WO2014048955A1 - Arterivirus - Google Patents
Arterivirus Download PDFInfo
- Publication number
- WO2014048955A1 WO2014048955A1 PCT/EP2013/069915 EP2013069915W WO2014048955A1 WO 2014048955 A1 WO2014048955 A1 WO 2014048955A1 EP 2013069915 W EP2013069915 W EP 2013069915W WO 2014048955 A1 WO2014048955 A1 WO 2014048955A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- plp2
- virus
- eav
- domain
- arterivirus
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/40—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum bacterial
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/42—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
- A61P31/22—Antivirals for DNA viruses for herpes viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5254—Virus avirulent or attenuated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/10011—Arteriviridae
- C12N2770/10021—Viruses as such, e.g. new isolates, mutants or their genomic sequences
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/10011—Arteriviridae
- C12N2770/10034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/10011—Arteriviridae
- C12N2770/10061—Methods of inactivation or attenuation
- C12N2770/10062—Methods of inactivation or attenuation by genetic engineering
Definitions
- the present invention relates to replication-competent Arteriviruses, to their use as a medicament, their use as a vaccine and in prophylaxis, to vaccines comprising such Arteriviruses and to Arteriviral PLP2-ubiquitin complexes.
- the Arterivirus family belongs to the order Nidovirales, of which currently four species are known: Equine arteritis virus (EAV), Porcine respiratory and reproductive syndrome virus (PRRSV), Lactate dehydrogenase elevating virus (LDV), and Simian hemorrhagic fever virus (SHFV). LDV and SHFV have only minor economic impact, since they infect mice and monkeys respectively. Contrary to this, EAV and especially PRRSV pose a considerable financial burden on society.
- EAV Equine arteritis virus
- PRRSV Porcine respiratory and reproductive syndrome virus
- LDV Lactate dehydrogenase elevating virus
- SHFV Simian hemorrhagic fever virus
- LDV and SHFV have only minor economic impact, since they infect mice and monkeys respectively. Contrary to this, EAV and especially PRRSV pose a considerable financial burden on society.
- Equine arteritis virus causes infections in horses, and thus forms a recurring problem in the horse breeding industry. Therefore it poses a significant economic burden on horse breeders.
- the Equine arteritis virus establishes a persistent infection in so-called "carrier stallions", which subsequently transmit the virus to mares, potentially leading to abortion of foetuses.
- PRRSV infection ranks as the number one health challenge for the pig industry, causing the greatest productivity losses when compared to other diseases caused by for example Clostridium difficile, swine influenza, Streptococcus sp., rotavirus or porcine circovirus.
- Clostridium difficile, swine influenza, Streptococcus sp., rotavirus or porcine circovirus Considering the emergence of highly virulent strains of PRRSV in South-East Asia in 2006 and the fact that the Asian swine industry is the largest in the world, it can safely be assumed that losses in this part of the world are considerably higher than those reported for the US .
- PRRSV remains a major threat to the swine industry since the associated disease has proven to be difficult to control, in spite of the availability of both live attenuated and killed vaccines against PRRSV.
- Live attenuated vaccines usually comprise a virus that is produced by serial passage of strains in cell culture, resulting in attenuated viruses that do no longer induce disease in pigs. These vaccines generally induce some level of long- lasting protection. However when derived from a single PRRSV vaccine strain they may not fully protect against heterologous PRRSV infection (PRRSV isolates can be highly diverged and group into a European and a North- American genotype).
- the Arterivirus family consists of positive-sense (+) single-stranded RNA viruses with a genome size ranging from about 13 to 16 kb.
- the RNA Upon infection, the RNA is translated into two replicase precursor polyproteins, ppla and pplab.
- the functional non-structural proteins (nsps) of Arteriviruses derive from cleavage of these polyproteins by internally encoded proteases. Upon release from the polyprotein, these non-structural proteins together form the replication and transcription complex which is responsible for the replication of the viral genome and for the synthesis of the subgenomic messenger RNAs encoding the structural proteins.
- the ppla and pplab polyproteins of the prototype Arterivirus, EAV, are cleaved into at least 13 nonstructural proteins by three internal proteases present in nonstructural protein 1 (nspl), nsp2 and nsp4.
- Arteriviral nsp2 contains a papain-like protease (PLP) domain in its N-terminal region.
- PLP2 as this protease is commonly referred to, is responsible for the cleavage of the junction between nsp2 and nsp3, and its catalytic activity is, likely for this reason, essential for viral replication.
- PLP2 papain-like protease
- nsp2 was more recently found to also play a role in the evasion of host innate immune responses, as indicated above.
- viral nucleic acids can trigger the activation of innate immune signaling cascades, resulting in the activation of transcription factors such as NFKB and IrO/Irf7, ultimately leading to the transcription of genes encoding beta interferon (IFN- ⁇ ) and other pro-inflammatory cytokines.
- IFN- ⁇ beta interferon
- these signaling pathways are extensively regulated, both positively and negatively, through protein ubiquitination (Jiang, X. (2012)).
- arteriviral PLP2 has also been shown to remove the ubiquitin-like antiviral protein Interferon Stimulated Gene 15 (ISG15) from cellular target proteins (Frias-Staheli, N. (2007), Sun, Z. (2012), Arguello, M.D. (2007)). This activity will be referred to as the delSGylating activity. Due to the close relatedness of ubiquitin and ISG15, this role of the PLP2 domain will generally be referred to as the DUB/delSGylating activity.
- ISG15 Interferon Stimulated Gene 15
- Patent Application WO2012/063212 describes attempts to make modifications that might possibly lead to impaired immune evasion capacities in PRRSV.
- a mutant virus is described that comprises 32 amino acid changes at locations scattered over the whole viral genome, all outside the PLP2 domain, all of which believed to be directly responsible for the interferon induction/inhibition phenotype of the virus. Thus, all of these changes must be introduced in order to turn a wild-type virus into a replication-competent virus that has a decreased interferon inhibition activity.
- Patent Application WO2009/008924 describes methods of preventing viral infection by inhibiting the delSGylating activity of OTU-containing viral proteins.
- the Application mainly aims at targeting the delSGylating activity of OTU-containing viral proteins by means of pharmaceutical compounds.
- this application does not disclose or even hint towards modifications in Arteriviruses that specifically remove the DUB/delSGylating activity while at the same time keeping the polyprotein processing function intact.
- a first problem to be solved is related to the production of a sufficient amount of an nsp2- fragment that allowed for crystallographic analysis of the PLP2 domain.
- Nsp2 expresses poorly in expression systems and, when expressed as a fusion protein, is difficult to remove from the fusion partner without PLP2 becoming insoluble and thus unsuitable for protein crystallization.
- a second problem encountered in the process of determining the 3D-structure of the PLP2 domain was the inability to crystallize the purified PLP2 domain.
- the mechanism-based suicide inhibitor Ub ( i-75)-3-bromopropylamine (Ub-3Br) was prepared according to Messick et al (2008) and Borodovsky et al (2002) as described by James et al (2011). Then, Ub-Br3 was covalently bound to purified PLP2 by gently mixing the proteins in a 3:2 molar ratio, respectively, for one hour at 37°C.
- the resulting PLP2- ubiquitin complex was purified by gel filtration, anion exchange (Source 15Q) chromatography and then exchanged into 20 mM Tris, pH 8.0, 50 mM NaCl before concentrating to 10 mg/ml and storing at 4°C.
- PLP2 adopts a compact, two-domain fold with a shallow Ub-binding site that directs the C-terminus of the bound Ub molecule (the 'distal' Ub in a Ub dimer) towards a solvent exposed active site (Fig. 1A).
- Domain I of PLP2 (residues 267-307 and 365-378) consists of a three-helix bundle (al , a2, a4) packed against a two-stranded antiparallel sheet ( ⁇ 2
- Domain II centers on a four-stranded ⁇ -sheet ( ⁇ 1
- Domain II comprises the majority of the Ub-binding site, which is stabilized by four cysteine residues (Cys 319, 349, 354, 356) that coordinate a zinc ion with tetrahedral geometry (Fig. IB). Their arrangement forms a C4 zinc finger that resembles a C-terminal type zinc necklace motif (Andreini et al., 2011) (Fig. IB).
- Cys344 A large insertion between positions CI (Cys319) and C2 (Cys349) appears to extend the stabilizing effect of the zinc finger throughout much of domain II.
- a fifth cysteine (Cys344) is located near the zinc ion but does not coordinate with it, consistent with other zinc necklace motifs that have been described (Andreini et al., 2011) and with previous findings showing that a Cys344 to alanine mutation had no effect on catalytic activity of the PLP2 domain (Snijder et al., 1995).
- cysteines Three of the cysteines (Cys 319, 349, and 354) are fully conserved in Arteriviruses, and mutational analysis of these residues and Cys356 demonstrated their presence to be essential for catalytic activity (Snijder et al., 1995). Given its distance from the active site however (-25 A) (Fig. 1 A), the zinc finger appears to play a structural role as opposed to participating in catalysis. Expression of the PLP2 domain in E. coli grown in the absence of zinc (M9 media) yields insoluble protein, supporting the idea that the zinc finger is structural and is likely required for correct folding of the protease.
