WO2014033184A1 - Use of a vegf antagonist in treating ocular vascular proliferative diseases - Google Patents
Use of a vegf antagonist in treating ocular vascular proliferative diseases Download PDFInfo
- Publication number
- WO2014033184A1 WO2014033184A1 PCT/EP2013/067846 EP2013067846W WO2014033184A1 WO 2014033184 A1 WO2014033184 A1 WO 2014033184A1 EP 2013067846 W EP2013067846 W EP 2013067846W WO 2014033184 A1 WO2014033184 A1 WO 2014033184A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- vegf antagonist
- weeks
- antibody vegf
- antibody
- administered
- Prior art date
Links
- 239000005557 antagonist Substances 0.000 title claims abstract description 143
- 201000010099 disease Diseases 0.000 title claims abstract description 33
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 title claims abstract description 33
- 230000002062 proliferating effect Effects 0.000 title claims description 27
- 230000002792 vascular Effects 0.000 title claims description 26
- 101100372758 Danio rerio vegfaa gene Proteins 0.000 title 1
- 101150030763 Vegfa gene Proteins 0.000 title 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims abstract description 143
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims abstract description 143
- 238000011282 treatment Methods 0.000 claims abstract description 51
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 claims description 134
- 238000002347 injection Methods 0.000 claims description 64
- 239000007924 injection Substances 0.000 claims description 64
- 206010055665 Corneal neovascularisation Diseases 0.000 claims description 29
- 201000000159 corneal neovascularization Diseases 0.000 claims description 29
- 238000000034 method Methods 0.000 claims description 28
- 238000002560 therapeutic procedure Methods 0.000 claims description 21
- 230000000649 photocoagulation Effects 0.000 claims description 13
- 206010012689 Diabetic retinopathy Diseases 0.000 claims description 12
- 229940121363 anti-inflammatory agent Drugs 0.000 claims description 12
- 239000002260 anti-inflammatory agent Substances 0.000 claims description 12
- 208000010412 Glaucoma Diseases 0.000 claims description 9
- 208000004644 retinal vein occlusion Diseases 0.000 claims description 9
- 201000003142 neovascular glaucoma Diseases 0.000 claims description 8
- 201000007914 proliferative diabetic retinopathy Diseases 0.000 claims description 8
- 150000001875 compounds Chemical class 0.000 claims description 7
- 238000002054 transplantation Methods 0.000 claims description 6
- 206010065630 Iris neovascularisation Diseases 0.000 claims description 5
- 239000004599 antimicrobial Substances 0.000 claims description 5
- 239000003889 eye drop Substances 0.000 claims description 5
- 108020001507 fusion proteins Proteins 0.000 claims description 5
- 102000037865 fusion proteins Human genes 0.000 claims description 5
- 102000008102 Ankyrins Human genes 0.000 claims description 4
- 108010049777 Ankyrins Proteins 0.000 claims description 4
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 claims description 4
- 201000005667 central retinal vein occlusion Diseases 0.000 claims description 4
- 229940012356 eye drops Drugs 0.000 claims description 4
- 201000008979 rubeosis iridis Diseases 0.000 claims description 4
- 241000243985 Onchocerca volvulus Species 0.000 claims description 3
- 108091008324 binding proteins Proteins 0.000 claims description 3
- 238000003745 diagnosis Methods 0.000 claims description 3
- 201000001371 inclusion conjunctivitis Diseases 0.000 claims description 3
- 208000002042 onchocerciasis Diseases 0.000 claims description 3
- 108091008601 sVEGFR Proteins 0.000 claims description 3
- 206010044325 trachoma Diseases 0.000 claims description 3
- 230000001960 triggered effect Effects 0.000 claims description 3
- 208000005100 Herpetic Keratitis Diseases 0.000 claims description 2
- 206010073938 Ophthalmic herpes simplex Diseases 0.000 claims description 2
- 230000000840 anti-viral effect Effects 0.000 claims description 2
- 201000010884 herpes simplex virus keratitis Diseases 0.000 claims description 2
- 230000004968 inflammatory condition Effects 0.000 claims 3
- 102000014914 Carrier Proteins Human genes 0.000 claims 1
- 239000000921 anthelmintic agent Substances 0.000 claims 1
- 229940124339 anthelmintic agent Drugs 0.000 claims 1
- 230000003110 anti-inflammatory effect Effects 0.000 claims 1
- 230000000845 anti-microbial effect Effects 0.000 claims 1
- 239000012678 infectious agent Substances 0.000 claims 1
- 206010060823 Choroidal neovascularisation Diseases 0.000 abstract description 4
- 206010073286 Pathologic myopia Diseases 0.000 abstract 1
- 206010064930 age-related macular degeneration Diseases 0.000 abstract 1
- 208000002780 macular degeneration Diseases 0.000 abstract 1
- 229940090044 injection Drugs 0.000 description 32
- 229960003876 ranibizumab Drugs 0.000 description 21
- 108010081667 aflibercept Proteins 0.000 description 20
- 238000002428 photodynamic therapy Methods 0.000 description 20
- 210000004204 blood vessel Anatomy 0.000 description 18
- 229960002833 aflibercept Drugs 0.000 description 16
- 230000004304 visual acuity Effects 0.000 description 14
- 210000001525 retina Anatomy 0.000 description 13
- 230000000694 effects Effects 0.000 description 10
- 206010029113 Neovascularisation Diseases 0.000 description 9
- 230000008901 benefit Effects 0.000 description 9
- 239000000203 mixture Substances 0.000 description 9
- 239000001301 oxygen Substances 0.000 description 9
- 229910052760 oxygen Inorganic materials 0.000 description 9
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 8
- 230000008859 change Effects 0.000 description 8
- 238000012014 optical coherence tomography Methods 0.000 description 8
- 125000003275 alpha amino acid group Chemical group 0.000 description 7
- 210000004087 cornea Anatomy 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 238000013532 laser treatment Methods 0.000 description 7
- 102000004169 proteins and genes Human genes 0.000 description 7
- 108090000623 proteins and genes Proteins 0.000 description 7
- 229960000397 bevacizumab Drugs 0.000 description 6
- 230000006378 damage Effects 0.000 description 6
- 238000002647 laser therapy Methods 0.000 description 6
- 230000002207 retinal effect Effects 0.000 description 6
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 5
- 230000007423 decrease Effects 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000013595 glycosylation Effects 0.000 description 5
- 238000006206 glycosylation reaction Methods 0.000 description 5
- 230000035755 proliferation Effects 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 150000003431 steroids Chemical class 0.000 description 5
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 4
- 102100040247 Tumor necrosis factor Human genes 0.000 description 4
- 230000002159 abnormal effect Effects 0.000 description 4
- 230000002411 adverse Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 229960003957 dexamethasone Drugs 0.000 description 4
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 4
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 4
- 238000013534 fluorescein angiography Methods 0.000 description 4
- 230000004410 intraocular pressure Effects 0.000 description 4
- 239000004005 microsphere Substances 0.000 description 4
- 230000010412 perfusion Effects 0.000 description 4
- 210000001957 retinal vein Anatomy 0.000 description 4
- 229940124597 therapeutic agent Drugs 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- REZQBEBOWJAQKS-UHFFFAOYSA-N triacontan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCO REZQBEBOWJAQKS-UHFFFAOYSA-N 0.000 description 4
- 210000003462 vein Anatomy 0.000 description 4
- 201000004569 Blindness Diseases 0.000 description 3
- 208000005590 Choroidal Neovascularization Diseases 0.000 description 3
- 206010061818 Disease progression Diseases 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- 208000001344 Macular Edema Diseases 0.000 description 3
- 206010025415 Macular oedema Diseases 0.000 description 3
- 206010038934 Retinopathy proliferative Diseases 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 3
- 229940027545 aflibercept injection Drugs 0.000 description 3
- 150000001413 amino acids Chemical class 0.000 description 3
- 238000002583 angiography Methods 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 238000002648 combination therapy Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 230000005750 disease progression Effects 0.000 description 3
- 210000003038 endothelium Anatomy 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 206010023332 keratitis Diseases 0.000 description 3
- 201000010230 macular retinal edema Diseases 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 239000003607 modifier Substances 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 230000002186 photoactivation Effects 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 230000004393 visual impairment Effects 0.000 description 3
- KBPLFHHGFOOTCA-UHFFFAOYSA-N 1-Octanol Chemical compound CCCCCCCCO KBPLFHHGFOOTCA-UHFFFAOYSA-N 0.000 description 2
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 2
- 229960002666 1-octacosanol Drugs 0.000 description 2
- WNWHHMBRJJOGFJ-UHFFFAOYSA-N 16-methylheptadecan-1-ol Chemical compound CC(C)CCCCCCCCCCCCCCCO WNWHHMBRJJOGFJ-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 206010002091 Anaesthesia Diseases 0.000 description 2
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 2
- 108010001282 CT-322 Proteins 0.000 description 2
- 206010070957 Choroidal haemangioma Diseases 0.000 description 2
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 2
- 108010036949 Cyclosporine Proteins 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 208000022873 Ocular disease Diseases 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 208000034698 Vitreous haemorrhage Diseases 0.000 description 2
- 238000001949 anaesthesia Methods 0.000 description 2
- 230000037005 anaesthesia Effects 0.000 description 2
- 210000001367 artery Anatomy 0.000 description 2
- 229940120638 avastin Drugs 0.000 description 2
- 229960004099 azithromycin Drugs 0.000 description 2
- MQTOSJVFKKJCRP-BICOPXKESA-N azithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)N(C)C[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 MQTOSJVFKKJCRP-BICOPXKESA-N 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 102000023732 binding proteins Human genes 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 229960005091 chloramphenicol Drugs 0.000 description 2
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 2
- 229960001265 ciclosporin Drugs 0.000 description 2
- MYSWGUAQZAJSOK-UHFFFAOYSA-N ciprofloxacin Chemical compound C12=CC(N3CCNCC3)=C(F)C=C2C(=O)C(C(=O)O)=CN1C1CC1 MYSWGUAQZAJSOK-UHFFFAOYSA-N 0.000 description 2
- 238000011284 combination treatment Methods 0.000 description 2
- 230000000052 comparative effect Effects 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 238000011109 contamination Methods 0.000 description 2
- 229930182912 cyclosporin Natural products 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 229960001259 diclofenac Drugs 0.000 description 2
- DCOPUUMXTXDBNB-UHFFFAOYSA-N diclofenac Chemical compound OC(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl DCOPUUMXTXDBNB-UHFFFAOYSA-N 0.000 description 2
- 238000009792 diffusion process Methods 0.000 description 2
- NOPFSRXAKWQILS-UHFFFAOYSA-N docosan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCO NOPFSRXAKWQILS-UHFFFAOYSA-N 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 230000004438 eyesight Effects 0.000 description 2
- IRHTZOCLLONTOC-UHFFFAOYSA-N hexacosan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCO IRHTZOCLLONTOC-UHFFFAOYSA-N 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- BTFJIXJJCSYFAL-UHFFFAOYSA-N icosan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCO BTFJIXJJCSYFAL-UHFFFAOYSA-N 0.000 description 2
- 208000014674 injury Diseases 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 229940076783 lucentis Drugs 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 2
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 2
- CNNRPFQICPFDPO-UHFFFAOYSA-N octacosan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCO CNNRPFQICPFDPO-UHFFFAOYSA-N 0.000 description 2
- GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 2
- 210000001328 optic nerve Anatomy 0.000 description 2
- 230000002085 persistent effect Effects 0.000 description 2
- -1 poly(phosphazine) Polymers 0.000 description 2
- 239000004633 polyglycolic acid Substances 0.000 description 2
- 229950008885 polyglycolic acid Drugs 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 229920001296 polysiloxane Polymers 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- WKSAUQYGYAYLPV-UHFFFAOYSA-N pyrimethamine Chemical compound CCC1=NC(N)=NC(N)=C1C1=CC=C(Cl)C=C1 WKSAUQYGYAYLPV-UHFFFAOYSA-N 0.000 description 2
- 229960000611 pyrimethamine Drugs 0.000 description 2
- 238000011867 re-evaluation Methods 0.000 description 2
- 238000011268 retreatment Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 230000008961 swelling Effects 0.000 description 2
- TYWMIZZBOVGFOV-UHFFFAOYSA-N tetracosan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCO TYWMIZZBOVGFOV-UHFFFAOYSA-N 0.000 description 2
- HLZKNKRTKFSKGZ-UHFFFAOYSA-N tetradecan-1-ol Chemical compound CCCCCCCCCCCCCCO HLZKNKRTKFSKGZ-UHFFFAOYSA-N 0.000 description 2
- 238000011200 topical administration Methods 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 230000008733 trauma Effects 0.000 description 2
- 238000011269 treatment regimen Methods 0.000 description 2
- 229960005294 triamcinolone Drugs 0.000 description 2
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical group O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 2
- CFOQKXQWGLAKSK-KTKRTIGZSA-N (13Z)-docosen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCCCCCO CFOQKXQWGLAKSK-KTKRTIGZSA-N 0.000 description 1
- ALSTYHKOOCGGFT-KTKRTIGZSA-N (9Z)-octadecen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCO ALSTYHKOOCGGFT-KTKRTIGZSA-N 0.000 description 1
- JXNPEDYJTDQORS-HZJYTTRNSA-N (9Z,12Z)-octadecadien-1-ol Chemical compound CCCCC\C=C/C\C=C/CCCCCCCCO JXNPEDYJTDQORS-HZJYTTRNSA-N 0.000 description 1
- IKYKEVDKGZYRMQ-PDBXOOCHSA-N (9Z,12Z,15Z)-octadecatrien-1-ol Chemical class CC\C=C/C\C=C/C\C=C/CCCCCCCCO IKYKEVDKGZYRMQ-PDBXOOCHSA-N 0.000 description 1
- JXNPEDYJTDQORS-AVQMFFATSA-N (9e,12e)-octadeca-9,12-dien-1-ol Chemical class CCCCC\C=C\C\C=C\CCCCCCCCO JXNPEDYJTDQORS-AVQMFFATSA-N 0.000 description 1
- XUBOMFCQGDBHNK-JTQLQIEISA-N (S)-gatifloxacin Chemical compound FC1=CC(C(C(C(O)=O)=CN2C3CC3)=O)=C2C(OC)=C1N1CCN[C@@H](C)C1 XUBOMFCQGDBHNK-JTQLQIEISA-N 0.000 description 1
- CFOQKXQWGLAKSK-UHFFFAOYSA-N 13-docosen-1-ol Natural products CCCCCCCCC=CCCCCCCCCCCCCO CFOQKXQWGLAKSK-UHFFFAOYSA-N 0.000 description 1
- AZSNMRSAGSSBNP-UHFFFAOYSA-N 22,23-dihydroavermectin B1a Natural products C1CC(C)C(C(C)CC)OC21OC(CC=C(C)C(OC1OC(C)C(OC3OC(C)C(O)C(OC)C3)C(OC)C1)C(C)C=CC=C1C3(C(C(=O)O4)C=C(C)C(O)C3OC1)O)CC4C2 AZSNMRSAGSSBNP-UHFFFAOYSA-N 0.000 description 1
- DKGXIVRSAKPDHF-UHFFFAOYSA-N 6-chloro-3-methyl-1-phenylpyrimidine-2,4-dione Chemical class O=C1N(C)C(=O)C=C(Cl)N1C1=CC=CC=C1 DKGXIVRSAKPDHF-UHFFFAOYSA-N 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- SPBDXSGPUHCETR-JFUDTMANSA-N 8883yp2r6d Chemical compound O1[C@@H](C)[C@H](O)[C@@H](OC)C[C@@H]1O[C@@H]1[C@@H](OC)C[C@H](O[C@@H]2C(=C/C[C@@H]3C[C@@H](C[C@@]4(O[C@@H]([C@@H](C)CC4)C(C)C)O3)OC(=O)[C@@H]3C=C(C)[C@@H](O)[C@H]4OC\C([C@@]34O)=C/C=C/[C@@H]2C)/C)O[C@H]1C.C1C[C@H](C)[C@@H]([C@@H](C)CC)O[C@@]21O[C@H](C\C=C(C)\[C@@H](O[C@@H]1O[C@@H](C)[C@H](O[C@@H]3O[C@@H](C)[C@H](O)[C@@H](OC)C3)[C@@H](OC)C1)[C@@H](C)\C=C\C=C/1[C@]3([C@H](C(=O)O4)C=C(C)[C@@H](O)[C@H]3OC\1)O)C[C@H]4C2 SPBDXSGPUHCETR-JFUDTMANSA-N 0.000 description 1
- IKYKEVDKGZYRMQ-IUQGRGSQSA-N 9,12,15-Octadecatrien-1-ol Chemical compound CC\C=C\C\C=C\C\C=C\CCCCCCCCO IKYKEVDKGZYRMQ-IUQGRGSQSA-N 0.000 description 1
- GSDSWSVVBLHKDQ-UHFFFAOYSA-N 9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid Chemical compound FC1=CC(C(C(C(O)=O)=C2)=O)=C3N2C(C)COC3=C1N1CCN(C)CC1 GSDSWSVVBLHKDQ-UHFFFAOYSA-N 0.000 description 1
