) 1999-10-14 2011-02-23 Curis, Inc. Mediators of hedgehog signaling pathways, compositions and uses related thereto
IL133809A0 (en) 1999-12-30 2001-04-30 Yeda Res & Dev Steroidal alkaloids and pharmaceutical compositions comprising them
DK1272168T3 (en) 2000-03-30 2006-02-13 Curis Inc Sma organic molecules as cell proliferation regulators
KR20040031782A (en) 2001-07-27 2004-04-13 쿠리스 인코퍼레이션 Mediators of Hedgehog Signaling Pathways, Compositions and Uses Related Thereto
CA2483311A1 (en) 2002-04-22 2003-10-30 Philip A. Beachy Modulators of hedgehog signaling pathways, compositions and uses related thereto
AU2003265853A1 (en) 2002-08-29 2004-03-19 Curis, Inc. Hedgehog antagonists, methods and uses related thereto
WO2005013800A2 (en) 2003-07-15 2005-02-17 The Johns Hopkins University Elevated hedgehog pathway activity in digestive system tumors, and methods of treating digestive system tumors having elevated hedgehog pathway activity
WO2005033288A2 (en) 2003-09-29 2005-04-14 The Johns Hopkins University Hedgehog pathway antagonists
US20080095761A1 (en) 2003-10-01 2008-04-24 The Johns Hopkins University Hedgehog Signaling in Prostate Regeneration Neoplasia and Metastasis
US20080057071A1 (en) 2003-10-20 2008-03-06 Watkins David N Use Of Hedgehog Pathway Inhibitors In Small-Cell Lung Cancer
PL1745041T3 (en) 2004-04-30 2012-11-30 Genentech Inc Quinoxaline inhibitors of the hedgehog signalling pathway
BRPI0514444A (en) 2004-08-27 2008-06-10 Infinity Pharmaceuticals Inc cyclopamine analogues and methods of use of these
PL1789390T3 (en) 2004-09-02 2012-04-30 Genentech Inc Pyridyl inhibitors of hedgehog signalling
AU2005302279A1 (en) 2004-10-28 2006-05-11 Irm Llc Compounds and compositions as hedgehog pathway modulators
EP1945202A2 (en) 2005-11-11 2008-07-23 Licentia OY Mammalian hedgehog signaling inhiabitors
WO2007059157A1 (en) 2005-11-14 2007-05-24 Genentech, Inc. Bisamide inhibitors of hedgehog signaling
EP2010170A2 (en) 2006-04-14 2009-01-07 Novartis AG Use of biarylcarboxamides in the treatment of hedgehog pathway-related disorders
UA93548C2 (en) 2006-05-05 2011-02-25 Айерем Елелсі Compounds and compositions as hedgehog pathway modulators
KR101563010B1 (en) 2006-10-31 2015-10-26 더 가버먼트 오브 더 유나이티드 스테이츠 오브 어메리카 애즈 리프리젠티드 바이 더 디파트먼트 오브 헬스 앤 휴먼 서비씨즈 Smoothened polypeptides and methods of use
TWI433674B (en) 2006-12-28 2014-04-11 Infinity Discovery Inc Cyclopamine analogs
MX2009009429A (en) 2007-03-07 2010-07-05 Infinity Discovery Inc Cyclopamine lactam analogs and methods of use thereof.
BRPI0808663A2 (en) 2007-03-07 2014-08-26 Infinity Discovery Inc HYPEROCYCLIC CYCLOAMINE ANALOGS AND METHODS OF USE
MX2009009786A (en) 2007-03-14 2009-09-24 Exelixis Inc Inhibitors of the hedgehog pathway.
UA100684C2 (en) 2007-03-15 2013-01-25 Новартіс Аг Normal;heading 1;heading 2;heading 3;BENZYL AND PYRIDINYL DERIVATIVES AS MODULATORS OF THE HEDGEHOG SIGNALING PATHWAY
WO2008131354A2 (en) 2007-04-20 2008-10-30 The Curators Of The University Of Missouri Phytoestrogens as regulators of hedgehog signaling and methods of their use in cancer treatment