- the PLP2 active site contains a catalytic cysteine nucleophile (Cys270) and histidine (His332) residue, along with an accompanying asparagine (Asn263) that hydrogen bonds with the imidazole ring of His332 (Fig. 1C).
- Cys270 catalytic cysteine nucleophile
- His332 histidine residue
- Asn263 an accompanying asparagine that hydrogen bonds with the imidazole ring of His332
- the side chain of Cys270 is covalently coupled to the C- terminus of Ub via the 3 -propylamine (3CN) modification, mimicking the acyl-enzyme intermediate step of the catalytic reaction and confirming the identity of Cys270 as the catalytic nucleophile (Fig. 1A, C).
- the Arterivirus PLP2 deviates from typical OTU-domain structures.
- Members of the OTU superfamily classify as structural relatives of Arterivirus PLP2, supporting its classification as a member of this superfamily.
- sequence similarity between Arterivirus PLP2 and OTU-domain proteases is very weak (Makarova et al., 2000) and indeed the EAV PLP2 structure exhibits topological features that deviate considerably from a typical OTU-fold.
- Domain I of known OTU-domain structures contains a pair of solvent exposed alpha helices that pack perpendicularly against two internal helices (Fig. ID, G, H).
- This topology subtly resembles the L domain of papain (Kamphuis et al., 1984) and markedly reduces the size of domain I of PLP2 and its contribution to Ub binding relative to other OTU- domain DUBs that have been determined in complex with Ub (Akutsu et al., 2011 ; Capodagli et al., 2011 ; Huang et al., 2012; James et al., 2011 ; Messick et al., 2008).
- a more striking deviation from known OTU-domain structures is the presence of the zinc finger in domain II of PLP2 (Fig. 1A, B) and its critical importance for catalytic activity (Snijder et al., 1995).
- Ub-binding domains containing zinc fingers exist within a number of OTU-domain DUBs, but none comprise part of the distal Ub binding site within the OTU-domain fold. They exist instead as accessory domains that are connected to the OTU-domain through flexible linkers (Komander et al., 2009), where, in the case of A20, they appear to provide additional polyubiquitin linkage specificity and possibly target the protein to specific signaling complexes (Bosanac et al., 2010).
- the zinc finger motif is an integral part of the OTU-fold and, as described below, plays a central role in binding and positioning the distal Ub molecule on the protease surface (Fig. 1).
- OTU-domain DUBs are grouped into three subclasses based on their structural characteristics: the Otubains, the A20-like OTU's and the OTU's (Komander et al., 2009).
- Arterivirus PLP2 enzymes represent a new (a fourth) subclass of zinc-dependent OTU's.
- Arterivirus PLP2 and CCHFV OTU are unique from eukaryotic OTU-domain DUBs in that they remove ISG15 from cellular targets in addition to Ub.
- the crossreactivity towards ISG 15 -tagged substrates observed for CCHFV OTU arises primarily from a unique ⁇ -hairpin on the Ub-binding site that modifies the site such that it can
- Arterivirus PLP2 in addition to its isopeptidase activity targeting Ub and ISG15, Arterivirus PLP2 also cleaves a specific peptide bond within the viral polyproteins as part of the replicase polyproteins' maturation process. Given the distance of helix a3 from the PLP2 active site (Fig. 1 A), it could now, for the first time, be determined that mutations could be introduced into this region of the Ub-binding site that would selectively disrupt PLP2's DUB and delSGylating activities without affecting the ability of the enzyme to bind and cleave the linear nsp2/nsp3 junction within the viral polypeptide.
- the 3D-structure of PLP2, ubiquitin and the PLP2-ubiquitin binding surface is given in figure 2 for the Arterivirus EAV, more specifically for strain Bucyrus (GeneBank accession number NC 0022532).
- a first embodiment of the present invention relates to replication-competent Arterivirus, characterized in that said virus has a decreased DUB/delSGylating activity due to a mutation in the PLP2 domain of the non-structural protein nsp2.
- the PLP2 domain of the non-structural protein nsp2 is a very short domain: the PLP2 domain of e.g. EAV strain Bucyrus consists of only 127 amino acids (SEQ ID NO.: 9) and that of PRRSV strain Lelystad consists of only 136 amino acids (SEQ ID NO.: 10).
- the PLP2 domain of e.g. PRRSV strain VR-2332 consists of 139 amino acids (SEQ ID NO.: 11)
- Figure 3 represents a sequence alignment of the PLP2 domain for EAV strain Bucyrus, PRRSV strain Lelystad, PRRSV strain VR-2332 and PRRSV strain GM2 (vide infra).
- Figure 4 shows the molecular models of VR-2332 and Lelystad based on the alignment of their respective sequences to EAV PLP2. Once aligned to EAV PLP2, this allows the sequences of either VR-2332 or LV to be substituted onto the 3D backbone structure of the EAV PLP2 crystal structure.
- amino acid side chains of the EAV PLP2 domain are replaced by those of VR-2332 or LV as dictated by the multiple sequence alignment. From there, missing loops are modelled ab initio and the overall 3D model is optimized using an appropriate energy minimising target function.
- the numbering of the amino acid sequence of the PLP2 domain of EAV as given in figure 3 is used in order to refer to the various boxed regions. This numbering is therefore referred to as "consensus numbering" of the PLP2 domain.
- a replication-competent Arterivirus is a virus that can still replicate, i.e. is capable of producing infectious progeny virus.
- the infectious progeny virus can be replication- competent infectious progeny virus or replication-defective infectious progeny virus.
- Replication-competent viruses according to the invention are very suitable as a basis for live attenuated Arterivirus vaccines.
- the amount of progeny virus must be sufficiently high. Therefore, for the purpose of this invention, a replication-competent virus is a virus that produces an amount of progeny virus in a susceptible cell system, that it not more than 3 10 logs below the amount of progeny virus produced by the same virus without a mutation according to the invention in the same cell system.
- the amount of progeny virus is not more than 2 10 logs below the amount of progeny virus that a virus without a mutation according to the invention would produce in the same cell system. More preferably, the amount of progeny virus is not more than 1 log below that amount.
- an Arterivirus according to the invention having a decreased DUB/delSGylating activity is a virus that has a mutation in the PLP2 domain such that said virus shows an increase in interferon beta mRNA induction to a level that is at least twice the amount of interferon beta mRNA induction shown by a wild-type virus.
- FIG 9A it is shown that e.g. EAV mutant I353R produces about 4 times as much IFN beta mRNA compared to the wild type virus that does not comprise the I353R mutation.
- the triple- mutant in figure 9 A even produces about 8 times as much IFN beta mRNA compared to the wild type virus.
- a mutant such as T312A already shows a level of DUB -activity that leads to a significantly denser alpha- flag lane, which represents the amount of remaining ubiquitin conjugates, than that of the wild-type virus.
- the inventors consider a virus that has a mutation in the PLP2 domain such that said virus shows an increase in interferon beta mRNA induction to a level of at least twice, preferably four, more preferably eight times the amount of interferon beta mRNA induction shown by a wild-type virus, to be a virus having a decreased DUB/delSGylating activity.
- a mutation can e.g. be a replacement, an insertion or a deletion, as explained below.
- FIG 3 an overview is given of the PLP2 domain of four different examples of Arteriviruses: EAV strain Bucyrus, and PRRSV strains GM2, Lelystad and VR-2332. An alignment of the sequences is made and relevant regions are indicated by boxes. This figure should be seen in close connection with figures 2 and 4.
- Figure 2 shows the 3D-structure of the PLP2 domain of EAV and the way ubiquitin binds to this structure.
- Figure 4 shows the predicted 3 D-structure of the PLP2 domain of PRRSV strains Lelystad and VR-2332 and the way ubiquitin binds to this structure, side-by-side with the crystal structure of the PLP2 domain of EAV strain Bucyrus for comparison.
- Residues in figure 3 that are boxed with dotted lines represent residues that interact near the active site with the RLRGG motif of ubiquitin. Mutating these residues is likely to affect the polyprotein processing activity of the PLP2 domain and should thus preferably be avoided.
- Residues boxed with thick lines represent residues that bind directly to the beta-grasp fold of ubiquitin (i.e. the main body of ubiquitin), not near the active site.
- the zinc-binding site and residues immediately surrounding this site form the majority of the ubiquitin interactions surface of the PLP2 domain that binds the beta-grasp fold of ubiquitin and likely the analogous region of the C-terminal domain of ISG15.
- the replication-competent Arterivirus having a decreased DUB/delSGylating activity due to a mutation in the PLP2 domain of nsp2 is selected from the group of viruses consisting of EAV and PRRSV.
- Figure 3 represents structurally aligned sequences defining the ubiquitin interaction surface alignment of 4 Arterivirus sequences representing major EAV and PRRSV strains.