- 239000005660 Abamectin Substances 0.000 description 1
- YUWPMEXLKGOSBF-GACAOOTBSA-N Anecortave acetate Chemical compound O=C1CC[C@]2(C)C3=CC[C@]4(C)[C@](C(=O)COC(=O)C)(O)CC[C@H]4[C@@H]3CCC2=C1 YUWPMEXLKGOSBF-GACAOOTBSA-N 0.000 description 1
- 206010002329 Aneurysm Diseases 0.000 description 1
- 101100381481 Caenorhabditis elegans baz-2 gene Proteins 0.000 description 1
- 239000004429 Calibre Substances 0.000 description 1
- 208000009043 Chemical Burns Diseases 0.000 description 1
- 206010051558 Corneal bleeding Diseases 0.000 description 1
- 206010054760 Corneal thinning Diseases 0.000 description 1
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 description 1
- MYMOFIZGZYHOMD-UHFFFAOYSA-N Dioxygen Chemical compound O=O MYMOFIZGZYHOMD-UHFFFAOYSA-N 0.000 description 1
- 206010061819 Disease recurrence Diseases 0.000 description 1
- 206010014476 Elevated cholesterol Diseases 0.000 description 1
- 108010008165 Etanercept Proteins 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- MPJKWIXIYCLVCU-UHFFFAOYSA-N Folinic acid Natural products NC1=NC2=C(N(C=O)C(CNc3ccc(cc3)C(=O)NC(CCC(=O)O)CC(=O)O)CN2)C(=O)N1 MPJKWIXIYCLVCU-UHFFFAOYSA-N 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 1
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 1
- 208000035150 Hypercholesterolemia Diseases 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 206010022948 Iris atrophy Diseases 0.000 description 1
- 108700036276 KH902 fusion Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 206010025421 Macule Diseases 0.000 description 1
- 208000009857 Microaneurysm Diseases 0.000 description 1
- 206010048851 Necrotising scleritis Diseases 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 102000004005 Prostaglandin-endoperoxide synthases Human genes 0.000 description 1
- 108090000459 Prostaglandin-endoperoxide synthases Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 101100372762 Rattus norvegicus Flt1 gene Proteins 0.000 description 1
- 208000037111 Retinal Hemorrhage Diseases 0.000 description 1
- 208000002367 Retinal Perforations Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- 206010039705 Scleritis Diseases 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- HDOVUKNUBWVHOX-QMMMGPOBSA-N Valacyclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 HDOVUKNUBWVHOX-QMMMGPOBSA-N 0.000 description 1
- 108010073925 Vascular Endothelial Growth Factor B Proteins 0.000 description 1
- 108010073923 Vascular Endothelial Growth Factor C Proteins 0.000 description 1
- 102000009520 Vascular Endothelial Growth Factor C Human genes 0.000 description 1
- 102100038217 Vascular endothelial growth factor B Human genes 0.000 description 1
- 206010047139 Vasoconstriction Diseases 0.000 description 1
- 229960004150 aciclovir Drugs 0.000 description 1
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 230000003444 anaesthetic effect Effects 0.000 description 1
- 229960001232 anecortave Drugs 0.000 description 1
- 108010089411 angiocal protein Proteins 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 239000002870 angiogenesis inducing agent Substances 0.000 description 1
- 230000000964 angiostatic effect Effects 0.000 description 1
- 230000002141 anti-parasite Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 239000003096 antiparasitic agent Substances 0.000 description 1
- 229910052786 argon Inorganic materials 0.000 description 1
- RRZXIRBKKLTSOM-XPNPUAGNSA-N avermectin B1a Chemical compound C1=C[C@H](C)[C@@H]([C@@H](C)CC)O[C@]11O[C@H](C\C=C(C)\[C@@H](O[C@@H]2O[C@@H](C)[C@H](O[C@@H]3O[C@@H](C)[C@H](O)[C@@H](OC)C3)[C@@H](OC)C2)[C@@H](C)\C=C\C=C/2[C@]3([C@H](C(=O)O4)C=C(C)[C@@H](O)[C@H]3OC\2)O)C[C@H]4C1 RRZXIRBKKLTSOM-XPNPUAGNSA-N 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 230000036770 blood supply Effects 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 125000004432 carbon atom Chemical group C* 0.000 description 1
- 210000004027 cell Anatomy 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 229940090100 cimzia Drugs 0.000 description 1
- 229960003405 ciprofloxacin Drugs 0.000 description 1
- 230000035602 clotting Effects 0.000 description 1
- 238000007906 compression Methods 0.000 description 1
- 230000006835 compression Effects 0.000 description 1
- 229950005748 conbercept Drugs 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- MWKFXSUHUHTGQN-UHFFFAOYSA-N decan-1-ol Chemical compound CCCCCCCCCCO MWKFXSUHUHTGQN-UHFFFAOYSA-N 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 229960000735 docosanol Drugs 0.000 description 1
- LQZZUXJYWNFBMV-UHFFFAOYSA-N dodecan-1-ol Chemical compound CCCCCCCCCCCCO LQZZUXJYWNFBMV-UHFFFAOYSA-N 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 150000002066 eicosanoids Chemical class 0.000 description 1
- 230000004406 elevated intraocular pressure Effects 0.000 description 1
- 229940073621 enbrel Drugs 0.000 description 1
- 229940051306 eylea Drugs 0.000 description 1
- 150000002191 fatty alcohols Chemical class 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 229960004884 fluconazole Drugs 0.000 description 1
- RFHAOTPXVQNOHP-UHFFFAOYSA-N fluconazole Chemical compound C1=NC=NN1CC(C=1C(=CC(F)=CC=1)F)(O)CN1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-N 0.000 description 1
- 229940043075 fluocinolone Drugs 0.000 description 1
- FEBLZLNTKCEFIT-VSXGLTOVSA-N fluocinolone acetonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O FEBLZLNTKCEFIT-VSXGLTOVSA-N 0.000 description 1
- 229960001048 fluorometholone Drugs 0.000 description 1
- FAOZLTXFLGPHNG-KNAQIMQKSA-N fluorometholone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@]2(F)[C@@H](O)C[C@]2(C)[C@@](O)(C(C)=O)CC[C@H]21 FAOZLTXFLGPHNG-KNAQIMQKSA-N 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 229960003923 gatifloxacin Drugs 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 102000058223 human VEGFA Human genes 0.000 description 1
- 229940048921 humira Drugs 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 230000007954 hypoxia Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 231100001032 irritation of the eye Toxicity 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- 208000023589 ischemic disease Diseases 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 229960002418 ivermectin Drugs 0.000 description 1
- 229960004752 ketorolac Drugs 0.000 description 1
- OZWKMVRBQXNZKK-UHFFFAOYSA-N ketorolac Chemical compound OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 OZWKMVRBQXNZKK-UHFFFAOYSA-N 0.000 description 1
- 229910052743 krypton Inorganic materials 0.000 description 1
- DNNSSWSSYDEUBZ-UHFFFAOYSA-N krypton atom Chemical compound [Kr] DNNSSWSSYDEUBZ-UHFFFAOYSA-N 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- 150000002617 leukotrienes Chemical class 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- JXNPEDYJTDQORS-UHFFFAOYSA-N linoleyl alcohol Natural products CCCCCC=CCC=CCCCCCCCCO JXNPEDYJTDQORS-UHFFFAOYSA-N 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000000465 moulding Methods 0.000 description 1
- 229940043348 myristyl alcohol Drugs 0.000 description 1
- GOQYKNQRPGWPLP-UHFFFAOYSA-N n-heptadecyl alcohol Natural products CCCCCCCCCCCCCCCCCO GOQYKNQRPGWPLP-UHFFFAOYSA-N 0.000 description 1
- 208000023922 necrotizing scleritis Diseases 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 229960001002 nepafenac Drugs 0.000 description 1
- QEFAQIPZVLVERP-UHFFFAOYSA-N nepafenac Chemical compound NC(=O)CC1=CC=CC(C(=O)C=2C=CC=CC=2)=C1N QEFAQIPZVLVERP-UHFFFAOYSA-N 0.000 description 1
- 210000004126 nerve fiber Anatomy 0.000 description 1
- 229960000808 netilmicin Drugs 0.000 description 1
- ZBGPYVZLYBDXKO-HILBYHGXSA-N netilmycin Chemical compound O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@]([C@H](NC)[C@@H](O)CO1)(C)O)NCC)[C@H]1OC(CN)=CC[C@H]1N ZBGPYVZLYBDXKO-HILBYHGXSA-N 0.000 description 1
- ZWRUINPWMLAQRD-UHFFFAOYSA-N nonan-1-ol Chemical compound CCCCCCCCCO ZWRUINPWMLAQRD-UHFFFAOYSA-N 0.000 description 1
- 229960001180 norfloxacin Drugs 0.000 description 1
- OGJPXUAPXNRGGI-UHFFFAOYSA-N norfloxacin Chemical compound C1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNCC1 OGJPXUAPXNRGGI-UHFFFAOYSA-N 0.000 description 1
- 229960001699 ofloxacin Drugs 0.000 description 1
- ALSTYHKOOCGGFT-MDZDMXLPSA-N oleyl alcohol Chemical compound CCCCCCCC\C=C\CCCCCCCCO ALSTYHKOOCGGFT-MDZDMXLPSA-N 0.000 description 1
- 229940055577 oleyl alcohol Drugs 0.000 description 1
- XMLQWXUVTXCDDL-UHFFFAOYSA-N oleyl alcohol Natural products CCCCCCC=CCCCCCCCCCCO XMLQWXUVTXCDDL-UHFFFAOYSA-N 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- LBIYNOAMNIKVKF-FPLPWBNLSA-N palmitoleyl alcohol Chemical compound CCCCCC\C=C/CCCCCCCCO LBIYNOAMNIKVKF-FPLPWBNLSA-N 0.000 description 1
- LBIYNOAMNIKVKF-UHFFFAOYSA-N palmitoleyl alcohol Natural products CCCCCCC=CCCCCCCCCO LBIYNOAMNIKVKF-UHFFFAOYSA-N 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000002745 poly(ortho ester) Substances 0.000 description 1
- 229920001610 polycaprolactone Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 238000012910 preclinical development Methods 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 229940071643 prefilled syringe Drugs 0.000 description 1
- 230000001023 pro-angiogenic effect Effects 0.000 description 1
- 239000003805 procoagulant Substances 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 238000011552 rat model Methods 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 229940116176 remicade Drugs 0.000 description 1
- 210000001927 retinal artery Anatomy 0.000 description 1
- 210000003583 retinal pigment epithelium Anatomy 0.000 description 1
- 229920002379 silicone rubber Polymers 0.000 description 1
- 229940068638 simponi Drugs 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 208000010110 spontaneous platelet aggregation Diseases 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 229960002673 sulfacetamide Drugs 0.000 description 1
- SKIVFJLNDNKQPD-UHFFFAOYSA-N sulfacetamide Chemical compound CC(=O)NS(=O)(=O)C1=CC=C(N)C=C1 SKIVFJLNDNKQPD-UHFFFAOYSA-N 0.000 description 1
- SEEPANYCNGTZFQ-UHFFFAOYSA-N sulfadiazine Chemical compound C1=CC(N)=CC=C1S(=O)(=O)NC1=NC=CC=N1 SEEPANYCNGTZFQ-UHFFFAOYSA-N 0.000 description 1
- 229960004306 sulfadiazine Drugs 0.000 description 1
- 238000011477 surgical intervention Methods 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- OULAJFUGPPVRBK-UHFFFAOYSA-N tetratriacontan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCO OULAJFUGPPVRBK-UHFFFAOYSA-N 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- RZWIIPASKMUIAC-VQTJNVASSA-N thromboxane Chemical compound CCCCCCCC[C@H]1OCCC[C@@H]1CCCCCCC RZWIIPASKMUIAC-VQTJNVASSA-N 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 229960000707 tobramycin Drugs 0.000 description 1
- NLVFBUXFDBBNBW-PBSUHMDJSA-N tobramycin Chemical compound N[C@@H]1C[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N NLVFBUXFDBBNBW-PBSUHMDJSA-N 0.000 description 1
- 229960003962 trifluridine Drugs 0.000 description 1
- VSQQQLOSPVPRAZ-RRKCRQDMSA-N trifluridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(C(F)(F)F)=C1 VSQQQLOSPVPRAZ-RRKCRQDMSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 229940093257 valacyclovir Drugs 0.000 description 1
- 230000002227 vasoactive effect Effects 0.000 description 1
- 230000025033 vasoconstriction Effects 0.000 description 1
- YTZALCGQUPRCGW-ZSFNYQMMSA-N verteporfin Chemical compound N1C(C=C2C(=C(CCC(O)=O)C(C=C3C(CCC(=O)OC)=C(C)C(N3)=C3)=N2)C)=C(C=C)C(C)=C1C=C1C2=CC=C(C(=O)OC)[C@@H](C(=O)OC)[C@@]2(C)C3=N1 YTZALCGQUPRCGW-ZSFNYQMMSA-N 0.000 description 1
- 230000007998 vessel formation Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 230000004382 visual function Effects 0.000 description 1
- 229940061392 visudyne Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61F—FILTERS IMPLANTABLE INTO BLOOD VESSELS; PROSTHESES; DEVICES PROVIDING PATENCY TO, OR PREVENTING COLLAPSING OF, TUBULAR STRUCTURES OF THE BODY, e.g. STENTS; ORTHOPAEDIC, NURSING OR CONTRACEPTIVE DEVICES; FOMENTATION; TREATMENT OR PROTECTION OF EYES OR EARS; BANDAGES, DRESSINGS OR ABSORBENT PADS; FIRST-AID KITS
- A61F9/00—Methods or devices for treatment of the eyes; Devices for putting-in contact lenses; Devices to correct squinting; Apparatus to guide the blind; Protective devices for the eyes, carried on the body or in the hand
- A61F9/007—Methods or devices for eye surgery
- A61F9/008—Methods or devices for eye surgery using laser
- A61F9/00821—Methods or devices for eye surgery using laser for coagulation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/178—Lectin superfamily, e.g. selectins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0048—Eye, e.g. artificial tears
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- This invention is in the field of treating retinal disorders.
- the present invention relates to the treatment of ocular vascular proliferative diseases.
- a lack of oxygen in the retina or cornea can result in the formation of new blood vessels - a process referred to as neovascularization.
- Low oxygen conditions induce the expression of vascular endothelial growth factor (VEGF) which stimulates the proliferation of new blood vessels.
- VEGF vascular endothelial growth factor
- Insufficient oxygen supply to the retina can be caused by several conditions. For example, in diabetic patients, insufficient insulin levels lead to an overaccumulation of glucose and/or fructose which in turn results in damage to the tiny blood vessels in the retina. This typically gives rise to abnormal blood vessel growth. In patients suffering from diabetic retinopathy, the disease often progresses from a non-proliferative stage to a proliferative stage. During the proliferative stage, fragile new blood vessels begin to extend into the clear, gel-like vitreous humour that fills the inside of the eye. In other instances, oxygen supply is limited to parts of the retina due to the occlusion of retinal veins. The occlusion shuts off the blood supply to the areas downstream of it.
- Retinal vein occlusion is more prevalent in persons with high blood pressure, elevated cholesterol levels or diabetes.
- Retinal arteries may become thicker and stiff with age. Thickened arteries can compress the retinal vein either in the optic nerve (where they are located in close proximity to the retinal vein) or at points where the arteries cross the veins in the retina. Compression of retinal veins can ultimately lead to their occlusion - a condition called venous occlusive disease. Occlusion of the vein can occur, e.g., on the surface of the retina (branch retinal vein occlusion) or within the optic nerve (central retinal vein occlusion). The increased blood pressure in the veins also causes bleeding and swelling in the retina.
- Neovascular glaucoma is a serious condition and is the result of elevated intraocular pressure (IOP) which may be due to the formation of abnormal neovascular tissue.
- IOP intraocular pressure
- These blood vessels may also appear on the surface of the iris - a condition referred to as rubeosis iridis.
- corneal neovascularization blood vessel ingrowth from the limbal vascular plexus into the cornea can occur when the cornea is continuously subjected to low oxygen conditions, ischemia is one cause for corneal neovascularization.
- ischemia is one cause for corneal neovascularization.
- Persons who wear hydrogel contact lenses for long periods of time each day are at a particular risk to develop corneal neovascularization.
- other circumstances including infection, inflammation, trauma and loss of the limbal stem cell barrier can promote an environment that promotes VEGF release and can cause corneal neovascularization.
- ranibizumab (Lucentis®) and bevacizumab (Avastin®) in the treatment of corneal neovascularization.
- VEGF antagonists were found to be safe and effective treatments for corneal neovascularization when appropriate precautions are observed (Stevenson et al. Ocul Surf (2012) 10(2):67-83). Although direct comparisons were not conclusive, the results suggested that ranibizumab may be modestly superior to bevacizumab in terms of both onset of action and degree of efficacy.