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001098344A2 (en) * 2000-06-16 2001-12-27 Curis, Inc. Angiogenesis-modulating compositions and uses
US20070060546A1 (en) * 2003-01-22 2007-03-15 Centre National De La Recherche Scientif Novel use of mifepristone and derivatives therefor as hedgehog protein signaling pathway modulators and applications of same
WO2007126455A2 (en) * 2006-04-05 2007-11-08 Genentech, Inc. Method for using boc/cdo to modulate hedgehog signaling

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
GENENTECH, INC.: "Erivedge (vismodegib);Revised 01/2012; Genentech, Inc. 04 July 2012; [retrieved on 3 March 2013]", PRESCRIBING INFORMATION;, January 2012 (2012-01-01), pages 3, XP008179924, Retrieved from the Internet <URL:http://www.accessdata.fda.gov/drugsatfda_docs/label/2012/203388lbl.pdf> [retrieved on 20130303] *
MURPHY, AA ET AL.: "Regression of Uterine Leiomyomata in Response to the Antiprogesterone RU 486';", JOUMAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, vol. 76, no. 2, 1993, pages 513 - 517, XP008179920 *
See also references of EP2925363A4 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11066419B2 (en) 2016-12-30 2021-07-20 Frequency Therapeutics, Inc. 1H-pyrrole-2,5-dione compounds and methods of using same
WO2019122153A3 (en) * 2017-12-21 2019-08-01 Aarhus Universitet Compounds for use in regulating follicle maturation

Also Published As

Publication number Publication date
US9844541B2 (en) 2017-12-19
US20150297575A1 (en) 2015-10-22
EP2925363A4 (en) 2016-11-09
AU2013352256A1 (en) 2015-06-18
EP2925363A1 (en) 2015-10-07
CA2893133A1 (en) 2014-06-05

Similar Documents

Publication Publication Date Title
CN107106590B (en) Combination (I)
Yuan et al. The role of RXFP2 in mediating androgen-induced inguinoscrotal testis descent in LH receptor knockout mice
Iezzi et al. Deacetylase inhibitors increase muscle cell size by promoting myoblast recruitment and fusion through induction of follistatin
US9844541B2 (en) Methods of modulating follicle stimulating hormone activity
US7629325B2 (en) Human Sef isoforms and methods of using same for cancer diagnosis and gene therapy
CN107188969A (en) Anti-epidermal growth factor receptor variant III Chimeric antigen receptors and its purposes for treating cancer
JP2009514528A (en) Negative immunomodulation method of immune response by NKG2D positive CD4 + cells
Tsuruoka et al. Exacerbation of autoimmune myocarditis by an immune checkpoint inhibitor is dependent on its time of administration in mice
US20230046305A1 (en) Peptides and other agents for treating pain and increasing pain sensitivity
MX2014006820A (en) Methods and compositions for treating antiprogestin-resistant cancers.
US7741275B2 (en) Agents and use thereof
Lampropoulou et al. Reduced expression of ERp46 under diabetic conditions in β-cells and the effect of liraglutide
US20070037202A1 (en) Potentiation of cancer therapies by ZNF217 inhibition
US8524228B2 (en) Netrin-1 compositions and methods of use thereof
TWI359271B (en) Pharmaceutical composition for insulin resistance
US20220267774A1 (en) Methods and compositions to direct breakdown of insulin mrna in benign fashion
JP2008521814A (en) DAP-10 and use thereof
US20240173290A1 (en) Novel use
EP2471918A1 (en) Screening method
US7807383B2 (en) Diagnosing and treating hormone resistant cancers
JP2009535391A (en) Inhibitors of hCAP18 / LL-37 for use in the treatment of breast cancer
US20220193113A1 (en) Novel therapeutic agent for gastrointestinal cancer and method for screening for the same
Voutilainen et al. Potential relevance of mullerian-inhibiting substance to ovarian physiology
WO2024040070A2 (en) Methods and compositions for treating cancer
US20110268748A1 (en) NURR-1 Interacting Protein (NuIP)

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13858461

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2893133

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 14648300

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 2013858461

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2013352256

Country of ref document: AU

Date of ref document: 20131127

Kind code of ref document: A