- the alignment is indeed structural in the sense that the boxes indicate regions of each of the PLP2 amino acid sequences that in all cases interact with ubiquitin, according to either the crystal structure (EAV) or the models (PRRSV) as shown side-by-side in figure 4.
- the amino acid numbering in figure 3 is represented here for four examples of Arteriviruses: for EAV strain Bucyrus and for PRRSVs Lelystad, VR-2332 and GM2. It is clear that other Arterivirus PLP2 sequences can equally be structurally aligned with the sequences already given in figure 3. As indicated above, for ease of reference, the numbering of the amino acid sequence of the PLP2 domain of EAV as given in figure 3 is used in order to refer to the various boxed regions.
- a more preferred form of this embodiment relates to a replication-competent Arterivirus according to the invention, characterized in that said mutation in the PLP2 domain is located at any of consensus positions 296-297 and/or 309-319 and/or 326-330 and/or 345-355 according to the EAV numbering as depicted in figure 3.
- the positions for PRRSV Lelystad are 463-464, 475-485, 492-496 and 512-522 respectively.
- PRRSV VR-2332 and PRRSV GM2 the positions are 471 -472, 483-493, 500-504 and 520-530.
- An even more preferred form of this embodiment relates to a replication-competent Arterivirus according to the invention, characterized in that said mutation in the PLP2 domain is located at any of consensus positions 296-297 and/or 310-318 and/or 327-329 and/or 346-354 according to the EAV numbering as depicted in figure 3.
- PRRSV Lelystad positions for e.g. PRRSV Lelystad are 463-464, 476-484, 493-495 and 513-521.
- Arterivirus according to the invention characterized in that said mutation in the PLP2 domain is located at any of consensus positions 296-297 and/or 311-317 and/or 328 and/or 347-348 and/or 351-353 according to the EAV numbering as depicted in figure 3.
- the inventors demonstrated, as an example, through site directed mutagenesis that e.g. positions Thr312, Ile313 and Ile353 of the EAV PLP2 ubiquitin interaction surface to be important for the DUB activity of the enzyme and the ability of the EAV virus to suppress the IFN response.
- positions Ile313 (Val479 of Lelystad PLP2, Leu487 of VR2332 PLP2) and Ile353 (Val520 of Lelystad PLP2, Cys528 of VR2332 PLP2) of the EAV PLP2 domain are on the solvent-exposed surface of the ubiquitin interaction surface
- these positions on Lelystad or VR2332 PLP2 domains could be mutated to a variety of amino acids to selectively disrupt DUB and delSGylating activity.
- amino acids e.g. include Ala, Arg, Ser, Thr, Trp (for which the inventors already demonstrated that it can be tolerated at position 353 in the EAV PLP2 domain).
- Thr312 of EAV PLP2 (Thr478 of Lelystad PLP2, Ala486 of VR2332 PLP2) is packed within a tight loop, thus mutations at this position need to more conservative as they could misfold the loop. Possible mutations at this position include e.g. Gly (for EAV, Lelystad and VR2332), Ala or Ser (EAV and Lelystad).
- a most preferred form of this embodiment relates to a replication-competent Arterivirus according to the invention, characterized in that said mutation in the PLP2 domain is at consensus position T312, 1313 or 1353.
- a specific form of this most preferred form relates to a replication-competent Arterivirus according to the invention, characterized in that said Arterivirus is EAV and said mutation in the PLP2 domain is T312A, 1313V, I353A, I353R, I353S, I353T or I353W
- residues of the ubiquitin interaction surface of the PLP2 domain that bind directly to ubiquitin (boxed by thick lines in Figure 3)
- residues of the ubiquitin interaction surface of the PLP2 domain that bind directly to ubiquitin (boxed by thick lines in Figure 3)
- residues of the ubiquitin interaction surface of the PLP2 domain that bind directly to ubiquitin (boxed by thick lines in Figure 3)
- residues of the ubiquitin interaction surface of the PLP2 domain that bind directly to ubiquitin (boxed by thick lines in Figure 3)
- residues 303-306 of EAV PLP2 (470-473 of Lelystad PLP2 and 478-481 of VR-2332 PLP2) play an important role in placing helix 2 underneath the ubiquitin interaction surface of the PLP2 enzymes. Mutation of residues within this region could be used to affect proper placement of helix 2, leading to distortion of the ubiquitin interaction surface and thus reduced DUB/delSGylating activity. Given these residues are distant from the PLP2 active site, their mutation could be used to reduce DUB/delSGylating activity with minimal effect on viral polyprotein processing.
- another more preferred form of this embodiment relates to a replication-competent Arterivirus according to the invention, characterized in that said mutation in the PLP2 domain is located at any of consensus positions 303-306 according to the EAV numbering as depicted in figure 3.
- the positions for PRRSV Lelystad are 470-473.
- the positions are 478-481.
- residues 343-346 of EAV PLP2 (510-513 of Lelystad PLP2 and 518-521 of VR-2332 PLP2) assist in positioning helix 3 of the zinc finger motif, a structure that forms a number of key binding interactions with Ub. Mutation of residues within this region could be created to distort the position of the zinc finger motif and surrounding ubiquitin interaction surface to selectively reduce DUB/delSGylating activity without affecting viral polyprotein processing.
- this embodiment relates to a replication- competent Arterivirus according to the invention, characterized in that said mutation in the PLP2 domain is located at any of consensus positions 343-346 according to the EAV numbering as depicted in figure 3.
- the positions for PRRSV Lelystad are 510-513.
- the positions are 518-521.
- EAV PLP2 residue Phe350 (Val517 of Lelystad PLP2 and Val525 of VR-2332 PLP2) is located on helix 3 of the zinc finger and participates in packing helix 3 against a-helix 2.
- mutation of EAV PLP2 residue Phe350 (Val517 of Lelystad PLP2 and Val525 of VR-2332 PLP2) could be used to displace the helix 3, thereby selectively reducing DUB/delSGylating activity.
- still another more preferred form of this embodiment relates to a replication-competent
- Arterivirus according to the invention characterized in that said mutation in the PLP2 domain is located at consensus position 350 according to the EAV numbering as depicted in figure 3.
- the position for PRRSV Lelystad is 517.
- the position for PRRSV VR-2332 is 525.
- residue mutations that can be introduced into the regions of the PLP2 enzymes deemed important for DUB and delSGylating activity depend on the local environment of the residue(s) to be mutated and can be determined by the skilled person without undue burden.
- a hydrophobic side chain e.g. Leucine
- allowable mutations could include: 1) complete removal of the side chain (i.e. substitute with glycine), 2) substitution with a polar side chain to electrostatically disrupt the hydrophobic interaction (e.g.
- Combinations of such mutations across the ubiquitin interaction surface could be used to achieve maximal reduction in DUB and delSGylating activity.
- the targeted residue is a buried hydrophobic residue
- substitutions need to be more conservative, this is, the substitution should preferably be another hydrophobic residue to retain overall proper protein folding, but with an altered shape so as to distort the ubiquitin interaction surface to reduce DUB and delSGylating activity. If the targeted residue forms an important electrostatic interaction needed for protein stability, then only those substitutions that retain this interaction can be introduced at this location.
- His498Ala substitutions yielded non- viable virus since these residues comprise catalytic residues of the active site; however, Asp458Ala, while producing viable virus, had no effect of NF-KB activation, since according to the EAV PLP2 structure, only the main chain carbonyl group of at this position interacts with ubiquitin. Thus, with the exception of proline perhaps, side chain substitutions at this position would not affect the catalytic function of PLP2. Ser462Ala however also yielded viable virus with slightly reduced ability to suppress Ub-dependent NFKB activation (2-fold).
- a polar residue at this position such as Ser (SD-0180 PLP2) or Asp (EAV PLP2) is within hydrogen-bonding distance of Arg74 of ubiquitin, which is very close to the PLP2 active site. Mutations at this site while suppressing DUB activity could also suppress polyprotein processing, as evidenced by the reduced viral titer of the Ser462Ala compared to the Asp458Ala mutant.
- a third viable mutation created by Sun et al (Asp465Ala) exists within helix 2 at a position would not allow the residue to interact directly with ubiquitin.
- deletions and/or insertions of a residue or residues within regions of the PLP2 domain that comprise the ubiquitin interactions surface could be employed to specifically disrupt DUB and delSGylating activity of the PLP2 domain.
- insertion of additional residues within the sequence 479 - 484 of PRRSV strain Lelystad (487-492 of VR-2332, 313-318 of EAV) would introduce additional bulk on the enzyme surface at the ubiquitin interaction surface, thereby disrupting ubiquitin and ISG15 binding, without affecting the active site region and thus polyprotein processing by the PLP2 domain.
- This strategy of inserting or deleting residues to distort the ubiquitin interaction surface could be employed at any site within the PLP2 domain that is indicated above as amenable to mutation.
- the strategy of inserting or deleting residues is applied to the PLP2 domain at any of consensus positions 296-297 and/or 303-306 and/or 309-319 and/or 326-330 and/or 343-355 according to the EAV numbering as depicted in figure 3.
- this strategy is applied to the regions of the PLP2 domain boxed by the thick lines in Figure 3.