- panretinal laser photocoagulation therapy compared with panretinal LPT plus intravitreal injection of 0.5 mg of ranibizumab in patients with high-risk proliferative diabetic retinopathy.
- LPT panretinal laser photocoagulation therapy
- intravitreal ranibizumab administered after panretinal LPT was associated with a larger reduction in leakage at week 48 compared with panretinal LPT alone.
- the adjunctive use of intravitreal ranibizumab appeared to protect against the modest visual acuity loss and the macular swelling usually observed in eyes that are treated with panretinal LPT alone.
- Ocular vascular proliferative diseases can lead to permanent vision loss if left untreated. It is an object of the invention to provide further and improved treatments for ocular vascular proliferative diseases.
- the present invention relates to the use of a non-antibody VEGF antagonist in the treatment of ocular vascular proliferative diseases.
- the invention further provides treatment schedules that reduce the total number of doctor visits leading to greater patient compliance and better overall disease outcomes such as stabilization or improvement of visual acuity.
- the invention also provides a non-antibody VEGF antagonist for use in a method for treating a patient having an ocular vascular proliferative disease, wherein said method comprises administering to the eye of a patient a non-antibody VEGF antagonist.
- the non-antibody VEGF antagonist may be administered intravitreally, e.g. through injection, or topically, e.g. in form of eye drops.
- the invention further provides the use of a non-antibody VEGF antagonist in the manufacture of a medicament for treating a patient having an ocular vascular proliferative disease.
- VEGF is a well-characterised signal protein which stimulates angiogenesis.
- Two antibody VEGF antagonists have been approved for human use, namely ranibizumab (Lucentis®) and bevacizumab (Avastin®).
- ranibizumab (Lucentis®)
- bevacizumab Avastin®
- Patients suffering from ocular vascular proliferative diseases have been treated with bevacizumab and ranibizumab (Filho et al. Acta Ophthalmol (201 1 ) 89(7):e567-72; Stevenson et al. Ocul Surf (2012) 10(2):67-83).
- the non-antibody VEGF antagonist is an immunoadhesin.
- aflibercept Esylea®
- VEGF-trap VEGF-trap
- Aflibercept is the preferred non-antibody VEGF antagonist for use with the invention.
- Aflibercept is a recombinant human soluble VEGF receptor fusion protein consisting of portions of human VEGF receptors 1 and 2 extracellular domains fused to the Fc portion of human IgGl .
- disulfide bridges can be formed between residues 30-79, 124- 1 85, 246-306 and 352-410 within each monomer, and between residues 21 1 -21 1 and 214-214 between the monomers.
- VEGF antagonist immunoadhesin currently in pre-clinical development is a recombinant human soluble VEGF receptor fusion protein similar to VEGF-trap containing extracellular ligand-binding domains 3 and 4 from VEGFR2/ KDR, and domain 2 from VEGFR l / Flt-1 ; these domains are fused to a human IgG Fc protein fragment (Li et al., 201 1 Molecular Vision 17:797-803).
- This antagonist binds to isoforms VEGF-A, VEGF-B and VEGF-C.
- the molecule is prepared using two different production processes resulting in different glycosylation patterns on the final proteins.
- the two glycoforms are referred to as KH902 (conbercept) and KH906.
- the fusion protein can have the following amino acid sequence (SEQ ID NO:2):
- Non-antibody VEGF antagonists include antibody mimetics (e.g. Affibody® molecules, affilins, affitins, anticalins, avimers, unitz domain peptides, and monobodies) with VEGF antagonist activity.
- antibody mimetics e.g. Affibody® molecules, affilins, affitins, anticalins, avimers, unitz domain peptides, and monobodies
- DARPin® MP01 12 One example for such a molecule is DARPin® MP01 12.
- the ankyrin binding domain may have the following amino acid sequence (SEQ ID NO: 3):
- Recombinant binding proteins comprising an ankyrin repeat domain that binds VEGF-A and prevents it from binding to VEGFR-2 are described in more detail in WO2010/060748 and WO2011/135067.
- antibody mimetics with VEGF antagonist activity are the 40 kD pegylated anticalin PRS-050 and the monobody angiocept (CT-322).
- the non-antibody VEGF antagonist may be modified to further improve its pharmacokinetic properties or bioavailability.
- a non-antibody VEGF antagonist may be chemically modified (e.g., pegylated) to extend its in vivo half-life.
- it may be modified by glycosylation or the addition of further glycosylation sites not present in the protein sequence of the natural protein from which the VEGF antagonist was derived.
- Variants of the above-specified VEGF antagonists that have improved characteristics for the desired application may be produced by the addition or deletion of amino acids.
- these amino acid sequence variants will have an amino acid sequence having at least 60% amino acid sequence identity with the amino acid sequences of SEQ ID NO: 1 , SEQ ID NO: 2 or SEQ ID NO: 3, preferably at least 80%, more preferably at least 85%, more preferably at least 90%, and most preferably at least 95%, including for example, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and 100%.
- Identity or homology with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Sequence identity can be determined by standard methods that are commonly used to compare the similarity in position of the amino acids of two polypeptides. Using a computer program such as
- BLAST or FASTA two polypeptides are aligned for optimal matching of their respective amino acids (either along the full length of one or both sequences or along a pre-determined portion of one or both sequences).
- the programs provide a default opening penalty and a default gap penalty, and a scoring matrix such as PAM 250 [a standard scoring matrix; see Dayhoff et al., in Atlas of Protein Sequence and Structure, vol. 5, supp. 3 ( 1978)] can be used in conjunction with the computer program.
- PAM 250 a standard scoring matrix; see Dayhoff et al., in Atlas of Protein Sequence and Structure, vol. 5, supp. 3 ( 1978)] can be used in conjunction with the computer program.
- the percent identity can then be calculated as: the total number of identical matches multiplied by 100 and then divided by the sum of the length of the longer sequence within the matched span and the number of gaps introduced into the longer sequences in order to align the two sequences.
- Non-antibody VEGF antagonists are preferred herein over antibody VEGF antagonists due their different pharmacokinetic profile when administered intravitreally.
- the non-antibody VEGF antagonist of the invention binds to VEGF via one or more protein domain(s) that are not derived from the antigen-binding domain of an antibody.
- the non-antibody VEGF antagonist of the invention are preferably proteinaceous, but may include modifications that are non-proteinaceous (e.g., pegylation, glycosylation).
- non-antibody VEGF antagonists are particularly useful for treating patients with ocular vascular proliferative diseases.
- a hallmark of ocular vascular proliferative diseases is the undesired proliferation of new blood vessels, often in places that are normally not vascularized, such as the cornea or iris.
- the proliferation of new blood vessels may be triggered by insufficient oxygen supply to the retina or cornea.
- Low oxygen conditions directly induce expression of VEGF and thus stimulate neovascularization.
- Neovascular glaucoma may develop as a late complication of ischemic retinopathies such as diabetic retinopathy or central retinal vein occlusion.
- Corneal neovascularization may occur secondarily to infection or inflammation in the eye, trauma to the eye (including chemical burns), or loss of the limbal stem cell barrier.
- corneal neovascularization For example, patients suffering from herpetic keratitis, trachoma or onchocerciasis typically also suffer from corneal neovascularization. Wearers of contact lenses are at an increased risk of developing corneal neovascularization. Extended use of contact lenses (e.g. more than 12 hours per day) may lead to hypoxia and irritation of the eye triggering corneal inflammation. Contact lens contamination can also cause corneal inflammation. Choroidal haemangioma, a type of benign vascular tumour, can also be associated with the proliferation of new blood vessels.
- a patient's medical history is usually used to determine the underlying cause for the development of ocular vascular proliferative diseases.
- the medical history as well as previous treatments may inform specific treatment options, in particular for combination treatments.
- patients having received one or more rounds of laser treatment may particularly benefit from the non-antibody VEGF antagonist therapy of the present invention.
- Combining non-antibody VEGF antagonist therapy with laser therapy may reduce the total treatment time as well as adverse effects that are often observed with laser therapy alone.
- combination therapy with an anti-inflammatory agent can be considered.
- an anti-inflammatory agent for patients in whom the ocular vascular proliferative disease is triggered by an inflammatory response, combination therapy with an anti-inflammatory agent can be considered.
- the combined use of steroids and non-antibody VEGF antagonist therapy to reduce inflammation and prevent formation of new blood vessels, respectively, may be particularly advantageous in patients with corneal neovascularization.
- Patients who suffer from corneal neovascularization secondary to bacterial, viral, fungal or acanthamoebal infection may benefit from non-antibody VEGF antagonist therapy in combination with an antimicrobial agent and optionally an anti-inflammatory agent.
- corneal stromal blood vessels due to corneal neovascularization are at a significant risk for immune rejection after corneal transplantation.
- Use of non-antibody VEGF antagonist therapy prior to (and optionally also subsequent to) corneal transplantation therefore may be particularly beneficial to patients with corneal stromal blood vessels as successful reduction of corneal vascularization will reduce the risk of graft rejection.
- VEGF antagonists other than the non-antibody VEGF antagonist of the invention to manage their ocular vascular proliferative diseases will benefit in particular from the non-antibody therapies of the invention.
- the non-antibody VEGF antagonist of the invention will generally be administered to the patient via intravitreal injection, though other routes of administration may be used, such as a slow-release depot, an ocular plug/reservoir or eye drops.
- Administration in aqueous form is usual, with a typical volume of 20-150 ⁇ 1 e.g. 40-60 ⁇ 1, or 50 ⁇ 1.
- Injection can be via a 30-gauge x 1 ⁇ 2-inch (12.7 mm) needle.
- aflibercept is generally administered via intravitreal injection at a dose of 2 mg (suspended in 0.05 mL buffer comprising 40 mg/mL in 10 mM sodium phosphate, 40 mM sodium chloride, 0.03% polysorbate 20, and 5% sucrose, pFI 6.2).
- the normal dose may be reduced for the treatment of smaller children and in particular infants.
- the dose for treating an infant with a VEGF antagonist of the invention is usually 50% of the dose administered to an adult. Smaller doses (e.g., 0.5 mg per monthly injection) may also be used.
- Patients suffering from corneal neovascularization may particularly benefit from topical administration of the non-antibody VEGF antagonist in form of eye drops. Further preferred modes of administration for patients with corneal neovascularization are subconjunctival injection or intracorneal injection.
- an intravitreal device is used to continuously deliver a non-antibody VEGF antagonist into the eye over a period of several months before needing to be refilled by injection.
- Various intravitreal delivery systems are known in the art. These delivery systems may be active or passive.
- WO2010/088548 describes a delivery system having a rigid body using passive diffusion to deliver a therapeutic agent.
- WO2002/100318 discloses a delivery system having a flexible body that allows active administration via a pressure differential.
- active delivery can be achieved by implantable miniature pumps.
- An example for an intravitreal delivery system using a miniature pump to deliver a therapeutic agent is the Ophthalmic MicroPump SystemTM marketed by Replenish, Inc. which can be programmed to deliver a set amount of a therapeutic agent for a pre-determined number of times.
- the non-antibody VEGF antagonist is typically encased in a small capsule-like container (e.g., a silicone elastomer cup).
- a small capsule-like container e.g., a silicone elastomer cup
- the container is usually implanted in the eye above the iris.
- the container comprises a release opening. Release of the non-antibody VEGF antagonist may be controlled by a membrane positioned between the non-antibody VEGF antagonist and the opening, or by means of a miniature pump connected to the container.
- the non-antibody VEGF antagonist may be deposited in a slow-release matrix that prevents rapid diffusion of the antagonist out of the container.
- the intravitreal device is designed to release the non-antibody VEGF antagonist at an initial rate that is higher in the first month.
- the release rate slowly decreases, e.g., over the course of the first month after implantation, to a rate that is about 50% less than the initial rate.
- the container may have a size that is sufficient to hold a supply of the non-antibody VEGF antagonist that lasts for about four to six months. Since a reduced dose of VEGF antagonist may be sufficient for effective treatment when administration is continuous, the supply in the container may last for one year or longer, preferably about two years, more preferably about three years.
- Intravitreal concentrations of the non-antibody VEGF antagonist are reduced, and therefore the potential risk of side-effects from non-antibody VEGF antagonist entering the circulation is decreased.
- This aspect may be of a particular advantage in children who may require general anaesthesia for intravitreal injections.
- Systemically elevated non-antibody VEGF antagonist levels may interfere with normal growth and development of children who therefore may benefit from lower intravitreal concentrations of the non-antibody VEGF antagonist.
- the non-antibody VEGF antagonist is provided in a pre-filled sterile syringe ready for administration.
- the syringe has low silicone content. More preferably, the syringe is silicone free.
- the syringe may be made of glass. Using a pre-filled syringe for delivery has the advantage that any contamination of the sterile antagonist solution prior to administration can be avoided. Pre-filled syringes also provide easier handling for the administering ophthalmologist.
- Non-antibody VEGF antagonist may be provided as slow-release formulations.
- Slow-release formulations are typically obtained by mixing a therapeutic agent with a biodegradable polymer or encapsulating it into microparticles. By varying the manufacture conditions of polymer-based delivery compositions, the release kinetic properties of the resulting compositions can be modulated.
- a slow-release formulation in accordance with the invention typically comprises a non-antibody VEGF antagonist, a polymeric carrier, and a release modifier for modifying a release rate of the non- antibody VEGF antagonist from the polymeric carrier.
- the polymeric carrier usually comprises one or more biodegradable polymers or co-polymers or combinations thereof.
- the polymeric carrier may be selected from poly-lactic acid (PLA), poly-glycolic acid (PGA), poly- lactide-co-glycolide (PLGA), polyesters, poly (orthoester), poly(phosphazine), poly (phosphate ester), polycaprolactones, or a combination thereof.
- a preferred polymeric carrier is PLGA.
- the release modifier is typically a long chain fatty alcohol, preferably comprising from 10 to 40 carbon atoms.
- Commonly used release modifiers include capryl alcohol, pelargonic alcohol, capric alcohol, lauryl alcohol, myristyl alcohol, cetyl alcohol, palmitoleyl alcohol, stearyl alcohol, isostearyl alcohol, elaidyl alcohol, oleyl alcohol, linoleyl alcohol, polyunsaturated elaidolinoleyl alcohol, polyunsaturated linolenyl alcohol, elaidolinolenyl alcohol, polyunsaturated ricinoleyl alcohol, arachidyl alcohol, behenyl alcohol, erucyl alcohol, lignoceryl alcohol, ceryl alcohol, montanyl alcohol, cluytyl alcohol, myricyl alcohol, melissyl alcohol, and geddyl alcohol.
- the non-antibody VEGF antagonist is incorporated into a microsphere-based sustained release composition.
- the microspheres are preferably prepared from PLGA.
- the amount of non- antibody VEGF antagonist incorporated in the microspheres and the release rate of the non-antibody VEGF antagonist can be controlled by varying the conditions used for preparing the microspheres. Processes for producing such slow-release formulations are described in US 2005/0281861 and US 2008/0107694.
- non-antibody VEGF antagonists of the invention allow increased spacing between administrations resulting in a more cost-effective therapy.
- better patient compliance is achieved when intravitreal injections have to be performed less frequently. This is particularly advantageous in patients suffering from ocular vascular proliferative diseases who may require multiple injections to improve visual acuity or prevent vision loss.
- a single injection of the VEGF antagonist according to the invention may be sufficient to ameliorate the disease or prevent disease progression for many years.
- three injections each one month apart are administered to the patient, while any subsequent injections are performed less frequently or on an as-needed basis, in certain cases, two injections spaced 6 weeks apart, preferably 8 weeks apart, more preferably 10 weeks apart may be required to improve visual acuity or halt disease progression. In other cases, three or more injections may be needed. In these cases, the time between injections should be at least 6 weeks, preferably 8 weeks, more preferably 10 weeks apart. Treatment may be continued until maximum visual acuity is achieved.
- treatment may be discontinued when visual acuity is stable for at least three months (i.e., no increase or decrease in visual acuity is observed during this period).
- Some treatment regimens may include an extended loading period in which the patient receives five or six intravitreal injections of the VEGF antagonist. Each injection is administered at least 4 weeks apart (e.g. one month apart). After the loading period, injections can be continued every 4 weeks or every month, but more typically they will be administered less frequently, e.g. every 8 weeks or every two months.
- Disease progression or recurrence of an ocular vascular proliferative disease may require one or more or continued treatment cycles. For example, in a first cycle, two injections spaced 6 weeks, preferably 8 weeks, more preferably 10 weeks apart may be administered followed by an interruption of treatment for 3 months, 4 months, 5 months, 6 months, 9 months, 12 months, 24 months or 36 months. If the ocular vascular proliferative disease reappears, the treatment is continued with a second cycle. In some cases three, four, five or more treatment cycles may be needed. For example, a further treatment cycle may be initiated if worsening of visual acuity is observed (e.g., by monthly checking a patient's vision after treatment has been discontinued).
- a further treatment cycle may be initiated if worsening of visual acuity is observed (e.g., by monthly checking a patient's vision after treatment has been discontinued).
- the non-antibody VEGF antagonist according to the invention is administered as needed.
- the non-antibody VEGF antagonist is administered the first time after an initial diagnosis of ocular vascular proliferative diseases has been made.
- a diagnosis of an ocular vascular proliferative disease can be made during examination of the eye by a combination of slit- lamp evaluation and biomicroscopic fundus examination with optical coherence tomography (OCT) and/or fluorescein fundus angiography.
- OCT optical coherence tomography
- fluorescein fundus angiography A second, third or further administration of the non-antibody VEGF antagonist is performed only if examination of the eye reveals signs of persistent or recurring ocular vascular proliferative disease.
- BCVA visual acuity
- Other retreatment criteria may include (i) an increase in central retinal thickness from the lowest central retinal thickness measurement as confirmed by OCT; (ii) the presence of new subretinal or intraretinal blood, or an increase of subretinal or intraretinal blood in comparison to the last visit; and/or (iii) additional neovascularisation as confirmed by fluorescein angiography.
- the compounds of the invention may be used in combination with one or more additional treatment.
- treatment with a VEGF antagonist of the invention may be performed in combination with laser photocoagulation therapy (LPT) and photodynamic therapy (PDT).
- LPT laser photocoagulation therapy
- PDT photodynamic therapy
- Laser treatment in some cases can itself lead to choroidal neovascularization.
- Laser therapy including LPT or PDT preferably should not be used in patients who previously responded with choroidal neovascularization to laser therapy.
- LPT uses laser light to cause controlled damage of the retina to produce a beneficial therapeutic effect. Small bursts of laser light can seal leaky blood vessels, destroy abnormal blood vessels, seal retinal tears, or destroy abnormal tissue in the back of the eye. It is quick, non-invasive, and usually requires no anaesthesia other than an anaesthetic eye drop. LPT techniques and apparatuses are readily available to ophthalmologists (see Lock et al. (2010) Med J Malaysia 65:88-94).
- LPT techniques can be classified as focal, panretinal (or scatter), or grid.
- Focal LPT applies small- sized burns to specific areas of focal leakage (microaneurysms) in the macula.
- Panretinal LPT scatters burns throughout the peripheral fundus.
- Grid LPT applies a pattern of burns to macular areas arising from diffuse capillary leakage or non-perfusion, with each burn typically spaced apart by two visible burn widths.
- Patients can receive more than one type of LPT (e.g. a combination of focal and panretinal LPT) and these may be administered one directly after the other, or after a delay.
- a useful panretinal LPT involves 1200-1600 burns.
- Laser spot sizes (spot diameters) of 50-500 ⁇ are typical (smaller spot sizes are more usual for focal LPT, larger for panretinal), applied for 50-200ms (continuously, or via micropulses), using green-to- yellow wavelengths e.g. using an argon gas (514.5nm) laser, a frequency-doubled Nd-YAG (532nm) laser, a krypton yellow laser (568.2nm), or a tunable dye laser (variable wavelength).
- a red laser may be used if a green or yellow laser is precluded ⁇ e.g. if vitreous hemorrhage is present).
- Micropulse laser therapy uses 810 nm or 577 nm lasers to direct a discontinuous beam of laser light on the affected tissue (Kiire et al. (2011) Retina Today, 67-70). This results in a greater degree of control over the photothermal effects in laser photocoagulation.
- the steady continuous- wave emission of conventional LPT is delivered in the form of short laser pulses. Each pulse typically is 100-300 ps in length with a 1700 to 1900 ps interval between each pulse.
- the "width" (“ON" time) of each pulse and the interval between pulses (“OFF” time) are adjustable by the surgeon. A shorter micropulse "width” limits the time for the laser-induced heat to spread to adjacent tissue.
- MLP is also referred to as “sub-threshold laser treatment” or “tissue-sparing laser therapy”. 10-25% of micropulse power is sufficient to show a consistent photothermal effect that is confined to the retinal pigment epithelium and does not affect the neurosensory retina.
- patients receive both LPT and a non-antibody VEGF antagonist.
- the administration of LPT and of non-antibody VEGF antagonist administration occur within 12 months of each other, preferably within six months of each other, and , ideally occur within one month or less of each other (e.g. within 10 days).
- the administration of LPT and non-antibody VEGF antagonist may occur on the same day.
- non-antibody VEGF antagonist therapy is administered prior to LPT.
- LPT can take place promptly after non-antibody VEGF antagonist administration (e.g. within 2-20 days, typically within 3-10 days), or can take place after a longer delay (e.g. after at least three weeks, after at least four weeks, after at least eight weeks, after at least 12 weeks, or after at least 24 weeks).
- treatment with non-antibody VEGF antagonist may be initiated at least 1 week, 2 weeks, 3 weeks, 4 weeks, 2 months, 3 months, 4 months, 5 months or 6 months before LPT.
- the non-antibody VEGF antagonist may be administered every 4 weeks, every 6 weeks, or every 8 weeks. Treatment may be continued at the same interval or extended intervals after LPT.
- the period between administration of the non-antibody VEGF antagonist may increase by 50% or 100%. For example, if the initial interval was 4 weeks, the interval may be extended to 6 or 8 weeks. If a patient receives LPT more than 12 weeks after receiving the non-antibody VEGF antagonist, their eye(s) might no longer contain detectable levels of the non-antibody VEGF antagonist.
- non-antibody VEGF antagonist therapy may be administered after LPT.
- the non-antibody VEGF antagonist is administered to the patient within 1-2 hours after LPT, typically within 60 minutes after completion of the first LPT session.
- the non-antibody VEGF antagonist may subsequently be administered every 4 weeks, every 6 weeks, every 8 weeks, every 12 weeks or preferably every 16 weeks.
- a patient receives in series (i) non-antibody VEGF antagonist (ii) at least one administration of LPT (iii) non-antibody VEGF antagonist.
- the patient may receive an initial intravitreal injection of non-antibody VEGF antagonist; then, within 3- 10 days of receiving the non-antibody VEGF antagonist, they receive focal photocoagulation; then, either on the same day as the focal photocoagulation, or later, but to be initiated within 14 days of receiving the non-antibody VEGF antagonist, they receive at least one sitting (e.g.
- panretinal photocoagulation if administered in more than one sitting, the panretinal photocoagulation should be completed within two to four weeks of receiving the non- antibody VEGF antagonist); and then, four weeks or a month after the initial injection, they receive a second injection of the non-antibody VEGF antagonist.
- This regimen may be continued with further doses of the non-antibody VEGF antagonist e.g. with a frequency of every one or two months.
- administration of the non-antibody VEGF antagonist is every four weeks (monthly) for the first three months. Afterwards administration of the non-antibody VEGF antagonist is once every eight weeks.
- a patient receives in series (i) an administration of LPT and (ii) at least one administration of a non-antibody VEGF antagonist.
- the patient may receive an initial intravitreal injection of non-antibody VEGF antagonist within 1 or 2 hours after panretinal photocoagulation therapy. Four to sixteen weeks later, intravitreal injection of non-antibody VEGF antagonist is repeated. In some instances, one or more additional injections are performed only if new vessel formation continues. The need for additional injections will be reassessed after an additional period of 4-16 weeks since the last injection.
- a patient receives panretinal photocoagulation therapy and, within approximately 60 minutes of receiving the laser treatment, is administered a first intravitreal injection of a non-antibody VEGF antagonist in the treated eye.
- a second injection and a third injection are administered, if new vessels are detected, e.g. by clinical assessment, colour photography, fluorescein angiography or on gonioscopy, during follow-up examinations.
- the non-antibody VEGF antagonist according to the invention is administered as needed.
- the treated eye may be re-evaluated by a combination of slit-lamp evaluation and biomicroscopic fundus examination with optical coherence tomography (OCT) and/or fluorescein fundus angiography.
- OCT optical coherence tomography
- Re- evaluation may take place at 4 weeks, 6 weeks, 8 weeks, 12 weeks or 1 weeks after the first LPT session.
- Subsequent follow-up visits may take place at 4 weeks, 6 weeks, 8 weeks, 12 weeks or 16 weeks after the first re-evaluation.
- a second, third or further administration of the non-antibody VEGF antagonist is performed only if examination of the eye reveals signs of persistent or recurring neovascularizat ion.
- Laser-induced tissue damage can stimulate the release of pro-angiogenic factors.
- Combination therapy of a non-antibody VEGF antagonist and LPT is particularly suitable to treat high-risk proliferative diabetic retinopathy. It is also suitable for treating corneal neovascularization and may reduce complications such as corneal haemorrhage, corneal thinning, iris atrophy and necrotizing scleritis.
- PDT uses a light-activated molecule to cause localised damage to neovascular endothelium, resulting in vessel occlusion.
- Light is delivered to the retina as a single circular spot via a fiber optic cable and a slit lamp, using a suitable ophthalmic magnification lens (laser treatment).
- the light-activated compound is injected into the circulation prior to the laser treatment, and damage is inflicted by photoactivation of the compound in the area afflicted by neovascularization.
- One commonly used light-activated compound is verteporfm (Visudyne®). Verteporfm is transported in the plasma primarily by lipoproteins.
- verteporfm Once verteporfm is activated by light in the presence of oxygen, highly reactive, short-lived singlet oxygen and reactive oxygen radicals are generated which damages the endothelium surrounding blood vessels. Damaged endothelium is known to release procoagulant and vasoactive factors through the lipo-oxygenase (leukotriene) and cyclooxygenase (eicosanoids such as thromboxane) pathways, resulting in platelet aggregation, fibrin clot formation and vasoconstriction. Verteporfm appears to somewhat preferentially accumulate in neovasculature. The wavelength of the laser used for photoactivation of the light-activated compound may vary depending on the specific light-activated compound used.
- 689 nm wavelength laser light delivery to the patient 15 minutes after the start of the 10-minute infusion with verteporfm may be used.
- Photoactivation is controlled by the total light dose delivered.
- the recommended light dose is 50 J/cm 2 of neovascular lesion administered at an intensity of 600 mW/cm 2 over 83 seconds.
- Light dose, light intensity, ophthalmic lens magnification factor and zoom lens setting are important parameters for the appropriate delivery of light to the predetermined treatment spot during PDT and may need to be adapted depending on the laser system used for therapy.
- Administration of the non-antibody VEGF antagonist is performed before or after photodynamic therapy. Typically, administration of the non-antibody VEGF antagonist and PDT will be performed on the same day (e.g. within 24 hours of one another). In one embodiment, treatment with non- antibody antagonist is started up to 48 hours before photodynamic therapy. Alternatively, treatment with non-antibody VEGF antagonist is initiated at least 1 week, 2, weeks, 3 weeks, 4 weeks, 2 months, 3 months, 4 months, 5 months or 6 months before PDT. The non-antibody VEGF antagonist may be administered every 4 weeks, every 6 weeks, or every 8 weeks. Treatment may be continued at the same interval or extended intervals after PDT. Where the interval is extended, the period between administration of the non-antibody VEGF antagonist may increase by 50% or 100%.
- non-antibody VEGF antagonist administration may be continuous, for example, if an intravitreal delivery system is used.
- the intravitreal device may be implanted prior to PDT.
- a single administration of non-antibody VEGF antagonist shortly before or after PDT may be sufficient to achieve the desired effect.
- a single dose of non-antibody VEGF antagonist may be given on the day of the PDT.
- PDT may be repeated as needed. Generally, it is not given more frequently than every 3 months. PDT may be repeated every 3 months. For example, treatment may be continued until there has been complete regression of polyps in the treated eye(s). Alternatively, PDT may be repeated less frequently, in particular if the non-antibody VEGF antagonist treatment is continued after PDT. For example, intervals between PDT may be extended to every 4 months, every 5 months, or every 6 months. Ideally, continued treatment with a non-antibody VEGF antagonist after PDT prevents recurrence of the ocular vascular proliferative disease.
- Combining PDT with non-antibody VEGF antagonist therapy is particularly useful in treating choroidal haemangioma as the combined use of both therapies may increase treatment efficacy and, at the same time, decrease undesired collateral vessel development.
- treatment time and patient compliance is improved by using a non-antibody VEGF antagonist in combination with an anti-inflammatory agent.
- Administering the VEGF antagonist in combination with an anti-inflammatory agent can have synergistic effects depending on the underlying cause of neovascularization. Addition of an anti-inflammatory agent is particularly advantageous in corneal neovascularization secondary to an inflammatory disease or condition.
- Anti-inflammatory agents include steroids and NSAIDs. NSAIDs used in the treatment of ocular diseases include ketorolac, nepafenac and diclofenac. In some instances, the use of diclofenac is preferred.
- Corticosteroids used in treating ocular diseases include dexamethasone, prednisolone, fluorometholone and fluocinolone.
- Other steroids or derivatives thereof that may be used in combination with VEGF antagonist treatment include anecortave, which has angiostatic effects but acts by a different mechanism than the VEGF antagonists according to the invention.
- a preferred anti-inflammatory agent is triamcinolone.
- the anti-inflammatory agent may also be a TNF-a antagonist.
- a TNF-a antibody may be administered in combination with a non-antibody VEGF antagonist.
- TNF-a antibodies e.g. those sold under the trade names Humira®, Remicade®, Simponi® and Cimzia®, are well known in the art.
- a TNF-a non-antibody antagonist such as Enbrel® may be administered in combination with a non-antibody VEGF antagonist.
- the anti-inflammatory agent may be administered at the same time as the non-antibody VEGF antagonist.
- the anti-inflammatory agent can be administered either systemically or locally.
- the anti-inflammatory agent may be administered orally, topically, or, preferably, intravitreally.
- triamcinolone is administered intravitreally at the same time as the non-antibody VEGF antagonist of the invention.
- the non-antibody VEGF antagonist is administered after administration of an antimicrobial agent.
- the antimicrobial agent may be selected from azithromycin, gatifloxacin, ciprofloxacin, ofloxacin, norfloxacin, polymixin B + chloramphenicol, chloramphenicol, gentamicin, fluconazole, sulfacetamide, tobramycin, neomycin + polymixin B, and netilmicin.
- Azithromycin is typically used to treat patients suffering from trachoma.
- the antimicrobial agent may be selected from pyrimethamine, sulfadiazine and folinic acid or a combination thereof.
- Combination with pyrimethamine can be particularly advantageous in treating patients with neovascularization associated with toxoplasmosis.
- combination treatment with broad-spectrum antiparasitic avermectin medicines such as ivermectin may be beneficial (e.g., in patients suffering from onchocerciasis).
- Patients suffering from herpes simplex virus-induced keratitis will benefit from combining antiviral treatment either in the form of topical therapy with trifluridine or oral administration of acyclovir or valacyclovir with non-antibody VEGF antagonist therapy.
- composition comprising X may consist exclusively of X or may include something additional e.g. X + Y.
- BRVO retinal vein occlusion
- the primary efficacy outcome measure was mean change from baseline best-corrected visual acuity (BCVA) letter score at month 6. Secondary outcomes included other parameters of visual function and central foveal thickness.
- Intraocular injections of 0.3 mg or 0.5 mg ranibizumab provided rapid, effective treatment for macular edema following BRVO with low rates of ocular and nonocular safety events.
- Mean (95% confidence interval [CI]) change from baseline BCVA letter score at month 6 was 16.6 (14.7-18.5) and 18.3 ( 16.0-20.6) in the 0.3 mg and 0.5 mg ranibizumab groups and 7.3 (5.1 -9.5) in the sham group (PO.0001 for each ranibizumab group vs. sham).
- the percentage of patients who gained > 15 letters in BCVA at month 6 was 55.2% (0.3 mg) and 61 .1 % (0.5 mg) in the ranibizumab groups and 28.8% in the sham group (P ⁇ 0.0001 for each ranibizumab group vs. sham).
- significantly more ranibizumab-treated patients (0.3 mg, 67.9%; 0.5 mg, 64.9%) had BCVA of >20/40 compared with sham patients (41 .7%; PO.0001 for each ranibizumab group vs. sham).
- central foveal thickness had decreased by a mean of 337 ⁇ (0.3 mg) and 345 ⁇ (0.5 mg) in the ranibizumab groups and 158 ⁇ in the sham group (PO.0001 for each ranibizumab group vs. sham).
- the median percent reduction in excess foveal thickness at month 6 was 97.0% and 97.6% in 0.3 mg and 0.5 mg groups and 27.9% in the sham group.
- BCVA Best-corrected visual acuity
- the inhibitiory effect of subconjunctival injection of KH902 on corneal neovascularization in a rat model was tested.
- Corneal neovascularization was induced by alkaline burn.
- the rats were randomly divided into four groups: ( 1 ) group 1 received a subconjunctival injection of H902 (30 mg/mL); (2) group 2 received a subconjunctival injection of dexamethasone (1 mg/mL); (3) group 3 received a subconjunctival injection of the solvent used to inject KH902 in group 1 ; (4) group 4 received a subconjunctival injection of saline, which was used as the solvent for dexamethasone in group 2.