- a most preferred replication-competent Arterivirus according to the invention comprises at least 2 mutations, each of which contributes to a decreased DUB/delSGylating activity. It is emphasized that two consecutive mutations at the nucleotide level, together leading to a mutation in a single amino acid are in this respect also considered to be comprised in the definition of a replication-competent Arterivirus according to the invention comprising at least 2 mutations.
- An example of such mutation is the EAV I353R mutant described above.
- Ile353 is located at the C-terminal end of helix a3 next to C4 (Cys354) of the zinc coordination site. It projects directly into the Ile44 patch of Ub where it makes extensive van der Waals interactions with Ile44, Val70 and Leu8 of Ub.
- Thr312 and Ile313 are located closer to the active site, where they make additional hydrophobic interactions with residues Leu8, Leu71 and Leu73 of Ub.
- Thr312 makes a critical hydrogen bonding interaction with Asn89 of ISG15 (Fig. D).
- a variety of single, double and triple mutations has now been made at three key positions (Ile353, Thr312 and Ile313) within the PLP2 domains' Ub-binding site.
- Amino acid 261 270 312 332 353 336 ild-type GYNPPGDGACGYRCLAF..25.. FQLSPTFTV IPGGRVCPKAKYAMICDKQHWRVKRAKGVGLCLDESCFRGICNCQRMS ..20.. FG VRV
- the first test is based upon the fact that it is not necessary to try and produce a recombinant mutant virus carrying a mutation in the PLP2 domain through reverse genetics, followed by launching that virus in a cell culture system in order to test for its replication competence.
- Replication competence in the context of these PLP2 experiments basically relies on the capability of a mutant PLP2 domain to perform nsp2/nsp3 cleavage and this can easily be tested in an in vitro system.
- the inventors used ectopic expression of the PLP2 domain and an in vitro assay to characterize the effect of various mutations at the above-mentioned positions on EAV replicase polyprotein processing and DUB/delSGylating activities. To this end, mutations were introduced into a mammalian expression vector encoding a self-cleaving nsp2-3 polyprotein carrying an N-terminal HA tag.
- the second test is based upon the fact that it's not necessary to make a replication-competent recombinant Arterivirus having a mutation in the PLP2 domain, in order to test for a decreased DUB/delSGylating activity of such mutated PLP2.
- the effect of mutations on PLP2 DUB activity can be tested by transfecting mammalian cells with plasmids encoding nsp2-3 carrying wild-type or mutant PLP2 combined with a plasmid expressing FLAG-tagged Ub.
- Ectopic expression of FLAG-Ub leads to FLAG-tagged ubiquitination of a wide range of cellular targets, which can be visualized by Western blot analysis using an anti-FLAG antibody.
- An in vitro assay is performed to provide a more detailed analysis of the effect of mutations in PLP2 on activity towards Ub, ISG15, and an RLRGG-peptide substrate that represents the C- terminal tail of Ub or ISG15 that enters the active site of PLP2.
- the inventors focused on mutants I353R and T312A/I313V/I353R, since these showed a pronounced effect on DUB activity in the cell culture-based assay, displayed a level of inhibition of IFN- ⁇ promoter activity similar to the active site mutant (described below), and yielded workable titers upon launching of the mutated virus in BHK-21 cells (described below).
- the ratio cat can also be independently and accurately obtained from integrating the MM equation at low substrate concentrations:
- the equation above can be used to quantify PLP2 activity in vitro using the fluorescent labelled substrates ubiquitin-aminomethylcoumarin (Ub-AMC), ISG15-aminomethylcoumarin (ISG15- AMC) or the C-terminal peptide motif of these substrates, RLRGG-AMC (Boston Biochem).
- Ub-AMC ubiquitin-aminomethylcoumarin
- ISG15- AMC ISG15-aminomethylcoumarin
- RLRGG-AMC Boston Biochem
- PLP2 mutants with a selective reduction in DUB or de!SGylating activity can be identified.
- equation 1 provides a useful method to circumvent solubility issues and determine "-cat in a rapid and reliable fashion. Because the product fluorescence is proportional to its concentration, the evolution of product fluorescence over time proceeds according to the following modification of equation- 1 at low substrate concentrations:
- the Examples section provides ample examples of replication-competent Arteriviruses having a decreased DUB/delSGylating activity due to a mutation in the PLP2 domain of the non-structural protein nsp2.
- DUB/delSGylating activity due to a mutation in the PLP2 domain of nsp2 may use the in vitro tests as discussed above for determining nsp2/nsp3 protease activity and the DUB/delSGylation activity, as described above and as described in a detailed manner in the Examples, for the fast screening of PLP2 mutants.
- the crystal structure of the PLP2 domain bound to ubiquitin could be determined due to the fact that such crystals could now for the first time be made in a stable form.
- the formation of such crystals was possible through the mixing of ubiquitin to a purified nsp2 fragment that comprises a PLP2 domain, under conditions allowing covalent binding of ubiquitin to the PLP2 domain in order to form a PLP2-ubiquitin complex.
- the PLP2 domain may be the domain as such (e.g. the amino acids from position 261-392 of the EAV nsp2), or it may comprise the PLP2 domain and a further part of the nsp2 protein.
- another embodiment of the present invention relates to a PLP2-ubiquitin complex comprising ubiquitin and at least the PLP2 domain of nsp2 of an Arterivirus, wherein said PLP2 domain is covalently bound to said ubiquitin, or a PLP2-ISG15 complex comprising ISG15 and at least the PLP2 domain of nsp2 of an Arterivirus, wherein said PLP2 domain is covalently bound to said ISG15.
- the Arterivirus is selected from the group of viruses consisting of EAV and PRRSV.
- Another embodiment of the present invention relates to live attenuated vaccines for the protection of mammals against Arteriviral infection, characterized in that such vaccines comprise a replication-competent Arterivirus according to the invention, and a pharmaceutically acceptable carrier.
- a wild-type or a live attenuated viral strain may be used as a starting material for making a live attenuated vaccine according to the invention.
- Methods for the attenuation of viruses, e.g. through serial passage over different cell lines have been extensively described in the art. They are well-known to the skilled person.
- the vaccine according to the invention will be administered through the parenteral route.
- the vaccine will be administered intramuscularly.
- a suitable amount of a virus according to the invention in a vaccine would range between 10 2 and 10 8 TCID 50 depending on the level of attenuation of the virus used.
- the literature cited above and the knowledge in the art with regard to EAV and PRRSV vaccination gives the skilled person ample guidance to determine the amount of virus needed.
- a vaccine strain is based upon an existing, commercially available virus strain comprising an attenuating deletion, the manufacturer's instructions would provide good guidance regarding the amount of virus to be used.
- an amount of between 10 4 and 10 6 TCID 50 would be considered a very suitable amount of virus.
- a preferred form of this embodiment relates to a vaccine according to the invention, characterized in that said vaccine comprises an additional immunogen of a virus or microorganism pathogenic to the animal to be vaccinated, an antibody against said immunogen or genetic information encoding an immunogen of said virus or micro-organism.
- viruses/micro-organisms pathogenic to swine are Brachyspira hyodysenteriae, African Swine Fever virus, Nipah virus, Porcine Circovirus, Porcine Torque Teno virus, Pseudorabies virus, Porcine influenza virus, Porcine parvo virus, Porcine Epidemic Diarrheal virus (PEDV), Foot and Mouth disease virus, Transmissible gastro-enteritis virus, Rotavirus, Escherichia coli, Erysipelo rhusiopathiae, Bordetella bronchiseptica,
- Salmonella cholerasuis Haemophilus parasuis, Pasteurella multocida, Streptococcus suis, Mycoplasma hyopneumoniae and Actinobacillus pleuropneumoniae.
- a more preferred form of this embodiment relates to a vaccine according to the invention, characterized in that said virus or micro-organism pathogenic to swine is selected from the group consisting of Brachyspira hyodysenteriae, African Swine Fever virus, Nipah virus, Porcine Circovirus, Porcine Torque Teno virus, Pseudorabies virus, Porcine influenza virus, Porcine Epidemic Diarrheal virus (PEDV), Foot and Mouth disease virus, Transmissible gastro-enteritis virus, Rotavirus, Escherichia coli, Erysipelo rhusiopathiae, Bordetella bronchiseptica,
- Salmonella cholerasuis Haemophilus parasuis, Pasteurella multocida, Streptococcus suis, Mycoplasma hyopneumoniae and Actinobacillus pleuropneumoniae.
- a pharmaceutically acceptable carrier can be, or may include, stabilizers, diluents and buffers. Suitable stabilizers are for example SPGA, carbohydrates (such as dried milk, serum albumin or casein) or degradation products thereof. Suitable buffers are for example alkali metal phosphates. Diluents include water, aqueous buffers (such as buffered saline), alcohols and polyols (such as glycerol).
- Vaccines in general, but especially vaccines comprising live attenuated viruses must be stored at low temperature, or they have to be in a freeze-dried form. Freeze-dried vaccines can be kept under moderate cooling conditions or even at room temperature. Often, the vaccine is mixed with stabilizers, e.g. to protect degradation-prone proteins from being degraded, to enhance the shelf- life of the vaccine, or to improve freeze-drying efficiency.
- stabilizers are i.a. SPGA, carbohydrates e.g. sorbitol, mannitol, trehalose, starch, sucrose, dextran or glucose, proteins such as albumin or casein or degradation products thereof, and buffers, such as alkali metal phosphates.
- a vaccine according to the invention is in a freeze-dried form.
- the vaccine may be suspended in a physiologically acceptable diluent.
- a physiologically acceptable diluent can e.g. be sterile water, a buffer and the like.
- Still another embodiment of the invention relates to a replication-competent Arterivirus according to the invention for use as a medicament.
- Another embodiment of the invention relates to a replication-competent Arterivirus according to the invention for use in a vaccine.
- Another embodiment of the invention relates to a replication-competent Arterivirus according to the invention for use in the prophylaxis of Arterivirus infection in a mammal.
- Plasmids, cells and antibodies Plasmids, cells and antibodies.
- EAV PLP2 For bacterial expression of EAV PLP2, a cDNA fragment encoding residues 261-392 of EAV ppla and an in-frame C-terminal HIS 6 purification tag was inserted downstream of a Ub fusion partner in the pASK3 vector (Gohara et al., 1999), yielding plasmid pASK3-ePLP2.
- a mammalian expression construct encoding an EAV nsp2-3 polyprotein was made by cloning residues 261-1064 of EAV ppla in- frame with an N-terminal HA tag in the pcDNA3.1 vector (Invitrogen).
- HEK293T cells were cultured in Dulbecco's modified Eagle medium (Lonza) supplemented with 10% fetal bovine serum (FBS), and 2 mM L-glutamine.
- BHK-21 cells were cultured in Glasgow minimum essential medium (Lonza) supplemented with 5% FBS, 10% tryptose phosphate broth, and 10 mM HEPES (pH 7.4).
- Primary equine lung fibroblasts (ELF) were cultured in minimum essential medium (Lonza) supplemented with 10% FBS and grown on collagen-coated plastics. All culture media contained 100 U/ml of penicillin and 100 mg/ml of streptomycin.
- a-HA abl 8181 ; Abeam
- a- FLAG FLAG
- a-GST sc459; Santa Cruz
- ⁇ - ⁇ -actin A5316; Sigma-Aldrich
- donkey-a-mouse-Cy3 715-165-151; Jackson ImmunoResearch
- goat-a-rabbit-AL488 A- 11008; Invitrogen
- the following antibodies were described elsewhere: a-hISG15 (clone 2.1) (Malakhov et al., 2003) and a-EAV N protein (clone 3E2) (MacLachlan et al., 1998). Rabbit antisera recognizing the EAV PLP2 domain and GFP were raised using recombinant proteins purified from Escherichia coli.
- Gold(DE3) cells were transformed with pASK3-ePLP2 and cultured to an optical density (OD 6 oo) of 0.7 in LB medium at 37°C.
- the culture was then supplemented with 200 ng/ml of anhydrous tetracycline and incubated for 3 hrs at 28°C with shaking to induce expression of the Ub-PLP2- HIS 6 fusion protein.
- the cells were pelleted and resuspended in ice-cold lysis buffer (20 mM MES pH 7, 500 mM NaCl, 10% glycerol, 5 mM imidazole pH 7.4, 0.5 mM TCEP) and lysed using a French pressure cell (AMECO).
- AMECO French pressure cell
- the lysate was clarified by centrifugation and loaded onto a Ni-NTA column (Qiagen) pre-equilibrated with lysis buffer. After washing with lysis buffer supplemented with 15 mM imidazole, recombinant PLP2 was eluted from the column using an equilibration buffer supplemented with 150 mM imidazole and exchanged into 50 mM Tris, pH 8.0, 300 mM NaCl and 5 mM DTT before storing at 4 °C.
- the endogenous DUB activity of the PLP2 domain resulted in the efficient removal of the N-terminal Ub-tag from the fusion protein during expression in E. coli; therefore, affinity chromatography yielded highly pure PLP2 carrying a C-terminal HIS 6 purification tag only.
- Ub(i-75)-3-bromopropylamine (Ub-3Br) was prepared according to Messick et al (Messick et al., 2008) and Borodovsky et al (Borodovsky et al., 2002) as described by James et al (James et al., 2011).
- Ub-Br3 was covalently bound to purified PLP2 by gently mixing the proteins in a 3:2 molar ratio for one hour at 37°C.
- the resulting PLP2-Ub complex was purified by gel filtration (Superdex 75) followed by anion exchange (Source 15Q) chromatography and then exchanged into 20 mM Tris, pH 8.0, 50 mM NaCl before concentrating to 10 mg/ml and storing at 4°C.
- the PLP2-Ub complex was crystallized by hanging-drop vapor diffusion at 10 mg/ml in mother liquor consisting of 100 mM MES pH 6.2, 18% PEG 20,000. Crystals were flash-cooled and stored in liquid nitrogen after sweeping them through mother liquor supplemented with 20% glycerol.
- X-ray data collection and crystal structure determination X-ray data collection and crystal structure determination.
- X-ray diffraction data for a multiwavelength anomalous dispersion (MAD) experiment were collected at the Canadian Light Source (beam line 08ID-1). Data were collected at three different wavelengths over the absorption edge of zinc from a single crystal of the PLP2-Ub complex held at 100K in a N 2 (g) stream. The data were processed using MOSFLM and SCALA (Collaborative Computational Project Number 4, 1994) and structure factor phases were determined using phenix.autosol (Adams et al., 2010). Initial phases generated by SOLVE were improved by density modification using RESOLVE within the PHENIX package. After reserving a random subset of reflections for cross-validation using the free R- factor (Brunger, 1992), a model was built using
- HEK293T cells were grown to 80% confluence in 10 cm 2 wells and transfected using CaP0 4 with 4 ⁇ g plasmid DNA encoding nsp2-3 containing wild-type or mutant PLP2. After 16 h at 37°C, cells were lysed in 2x Laemmli Sample Buffer (2xLSB; 250 mM Tris, 2% SDS, 20% glycerol, 0.01% bromophenol blue, 2 mM DTT, pH 6.8).
- 2xLSB 250 mM Tris, 2% SDS, 20% glycerol, 0.01% bromophenol blue, 2 mM DTT, pH 6.8.
- HEK293T cells were grown to demonstrate the DUB activity of the various PLP2 mutants.
- HEK293T cells were grown to assess delSGylation activity of the various mutants.
- Luciferase-based IFN- ⁇ promoter activity assay HEK293T cells, grown to 80%> confluence in 2 cm 2 wells, were transfected in quadruplicate with a combination of plasmids encoding firefly luciferase under control of the IFN- ⁇ promoter (50 ng), renilla luciferase (5 ng), RIG-I (2CARD) (25 ng) and nsp2-3 containing wild-type or mutant PLP2 (500 ng) using Lipofectamine2000 (Invitrogen). The total amount of DNA used for transfection was adjusted to 1 ⁇ g per well by the addition of the appropriate amount of empty vector.
- Measurements were performed at room temperature in 50 mM tris at 150 niM ionic strength (NaCl) buffer pH 8 from Sigma (St-Louis, MO). Substrate concentrations were kept at 50 ⁇ and 200 nM for the RLRGG-AMC and Ub- AMC substrates respectively, while the enzyme concentrations were used at final concentrations between 1.7-2.6 ⁇ for the RLRGG-AMC substrate and 116-174 nM for the Ub-AMC substrate. The samples were excited with 360 nm light and the time-dependent emission was collected at 460 nm.
- the k c K M value for RLRGG-AMC of the wild-type virus and the mutant I353R is comparable, whereas the k c K M value for Ub-AMC of the mutant I353R is 20 times lower than that of the wild-type virus.
- Table 3 Experimental k c K M values for the wild-type and I353R mutant EAV PLP2 enzymes determined with respect to the RLRGG-AMC and Ub-AMC substrates.
- Reverse genetics Mutations in the EAV PLP2-coding sequence were engineered in an appropriate shuttle vector by site-directed mutagenesis using Pfu DNA polymerase (Fermentas) and subsequently transferred to pEAN551/AB, which is a derivative of EAV full-length cDNA clone pEAN551 carrying additional (translationally silent) Aflll and BspEI restriction sites (Posthuma et al., 2008). The virus derived from pEAN551/AB was used as wild-type control in all experiments. All constructs were verified by sequence analysis.
- RNA transcription from ⁇ 3 ⁇ 4o/-linearized wild-type or mutant EAV full-length cDNA clones was performed using the mMESSAGE mMACHINE T7 Kit (Ambion). Five ⁇ g of in vitro synthesized EAV RNA was electroporated into 5.0 ⁇ 10 6 BHK-21 cells using the Amaxa Cell Line Nucleofector Kit T and the program T-020 of the Amaxa Nucleofector (Lonza) according to the manufacturer's instructions. Cells were resuspended in the appropriate medium, seeded in 75 cm 2 flasks and incubated at 39.5°C. Virus-containing supernatants were harvested at 24 h post transfection and titers were determined by plaque assay on equine lung fibroblast cells as described before (Nedialkova et al., 2010).
- Confluent equine lung fibroblast cells were infected with wild-type or mutant EAV at an m.o.i. of 0.25 and incubated at 37°C. At 20 and 24 h p.i., cell lysates were harvested in TriPure Isolation Reagent (Roche). After the addition of chloroform, the aqueous phase was mixed in a 1 :1 ratio with buffer RA1 of the Nucleospin RNA II kit (Macherey-Nagel) and RNA was isolated as per manufacturer's instructions.
- Figure 9 shows the results of the qPCR.
- figure 9B it can be seen that the amount of viral mRNA produced in primary equine lung cells infected with wild type virus, a single mutant (D53R) and a triple mutant (T312A/I313V/I353R) is practically equal. This shows that in these mutant viruses the replication level is practically unchanged compared to that of wild-type virus, indicating that the mutants are capable of polyprotein processing.
- EAV Kentucky 84 strain EAV Kentucky 84 strain, commonly referred to as KY84.
- Virus was applied intranasally (IN) by dosing 5 ml of a virus suspension containing 2x10 4 PFU per ml, using a nozzle attached to a syringe. After infection (i.e. vaccination and challenge), rectal temperatures were taken daily from 0 to 14 days post-infection, and at 21 and 28 days post-infection. After challenge, all mares were observed for clinical signs daily from 0 to 14 days post infection.
- Blood samples of the mares were taken at day 0, before the vaccination and challenge, and 2, 4, 6, 8, 10, 12, 14, 21, and 28 days after each of the infections. Blood samples were tested for the presence of EAV and EAV-specific antibodies.
- Serum was prepared from the blood samples collected in tubes without anti-coagulant. After clotting of the blood for at least 4 hours at room temperature, serum was collected by centrifugation at 700xg for 15 minutes at 4°C. Until use, the sera were stored at - 20°C.
- the neutralizing antibody titers of the test sera were determined in duplicate in 96-well plates. Briefly, two-fold serial dilutions of the sample (in duplicate) were made in microtitre plates and mixed with a fixed amount of live EAV virus. After an incubation period of 1 hour, Vero cells were added. The plates were incubated for four days at 37°C in the presence of C0 2 whereafter the monolayer was examined for cytopathic effect (CPE). Each well was either scored negative (no CPE) or positive (CPE). The EAV neutralizing antibody titre was calculated as the reciprocal of the highest serum dilution at which no CPE was observed and expressed as log 2 .
- RNA isolation from whole blood and quantitation of EAV RNA was assessed for the following criteria: RNA isolation from whole blood and quantitation of EAV RNA.
- RNA from whole blood collected with a TempusTM Blood RNA Tube was isolated using a 'MagMAXTM for Stabilized Blood Tubes RNA Isolation Kit' according to the manufacturer's instructions
- RNA 800 ng
- RevertAid H Minus RT Fermentas
- oligo(dT)20 primer RNA from total blood was reverse transcribed using RevertAid H Minus RT (Fermentas) and oligo(dT)20 primer. Samples were subsequently assayed by quantitative realtime on a CFX384 Touch Real-Time PCR detection system (BioRad) using iTaq SYBR Green Supermix with ROX (BioRad). A primer set was designed using the common software program Primer3.
- VN titers Based on individual data mean values were calculated. A graphical summary of the VN titers is given in Figure 11. At the start of the experiment all horses were negative for neutralizing antibodies to EAV. After vaccination, EAV specific VN antibody titres were detectable reaching a plateau of ⁇ 7.5 log 2 for both group 1 (EAV-wt) and group 2 (EAV-PLP2). After challenge, specific VN antibody titers were detectable for the control group and the challenge infection did not further increase the VN titers of the animals of both vaccinated groups.
- EAV-PLP2 mutant grows considerably well in vivo, in line with what could be seen in the in vitro experiments (Example 1).
- both non-vaccinated animals displayed high viral RNA titers in their blood, demonstrating that the challenge infection was successful.
- viral RNA of the challenge strain could be detected in their blood at either 4, 6, and/or 8 days post-challenge, while challenge strain RNA could not be detected in any of the group 2 animals at these time points. This is a clear indication that the mutant strain induces an improved immune response when compared to the wild-type strain.
- Figure 1 Structure of the EAV PLP2-Ub complex and superposition with yeast OTU1 and CCHFV OTU.
- the cysteine nucleophile (Cys270) is covalently linked to Ub via the 3NC linker, which replaces Gly76 of Ub. Asn263, which orients the imidazole ring of His332 occurs in two alternate conformations.
- E Superposition of EAV PLP2 and CCHFV OTU complexed with Ub.
- FIG. 2 EAV PLP2 structure (based on PISA analysis).
- the grey area defines the ubiquitin interaction surface on the PLP2 enzyme (617 A 2 ) that should be targeted to selectively disrupt DUB and ISGylating activity.
- the catalytic nucleophile cysteine 270 (C270) within the enzyme active site is covalently bound to the C-terminus of ubiquitin, resembling the acyl-enzyme intermediate step of the catalytic reaction.
- Figure 3 Multiple sequence alignment of EAV and PRRS sequences. This figure represents the structurally functional alignment for the Arteriviral PLP2 domain.
- FIG. 4 Structure models of PRRSV PLP2 domain based on the crystallographic structure of Arteriviral PLP2 domain bound to Ub.
- FIG. 5 Ub-binding site of the EAV PLP2 domain and comparative model of ISG15 bound to the EAV PLP2 domain.
- EAV PLP2 residue Ile353 forms van der Waals interactions with Ile44, Leu8, and Val70 of Ub, whereas residues Thr312 and Ile313 interact with a hydrophobic patch on Ub (formed by residues Leu8, Val70, Leu71, and Ile73) closer to the active site of PLP2.
- Comparative molecular model of the EAV PLP2 domain bound to ISG15 was constructed by superposing the C-terminal Ub-like domain of ISG15 (from PDB 1Z2M) onto the Ub molecule of the EAV PLP2-Ub complex. The model predicts that the EAV PLP2 domain binds ISG15 such that it can accommodate the additional bulk present on ISG15 that is absent in Ub. D) Close-up of the modeled EAV PLP2-ISG15 binding interface showing a hydrogen bonding interaction between residues Asn89 of ISG15 and Thr312 of the EAV PLP2 domain believed to be important for ISG15 binding.
- Figure 6 Decoupling of the polyprotein processing and DUB activities of the EAV PLP2 domain.
- HEK293T cells were transfected with plasmids encoding nsp2-3 containing wild-type or mutant PLP2. After 16 h at 37°C, cells were lysed and results were analyzed by Western blot. Proteolytic processing of the nsp2
- HEK293T cells were transfected with a combination of plasmids encoding nsp2-3 containing wild-type or mutant PLP2 and FLAG-Ub.
- FLAG-Ub leads to FLAG-tagged ubiquitination of a wide range of cellular proteins, which can be visualized on Western blot using an anti-FLAG antibody.
- Expression of wild -type PLP2 strongly decreased ubiquitination, while expression of the C270A/H332A mutant did not.
- Ub-binding site mutants showed varying degrees of DUB activity, with phenotypes ranging between wild -type and the active site mutant.
- Figure 7 PLP2 Ub-binding site mutations attenuate inhibition of IFN- ⁇ promoter activation.
- HEK293T cells were transfected in quadruplicate with a combination of plasmids encoding firefly luciferase under control of the IFN- ⁇ promoter, renilla luciferase, RIG-I (2CARD) , and nsp2-3 containing wild-type or mutant PLP2. Wild-type PLP2 strongly inhibited activation of the IFN- ⁇ promoter, while the active site mutant showed only minor inhibitory activity. Ub-binding site mutants showed varying degrees of inhibition. Data was obtained in three independent experiments and analyzed using an unpaired two-tailed Student's t test. Error bars represent standard deviation and p-values are relative to wild-type.
- FIG. 8 HEK293T cells were transfected with a combination of plasmids encoding nsp2-3 containing wild-type or mutant PLP2, ISG15, and El (UbElL) and E2 (UbcM8) enzymes.
- ISG15 and its El and E2 enzymes results in the ISGylation of a population of cellular proteins, which can be visualized on Western blot using an anti-ISG15 antibody.
- Expression of wild-type PLP2 decreased ISGylation, while expression of the active site mutant did not.
- Ub-binding site mutations had only a mild effect on delSGylating activity.
- Figure 9 Quantitative real-time PCR. This figure shows the effect of several mutations in the PLP2 domain on viral growth (quantification of EAV genome in Figure 9B) and and on
- FIG. 10 Mean body temperature of animals vaccinated with EAV-wt, the EAV mutant strain EAV-PLP2 and non- vaccinated animals before and after challenge.
- Figure 11 Mean EAV virus neutralizing antibody titers of animals vaccinated with EAV-wt, the EAV mutant strain EAV-PLP2 and non-vaccinated animals before and after challenge.
- Bosanac I., Wertz, I.E., Pan, B., Yu, C, Kusam, S., Lam, C, Phu, L., Phung, Q., Maurer, B., Arnott, D., Kirkpatrick, D.S., Dixit, V.M., Hymowitz, S.G., 2010. ubiquitin Binding to A20 ZnF4 Is Required for Modulation of NF-?B Signaling. Molecular Cell 40, 548-557.
- the ISG15 conjugation system broadly targets newly synthesized proteins: implications for the antiviral function of ISG15. Mol Cell 38, 722-732.
- TBK1 are essential components of the IRF3 signaling pathway. Nat Immunol 4, 491 -496.
- virus NSl targets the ubiquitin ligase TRIM25 to evade recognition by the host viral RNA sensor RIG-I.
- E3 ubiquitin ligase is essential for RIG-I-mediated antiviral activity. Nature 446, 916-920.
- rubi- and aphthovirus proteases and delineation of a novel conserved domain associated with proteases of rubi-, alpha- and coronaviruses.
- DUBA a deubiquitinase that regulates type I interferon production. Science 318, 1628-1632.
- Poliovirus proteinase 2A induces cleavage of eucaryotic initiation
- factor 4F polypeptide p220 J Virol 61, 2711-2718.
- Hepatitis C virus protease NS3/4A cleaves mitochondrial antiviral signaling protein
- Ubiquitin-like protein ISG15 modifies key regulators of signal transduction. J Biol Chem 278, 16608-16613.
- replication/transcription complex a key role for nonstructural protein 3 in the remodeling of intracellular membranes. J Virol 82, 4480- 4491.
- Non-structural proteins 2 and 3 interact to modify host cell membranes during the
- nonstructural protein 2 possesses deubiquitinating and interferon antagonism functions. J Virol 84, 7832-7846.
- a poliovirus 2A(pro) mutant unable to cleave 3CD shows inefficient viral protein synthesis
- PLP2 a potent deubiquitinase from murine hepatitis virus, strongly inhibits cellular
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Pulmonology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2883591A CA2883591A1 (en) | 2012-09-26 | 2013-09-25 | Arterivirus |
| MX2015003765A MX2015003765A (en) | 2012-09-26 | 2013-09-25 | Arterivirus. |
| RU2015115486A RU2015115486A (en) | 2012-09-26 | 2013-09-25 | ARTERIVIRUS |
| CN201380050255.2A CN104812409A (en) | 2012-09-26 | 2013-09-25 | Arterivirus |
| JP2015533566A JP2015532269A (en) | 2012-09-26 | 2013-09-25 | Arteri virus |
| US14/430,674 US20150313988A1 (en) | 2012-09-26 | 2013-09-25 | Arterivirus |
| BR112015006605A BR112015006605A2 (en) | 2012-09-26 | 2013-09-25 | live attenuated vaccine, method of producing an arterivirus, arterivirus, and plp2-ubiquitin complex or plp2-isg15 complex |
| KR1020157008519A KR20150060744A (en) | 2012-09-26 | 2013-09-25 | Arterivirus |
| EP13770674.3A EP2900257A1 (en) | 2012-09-26 | 2013-09-25 | Arterivirus |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12186162 | 2012-09-26 | ||
| EP12186162.9 | 2012-09-26 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014048955A1 true WO2014048955A1 (en) | 2014-04-03 |
Family
ID=46924351
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2013/069915 Ceased WO2014048955A1 (en) | 2012-09-26 | 2013-09-25 | Arterivirus |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US9457073B2 (en) |
| EP (1) | EP2900257A1 (en) |
| JP (1) | JP2015532269A (en) |
| KR (1) | KR20150060744A (en) |
| CN (1) | CN104812409A (en) |
| BR (1) | BR112015006605A2 (en) |
| CA (1) | CA2883591A1 (en) |
| MX (1) | MX2015003765A (en) |
| RU (1) | RU2015115486A (en) |
| WO (1) | WO2014048955A1 (en) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104497148A (en) * | 2014-12-17 | 2015-04-08 | 广州谱泰生物技术有限公司 | Preparation method for recombinant ubiquitin blue ear disease vaccine |
| WO2017162727A1 (en) | 2016-03-23 | 2017-09-28 | Intervet International B.V. | A combination vaccine against pcv2 and prrs virus infection comprising albumin |
| WO2017162741A1 (en) | 2016-03-23 | 2017-09-28 | Intervet International B.V. | A combination vaccine against pcv2 virus and mycoplasma hyopneumoniae infection |
| WO2017162720A1 (en) | 2016-03-23 | 2017-09-28 | Intervet International B.V. | A vaccine for intradermal application against pcv2 and prrs virus infection |
| WO2018099889A1 (en) | 2016-11-29 | 2018-06-07 | Intervet International B.V. | Swine vaccine |
| WO2018189290A1 (en) | 2017-04-13 | 2018-10-18 | Intervet International B.V. | Vaccines containing swine pathogens for associated non-mixed use |
| WO2021213949A1 (en) | 2020-04-20 | 2021-10-28 | Intervet International B.V. | A combination of vaccines to prophylactically treat a pig |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9457073B2 (en) * | 2012-09-26 | 2016-10-04 | University Of Manitoba | Live attenuated replication-competent arteriviruses having decreased dub/deisgylating activity |
| CN105779651A (en) * | 2016-04-08 | 2016-07-20 | 浙江省淡水水产研究所 | Rapid detection kit and detection method of Chinese softshell turtle artertivirus |
| CN114778852B (en) * | 2022-04-26 | 2023-09-01 | 中国农业大学 | An indirect ELISA method for detecting PRRSV PLP2 antibody |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110033498A1 (en) * | 2007-04-05 | 2011-02-10 | Adolfo Garcia-Sastre | METHODS OF PREVENTING AND TREATING VIRAL INFECTIONS BY INHIBITING THE DelSGYLATION ACTIVITY OF OTU DOMAIN-CONTAINING VIRAL PROTEINS |
| US20120213810A1 (en) * | 2011-02-17 | 2012-08-23 | Boehringer Ingelheim Vetmedica, Gmbh | Novel european prrsv strain |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20070096019A (en) * | 2005-01-13 | 2007-10-01 | 베링거잉겔하임베트메디카게엠베하 | Improved PRS Vaccine |
| ES2389748T3 (en) * | 2007-06-25 | 2012-10-31 | South Dakota State University | Recombinant North American type 1 reproductive and respiratory syndrome virus and methods of use |
| UA108902C2 (en) | 2010-11-10 | 2015-06-25 | NORTH AMERICAN REPRODUCTIVE AND RESPIRATORY PIG SYNDROME (PRRS) VIRUS | |
| BR112013030321A2 (en) * | 2011-05-27 | 2017-07-11 | Sinovet Beijing Biotechnology Co Ltd | vaccine composition, method for preparing the vaccine composition, use of the vaccine composition, method for immunizing a pig, csfv vaccine strain, and use of a cell in cultivating a csfv vaccine strain. |
| US9457073B2 (en) * | 2012-09-26 | 2016-10-04 | University Of Manitoba | Live attenuated replication-competent arteriviruses having decreased dub/deisgylating activity |
-
2013
- 2013-09-24 US US14/035,415 patent/US9457073B2/en not_active Expired - Fee Related
- 2013-09-25 RU RU2015115486A patent/RU2015115486A/en not_active Application Discontinuation
- 2013-09-25 WO PCT/EP2013/069915 patent/WO2014048955A1/en not_active Ceased
- 2013-09-25 CA CA2883591A patent/CA2883591A1/en active Pending
- 2013-09-25 JP JP2015533566A patent/JP2015532269A/en active Pending
- 2013-09-25 KR KR1020157008519A patent/KR20150060744A/en not_active Withdrawn
- 2013-09-25 US US14/430,674 patent/US20150313988A1/en not_active Abandoned
- 2013-09-25 EP EP13770674.3A patent/EP2900257A1/en not_active Withdrawn
- 2013-09-25 CN CN201380050255.2A patent/CN104812409A/en active Pending
- 2013-09-25 MX MX2015003765A patent/MX2015003765A/en unknown
- 2013-09-25 BR BR112015006605A patent/BR112015006605A2/en not_active Application Discontinuation
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110033498A1 (en) * | 2007-04-05 | 2011-02-10 | Adolfo Garcia-Sastre | METHODS OF PREVENTING AND TREATING VIRAL INFECTIONS BY INHIBITING THE DelSGYLATION ACTIVITY OF OTU DOMAIN-CONTAINING VIRAL PROTEINS |
| US20120213810A1 (en) * | 2011-02-17 | 2012-08-23 | Boehringer Ingelheim Vetmedica, Gmbh | Novel european prrsv strain |
Non-Patent Citations (10)
| Title |
|---|
| DATABASE Geneseq [online] 6 December 2012 (2012-12-06), "Attenuated PRRS 94881 MSV (Master seed virus) ORF1a polypeptide SEQ: 2.", XP002691083, retrieved from EBI accession no. GSP:AZZ01653 Database accession no. AZZ01653 * |
| DATABASE UniProt [online] 10 August 2010 (2010-08-10), "SubName: Full=Replicase polyprotein 1ab;", XP002691081, retrieved from EBI accession no. UNIPROT:D7P3X5 Database accession no. D7P3X5 * |
| DATABASE UniProt [online] 5 July 2004 (2004-07-05), "SubName: Full=Polyprotein; Flags: Fragment;", XP002691082, retrieved from EBI accession no. UNIPROT:Q6TXK6 Database accession no. Q6TXK6 * |
| FANG Y ET AL: "Heterogeneity in Nsp2 of European-like porcine reproductive and respiratory syndrome viruses isolated in the United States", VIRUS RESEARCH, AMSTERDAM, NL, vol. 100, no. 2, 15 March 2004 (2004-03-15), pages 229 - 235, XP002416342, ISSN: 0168-1702, DOI: 10.1016/J.VIRUSRES.2003.12.026 * |
| J. ZHANG ET AL: "Molecular epidemiology and genetic characterization of equine arteritis virus isolates associated with the 2006-2007 multi-state disease occurrence in the USA", JOURNAL OF GENERAL VIROLOGY, vol. 91, no. 9, 1 September 2010 (2010-09-01), pages 2286 - 2301, XP055051365, ISSN: 0022-1317, DOI: 10.1099/vir.0.019737-0 * |
| NATALIA FRIAS-STAHELI ET AL: "Ovarian Tumor Domain-Containing Viral Proteases Evade Ubiquitin- and ISG15-Dependent Innate Immune Responses", CELL HOST & MICROBE, vol. 2, no. 6, 1 December 2007 (2007-12-01), pages 404 - 416, XP055049785, ISSN: 1931-3128, DOI: 10.1016/j.chom.2007.09.014 * |
| P. B. VAN KASTEREN ET AL: "Arterivirus and Nairovirus Ovarian Tumor Domain-Containing Deubiquitinases Target Activated RIG-I To Control Innate Immune Signaling", JOURNAL OF VIROLOGY, vol. 86, no. 2, 15 January 2012 (2012-01-15), pages 773 - 785, XP055049790, ISSN: 0022-538X, DOI: 10.1128/JVI.06277-11 * |
| P. B. VAN KASTEREN ET AL: "Deubiquitinase function of arterivirus papain-like protease 2 suppresses the innate immune response in infected host cells", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 110, no. 9, 26 February 2013 (2013-02-26), pages E838 - E847, XP055088925, ISSN: 0027-8424, DOI: 10.1073/pnas.1218464110 * |
| U. B. R. BALASURIYA ET AL: "Development and characterization of an infectious cDNA clone of the virulent Bucyrus strain of Equine arteritis virus", JOURNAL OF GENERAL VIROLOGY, vol. 88, no. 3, 1 March 2007 (2007-03-01), pages 918 - 924, XP055050040, ISSN: 0022-1317, DOI: 10.1099/vir.0.82415-0 * |
| Z. SUN ET AL: "Nonstructural Protein 2 of Porcine Reproductive and Respiratory Syndrome Virus Inhibits the Antiviral Function of Interferon-Stimulated Gene 15", JOURNAL OF VIROLOGY, vol. 86, no. 7, 1 April 2012 (2012-04-01), pages 3839 - 3850, XP055050899, ISSN: 0022-538X, DOI: 10.1128/JVI.06466-11 * |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104497148A (en) * | 2014-12-17 | 2015-04-08 | 广州谱泰生物技术有限公司 | Preparation method for recombinant ubiquitin blue ear disease vaccine |
| CN104497148B (en) * | 2014-12-17 | 2018-05-18 | 青岛明勤生物科技有限公司 | A kind of preparation for recombinating ubiquitination blue-ear disease vaccine |
| WO2017162727A1 (en) | 2016-03-23 | 2017-09-28 | Intervet International B.V. | A combination vaccine against pcv2 and prrs virus infection comprising albumin |
| WO2017162741A1 (en) | 2016-03-23 | 2017-09-28 | Intervet International B.V. | A combination vaccine against pcv2 virus and mycoplasma hyopneumoniae infection |
| WO2017162720A1 (en) | 2016-03-23 | 2017-09-28 | Intervet International B.V. | A vaccine for intradermal application against pcv2 and prrs virus infection |
| US10953084B2 (en) | 2016-03-23 | 2021-03-23 | Intervet Inc. | Combination vaccine against PCV2 and PRRS virus infection comprising albumin |
| US11654191B2 (en) | 2016-03-23 | 2023-05-23 | Intervet Inc. | Vaccine for intradermal application against PCV2 and PRRS virus infection |
| WO2018099889A1 (en) | 2016-11-29 | 2018-06-07 | Intervet International B.V. | Swine vaccine |
| WO2018189290A1 (en) | 2017-04-13 | 2018-10-18 | Intervet International B.V. | Vaccines containing swine pathogens for associated non-mixed use |
| US11311614B2 (en) | 2017-04-13 | 2022-04-26 | Intervet Inc. | Vaccines containing swine pathogens for associated non-mixed use |
| EP4335455A2 (en) | 2017-04-13 | 2024-03-13 | Intervet International B.V. | Vaccines containing swine pathogens for associated non-mixed use |
| WO2021213949A1 (en) | 2020-04-20 | 2021-10-28 | Intervet International B.V. | A combination of vaccines to prophylactically treat a pig |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2015532269A (en) | 2015-11-09 |
| US20140154265A1 (en) | 2014-06-05 |
| CN104812409A (en) | 2015-07-29 |
| MX2015003765A (en) | 2015-11-16 |
| RU2015115486A (en) | 2016-11-20 |
| EP2900257A1 (en) | 2015-08-05 |
| US20150313988A1 (en) | 2015-11-05 |
| KR20150060744A (en) | 2015-06-03 |
| BR112015006605A2 (en) | 2017-10-10 |
| US9457073B2 (en) | 2016-10-04 |
| CA2883591A1 (en) | 2014-04-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9457073B2 (en) | Live attenuated replication-competent arteriviruses having decreased dub/deisgylating activity | |
| Yang et al. | Structural biology of SARS-CoV-2 and implications for therapeutic development | |
| Malone et al. | Structures and functions of coronavirus replication–transcription complexes and their relevance for SARS-CoV-2 drug design | |
| Wu et al. | Structure genomics of SARS-CoV-2 and its Omicron variant: drug design templates for COVID-19 | |
| Fung et al. | Post-translational modifications of coronavirus proteins: roles and function | |
| Du et al. | The spike protein of SARS-CoV—a target for vaccine and therapeutic development | |
| Mielech et al. | Nidovirus papain-like proteases: multifunctional enzymes with protease, deubiquitinating and deISGylating activities | |
| Yang et al. | Design of wide-spectrum inhibitors targeting coronavirus main proteases | |
| Qiu et al. | Functional studies of the coronavirus nonstructural proteins | |
| Candido et al. | Spike protein of SARS-CoV-2 variants: a brief review and practical implications | |
| Groneberg et al. | Molecular mechanisms of severe acute respiratory syndrome (SARS) | |
| Schiller et al. | Processing of the coronavirus MHV-JHM polymerase polyprotein: identification of precursors and proteolytic products spanning 400 kilodaltons of ORF1a | |
| Mu et al. | Crystal structure of 2A proteinase from hand, foot and mouth disease virus | |
| Mohammed | SARS-CoV-2 proteins: are they useful as targets for COVID-19 drugs and vaccines? | |
| Bartlam et al. | Structural proteomics of the SARS coronavirus: a model response to emerging infectious diseases | |
| Liao et al. | Classification, replication, and transcription of Nidovirales | |
| Esson et al. | Phenotypic and genetic characterization of a next generation live-attenuated yellow fever vaccine candidate | |
| Ge et al. | Structural basis of severe acute respiratory syndrome coronavirus 2 infection | |
| Kangarshahi et al. | THE PROTEINS OF SARS-CoV-2 AND THEIR FUNCTIONS. | |
| TW202400800A (en) | Compositions and methods for the prevention and treatment of rabies virus infection | |
| Jalali et al. | SARS-CoV-2: Review of structure, genome, genetic variants, and vaccines | |
| Madhugiri et al. | The Coronavirus Replication–Transcription Complex | |
| Ng | Functional studies of viral and host cell factors involved in the regulation of coronaviruses replication and pathogenesis | |
| Patel | Biochemically investigating the roles of papain-like proteases from+ ssRNA viruses in replication and innate immune suppression | |
| Mnyamana | Antibody production with synthetic peptides against human Coronavirus-NL63 ORF3 protein |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13770674 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2883591 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013770674 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14430674 Country of ref document: US Ref document number: MX/A/2015/003765 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2015533566 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20157008519 Country of ref document: KR Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015006605 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A20150231 Country of ref document: BY |
|
| ENP | Entry into the national phase |
Ref document number: 2015115486 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112015006605 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150325 |