- the area of corneal neovascularization and the average optical density value of VEGF immunohistochemical staining in the four groups were measured.
- Twenty patients are enrolled in an open-label pilot study to assess the use of 2.0 mg intravitreally administered aflibercept in the treatment of proliferative diabetic retinopathy. All patients present with active proliferative retinopathy at the time of enrolment. Patients are randomised into two groups.
- the first group receives intravitreal aflibercept every four weeks, while the second group receives intravitreal aflibercept every eight weeks.
- patients in both groups receive five intravitreal injections of aflibercept beginning at day 1, and then at weeks 4, 8, 12, and 16.
- patients in the first group will continue to receive aflibercept intravitreally every 4 weeks, beginning at week 20, through week 48, while patients in the second group will receive aflibercept intravitreally every 8 weeks, beginning week 24, through week 48.
- Secondary outcome measures are (i) the mean change in the area of fluorescein leakage in mm 2 (area of neovascularisation) compared to baseline; (ii) proportion of patients with complete regression of neovascularisation; (iii) the mean change in ETDRS BCVA from baseline; (iv) the proportion of subjects gaining > 5 letters, > 10 letters and > 15 letters from baseline; (v) the proportion of subjects losing > 5 letters from baseline; (vi) the mean change in retinal thickness from baseline as demonstrated by OCT imaging; (vii) the proportion of subjects without vitreous hemorrhage or pre- retinal haemorrhage; (viii) the proportion of subjects with complete avoidance of panretinal laser photocoagulation (PRP)/additional PRP; and (ix) the proportion of subjects with avoidance of vitrectomy.
- PRP panretinal laser photocoagulation
- NVG neovascular glaucoma
- the primary endpoint of the study will be an assessment of the safety profile of repeated intravitreal aflibercept injections in patients with NVG by evaluating the incidence and severity of adverse events.
- Secondary outcome measures are (i) the rate and extent of resolution of neovasculariaation; (ii) the mean change in intraocular pressure (IOP); (iii) the proportion of patients losing > 5 letters on visual acuity; (iv) the proportion of patients gaining > 5 letters on visual acuity; (v) the mean change in visual acuity; (vi) the visual field; (vii) the average retinal nerve fiber layer and central macular thickness; (viii) the need for additional IOP lowering medications; and (ix) the need for surgical intervention in both arms during the 52-week period.
- IOP intraocular pressure
- Twenty-four patients are enrolled in an open-label study evaluating the impact of repeat intravitreal injections of aflibercept on capillary non-perfusion in patients with proliferative retinopathy and/or macular edema secondary to proliferative diabetic retinopathy and central retinal venous occlusive disease.
- Patients are randomised into two groups. Patients in the first group will receive intravitreal aflibercept injections every month for the 12 month duration of the study. Patients in the second group will receive intravitreal aflibercept injections every month for the first 6 months, then every other month for the next 6 months.
- Treatment criteria will allow for patients to be treated every month in the second 6 months if needed.
- Primary outcome measures include the mean change in capillary non-perfusion as assessed by the presence and amount of capillary non-perfusion measured by wide-angle angiography at baseline, month 3, month 6, and month 12.
- Ten patients with corneal neovascularization in one or more quadrants crossing more than 0.5 mm over the limbus at the time of corneal transplantation are enrolled in a phase 1 , prospective, randomised, open-label clinical trial. Patients are randomised into two groups. Patients in the first group will receive 2mg (0.05mL) aflibercept via subconjunctival injection in addition to standard of care treatment (steroids and cyclosporine). Patients will receive one injection four weeks (+/- 1 week) prior to transplantation. They will receive a second injection at the conclusion of corneal transplantation.
- Patients may receive as-needed repeat injections (minimum of 30 days in between treatments) for recurrence of corneal neovascularization (defined as >1.0 mm crossing onto the cornea, past the limbus, or extension of vessels beyond previously documented extent) during the follow-up period.
- Patients in the first group will receive standard of care (steroids and cyclosporine) treatment only.
- standard of care steroids and cyclosporine
- the primary endpoint in this study is safety as defined by incidence and severity of adverse events in patients with corneal neovascularization undergoing corneal transplant.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Zoology (AREA)
- Ophthalmology & Optometry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Heart & Thoracic Surgery (AREA)
- Vascular Medicine (AREA)
- Cardiology (AREA)
- Physics & Mathematics (AREA)
- Optics & Photonics (AREA)
- Surgery (AREA)
- Biomedical Technology (AREA)
- Rheumatology (AREA)
- Pain & Pain Management (AREA)
- Urology & Nephrology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to the use of a non-antibody VEGF antagonist, in the treatment of choroidal neovascularisation secondary to diseases other than age-related macular degeneration and pathologic myopia.
Description
USE OF A VEGF ANTAGONIST IN TREATING
OCULAR VASCULAR PROLIFERATIVE DISEASES
This invention is in the field of treating retinal disorders. In particular, the present invention relates to the treatment of ocular vascular proliferative diseases.
BACKGROUND ART
A lack of oxygen in the retina or cornea can result in the formation of new blood vessels - a process referred to as neovascularization. Low oxygen conditions induce the expression of vascular endothelial growth factor (VEGF) which stimulates the proliferation of new blood vessels.
Insufficient oxygen supply to the retina can be caused by several conditions. For example, in diabetic patients, insufficient insulin levels lead to an overaccumulation of glucose and/or fructose which in turn results in damage to the tiny blood vessels in the retina. This typically gives rise to abnormal blood vessel growth. In patients suffering from diabetic retinopathy, the disease often progresses from a non-proliferative stage to a proliferative stage. During the proliferative stage, fragile new blood vessels begin to extend into the clear, gel-like vitreous humour that fills the inside of the eye. In other instances, oxygen supply is limited to parts of the retina due to the occlusion of retinal veins. The occlusion shuts off the blood supply to the areas downstream of it. Retinal vein occlusion is more prevalent in persons with high blood pressure, elevated cholesterol levels or diabetes. Retinal arteries may become thicker and stiff with age. Thickened arteries can compress the retinal vein either in the optic nerve (where they are located in close proximity to the retinal vein) or at points where the arteries cross the veins in the retina. Compression of retinal veins can ultimately lead to their occlusion - a condition called venous occlusive disease. Occlusion of the vein can occur, e.g., on the surface of the retina (branch retinal vein occlusion) or within the optic nerve (central retinal vein occlusion). The increased blood pressure in the veins also causes bleeding and swelling in the retina.
Ocular ischemic diseases such as diabetic retinopathy and central vein occlusion can lead to neovascular glaucoma. Neovascular glaucoma is a serious condition and is the result of elevated intraocular pressure (IOP) which may be due to the formation of abnormal neovascular tissue. These blood vessels may also appear on the surface of the iris - a condition referred to as rubeosis iridis.
Similarly, blood vessel ingrowth from the limbal vascular plexus into the cornea can occur when the cornea is continuously subjected to low oxygen conditions, ischemia is one cause for corneal neovascularization. Persons who wear hydrogel contact lenses for long periods of time each day are at a particular risk to develop corneal neovascularization. However, other circumstances including infection, inflammation, trauma and loss of the limbal stem cell barrier can promote an environment that promotes VEGF release and can cause corneal neovascularization.
The VEGF-induced formation of new blood vessels is detrimental, and retinal, intertrabecular or corneal neovascularization can ultimately lead to vision loss. A recent small-scale clinical trial tested topical administration of ranibizumab (Lucentis®) and bevacizumab (Avastin®) in the treatment of
corneal neovascularization. VEGF antagonists were found to be safe and effective treatments for corneal neovascularization when appropriate precautions are observed (Stevenson et al. Ocul Surf (2012) 10(2):67-83). Although direct comparisons were not conclusive, the results suggested that ranibizumab may be modestly superior to bevacizumab in terms of both onset of action and degree of efficacy.
Ghanem et al. {Middle East Afr J Ophthalmol (2009) 16(2):75-79) reported a clinical case series of sixteen patients with rubeosis iridis and secondary glaucoma who were administered an intravitreal injection of bevacizumab. This treatment led to regression of iris neovascularization with a subsequent drop of the 10P in eyes with neo vascular glaucoma.
Another recent small-scale study evaluated the effects of panretinal laser photocoagulation therapy (LPT) compared with panretinal LPT plus intravitreal injection of 0.5 mg of ranibizumab in patients with high-risk proliferative diabetic retinopathy (Filho et al. Acta Ophthalmol (2011) 89(7):e567-72). The study found that intravitreal ranibizumab administered after panretinal LPT was associated with a larger reduction in leakage at week 48 compared with panretinal LPT alone. The adjunctive use of intravitreal ranibizumab appeared to protect against the modest visual acuity loss and the macular swelling usually observed in eyes that are treated with panretinal LPT alone.
Dastjerdi et al. {Arch Ophthalmol (2009) 127(4):381-389) report that topical bevacizumab leads to decrease in invasion area and vessel calibre and reduces the severity of corneal neovascularization without local or systemic side-effects.
Ocular vascular proliferative diseases can lead to permanent vision loss if left untreated. It is an object of the invention to provide further and improved treatments for ocular vascular proliferative diseases.
DISCLOSURE OF THE INVENTION
The present invention relates to the use of a non-antibody VEGF antagonist in the treatment of ocular vascular proliferative diseases. The invention further provides treatment schedules that reduce the total number of doctor visits leading to greater patient compliance and better overall disease outcomes such as stabilization or improvement of visual acuity.
The invention also provides a non-antibody VEGF antagonist for use in a method for treating a patient having an ocular vascular proliferative disease, wherein said method comprises administering to the eye of a patient a non-antibody VEGF antagonist. The non-antibody VEGF antagonist may be administered intravitreally, e.g. through injection, or topically, e.g. in form of eye drops.
The invention further provides the use of a non-antibody VEGF antagonist in the manufacture of a medicament for treating a patient having an ocular vascular proliferative disease.
Non-Antibody VEGF antagonists
VEGF is a well-characterised signal protein which stimulates angiogenesis. Two antibody VEGF antagonists have been approved for human use, namely ranibizumab (Lucentis®) and bevacizumab
(Avastin®). Patients suffering from ocular vascular proliferative diseases have been treated with bevacizumab and ranibizumab (Filho et al. Acta Ophthalmol (201 1 ) 89(7):e567-72; Stevenson et al. Ocul Surf (2012) 10(2):67-83).
In one aspect of the invention, the non-antibody VEGF antagonist is an immunoadhesin. One such immiioadhesin is aflibercept (Eylea®), which has recently been approved for human use and is also known as VEGF-trap (Holash et al. (2002) PNAS USA 99: 1 1393-98; Riely & Miller (2007) Clin Cancer Res 13;4623-7s). Aflibercept is the preferred non-antibody VEGF antagonist for use with the invention. Aflibercept is a recombinant human soluble VEGF receptor fusion protein consisting of portions of human VEGF receptors 1 and 2 extracellular domains fused to the Fc portion of human IgGl . It is a dimeric glycoprotein with a protein molecular weight of 97 kilodaltons (kDa) and contains glycosylation, constituting an additional 15% of the total molecular mass, resulting in a total molecular weight of 1 15 kDa. It is conveniently produced as a glycoprotein by expression in recombinant CHO Kl cells. Each monomer can have the following amino acid sequence (SEQ ID NO: 1 ):
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATY KEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDWLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPS SKHQHK LWRDLKTQSGSEMKKFLSTLTIDGV RSDQGLYTCAASSGLMTKK STFVRVHEKDKTHTCPP
CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNA TKPREEQYNST YRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR QQGN SCSVMHEALHNHYTQKSL SLSPG
and disulfide bridges can be formed between residues 30-79, 124- 1 85, 246-306 and 352-410 within each monomer, and between residues 21 1 -21 1 and 214-214 between the monomers.
Another non-antibody VEGF antagonist immunoadhesin currently in pre-clinical development is a recombinant human soluble VEGF receptor fusion protein similar to VEGF-trap containing extracellular ligand-binding domains 3 and 4 from VEGFR2/ KDR, and domain 2 from VEGFR l / Flt-1 ; these domains are fused to a human IgG Fc protein fragment (Li et al., 201 1 Molecular Vision 17:797-803). This antagonist binds to isoforms VEGF-A, VEGF-B and VEGF-C. The molecule is prepared using two different production processes resulting in different glycosylation patterns on the final proteins. The two glycoforms are referred to as KH902 (conbercept) and KH906. The fusion protein can have the following amino acid sequence (SEQ ID NO:2):
MVSYWDTGVLLCALLSCLLLTGSSSGGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRII DSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDWLSPSHGIELSVGE LVLNCTARTELNVGIDFNWEYPSSKHQHKKLWRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSG LMT KNSTFVRVHEKPFVAFGSGMESLVEATVGERVRLPAKYLGYPPPEIKWYKNGIPLESNHTI AGHVL TIMEVSERDTGNYTVILTNPISKEKQSHWSLWYVPPGPGD THTCPLCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEWFNWYVDGVEVHNA TKPREEQYNSTYRWSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NY ATPPVLDSDGSFFLYSKLTVDKSR QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
and, like VEGF-trap, can be present as a dimer. This fusion protein and related molecules are further characterized in EP 1767546.
Other non-antibody VEGF antagonists include antibody mimetics (e.g. Affibody® molecules, affilins, affitins, anticalins, avimers, unitz domain peptides, and monobodies) with VEGF antagonist activity. This includes recombinant binding proteins comprising an ankyrin repeat domain that binds VEGF-A and prevents it from binding to VEGFR-2. One example for such a molecule is DARPin® MP01 12. The ankyrin binding domain may have the following amino acid sequence (SEQ ID NO: 3):
GSDLGKKLLEAARAGQDDEVRILMANGADVNTADSTGWTPLHLAVPWGHLEIVEVLLKYGADVNAKDFQGW TPLHLAAAIGHQEIVEVLLKNGADVNAQD FGKTAFDISIDNGNEDLAEILQKAA
Recombinant binding proteins comprising an ankyrin repeat domain that binds VEGF-A and prevents it from binding to VEGFR-2 are described in more detail in WO2010/060748 and WO2011/135067.
Further specific antibody mimetics with VEGF antagonist activity are the 40 kD pegylated anticalin PRS-050 and the monobody angiocept (CT-322).
The non-antibody VEGF antagonist may be modified to further improve its pharmacokinetic properties or bioavailability. For example, a non-antibody VEGF antagonist may be chemically modified (e.g., pegylated) to extend its in vivo half-life. Alternatively or in addition, it may be modified by glycosylation or the addition of further glycosylation sites not present in the protein sequence of the natural protein from which the VEGF antagonist was derived.
Variants of the above-specified VEGF antagonists that have improved characteristics for the desired application may be produced by the addition or deletion of amino acids. Ordinarily, these amino acid sequence variants will have an amino acid sequence having at least 60% amino acid sequence identity with the amino acid sequences of SEQ ID NO: 1 , SEQ ID NO: 2 or SEQ ID NO: 3, preferably at least 80%, more preferably at least 85%, more preferably at least 90%, and most preferably at least 95%, including for example, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and 100%. Identity or homology with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
Sequence identity can be determined by standard methods that are commonly used to compare the similarity in position of the amino acids of two polypeptides. Using a computer program such as
BLAST or FASTA, two polypeptides are aligned for optimal matching of their respective amino acids (either along the full length of one or both sequences or along a pre-determined portion of one or both sequences). The programs provide a default opening penalty and a default gap penalty, and a scoring matrix such as PAM 250 [a standard scoring matrix; see Dayhoff et al., in Atlas of Protein
Sequence and Structure, vol. 5, supp. 3 ( 1978)] can be used in conjunction with the computer program. For example, the percent identity can then be calculated as: the total number of identical matches multiplied by 100 and then divided by the sum of the length of the longer sequence within the matched span and the number of gaps introduced into the longer sequences in order to align the two sequences.
Non-antibody VEGF antagonists are preferred herein over antibody VEGF antagonists due their different pharmacokinetic profile when administered intravitreally. Preferably, the non-antibody VEGF antagonist of the invention binds to VEGF via one or more protein domain(s) that are not derived from the antigen-binding domain of an antibody. The non-antibody VEGF antagonist of the invention are preferably proteinaceous, but may include modifications that are non-proteinaceous (e.g., pegylation, glycosylation).
Patient
In one aspect of the invention, non-antibody VEGF antagonists are particularly useful for treating patients with ocular vascular proliferative diseases. A hallmark of ocular vascular proliferative diseases is the undesired proliferation of new blood vessels, often in places that are normally not vascularized, such as the cornea or iris. The proliferation of new blood vessels may be triggered by insufficient oxygen supply to the retina or cornea. Low oxygen conditions directly induce expression of VEGF and thus stimulate neovascularization.
The proliferation of new blood vessels in the retina, the iris, the intertrabecular spaces and the cornea leads to a variety of more or less distinct conditions such as proliferative diabetic retinopathy, venous occlusive disease (most commonly due to branch or central retinal vein occlusion), rubeosis iridis, and corneal neovascularization. Neovascular glaucoma may develop as a late complication of ischemic retinopathies such as diabetic retinopathy or central retinal vein occlusion. Corneal neovascularization may occur secondarily to infection or inflammation in the eye, trauma to the eye (including chemical burns), or loss of the limbal stem cell barrier. For example, patients suffering from herpetic keratitis, trachoma or onchocerciasis typically also suffer from corneal neovascularization. Wearers of contact lenses are at an increased risk of developing corneal neovascularization. Extended use of contact lenses (e.g. more than 12 hours per day) may lead to hypoxia and irritation of the eye triggering corneal inflammation. Contact lens contamination can also cause corneal inflammation. Choroidal haemangioma, a type of benign vascular tumour, can also be associated with the proliferation of new blood vessels.
Patients with any of the conditions mentioned in the previous paragraph will benefit from the use of non-antibody antagonist.
A patient's medical history is usually used to determine the underlying cause for the development of ocular vascular proliferative diseases. The medical history as well as previous treatments may inform specific treatment options, in particular for combination treatments.
For example, patients having received one or more rounds of laser treatment may particularly benefit from the non-antibody VEGF antagonist therapy of the present invention. Combining non-antibody VEGF antagonist therapy with laser therapy may reduce the total treatment time as well as adverse effects that are often observed with laser therapy alone.
For patients in whom the ocular vascular proliferative disease is triggered by an inflammatory response, combination therapy with an anti-inflammatory agent can be considered. For example, the combined use of steroids and non-antibody VEGF antagonist therapy to reduce inflammation and prevent formation of new blood vessels, respectively, may be particularly advantageous in patients with corneal neovascularization. Patients who suffer from corneal neovascularization secondary to bacterial, viral, fungal or acanthamoebal infection may benefit from non-antibody VEGF antagonist therapy in combination with an antimicrobial agent and optionally an anti-inflammatory agent.
Patients with corneal stromal blood vessels due to corneal neovascularization are at a significant risk for immune rejection after corneal transplantation. Use of non-antibody VEGF antagonist therapy prior to (and optionally also subsequent to) corneal transplantation therefore may be particularly beneficial to patients with corneal stromal blood vessels as successful reduction of corneal vascularization will reduce the risk of graft rejection.
Patients who would require multiple intravitreal injections (e.g., more than 3 injections, preferably more than 6 injections) of a VEGF antagonist other than the non-antibody VEGF antagonist of the invention to manage their ocular vascular proliferative diseases will benefit in particular from the non-antibody therapies of the invention.
Administration
The non-antibody VEGF antagonist of the invention will generally be administered to the patient via intravitreal injection, though other routes of administration may be used, such as a slow-release depot, an ocular plug/reservoir or eye drops. Administration in aqueous form is usual, with a typical volume of 20-150μ1 e.g. 40-60μ1, or 50μ1. Injection can be via a 30-gauge x ½-inch (12.7 mm) needle. For example, aflibercept is generally administered via intravitreal injection at a dose of 2 mg (suspended in 0.05 mL buffer comprising 40 mg/mL in 10 mM sodium phosphate, 40 mM sodium chloride, 0.03% polysorbate 20, and 5% sucrose, pFI 6.2). However, the normal dose may be reduced for the treatment of smaller children and in particular infants. The dose for treating an infant with a VEGF antagonist of the invention is usually 50% of the dose administered to an adult. Smaller doses (e.g., 0.5 mg per monthly injection) may also be used. Patients suffering from corneal neovascularization may particularly benefit from topical administration of the non-antibody VEGF antagonist in form of eye drops. Further preferred modes of administration for patients with corneal neovascularization are subconjunctival injection or intracorneal injection.
Alternatively, an intravitreal device is used to continuously deliver a non-antibody VEGF antagonist into the eye over a period of several months before needing to be refilled by injection. Various intravitreal delivery systems are known in the art. These delivery systems may be active or passive.
For example, WO2010/088548 describes a delivery system having a rigid body using passive diffusion to deliver a therapeutic agent. WO2002/100318 discloses a delivery system having a flexible body that allows active administration via a pressure differential. Alternatively, active delivery can be achieved by implantable miniature pumps. An example for an intravitreal delivery system using a miniature pump to deliver a therapeutic agent is the Ophthalmic MicroPump System™ marketed by Replenish, Inc. which can be programmed to deliver a set amount of a therapeutic agent for a pre-determined number of times.
The non-antibody VEGF antagonist is typically encased in a small capsule-like container (e.g., a silicone elastomer cup).The container is usually implanted in the eye above the iris. The container comprises a release opening. Release of the non-antibody VEGF antagonist may be controlled by a membrane positioned between the non-antibody VEGF antagonist and the opening, or by means of a miniature pump connected to the container. Alternatively, the non-antibody VEGF antagonist may be deposited in a slow-release matrix that prevents rapid diffusion of the antagonist out of the container.
Preferably, the intravitreal device is designed to release the non-antibody VEGF antagonist at an initial rate that is higher in the first month. The release rate slowly decreases, e.g., over the course of the first month after implantation, to a rate that is about 50% less than the initial rate. The container may have a size that is sufficient to hold a supply of the non-antibody VEGF antagonist that lasts for about four to six months. Since a reduced dose of VEGF antagonist may be sufficient for effective treatment when administration is continuous, the supply in the container may last for one year or longer, preferably about two years, more preferably about three years.
Because only a small surgery is required to implant a delivery system and intravitreal injections are avoided, patient compliance issues with repeated intravitreal injections can be avoided. Intravitreal concentrations of the non-antibody VEGF antagonist are reduced, and therefore the potential risk of side-effects from non-antibody VEGF antagonist entering the circulation is decreased. This aspect may be of a particular advantage in children who may require general anaesthesia for intravitreal injections. Systemically elevated non-antibody VEGF antagonist levels may interfere with normal growth and development of children who therefore may benefit from lower intravitreal concentrations of the non-antibody VEGF antagonist.
In one aspect of the invention, the non-antibody VEGF antagonist is provided in a pre-filled sterile syringe ready for administration. Preferably, the syringe has low silicone content. More preferably, the syringe is silicone free. The syringe may be made of glass. Using a pre-filled syringe for delivery has the advantage that any contamination of the sterile antagonist solution prior to administration can be avoided. Pre-filled syringes also provide easier handling for the administering ophthalmologist.
Slow-release formulations
Non-antibody VEGF antagonist may be provided as slow-release formulations. Slow-release formulations are typically obtained by mixing a therapeutic agent with a biodegradable polymer or
encapsulating it into microparticles. By varying the manufacture conditions of polymer-based delivery compositions, the release kinetic properties of the resulting compositions can be modulated.
A slow-release formulation in accordance with the invention typically comprises a non-antibody VEGF antagonist, a polymeric carrier, and a release modifier for modifying a release rate of the non- antibody VEGF antagonist from the polymeric carrier. The polymeric carrier usually comprises one or more biodegradable polymers or co-polymers or combinations thereof. For example, the polymeric carrier may be selected from poly-lactic acid (PLA), poly-glycolic acid (PGA), poly- lactide-co-glycolide (PLGA), polyesters, poly (orthoester), poly(phosphazine), poly (phosphate ester), polycaprolactones, or a combination thereof. A preferred polymeric carrier is PLGA. The release modifier is typically a long chain fatty alcohol, preferably comprising from 10 to 40 carbon atoms. Commonly used release modifiers include capryl alcohol, pelargonic alcohol, capric alcohol, lauryl alcohol, myristyl alcohol, cetyl alcohol, palmitoleyl alcohol, stearyl alcohol, isostearyl alcohol, elaidyl alcohol, oleyl alcohol, linoleyl alcohol, polyunsaturated elaidolinoleyl alcohol, polyunsaturated linolenyl alcohol, elaidolinolenyl alcohol, polyunsaturated ricinoleyl alcohol, arachidyl alcohol, behenyl alcohol, erucyl alcohol, lignoceryl alcohol, ceryl alcohol, montanyl alcohol, cluytyl alcohol, myricyl alcohol, melissyl alcohol, and geddyl alcohol.
Preferably, the non-antibody VEGF antagonist is incorporated into a microsphere-based sustained release composition. The microspheres are preferably prepared from PLGA. The amount of non- antibody VEGF antagonist incorporated in the microspheres and the release rate of the non-antibody VEGF antagonist can be controlled by varying the conditions used for preparing the microspheres. Processes for producing such slow-release formulations are described in US 2005/0281861 and US 2008/0107694.
Treatment Regimens
In comparison to antibody VEGF antagonists, non-antibody VEGF antagonists of the invention allow increased spacing between administrations resulting in a more cost-effective therapy. In addition, better patient compliance is achieved when intravitreal injections have to be performed less frequently. This is particularly advantageous in patients suffering from ocular vascular proliferative diseases who may require multiple injections to improve visual acuity or prevent vision loss.
In some cases, a single injection of the VEGF antagonist according to the invention may be sufficient to ameliorate the disease or prevent disease progression for many years. In other cases, three injections each one month apart are administered to the patient, while any subsequent injections are performed less frequently or on an as-needed basis, in certain cases, two injections spaced 6 weeks apart, preferably 8 weeks apart, more preferably 10 weeks apart may be required to improve visual acuity or halt disease progression. In other cases, three or more injections may be needed. In these cases, the time between injections should be at least 6 weeks, preferably 8 weeks, more preferably 10 weeks apart. Treatment may be continued until maximum visual acuity is achieved. For example, treatment may be discontinued when visual acuity is stable for at least three months (i.e., no increase or decrease in visual acuity is observed during this period).
Some treatment regimens may include an extended loading period in which the patient receives five or six intravitreal injections of the VEGF antagonist. Each injection is administered at least 4 weeks apart (e.g. one month apart). After the loading period, injections can be continued every 4 weeks or every month, but more typically they will be administered less frequently, e.g. every 8 weeks or every two months.
Disease progression or recurrence of an ocular vascular proliferative disease may require one or more or continued treatment cycles. For example, in a first cycle, two injections spaced 6 weeks, preferably 8 weeks, more preferably 10 weeks apart may be administered followed by an interruption of treatment for 3 months, 4 months, 5 months, 6 months, 9 months, 12 months, 24 months or 36 months. If the ocular vascular proliferative disease reappears, the treatment is continued with a second cycle. In some cases three, four, five or more treatment cycles may be needed. For example, a further treatment cycle may be initiated if worsening of visual acuity is observed (e.g., by monthly checking a patient's vision after treatment has been discontinued).
In another aspect of the invention, the non-antibody VEGF antagonist according to the invention is administered as needed. The non-antibody VEGF antagonist is administered the first time after an initial diagnosis of ocular vascular proliferative diseases has been made. A diagnosis of an ocular vascular proliferative disease can be made during examination of the eye by a combination of slit- lamp evaluation and biomicroscopic fundus examination with optical coherence tomography (OCT) and/or fluorescein fundus angiography. A second, third or further administration of the non-antibody VEGF antagonist is performed only if examination of the eye reveals signs of persistent or recurring ocular vascular proliferative disease. Typically, best-corrected visual acuity (BCVA) letter score is recorded at baseline and each subsequent visit. Treatment may be continued or resumed if the patient has lost more than five letters of BCVA from baseline. Other retreatment criteria may include (i) an increase in central retinal thickness from the lowest central retinal thickness measurement as confirmed by OCT; (ii) the presence of new subretinal or intraretinal blood, or an increase of subretinal or intraretinal blood in comparison to the last visit; and/or (iii) additional neovascularisation as confirmed by fluorescein angiography.
Combination therapy
The compounds of the invention may be used in combination with one or more additional treatment. In one aspect of the invention, treatment with a VEGF antagonist of the invention may be performed in combination with laser photocoagulation therapy (LPT) and photodynamic therapy (PDT). Laser treatment in some cases can itself lead to choroidal neovascularization. Laser therapy including LPT or PDT preferably should not be used in patients who previously responded with choroidal neovascularization to laser therapy.
LPT uses laser light to cause controlled damage of the retina to produce a beneficial therapeutic effect. Small bursts of laser light can seal leaky blood vessels, destroy abnormal blood vessels, seal retinal tears, or destroy abnormal tissue in the back of the eye. It is quick, non-invasive, and usually
requires no anaesthesia other than an anaesthetic eye drop. LPT techniques and apparatuses are readily available to ophthalmologists (see Lock et al. (2010) Med J Malaysia 65:88-94).
LPT techniques can be classified as focal, panretinal (or scatter), or grid. Focal LPT applies small- sized burns to specific areas of focal leakage (microaneurysms) in the macula. Panretinal LPT scatters burns throughout the peripheral fundus. Grid LPT applies a pattern of burns to macular areas arising from diffuse capillary leakage or non-perfusion, with each burn typically spaced apart by two visible burn widths. Patients can receive more than one type of LPT (e.g. a combination of focal and panretinal LPT) and these may be administered one directly after the other, or after a delay. A useful panretinal LPT involves 1200-1600 burns.
Laser spot sizes (spot diameters) of 50-500μπι are typical (smaller spot sizes are more usual for focal LPT, larger for panretinal), applied for 50-200ms (continuously, or via micropulses), using green-to- yellow wavelengths e.g. using an argon gas (514.5nm) laser, a frequency-doubled Nd-YAG (532nm) laser, a krypton yellow laser (568.2nm), or a tunable dye laser (variable wavelength). In some cases a red laser may be used if a green or yellow laser is precluded {e.g. if vitreous hemorrhage is present). Micropulse laser therapy (MLP) uses 810 nm or 577 nm lasers to direct a discontinuous beam of laser light on the affected tissue (Kiire et al. (2011) Retina Today, 67-70). This results in a greater degree of control over the photothermal effects in laser photocoagulation. The steady continuous- wave emission of conventional LPT is delivered in the form of short laser pulses. Each pulse typically is 100-300 ps in length with a 1700 to 1900 ps interval between each pulse. The "width" ("ON" time) of each pulse and the interval between pulses ("OFF" time) are adjustable by the surgeon. A shorter micropulse "width" limits the time for the laser-induced heat to spread to adjacent tissue. A longer interval between pulses allows cooling to take place before the next pulse is delivered. Intraretinal damage thus can be avoided. Hence MLP is also referred to as "sub-threshold laser treatment" or "tissue-sparing laser therapy". 10-25% of micropulse power is sufficient to show a consistent photothermal effect that is confined to the retinal pigment epithelium and does not affect the neurosensory retina.
In one aspect of the invention, patients receive both LPT and a non-antibody VEGF antagonist. The administration of LPT and of non-antibody VEGF antagonist administration occur within 12 months of each other, preferably within six months of each other, and , ideally occur within one month or less of each other (e.g. within 10 days). The administration of LPT and non-antibody VEGF antagonist may occur on the same day.
Typically, non-antibody VEGF antagonist therapy is administered prior to LPT. LPT can take place promptly after non-antibody VEGF antagonist administration (e.g. within 2-20 days, typically within 3-10 days), or can take place after a longer delay (e.g. after at least three weeks, after at least four weeks, after at least eight weeks, after at least 12 weeks, or after at least 24 weeks). For example, treatment with non-antibody VEGF antagonist may be initiated at least 1 week, 2 weeks, 3 weeks, 4 weeks, 2 months, 3 months, 4 months, 5 months or 6 months before LPT. The non-antibody VEGF
antagonist may be administered every 4 weeks, every 6 weeks, or every 8 weeks. Treatment may be continued at the same interval or extended intervals after LPT. Where the interval is extended, the period between administration of the non-antibody VEGF antagonist may increase by 50% or 100%. For example, if the initial interval was 4 weeks, the interval may be extended to 6 or 8 weeks. If a patient receives LPT more than 12 weeks after receiving the non-antibody VEGF antagonist, their eye(s) might no longer contain detectable levels of the non-antibody VEGF antagonist.
Alternatively, non-antibody VEGF antagonist therapy may be administered after LPT. For instance, the non-antibody VEGF antagonist is administered to the patient within 1-2 hours after LPT, typically within 60 minutes after completion of the first LPT session. The non-antibody VEGF antagonist may subsequently be administered every 4 weeks, every 6 weeks, every 8 weeks, every 12 weeks or preferably every 16 weeks.
Some embodiments involve more than one administration of LPT and/or of non-antibody VEGF antagonist. For instance, in one useful embodiment a patient receives in series (i) non-antibody VEGF antagonist (ii) at least one administration of LPT (iii) non-antibody VEGF antagonist. For example, the patient may receive an initial intravitreal injection of non-antibody VEGF antagonist; then, within 3- 10 days of receiving the non-antibody VEGF antagonist, they receive focal photocoagulation; then, either on the same day as the focal photocoagulation, or later, but to be initiated within 14 days of receiving the non-antibody VEGF antagonist, they receive at least one sitting (e.g. up to three) of panretinal photocoagulation (if administered in more than one sitting, the panretinal photocoagulation should be completed within two to four weeks of receiving the non- antibody VEGF antagonist); and then, four weeks or a month after the initial injection, they receive a second injection of the non-antibody VEGF antagonist. This regimen may be continued with further doses of the non-antibody VEGF antagonist e.g. with a frequency of every one or two months. Preferably, administration of the non-antibody VEGF antagonist is every four weeks (monthly) for the first three months. Afterwards administration of the non-antibody VEGF antagonist is once every eight weeks.
Alternatively, a patient receives in series (i) an administration of LPT and (ii) at least one administration of a non-antibody VEGF antagonist. The patient may receive an initial intravitreal injection of non-antibody VEGF antagonist within 1 or 2 hours after panretinal photocoagulation therapy. Four to sixteen weeks later, intravitreal injection of non-antibody VEGF antagonist is repeated. In some instances, one or more additional injections are performed only if new vessel formation continues. The need for additional injections will be reassessed after an additional period of 4-16 weeks since the last injection. For example, a patient receives panretinal photocoagulation therapy and, within approximately 60 minutes of receiving the laser treatment, is administered a first intravitreal injection of a non-antibody VEGF antagonist in the treated eye. At weeks 16 and 32 after the first injection, a second injection and a third injection, respectively, are administered, if new vessels are detected, e.g. by clinical assessment, colour photography, fluorescein angiography or on gonioscopy, during follow-up examinations.
In another, preferred aspect of the invention, the non-antibody VEGF antagonist according to the invention is administered as needed. For example, after completion of the first LPT session, the treated eye may be re-evaluated by a combination of slit-lamp evaluation and biomicroscopic fundus examination with optical coherence tomography (OCT) and/or fluorescein fundus angiography. Re- evaluation may take place at 4 weeks, 6 weeks, 8 weeks, 12 weeks or 1 weeks after the first LPT session. Subsequent follow-up visits may take place at 4 weeks, 6 weeks, 8 weeks, 12 weeks or 16 weeks after the first re-evaluation. A second, third or further administration of the non-antibody VEGF antagonist is performed only if examination of the eye reveals signs of persistent or recurring neovascularizat ion.
Laser-induced tissue damage can stimulate the release of pro-angiogenic factors. Combination therapy of a non-antibody VEGF antagonist and LPT is particularly suitable to treat high-risk proliferative diabetic retinopathy. It is also suitable for treating corneal neovascularization and may reduce complications such as corneal haemorrhage, corneal thinning, iris atrophy and necrotizing scleritis.
PDT uses a light-activated molecule to cause localised damage to neovascular endothelium, resulting in vessel occlusion. Light is delivered to the retina as a single circular spot via a fiber optic cable and a slit lamp, using a suitable ophthalmic magnification lens (laser treatment). The light-activated compound is injected into the circulation prior to the laser treatment, and damage is inflicted by photoactivation of the compound in the area afflicted by neovascularization. One commonly used light-activated compound is verteporfm (Visudyne®). Verteporfm is transported in the plasma primarily by lipoproteins. Once verteporfm is activated by light in the presence of oxygen, highly reactive, short-lived singlet oxygen and reactive oxygen radicals are generated which damages the endothelium surrounding blood vessels. Damaged endothelium is known to release procoagulant and vasoactive factors through the lipo-oxygenase (leukotriene) and cyclooxygenase (eicosanoids such as thromboxane) pathways, resulting in platelet aggregation, fibrin clot formation and vasoconstriction. Verteporfm appears to somewhat preferentially accumulate in neovasculature. The wavelength of the laser used for photoactivation of the light-activated compound may vary depending on the specific light-activated compound used. For example, 689 nm wavelength laser light delivery to the patient 15 minutes after the start of the 10-minute infusion with verteporfm may be used. Photoactivation is controlled by the total light dose delivered. Using verteporfm in the treatment of choroidal neovascularization by PDT, the recommended light dose is 50 J/cm2 of neovascular lesion administered at an intensity of 600 mW/cm2 over 83 seconds. Light dose, light intensity, ophthalmic lens magnification factor and zoom lens setting are important parameters for the appropriate delivery of light to the predetermined treatment spot during PDT and may need to be adapted depending on the laser system used for therapy.
Administration of the non-antibody VEGF antagonist is performed before or after photodynamic therapy. Typically, administration of the non-antibody VEGF antagonist and PDT will be performed on the same day (e.g. within 24 hours of one another). In one embodiment, treatment with non-
antibody antagonist is started up to 48 hours before photodynamic therapy. Alternatively, treatment with non-antibody VEGF antagonist is initiated at least 1 week, 2, weeks, 3 weeks, 4 weeks, 2 months, 3 months, 4 months, 5 months or 6 months before PDT. The non-antibody VEGF antagonist may be administered every 4 weeks, every 6 weeks, or every 8 weeks. Treatment may be continued at the same interval or extended intervals after PDT. Where the interval is extended, the period between administration of the non-antibody VEGF antagonist may increase by 50% or 100%. For example, if the initial interval was 4 weeks, the interval may be extended to 6 or 8 weeks. Alternatively, non-antibody VEGF antagonist administration may be continuous, for example, if an intravitreal delivery system is used. The intravitreal device may be implanted prior to PDT. Alternatively, a single administration of non-antibody VEGF antagonist shortly before or after PDT may be sufficient to achieve the desired effect. For example, a single dose of non-antibody VEGF antagonist may be given on the day of the PDT.
PDT may be repeated as needed. Generally, it is not given more frequently than every 3 months. PDT may be repeated every 3 months. For example, treatment may be continued until there has been complete regression of polyps in the treated eye(s). Alternatively, PDT may be repeated less frequently, in particular if the non-antibody VEGF antagonist treatment is continued after PDT. For example, intervals between PDT may be extended to every 4 months, every 5 months, or every 6 months. Ideally, continued treatment with a non-antibody VEGF antagonist after PDT prevents recurrence of the ocular vascular proliferative disease.
Combining PDT with non-antibody VEGF antagonist therapy is particularly useful in treating choroidal haemangioma as the combined use of both therapies may increase treatment efficacy and, at the same time, decrease undesired collateral vessel development.
In a further aspect of the invention, treatment time and patient compliance is improved by using a non-antibody VEGF antagonist in combination with an anti-inflammatory agent. Administering the VEGF antagonist in combination with an anti-inflammatory agent can have synergistic effects depending on the underlying cause of neovascularization. Addition of an anti-inflammatory agent is particularly advantageous in corneal neovascularization secondary to an inflammatory disease or condition. Anti-inflammatory agents include steroids and NSAIDs. NSAIDs used in the treatment of ocular diseases include ketorolac, nepafenac and diclofenac. In some instances, the use of diclofenac is preferred. Corticosteroids used in treating ocular diseases include dexamethasone, prednisolone, fluorometholone and fluocinolone. Other steroids or derivatives thereof that may be used in combination with VEGF antagonist treatment include anecortave, which has angiostatic effects but acts by a different mechanism than the VEGF antagonists according to the invention. A preferred anti-inflammatory agent is triamcinolone. The anti-inflammatory agent may also be a TNF-a antagonist. For example, a TNF-a antibody may be administered in combination with a non-antibody VEGF antagonist. TNF-a antibodies, e.g. those sold under the trade names Humira®, Remicade®, Simponi® and Cimzia®, are well known in the art. Alternatively, a TNF-a non-antibody antagonist such as Enbrel® may be administered in combination with a non-antibody VEGF antagonist.
The anti-inflammatory agent may be administered at the same time as the non-antibody VEGF antagonist. The anti-inflammatory agent can be administered either systemically or locally. For example, the anti-inflammatory agent may be administered orally, topically, or, preferably, intravitreally. In a preferred embodiment, triamcinolone is administered intravitreally at the same time as the non-antibody VEGF antagonist of the invention.
In yet another aspect of the invention, the non-antibody VEGF antagonist is administered after administration of an antimicrobial agent. For example, the antimicrobial agent may be selected from azithromycin, gatifloxacin, ciprofloxacin, ofloxacin, norfloxacin, polymixin B + chloramphenicol, chloramphenicol, gentamicin, fluconazole, sulfacetamide, tobramycin, neomycin + polymixin B, and netilmicin. Azithromycin is typically used to treat patients suffering from trachoma. Alternatively, the antimicrobial agent may be selected from pyrimethamine, sulfadiazine and folinic acid or a combination thereof. Combination with pyrimethamine can be particularly advantageous in treating patients with neovascularization associated with toxoplasmosis. In some instances, combination treatment with broad-spectrum antiparasitic avermectin medicines such as ivermectin may be beneficial (e.g., in patients suffering from onchocerciasis). Patients suffering from herpes simplex virus-induced keratitis will benefit from combining antiviral treatment either in the form of topical therapy with trifluridine or oral administration of acyclovir or valacyclovir with non-antibody VEGF antagonist therapy.
General
The term "comprising" encompasses "including" as well as "consisting" e.g. a composition "comprising" X may consist exclusively of X or may include something additional e.g. X + Y.
The term "about" in relation to a numerical value x is optional and means, for example, x±\Q%,
MODES FOR CARRYING OUT THE INVENTION
Comparative example 1
A total of 397 patients were enrolled in a clinical study to assess the efficacy and safety of intraocular injections of 0.3 mg or 0.5 mg ranibizumab in patients with macular edema following branch retinal vein occlusion (BRVO). Eligible patients were randomized 1 : 1 : 1 to receive monthly intraocular injections of 0.3 mg or 0.5 mg of ranibizumab or sham injections.
The primary efficacy outcome measure was mean change from baseline best-corrected visual acuity (BCVA) letter score at month 6. Secondary outcomes included other parameters of visual function and central foveal thickness.
Intraocular injections of 0.3 mg or 0.5 mg ranibizumab provided rapid, effective treatment for macular edema following BRVO with low rates of ocular and nonocular safety events. Mean (95% confidence interval [CI]) change from baseline BCVA letter score at month 6 was 16.6 (14.7-18.5) and 18.3 ( 16.0-20.6) in the 0.3 mg and 0.5 mg ranibizumab groups and 7.3 (5.1 -9.5) in the sham group (PO.0001 for each ranibizumab group vs. sham). The percentage of patients who gained > 15 letters in BCVA at month 6 was 55.2% (0.3 mg) and 61 .1 % (0.5 mg) in the ranibizumab groups and
28.8% in the sham group (P<0.0001 for each ranibizumab group vs. sham). At month 6, significantly more ranibizumab-treated patients (0.3 mg, 67.9%; 0.5 mg, 64.9%) had BCVA of >20/40 compared with sham patients (41 .7%; PO.0001 for each ranibizumab group vs. sham). At the same time point, central foveal thickness had decreased by a mean of 337 μιη (0.3 mg) and 345 μιτι (0.5 mg) in the ranibizumab groups and 158 μηι in the sham group (PO.0001 for each ranibizumab group vs. sham). The median percent reduction in excess foveal thickness at month 6 was 97.0% and 97.6% in 0.3 mg and 0.5 mg groups and 27.9% in the sham group. More patients in the sham group (54.5%) received rescue grid laser compared with the 0.3 mg ( 18.7%) and 0.5 mg ( 19.8%) ranibizumab groups.
Comparative example 2
Forty patients were enrolled in a clinical study. Only patients with high-risk proliferative retinopathy without prior laser treatment or vitrectomy were included in the study. Patients were randomly assigned to receive panretinal photocoagulation (PRP) or PRP plus intravitreal VEGF antagonist therapy. PRP was administered in two sessions (weeks 0 and 2). Six to eight hundred 500-μπι spots were performed per session. Intravitreal ranibizumab was administered at the end of the first laser session in the group receiving intravitreal VEGF antagonist therapy. At weeks 16 and 32, patients were re-evaluated. If active new vessels were detected by fluorescein angiography, the eye was retreated. Patients in the PRP/ VEGF antagonist group received intravitreal ranibizumab. Patients in the PRP group received 500-μιη additional spots per quadrant of active new vessels.
Best-corrected visual acuity (BCVA) was determined according to the methods used in the Early Treatment Diabetic Retinopathy Study (ETDRS). Fluorescein angiography was employed to measure fluorescein leakage (FLA). Optical coherence tomography (OCT) was used to assess central subfield macular thickness (CSMT).
Twenty-nine of 40 patients initially enrolled in the study completed the 48-week follow-up evaluation. At baseline, mean ± SE FLA (mm2) was 9.0 ± 1.3 and 1 1.7 ± 1.3 (p = 0.1502); BCVA (logMAR) was 0.3 1 ± 0.05 and 0.27 ± 0.06 (p = 0.6645); and CSMT (μιη) was 216.3 ± 10.7 and 249.4 ± 36.1 (p = 0.3925), in the PRP group and PRP/VEGF antagonist group, respectively. There was a significant (p < 0.05) FLA reduction at all study visits in both groups. The reduction observed in the PRP/VEGF antagonist group was significantly larger than that in the PRP group at week 48 (PRP = 2.9 ± 1.3 mm2; PRP/VEGF antagonist group = 5.8 ± 1.3 mm2; p = 0.0291). Worsening of BCVA was observed at 16, 32 and 48 weeks after treatment in the PRP group (p < 0.05), while no significant BCVA changes were observed in the PRP/VEGF antagonist group. A significant CSMT increase was observed in the PRP group at all study visits. In contrast, a significant decrease in CSMT was observed in the PRP/VEGF antagonist group at week 16, and no significant difference in CSMT from baseline was observed at weeks 32 and 48. Example 3
The inhibitiory effect of subconjunctival injection of KH902 on corneal neovascularization in a rat model was tested. Corneal neovascularization was induced by alkaline burn. The rats were randomly divided into four groups: ( 1 ) group 1 received a subconjunctival injection of H902 (30 mg/mL); (2)
group 2 received a subconjunctival injection of dexamethasone (1 mg/mL); (3) group 3 received a subconjunctival injection of the solvent used to inject KH902 in group 1 ; (4) group 4 received a subconjunctival injection of saline, which was used as the solvent for dexamethasone in group 2.
At the 28th day after the treatments, the area of corneal neovascularization and the average optical density value of VEGF immunohistochemical staining in the four groups were measured.
On the 28th day after molding, the area of corneal neovascularization was significantly smaller in group 1 than in groups 2-4 (P < 0.05 or P < 0.01 ). VEGF expression levels were also significantly lower in group 1 than in groups 2-4 (P < 0.01). Hence subconjunctival injection of H902 is more effective than dexamethasone in inhibiting corneal neovascularization in a rat alkaline burn model. Example 4
Twenty patients are enrolled in an open-label pilot study to assess the use of 2.0 mg intravitreally administered aflibercept in the treatment of proliferative diabetic retinopathy. All patients present with active proliferative retinopathy at the time of enrolment. Patients are randomised into two groups.
After an initial loading period, the first group receives intravitreal aflibercept every four weeks, while the second group receives intravitreal aflibercept every eight weeks. During the loading period, patients in both groups receive five intravitreal injections of aflibercept beginning at day 1, and then at weeks 4, 8, 12, and 16. Following the five initial injections, patients in the first group will continue to receive aflibercept intravitreally every 4 weeks, beginning at week 20, through week 48, while patients in the second group will receive aflibercept intravitreally every 8 weeks, beginning week 24, through week 48.
Patients in both arms will be followed up every 4 weeks until week 52. The primary endpoint of the study will be at week 52 and will assess the incidence and severity of adverse events of intravitreal aflibercept injection in the treatment of proliferative diabetic retinopathy.
Secondary outcome measures are (i) the mean change in the area of fluorescein leakage in mm2 (area of neovascularisation) compared to baseline; (ii) proportion of patients with complete regression of neovascularisation; (iii) the mean change in ETDRS BCVA from baseline; (iv) the proportion of subjects gaining > 5 letters, > 10 letters and > 15 letters from baseline; (v) the proportion of subjects losing > 5 letters from baseline; (vi) the mean change in retinal thickness from baseline as demonstrated by OCT imaging; (vii) the proportion of subjects without vitreous hemorrhage or pre- retinal haemorrhage; (viii) the proportion of subjects with complete avoidance of panretinal laser photocoagulation (PRP)/additional PRP; and (ix) the proportion of subjects with avoidance of vitrectomy.
Example 5
Twenty patients are enrolled in an open-label pilot study to assess the use of 2.0 mg (0.05 ml) intravitreally administered aflibercept in the treatment of neovascular glaucoma (NVG). Patients are
randomised into two groups. Patients in the first group will receive a single, intravitreal injection of aflibercept injection at baseline followed by standard of care (PRP). Patients in the second group will receive three intravitreal aflibercept injection (one at baseline followed by two additional injections at 4 weeks and 8 weeks). Additional injections will be spaced every 8 weeks apart. Both groups will be treated for a total of 52 weeks.
The primary endpoint of the study will be an assessment of the safety profile of repeated intravitreal aflibercept injections in patients with NVG by evaluating the incidence and severity of adverse events. Secondary outcome measures are (i) the rate and extent of resolution of neovasculariaation; (ii) the mean change in intraocular pressure (IOP); (iii) the proportion of patients losing > 5 letters on visual acuity; (iv) the proportion of patients gaining > 5 letters on visual acuity; (v) the mean change in visual acuity; (vi) the visual field; (vii) the average retinal nerve fiber layer and central macular thickness; (viii) the need for additional IOP lowering medications; and (ix) the need for surgical intervention in both arms during the 52-week period.
Example 6
Twenty-four patients are enrolled in an open-label study evaluating the impact of repeat intravitreal injections of aflibercept on capillary non-perfusion in patients with proliferative retinopathy and/or macular edema secondary to proliferative diabetic retinopathy and central retinal venous occlusive disease. Patients are randomised into two groups. Patients in the first group will receive intravitreal aflibercept injections every month for the 12 month duration of the study. Patients in the second group will receive intravitreal aflibercept injections every month for the first 6 months, then every other month for the next 6 months. Retreatment criteria will allow for patients to be treated every month in the second 6 months if needed. Primary outcome measures include the mean change in capillary non-perfusion as assessed by the presence and amount of capillary non-perfusion measured by wide-angle angiography at baseline, month 3, month 6, and month 12.
Example 7
Ten patients with corneal neovascularization in one or more quadrants crossing more than 0.5 mm over the limbus at the time of corneal transplantation are enrolled in a phase 1 , prospective, randomised, open-label clinical trial. Patients are randomised into two groups. Patients in the first group will receive 2mg (0.05mL) aflibercept via subconjunctival injection in addition to standard of care treatment (steroids and cyclosporine). Patients will receive one injection four weeks (+/- 1 week) prior to transplantation. They will receive a second injection at the conclusion of corneal transplantation. Patients may receive as-needed repeat injections (minimum of 30 days in between treatments) for recurrence of corneal neovascularization (defined as >1.0 mm crossing onto the cornea, past the limbus, or extension of vessels beyond previously documented extent) during the follow-up period. Patients in the first group will receive standard of care (steroids and cyclosporine) treatment only. The primary endpoint in this study is safety as defined by incidence and severity of adverse events in patients with corneal neovascularization undergoing corneal transplant.
It will be understood that the invention is described above by way of example only and modifications may be made whilst remaining within the scope and spirit of the invention.
Claims
1. A method for treating a patient having an ocular vascular proliferative disease, comprising administering to the patient a non-antibody VEGF antagonist.
2. The method of claim 1 , wherein the patient suffers from proliferative diabetic retinopathy, venous occlusive disease, rubeosis iridis, corneal neovascularization, or neovascular glaucoma.
3. The method of claim 2, wherein corneal neovascularization is secondary to an inflammatory condition.
4. The method of claim 3, wherein the inflammatory condition is triggered by an infectious agent,
5. The method of claim 3, wherein the inflammatory condition is herpetic keratitis, trachoma or onchocerciasis.
6. The method of claim 2, wherein corneal neovascularization is secondary to contact lens use.
7. The method of claim 1, wherein the non-antibody VEGF antagonist is administered prior to corneal transplantation.
8. The method of any one of claims 3-7, wherein the non-antibody VEGF antagonist is administered in the form of eye drops.
9. The method of claim 1 further comprising administering to the patient an anti-inflammatory agent.
10. The method of claim 1 further comprising administering to the patient in combination with an antimicrobial, an antiviral or an anthelmintic agent.
1 1. The method of claim 2, wherein venous occlusive disease is due to branch retinal vein occlusion or central retinal vein occlusion.
12. The method of claim 2, wherein the patient suffers from proliferative diabetic retinopathy and the non-antibody VEGF antagonist is administered in combination with laser photocoagulation therapy.
13. The method of claim 12, wherein the non-antibody VEGF antagonist is administered prior to laser photocoagulation therapy.
14. The method of any one of the preceding claims, wherein the non-antibody antagonist is selected from a recombinant human soluble VEGF receptor fusion protein and a recombinant binding protein comprising an ankyrin repeat domain that binds VEGF-A.
15. The method of any one of the preceding claims, wherein the patient has received more than three injections of a VEGF antagonist other than the non-antibody VEGF antagonist of claim 14.
16. The method of claim 15, wherein both the non-antibody VEGF antagonist and the antiinflammatory compound are administered intravitreally.
17. The method of any one of the preceding claims, wherein the non-antibody VEGF antagonist is administered every 6 weeks, every 8 weeks or every 10 weeks.
18. The method of any one of the preceding claims, wherein the non-antibody VEGF antagonist is administered continuously.
1 . The method of any one of the preceding claims, wherein a first dose of the non-antibody VEGF antagonist is administered after the initial diagnosis of the ocular vascular proliferative disease and wherein a second dose of the non-antibody VEGF antagonist is administered only if the ocular vascular proliferative disease persists or recurs after administration of the first dose.
20. The method of claim 19, wherein the interval between the first and the second treatment is at least 6 weeks, at least 8 weeks or at least 10 weeks.
21. The method of claim 19, wherein the interval between the first and the second treatment is at least 3 months, 6 month or 9 months.
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2015529009A JP2015528454A (en) | 2012-08-28 | 2013-08-28 | Use of VEGF antagonists in the treatment of ocular proliferative diseases |
US14/423,719 US20150297675A1 (en) | 2012-08-28 | 2013-08-28 | Use of a vegf antagonist in treating ocular vascular proliferative diseases |
EP13753858.3A EP2890389A1 (en) | 2012-08-28 | 2013-08-28 | Use of a vegf antagonist in treating ocular vascular proliferative diseases |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201261693913P | 2012-08-28 | 2012-08-28 | |
US61/693,913 | 2012-08-28 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2014033184A1 true WO2014033184A1 (en) | 2014-03-06 |
Family
ID=49083670
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2013/067846 WO2014033184A1 (en) | 2012-08-28 | 2013-08-28 | Use of a vegf antagonist in treating ocular vascular proliferative diseases |
Country Status (4)
Country | Link |
---|---|
US (1) | US20150297675A1 (en) |
EP (1) | EP2890389A1 (en) |
JP (1) | JP2015528454A (en) |
WO (1) | WO2014033184A1 (en) |
Cited By (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014203183A1 (en) * | 2013-06-20 | 2014-12-24 | Novartis Ag | Use of a vegf antagonist in treating macular edema |
WO2017049009A1 (en) | 2015-09-15 | 2017-03-23 | Genentech, Inc. | Cystine knot scaffold platform |
WO2017085253A1 (en) * | 2015-11-18 | 2017-05-26 | Formycon Ag | Pre-filled plastic syringe containing a vegf antagonist |
WO2018229034A1 (en) | 2017-06-14 | 2018-12-20 | Bayer Pharma Aktiengesellschaft | Non-antibody vegf antagonists for the treatment of neovascular glaucoma |
US10973867B2 (en) | 2015-12-30 | 2021-04-13 | Marshall University Research Corporation | Compositions and methods for treating retinopathy |
US11066465B2 (en) | 2015-12-30 | 2021-07-20 | Kodiak Sciences Inc. | Antibodies and conjugates thereof |
US11155610B2 (en) | 2014-06-28 | 2021-10-26 | Kodiak Sciences Inc. | Dual PDGF/VEGF antagonists |
WO2021252803A1 (en) | 2020-06-11 | 2021-12-16 | Genentech, Inc. | Nanolipoprotein-polypeptide conjugates and compositions, systems, and methods using same |
US11912784B2 (en) | 2019-10-10 | 2024-02-27 | Kodiak Sciences Inc. | Methods of treating an eye disorder |
US11911385B1 (en) | 2022-12-14 | 2024-02-27 | Aldeyra Therapeutics, Inc. | Methotrexate treatment methods |
US12005061B2 (en) * | 2019-09-13 | 2024-06-11 | Aldeyra Therapeutics, Inc. | Ophthalmic formulations of methotrexate |
Families Citing this family (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2494108C2 (en) | 2006-04-07 | 2013-09-27 | Аерпио Терапетикс, Инк. | Human protein tyrosine phosphatase beta binding antibodies (hptpbeta), and use thereof |
JP6953433B2 (en) * | 2016-01-26 | 2021-10-27 | フォーマイコン アーゲーFormycon Ag | A liquid pharmaceutical composition containing a VEGF antagonist and a prefilled syringe containing the pharmaceutical composition. |
KR20200089282A (en) * | 2017-11-20 | 2020-07-24 | 저스트-에보텍 바이오로직스, 아이엔씨. | Aflibercept formulation containing lysine salt as isotonic agent and use thereof |
US20210017266A1 (en) * | 2018-03-16 | 2021-01-21 | Novartis Ag | Methods for treating ocular diseases |
KR102038008B1 (en) * | 2018-04-03 | 2019-10-29 | 주식회사 루트로닉 | An ophthalmic treatment apparatus and method for controlling that |
CN113164597A (en) | 2018-09-24 | 2021-07-23 | 爱尔皮奥制药公司 | Multispecific antibodies targeting HPTP-beta (VE-PTP) and VEGF |
WO2023019216A2 (en) * | 2021-08-13 | 2023-02-16 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for diagnosing and treating ischemic eye disease |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20080268051A1 (en) * | 2007-04-30 | 2008-10-30 | Allergan, Inc. | High viscosity macromolecular compositions for treating ocular conditions |
WO2010060748A1 (en) * | 2008-11-03 | 2010-06-03 | Molecular Partners Ag | Binding proteins inhibiting the vegf-a receptor interaction |
WO2010136492A2 (en) * | 2009-05-28 | 2010-12-02 | Glaxo Group Limited | Antigen-binding proteins |
WO2012105610A1 (en) * | 2011-02-02 | 2012-08-09 | 公立大学法人名古屋市立大学 | Medicinal agent for prevention or treatment of diseases associated with intraocular neovascularization and/or intraocular vascular hyperpermeability |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2003066078A1 (en) * | 2002-02-07 | 2003-08-14 | Delta Biotechnology Limited | Hiv inhibiting proteins |
US7399612B2 (en) * | 2003-06-30 | 2008-07-15 | Regeneron Pharmaceuticals, Inc. | VEGF-binding fusion proteins and nucleic acids encoding the same |
US20110200612A1 (en) * | 2008-06-30 | 2011-08-18 | Michael Schuster | Treatment of eye diseases and excessive neovascularization using combined therapy |
-
2013
- 2013-08-28 EP EP13753858.3A patent/EP2890389A1/en not_active Withdrawn
- 2013-08-28 WO PCT/EP2013/067846 patent/WO2014033184A1/en active Application Filing
- 2013-08-28 US US14/423,719 patent/US20150297675A1/en not_active Abandoned
- 2013-08-28 JP JP2015529009A patent/JP2015528454A/en active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20080268051A1 (en) * | 2007-04-30 | 2008-10-30 | Allergan, Inc. | High viscosity macromolecular compositions for treating ocular conditions |
WO2010060748A1 (en) * | 2008-11-03 | 2010-06-03 | Molecular Partners Ag | Binding proteins inhibiting the vegf-a receptor interaction |
WO2010136492A2 (en) * | 2009-05-28 | 2010-12-02 | Glaxo Group Limited | Antigen-binding proteins |
WO2012105610A1 (en) * | 2011-02-02 | 2012-08-09 | 公立大学法人名古屋市立大学 | Medicinal agent for prevention or treatment of diseases associated with intraocular neovascularization and/or intraocular vascular hyperpermeability |
Non-Patent Citations (2)
Title |
---|
DATABASE BIOSIS [online] BIOSCIENCES INFORMATION SERVICE, PHILADELPHIA, PA, US; 2003, WIEGAND S J ET AL: "LONG - LASTING INHIBITION OF CORNEAL NEOVASCULARIZATION FOLLOWING SYSTEMIC ADMINISTRATION OF THE VEGF TRAP", XP002716541, Database accession no. PREV200300511706 * |
LI TAO ET AL: "KH906, a recombinant human VEGF receptor fusion protein, is a new effective topical treatment for corneal neovascularization", MOLECULAR VISION, vol. 17, no. 89-90, March 2011 (2011-03-01), XP002716540, ISSN: 1090-0535 * |
Cited By (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014203183A1 (en) * | 2013-06-20 | 2014-12-24 | Novartis Ag | Use of a vegf antagonist in treating macular edema |
US11155610B2 (en) | 2014-06-28 | 2021-10-26 | Kodiak Sciences Inc. | Dual PDGF/VEGF antagonists |
CN114591422A (en) * | 2015-09-15 | 2022-06-07 | 豪夫迈·罗氏有限公司 | Cystine knot scaffold platform |
WO2017049009A1 (en) | 2015-09-15 | 2017-03-23 | Genentech, Inc. | Cystine knot scaffold platform |
JP2018533912A (en) * | 2015-09-15 | 2018-11-22 | ジェネンテック, インコーポレイテッド | Cystine knot scaffold platform |
JP7166916B2 (en) | 2015-09-15 | 2022-11-08 | ジェネンテック, インコーポレイテッド | Cystine knot scaffold platform |
US10428125B2 (en) | 2015-09-15 | 2019-10-01 | Genentech, Inc. | Cystine knot scaffold platform |
US10696721B2 (en) | 2015-09-15 | 2020-06-30 | Genentech, Inc. | Cystine knot scaffold platform |
US11407794B2 (en) | 2015-09-15 | 2022-08-09 | Genetech, Inc. | Cystine knot scaffold platform |
US11155586B2 (en) | 2015-09-15 | 2021-10-26 | Genentech, Inc. | Cystine knot scaffold platform |
US11078243B2 (en) | 2015-09-15 | 2021-08-03 | Genentech, Inc. | Cystine knot scaffold platform |
AU2016356047B2 (en) * | 2015-11-18 | 2021-10-21 | Formycon Ag | Pre-filled plastic syringe containing a VEGF antagonist |
WO2017085253A1 (en) * | 2015-11-18 | 2017-05-26 | Formycon Ag | Pre-filled plastic syringe containing a vegf antagonist |
CN108290004A (en) * | 2015-11-18 | 2018-07-17 | 福尔密孔股份公司 | Pre-filled plastic injector containing VEGF antagonist |
US11066465B2 (en) | 2015-12-30 | 2021-07-20 | Kodiak Sciences Inc. | Antibodies and conjugates thereof |
US10973867B2 (en) | 2015-12-30 | 2021-04-13 | Marshall University Research Corporation | Compositions and methods for treating retinopathy |
WO2018229034A1 (en) | 2017-06-14 | 2018-12-20 | Bayer Pharma Aktiengesellschaft | Non-antibody vegf antagonists for the treatment of neovascular glaucoma |
US12005061B2 (en) * | 2019-09-13 | 2024-06-11 | Aldeyra Therapeutics, Inc. | Ophthalmic formulations of methotrexate |
US12005060B2 (en) * | 2019-09-13 | 2024-06-11 | Aldeyra Therapeutics, Inc. | Ophthalmic formulations of methotrexate |
US11912784B2 (en) | 2019-10-10 | 2024-02-27 | Kodiak Sciences Inc. | Methods of treating an eye disorder |
WO2021252803A1 (en) | 2020-06-11 | 2021-12-16 | Genentech, Inc. | Nanolipoprotein-polypeptide conjugates and compositions, systems, and methods using same |
US11911385B1 (en) | 2022-12-14 | 2024-02-27 | Aldeyra Therapeutics, Inc. | Methotrexate treatment methods |
Also Published As
Publication number | Publication date |
---|---|
JP2015528454A (en) | 2015-09-28 |
US20150297675A1 (en) | 2015-10-22 |
EP2890389A1 (en) | 2015-07-08 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2014033184A1 (en) | Use of a vegf antagonist in treating ocular vascular proliferative diseases | |
AU2017203923B2 (en) | Use of a VEGF antagonist in treating chorioretinal neovascular and permeability disorders in paediatric patients | |
WO2014203182A1 (en) | Use of a vegf antagonist in treating choroidal neovascularisation | |
Chang et al. | Corneal neovascularization: an anti-VEGF therapy review | |
AU2019206000A1 (en) | Use of a VEGF antagonist in treating retinopathy of prematurity | |
WO2014203183A1 (en) | Use of a vegf antagonist in treating macular edema | |
CA3025258C (en) | Use of sirolimus to treat exudative age-related macular degeneration with persistent edema | |
WO2014203181A1 (en) | Treatment of polypoidal choroidal vasculopathy | |
CN108779173A (en) | Inhibit eye rear portion fibrosis by antagonism placenta growth factor | |
US20230167170A1 (en) | Compositions comprising anti-vegf and nanoparticles and methods of using the same for the treatment of abnormal or excessive angiogenesis | |
Kwon et al. | Clinical Study Effect of Preoperative Intravitreal Bevacizumab on the Surgical Outcome of Neovascular Glaucoma at Different Stages | |
CN116710137A (en) | VEGF antagonists for use in methods of treating ocular disorders | |
EDEMA | 7B Diabetic Macular Edema: Clinical Trials | |
Tano | Limited Macular | |
Chow et al. | Anti-VEGF drugs and clinical trials | |
Jiwani et al. | Recent Trends in the Treatment of Diabetic Retinopathy: A | |
Lim et al. | Todd R. Klesert |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13753858 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 14423719 Country of ref document: US |
|
ENP | Entry into the national phase |
Ref document number: 2015529009 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |