WO2014026882A1 - Azaheterocycles as bir2 and/or bir3 inhibitors - Google Patents

Azaheterocycles as bir2 and/or bir3 inhibitors Download PDF

Info

Publication number
WO2014026882A1
WO2014026882A1 PCT/EP2013/066458 EP2013066458W WO2014026882A1 WO 2014026882 A1 WO2014026882 A1 WO 2014026882A1 EP 2013066458 W EP2013066458 W EP 2013066458W WO 2014026882 A1 WO2014026882 A1 WO 2014026882A1
Authority
WO
WIPO (PCT)
Prior art keywords
methylamino
propanamido
methyl
butanoyl
carboxamide hydrochloride
Prior art date
Application number
PCT/EP2013/066458
Other languages
French (fr)
Inventor
Joan Heather Hogg
Kang Le
Yan Lou
Steven Gregory Mischke
Stacy Remiszewski
Original Assignee
F. Hoffmann-La Roche Ag
Hoffmann-La Roche Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=48948413&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2014026882(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to MX2015001905A priority Critical patent/MX2015001905A/en
Priority to MA37896A priority patent/MA37896A1/en
Priority to KR20157003782A priority patent/KR20150042792A/en
Priority to EP13745838.6A priority patent/EP2885275A1/en
Priority to AU2013304214A priority patent/AU2013304214A1/en
Priority to SG11201500581WA priority patent/SG11201500581WA/en
Priority to JP2015526932A priority patent/JP6203261B2/en
Priority to US14/419,288 priority patent/US9422332B2/en
Priority to CN201380035682.3A priority patent/CN104540806B/en
Priority to CA2878106A priority patent/CA2878106A1/en
Priority to EA201590347A priority patent/EA201590347A1/en
Priority to BR112015003201A priority patent/BR112015003201A2/en
Application filed by F. Hoffmann-La Roche Ag, Hoffmann-La Roche Inc. filed Critical F. Hoffmann-La Roche Ag
Publication of WO2014026882A1 publication Critical patent/WO2014026882A1/en
Priority to ZA2015/00342A priority patent/ZA201500342B/en
Priority to PH12015500185A priority patent/PH12015500185B1/en
Priority to CR20150041A priority patent/CR20150041A/en
Priority to IL237063A priority patent/IL237063A0/en
Priority to HK15110299.0A priority patent/HK1209427A1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/08—Tripeptides
    • C07K5/0802—Tripeptides with the first amino acid being neutral
    • C07K5/0804—Tripeptides with the first amino acid being neutral and aliphatic
    • C07K5/0806—Tripeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atoms, i.e. Gly, Ala
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • A61K31/4035—Isoindoles, e.g. phthalimide
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47—Quinolines; Isoquinolines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D209/00—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D209/02—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring
    • C07D209/44—Iso-indoles; Hydrogenated iso-indoles
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D217/00—Heterocyclic compounds containing isoquinoline or hydrogenated isoquinoline ring systems
    • C07D217/22—Heterocyclic compounds containing isoquinoline or hydrogenated isoquinoline ring systems with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to carbon atoms of the nitrogen-containing ring
    • C07D217/26—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/12—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D405/00—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
    • C07D405/02—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
    • C07D405/06—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D409/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
    • C07D409/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings
    • C07D409/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • the present invention relates to substituted isoindolines and tetrahydro- isoquinolines which act as inhibitors of SMAC protein binding to Inhibitor of Apoptosis Proteins (IAPs), and/or inhibitors of activated caspase protein binding to IAPs. These molecules are useful in the amelioration, treatment or control of cancer, especially solid tumors.
  • IAPs Apoptosis Proteins
  • These compounds bind to the BIR2 and/or BIR3 regions of IAP proteins, including XIAP and cIAP, resulting in activation or reactivation of the caspase cascade and, as such, are useful for the treatment of proliferative diseases, including cancer.
  • Cancer is a disease of uncontrolled cell growth causing local expansion of a tumor and, potentially, distant metastases.
  • One mechanism by which cancer cells grow is by avoidance of apoptosis, or programmed cell death. Alterations in apoptotic pathways have been linked to cancer cells being resistant to standard treatments, e.g., chemotherapeutics or radiation, and to the incidence and progression of cancer. See, e.g., E. Dean et al., "X- linked inhibitor of apoptosis protein as a therapeutic target," Expert Opin. Ther. Targets (2007) 11(11):1459-1471
  • the two basic pathways for apoptotic cell death are the intrinsic pathway and the extrinsic pathway.
  • the intrinsic apoptotic pathway can be initiated by various mechanisms including cellular stress and drug-induced DNA damage.
  • the extrinsic pathway can be initiated by activation of the death receptors by a chemokine. Initiation of either pathway results in the activation of a family of proteases called caspases. Once activated, the caspases can act to cleave a variety of substrates creating a cascade of events that lead to the activation of the effector caspases 3 and 7 and eventual cell death.
  • the IAP family of proteins can bind to and inhibit the activity of caspases thus inhibiting apoptosis. See, e.g., Dean, supra at 1460.
  • the IAPs can contain up to three copies of homologous structural domains called baculoviral IAP repeat (BIR) domains, BIR1, BIR2 and BIR3.
  • BIR3 domain of the prototypical IAPs, cIAP and XIAP can bind to and inhibit activated caspase 9.
  • the BIR2 domain in contrast, binds to and inhibits caspases 3 and 7.
  • the proapoptotic protein Smac also known as DIABLO
  • DIABLO can block the BIR2 and BIR3 domains of IAPs competing with activated caspases resulting in release of the activated caspases from the IAPs and completion of the apoptotic program. See, e.g., S. Wang, "Design of Small-Molecule Smac Mimetics as IAP Antagonists," Current Topics in Microbiology and Immunology 348, DOI 10.1007/82 2010 111, pp. 89-113.
  • One aspect of the present invention is a compound of Formula I
  • the present invention also relates to pharmaceutical compositions comprising one or more compounds of the invention, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient.
  • the present invention further relates to a method of ameliorating, controlling or treating cancer, including specifically solid tumors, for example lung, pancreatic, colon, breast, bone and prostate cancers in a mammal, specifically a human, comprising administering to said mammal a therapeutically effective amount of a compound according to the invention or a pharmaceutically acceptable salt thereof.
  • Alkyl means a monovalent linear or branched saturated hydrocarbon of 1 to 12 carbon atoms. In particular embodiments, alkyl has 1 to 6 carbon atoms, and in more particular embodiments 1 to 4 carbon atoms.
  • lower alkyl denotes an alkyl group having from 1-6 carbon atoms (“Ci_6-alkyl”). Examples of alkyl include methyl, ethyl, propyl, isopropyl, butyl (also known as n-butyl), iso-butyl, sec-butyl, tert-butyl, pentyl, hexyl, and the like.
  • the alkyl group can be optionally enriched in deuterium, e.g., -CD 3 , - CD 2 CD 3 and the like.
  • Aryl means a monovalent aromatic carbocyclic mono- , bi- or tricyclic ring system comprising 6 to 19 carbon ring atoms.
  • aryl moieties include, but are not limited to, phenyl, naphthyl (or naphathelenyl), tolyl, xylyl, pyridinyl, quinolinyl, pyrimidinyl, imidazolyl, thiazolyl, anthracenyl, tetrazolyl, and fluorenyl.
  • a particular aryl is phenyl.
  • Cycloalkyl means a substituted on unsubstituted stable monovalent saturated monocyclic, bicyclic or tricyclic system which consists of 3 to 10 ring carbon atoms.
  • cycloalkyl denotes a monovalent saturated monocyclic hydrocarbon group of 3 to 8 ring carbon atoms, more particular of 3 to 7 carbon atoms (“C 3 _ 7-cycloalkyl”).
  • Particular cycloalkyl groups are monocyclic. Examples for monocyclic cycloalkyl are cyclopropyl, cyclobutnyl, cyclopentyl, cyclohexyl or cycloheptyl.
  • Bicyclic means consisting of two saturated carbocycles having one or more carbon atoms in common.
  • Examples for bicyclic cycloalkyl are bicyclo[2.2.1]heptanyl, or bicyclo[2.2.2]octanyl.
  • Tricyclic means consisting of three saturated carbocycles having two or more carbon atoms in common. Examples of tricyclic cycloalkyl include adamantane.
  • Halogen when referring to two or more rings, e.g. aryl fused with cycloalkyl, means that the rings have at least two atoms in common.
  • An example of aryl fused with cycloalkyl is tetrahydronaphthalenyl.
  • Halogen or “Halo” means at atom selected from F, CI, Br or I. In particular embodiments Halogen means F and CI.
  • Heteroatom means at atom selected from N, O or S.
  • Heteroaryl means a substituted or unsubstituted aromatic heterocyclic ring system containing up to two rings, at least one ring of which includes 1 , 2, or 3 heteroatoms, the remaining ring atoms being carbon.
  • heteroaryl groups include, but are not limited to, thienyl (or thiophenyl), furyl (or furanyl), indolyl, pyrrolyl, pyridinyl, pyrazinyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, quinolinyl, isoquinolinyl, indazolyl, pyrimidinyl, imidazolyl, triazolyl , tetrazolyl, triazinyl, pyrazolyl, benzo[d]isoxazolyl, 2- oxo-2H-chromen-4-yl, benzo[d]isoxazolyl, benzo[b]thi
  • heteroaryl that is bicyclic it should be understood that one ring may be aryl while the other is heteroaryl and both may be independently substituted or unsubstituted.
  • Heterocyclyl "heterocycle” or “heterocyclic ring” means a substituted or unsubstituted monovalent saturated or partly unsaturated mono- or bicyclic ring, non- aromatic hydrocarbon system of 3 to 9 ring atoms, comprising 1 , 2, or 3 ring heteroatoms selected from N, O and S, the remaining ring atoms being carbon.
  • heterocycloalkyl is a monovalent saturated monocyclic ring system of 4 to 7 ring atoms, comprising 1 , 2, or 3 ring heteroatoms selected from N, O and S, the remaining ring atoms being carbon.
  • Examples for monocyclic saturated heterocycloalkyl are aziridinyl, oxiranyl, azetidinyl, oxetanyl, pyrrolidinyl, tetrahydrofuranyl, tetrahydro-thienyl, pyrazolidinyl, imidazolidinyl, oxazolidinyl, isoxazolidinyl, thiazolidinyl, piperidinyl, tetrahydropyranyl, tetrahydrothiopyranyl, tetrahydrofuranyl, piperazinyl, morpholinyl, thiomo holinyl, l,l-dioxo-thiomorpholin-4-yl, azepanyl, diazepanyl, homopiperazinyl, or oxazepanyl.
  • partly unsaturated heterocycloalkyl examples include dihydrofuryl, imidazolinyl, dihydro-oxazolyl, dihydro-oxadiazolyl, dihydro-triazolyl, tetrahydro-pyridinyl, tetrahydro- triazinyl or dihydropyranyl.
  • heterocycle that is bicyclic it should be understood that one ring may be heterocycle while the other is cycloalkyl, and either or both may be independently substituted.
  • bicyclic saturated heterocycloalkyl are 8-aza-bicyclo[3.2.1]octyl, quinuclidinyl, 8-oxa-3-aza-bicyclo[3.2.1]octyl, 9-aza-bicyclo[3.3.1]nonyl, 3-oxa-9-aza- bicyclo[3.3.1]nonyl, or 3-thia-9-aza-bicyclo[3.3.1]nonyl.
  • IC 50 refers to the concentration of a particular compound required to inhibit 50% of a specific measured activity. IC 50 can be measured, inter alia, as is described subsequently in Example 48.
  • “Pharmaceutically acceptable,” such as pharmaceutically acceptable carrier, excipient, etc., means pharmacologically acceptable and substantially non-toxic to the subject to which the particular compound is administered.
  • “Pharmaceutically acceptable salt” refers to conventional acid-addition salts or base- addition salts that retain the biological effectiveness and properties of the compounds of the present invention and are formed from suitable non-toxic organic or inorganic acids or organic or inorganic bases.
  • Sample acid-addition salts include those derived from inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfamic acid, phosphoric acid and nitric acid, and those derived from organic acids such as p- toluenesulfonic acid, salicylic acid, methanesulfonic acid, oxalic acid, succinic acid, citric acid, malic acid, lactic acid, fumaric acid, trifluoroacetic acid and the like.
  • Sample base- addition salts include those derived from ammonium, potassium, sodium and, quaternary ammonium hydroxides, such as for example, tetramethylammonium hydroxide.
  • Chemical modification of a pharmaceutical compound (i.e. drug) into a salt is a technique well known to pharmaceutical chemists to obtain improved physical and chemical stability, hygroscopicity, flowability and solubility of compounds. See, e.g., Ansel et al, Pharmaceutical Dosage Forms and Drug Delivery Systems (1995) at pgs. 456-457.
  • “Pharmaceutically acceptable salt” refers to conventional acid-addition salts or base- addition salts that retain the biological effectiveness and properties of the compounds of the present invention and are formed from suitable non-toxic organic or inorganic acids or organic or inorganic bases.
  • Sample acid-addition salts include those derived from inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfamic acid, phosphoric acid and nitric acid, and those derived from organic acids such as p- toluenesulfonic acid, salicylic acid, methanesulfonic acid, oxalic acid, succinic acid, citric acid, malic acid, lactic acid, fumaric acid, trifluoro acetic acid and the like.
  • Sample base- addition salts include those derived from ammonium, potassium, sodium and, quaternary ammonium hydroxides, such as for example, tetramethylammonium hydroxide.
  • Chemical modification of a pharmaceutical compound (i.e. drug) into a salt is a technique well known to pharmaceutical chemists to obtain improved physical and chemical stability, hygroscopicity, flowability and solubility of compounds. See, e.g., Ansel et al, Pharmaceutical Dosage Forms and Drug Delivery Systems (1995) at pgs. 456-457.
  • substituted as in substituted alkyl, aryl or heteroaryl means that the substitution (i.e. replacement of one hydrogen atom) can occur at one or more positions and, unless otherwise indicated, that the substituents at each substitution site are independently selected from the specified options.
  • substitution i.e. replacement of one hydrogen atom
  • substituents at each substitution site are independently selected from the specified options.
  • optionally substituted refers to the fact that one or more hydrogen atoms of a chemical group (with one or more hydrogen atoms) can be, but does not necessarily have to be, substituted with another substituent.
  • R 1 is selected from H and halogen;
  • R 2 is selected from
  • R 3 is selected from
  • R 4 is selected from H and lower alkyl; n is 1 or 2; m is 0 or 1 ; and q is 0, 1 or 2; or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound of Formula I:
  • R is selected from H and halogen
  • R 2 is selected from • aryl that optionally may be substituted with Ci_6-alkyl, OR 4 , and halogen,
  • R 3 is selected from
  • Ci-6-alkyl that optionally may be substituted with OR 4 and aryl
  • R 4 is selected from H and Ci_6-alkyl; n is 1 or 2; m is 0 or 1 ; and q is 0, 1 or 2; or a pharmaceutically acceptable salt of the foregoing compound.
  • the present invention relates to a compound as described herein wherein R 1 is halogen, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R 1 is H.
  • the present invention relates to a compound as described herein wherein R 2 is aryl that optionally may be substituted with OR 4 , halogen and Ci-6-alkyl, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R is phenyl or naphthalenyl, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R 2 is heteroaryl that optionally may be substituted with Ci-6-alkyl, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R 2 is selected from selected from quinolinyl, benzo[b]thiophenyl or indolyl. In one embodiment, the present invention relates to a compound as described herein wherein R 3 is Ci_6-alkyl that optionally may be substituted with OR 4 and aryl, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R 3 is Ci-6-alkyl substituted with phenyl, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R 3 is OR 4 and R 4 is H, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R 3 is C3_7-cycloalkyl, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R 3 is cyclohexyl or cyclopentyl, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R is aryl, or a pharmaceutically acceptable salt thereof. In one embodiment, the present invention relates to a compound as described herein wherein R 3 is phenyl.
  • the present invention relates to a compound as described herein wherein R 3 is heterocyclyl, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R is tetrahydropyran.
  • the present invention relates to a compound as described herein wherein m is 0, n is 1 , and q is 0, or a pharmaceutically acceptable salt thereof.
  • the present invention relates to a compound as described herein wherein R 1 is H, R 2 is aryl, R 3 is Ci_6-alkyl, n is 1 and m and q are 0.
  • the present invention relates to a compound as described herein wherein R 3 is Ci_6-alkyl, n is 1 and m is 0, said compound being selected from the group comprising: (S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro- lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride;
  • the present invention relates to a compound as described herein wherein R 3 is Ci_6-alkyl, n is 2 and m is 0, said compound being selected from the group comprising:
  • the present invention relates to a compound as described herein wherein R 3 is Ci_6-alkyl, n is 1 and m is 1, said compound being
  • the present invention relates to a compound as described herein wherein R 3 is C3-7-cycloalkyl and n is 1, said compound being selected from the group comprising:
  • the present invention relates to a compound as described herein wherein R 3 is C3-7-cycloalkyl and n is 2, said compound being selected from the group comprising:
  • the present invention relates to a compound as described herein wherein R 3 is heterocyclyl, said compound being selected from the group comprising:
  • the present invention relates to a compound as described herein wherein R 3 is aryl, said compound being
  • the present invention relates to a compound as described herein selected from the group comprising:
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising any of the compounds as described herein, or a pharmaceutically acceptable salt thereof, as an active ingredient together with a pharmaceutically acceptable carrier or excipient.
  • the present invention relates to a compound as described herein for use as a therapeutically active substance. In one embodiment, the present invention relates to the use of a compound as described herein, or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for the therapeutic and/or prophylactic treatment of cancer.
  • the present invention relates to the use of a compound as described herein, or a pharmaceutically acceptable salt thereof, for the therapeutic and/or prophylactic treatment of cancer.
  • the present invention relates to a method of treating or ameliorating cancer comprising administering to a subject in need of such treatment a therapeutically effective amount of a compound as described herein.
  • the present invention relates to compounds of Formula I
  • R 1 is selected from H, CI and F;
  • R 2 is selected from
  • R 3 is selected from • isopropyl
  • R 4 is selected from H and lower alkyl; n is 1 or 2; m is 0 or 1 ; and q is 0, 1 or 2; or a pharmaceutically acceptable salt thereof.
  • the present invention relates to compounds of Formula I
  • R 1 is H
  • R 2 is selected from
  • R 3 is selected from
  • R 4 is selected from H and lower alkyl; n is 1; m is 0; and q is 0; or a pharmaceutically acceptable salt thereof.
  • R 1 is halogen, or a pharmaceutically acceptable salt thereof.
  • R 1 is F or CI.
  • Another embodiment of the invention relates to compounds of Formula I where R 1 is H, or a pharmaceutically acceptable salt thereof.
  • R 2 is aryl that optionally may be substituted with OR 4 , halogen and lower alkyl, or a pharmaceutically acceptable salt thereof.
  • R 2 is phenyl or naphthalenyl, each of which optionally may be substituted as defined above.
  • R is heteroaryl that optionally may be substituted with lower alkyl, or a pharmaceutically acceptable salt thereof.
  • R 2 is selected from quinolinyl, benzo[b]thiophenyl or indolyl.
  • R 3 lower alkyl that optionally may be substituted with OR 4 and aryl, or a pharmaceutically acceptable salt thereof.
  • R 3 is lower alkyl substituted with phenyl.
  • R 4 is H.
  • R is cycloalkyl, or a pharmaceutically acceptable salt thereof.
  • R is cyclohexyl or cyclopentyl.
  • R 3 is aryl, or a pharmaceutically acceptable salt thereof.
  • R 3 is phenyl.
  • R 3 is heterocyclyl, or a pharmaceutically acceptable salt thereof.
  • R 3 is tetrahydropyran.
  • Another embodiment of the invention relates to compounds of Formula I where q is 0, or a pharmaceutically acceptable salt thereof.
  • Another embodiment of the invention relates to compounds of Formula I where R 1 is H, R 2 is aryl, R 3 is lower alkyl, n is 1 and m and q are 0.
  • R 3 is alkyl that optionally may be substituted as defined above, n is 1 and m is 1 include:
  • R 3 is cycloalkyl and n is 1
  • R 3 is cycloalkyl and n is 1
  • the compounds of Formula I as well as their salts have at least one asymmetric carbon atom and therefore may be present as mixtures of different stereoisomers.
  • the various isomers can be isolated by known separation methods, e.g., chromatography.
  • the compounds of the invention preferably bind to BIR domains of an IAP preventing the IAP from binding to other proteins.
  • Bir binding proteins include, but are not limited to, caspase 3, caspase 7, caspase 9, Smac and the like.
  • IAPs include, but are not limited to, XIAP, cIAPl , cIAP2 or NAIP.
  • the compound of the invention bind to the BIR2 and/or BIR3 domains of XIAP, cIAPland/or cIAP2.
  • the compounds of the invention bind to the BIR2 domain of XIAP, cIAP land/or cIAP2.
  • apoptosis in cells or sensitizing cells to apoptotic signals in particular cancer cells.
  • Apoptotic signals can be induced in cancer cells by, e.g., radiation therapy or antineoplastic chemotherapy.
  • apoptotic signals can be induced in cancer cells by activation of the death receptors by death receptor agonists.
  • Death receptor agonists can be naturally occurring, e.g., tumor necrosis factor a, (TNF-a) or non-naturally occurring, e.g., a synthetic antibody such as a DR4 or DR5 antibody.
  • the compounds of the present invention are thus useful in the amelioration, control or treatment of cell proliferative disorders such as, in particular, oncological disorders.
  • These compounds and formulations containing said compounds are anticipated to be useful in the treatment or control of blood cancers, such as, for example, acute myeloid leukemia, or solid tumors, such as, for example, breast, colon, lung and prostate tumors.
  • a "therapeutically effective amount” or “effective amount” of a compound in accordance with this invention means an amount of compound that is effective to prevent, alleviate or ameliorate symptoms of disease or prolong the survival of the subject being treated. Determination of a therapeutically effective amount is within the skill in the art.
  • the therapeutically effective amount or dosage of a compound according to this invention can vary within wide limits and may be determined in a manner known in the art. Such dosage will be adjusted to the individual requirements in each particular case including the specific compound(s) being administered, the route of administration, the condition being treated, as well as the patient being treated. In general, in the case of oral or parenteral administration to adult humans weighing approximately 70 Kg, a daily dosage of about 10 mg to about 10,000 mg, preferably from about 200 mg to about 1 ,000 mg, should be appropriate, although the upper limit may be exceeded when indicated.
  • the daily dosage can be administered as a single dose or in divided doses, or for parenteral administration, it may be given as one or more bolus injections or as a continuous infusion.
  • compositions useful in the practice of the invention i.e., comprising the compounds of the invention can be administered internally, such as orally (e.g. in the form of tablets, coated tablets, dragees, hard and soft gelatin capsules, solutions, emulsions or suspensions), nasally (e.g. in the form of nasal sprays) or rectally (e.g. in the form of suppositories).
  • the administration can also be effected parentally, such as intramuscularly or intravenously (e.g. in the form of injection solutions).
  • administration can be effected topically (e.g. in the form of ointments, creams or oils).
  • the present invention includes pharmaceutical compositions comprising at least one compound of formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient and/or carrier.
  • compositions can be suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration.
  • the formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated, as well as the particular mode of administration.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of a formula I compound which produces a therapeutic effect.
  • compositions include the step of bringing into association a compound of the present invention with the carrier and, optionally, one or more accessory ingredients.
  • the formulations are prepared by uniformly and intimately bringing into association a compound of the present invention with liquid carriers, or finely divided solid carriers, or both, and then, if necessary, shaping the product.
  • the compounds of Formula I and their pharmaceutically acceptable salts and esters can be processed with pharmaceutically inert, inorganic or organic adjuvants for the production of tablets, coated tablets, dragees and hard gelatin capsules.
  • Lactose, polyvinylpyrrolidone, hydroxypropylmethylcellulose, hydroxypropyl-cellulose, microcrystalline cellulose, corn starch or derivatives thereof, talc, stearic acid or its salts etc. can be used, for example, as such adjuvants for tablets, dragees and hard gelatin capsules.
  • Suitable adjuvants for soft gelatin capsules are, for example, vegetable oils, waxes, fats, semi-solid substances and liquid polyols, etc.
  • Suitable adjuvants for the production of solutions and syrups are, for example, H 2 0, polyols, saccharose, invert sugar, glucose, etc.
  • Suitable adjuvants for injection solutions are, for example, H 2 0, alcohols, polyols, glycerol, vegetable oils, etc.
  • Suitable adjuvants for suppositories are, for example, natural or hardened oils, waxes, fats, semi-solid or liquid polyols, etc.
  • Suitable adjuvants for topical preparations are glycerides, semi-synthetic and synthetic glycerides, hydrogenated oils, liquid waxes, liquid paraffins, liquid fatty alcohols, sterols, polyethylene glycols and cellulose derivatives.
  • the pharmaceutical preparations can contain preservatives, solubilizers, viscosity-increasing substances, stabilizers, wetting agents, emulsifiers, sweeteners, colorants, flavors, salts for varying the osmotic pressure, buffers, masking agents or antioxidants. They can also contain other therapeutic substances.
  • the compounds in the present invention (compounds of general Formula I) can be prepared using the general reaction scheme set out in Scheme 1 below.
  • the amino group in compounds of general formula 2 can be protected with a suitable protecting group, PGl , to provide compounds of general formula 3.
  • Compounds of general formula 3 can be reacted with a chlorinating agent, e.g., POCI 3 , and an amine of general formula 4 to afford compounds of general formula 5.
  • the protecting group PGl in compounds of general formula 5 can be removed to afford compounds of general formula 6.
  • Compounds of general formula 6 can treated with a suitably protected a-amino acid of general formula 7 under dehydrating conditions to provide compounds of general formula 8.
  • the protecting group PG2 in compounds of general formula 8 can be removed to afford compounds of general formula 9.
  • Compounds of general formula 9 can treated with a suitably protected a-amino acid of general formula 10 under dehydrating conditions to provide compounds of general formula 11.
  • the protecting group PG3 in compounds of general formula 11 can be removed to afford compounds of general formula I.
  • the compounds of the present invention may be synthesized according to known techniques.
  • the following examples and references are provided to aid the understanding of the present invention.
  • the examples are not intended, however, to limit the invention, the true scope of which is set forth in the appended claims.
  • Step 1 To a solution of 2-(tert-butoxycarbonyl)isoindoline-l-carboxylic acid (500 mg, 1.9 mmol, Eq: 1.00) and 2,6-difluoroaniline (294 mg, 2.28 mmol, Eq: 1.2) in pyridine (10 mL) at 0 °C was added POCI 3 (437 mg, 266 ⁇ , 2.85 mmol, Eq: 1.5). The reaction was warmed to RT and stirred for 2 h. The mixture was evaporated and water was added and the resulting mixture was extracted with EtOAc. The combined organics were washed with water, brine, dried with MgSC>4 and concentrated in vacuo.
  • Step 2 To a solution of l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro-isoindole-2- carboxylic acid tert-butyl ester (460 mg, 1.23 mmol, Eq: 1.00) in CH 2 CI 2 (6 mL) was added TFA (2 mL) dropwise. The reaction was stirred at RT for 1 h. The solvent was evaporated to afford 2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate which was used without further purification.
  • Step 3 To a solution of 2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6-difluoro- phenyl)-amide trifluoroacetate (477 mg, 1.23 mmol, Eq: 1.00), (S)-2-(tert- butoxycarbonylamino)-3-methylbutanoic acid (267 mg, 1.23 mmol, Eq: 1.00) and HATU (514 mg, 1.35 mmol, Eq: 1.1) in DMF (1.85 mL) at 0 °C was added DIEA
  • Step 4 To a solution of ⁇ (S)-l-[(S)-l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro- isoindole-2-carbonyl]-2-methyl-propyl ⁇ -carbamic acid tert-butyl (210 mg, 443 ⁇ , Eq: 1.00) in CH 2 CI 2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh.
  • Step 5 To a solution of (S)-2-((S)-2-amino-3-methyl-butyryl)-2,3-dihydro-lH- isoindole-1 -carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate (216 mg, 443 ⁇ , Eq: 1.00), (S)-2-(tert-butoxycarbonyl-methyl-amino)-propionic acid (83.8 mg, 443 ⁇ , Eq: 1.00), HATU (185 mg, 487 ⁇ , Eq: 1.1) in DMF (500 ⁇ ) at 0 °C was added DIEA (172 mg, 232 ⁇ ,, 1.33 mmol, Eq: 3).
  • Step 6 A solution of acetyl chloride (552 mg, 500 ⁇ ,, 7.03 mmol, Eq: 18.0) in MeOH (2 mL) was added to a vial containing ((S)-l- ⁇ (S)-l-[(S)-l-(2,6-difluoro- phenylcarbamoyl)- 1 ,3-dihydro-isoindole-2-carbonyl]-2-methyl-propylcarbamoyl ⁇ -ethyl)- methyl-carbamic acid tert-butyl ester ester (218 mg, 390 ⁇ , Eq: 1.00). The mixture was stirred at RT for 1 h.
  • Step 1 To the solution of (S)-2-(tert-butoxycarbonyl)isoindoline-l-carboxylic acid (300 mg, 1.14 mmol, Eq: 1.00) and 2,6-difiuoroaniline (177 mg, 1.37 mmol, Eq: 1.2) in pyridine (3.00 mL) at 0 °C was added POCl 3 (262 mg, 159 ⁇ , 1.71 mmol, Eq: 1.5). The mixture was warmed to RT and stirred for 2 h. The mixture was evaporated, water was added and the mixture extracted with EtOAc. The combined organics were washed with water, brine, dried with MgS0 4 and concentrated in vacuo.
  • Step 2 To a solution of (S)-l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro- isoindole-2-carboxylic acid tert-butyl ester in CH 2 CI 2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh and the mixture evaporated to afford (S)- 2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide which was used without further purification.
  • Step 3 To a solution of (S)-2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6- difluoro-phenyl)-amide (160 mg, 412 ⁇ , Eq: 1.00), (S)-2-(tert-butoxycarbonylamino)-2- cyclohexylacetic acid (106 mg, 412 ⁇ , Eq: 1.00) and HATU (172 mg, 453 ⁇ , Eq: 1.1) in DMF (500 ⁇ ) at 0 °C was added DIEA (160 mg, 216 ⁇ , 1.24 mmol, Eq: 3). The reaction was stirred at RT for 1 h, diluted with water and extracted with EtOAc.
  • Step 4 To a solution of ⁇ (S)-l-cyclohexyl-2-[(S)-l-(2,6-difiuoro-phenylcarbamoyl)- l,3-dihydro-isoindol-2-yl]-2-oxo-ethyl ⁇ -carbamic acid tert-butyl ester (174mg, 339 ⁇ , Eq: 1.00) in CH 2 CI 2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh.
  • Step 5 To a solution of (S)-2-((S)-2-amino-2-cyclohexyl-acetyl)-2,3-dihydro-lH- isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate (179 mg, 339 ⁇ , Eq: 1.00), (S)-2-(tert-butoxycarbonyl-methyl-amino)-propionic acid (64.2 mg, 339 ⁇ , Eq: 1.00), HATU (142 mg, 373 ⁇ , Eq: 1.1) in DMF (1 mL) at 0 °C was added DIEA (132 mg, 178 ⁇ ,, 1.02 mmol, Eq: 3).
  • Step 6 A solution of acetyl chloride (552 mg, 500 ⁇ ., 7.03 mmol, Eq: 24.2) in MeOH (2mL) was added to a vial containing ((S)-l- ⁇ (S)-l-Cyclohexyl-2-[(S)-l-(2,6- difluoro-phenylcarbamoyl)-l ,3-dihydro-isoindol-2-yl]-2-oxo-ethylcarbamoyl ⁇ -ethyl)- methyl-carbamic acid tert-butyl ester (174 mg, 291 ⁇ , Eq: 1.00). The mixture was stirred at RT for 1 h.
  • Step 1 To the solution of (S)-3,4-dihydro-lH-isoquinoline-l,2-dicarboxylic acid 2- tert-butyl ester (500 mg, 1.8 mmol, Eq: 1.00) and 2,6-difiuoroaniline (279 mg, 2.16 mmol, Eq: 1.2) in pyridine (10.0 mL) at 0 °C was added POCl 3 (415 mg, 252 ⁇ ,, 2.7 mmol, Eq: 1.5). The mixture was warmed to RT and stirred for 2 h. The solvent was evaporated, water was added and the mixture extracted with EtOAc.
  • Step 2 To a solution of (S)-l-(2,6-difluoro-phenylcarbamoyl)-3,4-dihydro-lH- isoquinoline-2-carboxylic acid tert-butyl ester (50 mg, 129 ⁇ , Eq: 1.00) in CH2CI2 (6 mL) was added TFA (2 mL) dropwise. The reaction was stirred at RT for lh. The mixture was evaporated to provide (S)-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6- difluoro-phenyl)-amide trifluoroacetate which was used without further purification.
  • Step 3 To a solution of (S)-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6- difluoro-phenyl)-amide trifluoroacetate (52 mg, 129 ⁇ , Eq: 1.00), (S)-2-(tert- butoxycarbonylamino)-2-cyclohexylacetic acid (33.3 mg, 129 ⁇ , Eq: 1.00) and HATU (54.1 mg, 142 ⁇ , Eq: 1.1) in DMF (300 ⁇ ) at 0 °C was added DIEA (50.1 mg, 67.7 ⁇ , 388 ⁇ , Eq: 3).
  • Step 5 To a solution of (S)-2-((S)-2-amino-2-cyclohexyl-acetyl)-l,2,3,4-tetrahydro- isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate (63.6 mg, 117 ⁇ , Eq: 1.00), (S)-2-(tert-butoxycarbonyl-methyl-amino)-propionic acid (22.2 mg, 117 ⁇ , Eq: 1.00), HATU (49.1 mg, 129 ⁇ , Eq: 1.1) in DMF (500 £L) at 0 °C was added DIEA (45.5 mg, 61.5 ⁇ ,, 352 ⁇ , Eq: 3).
  • Step 6 A solution of acetyl chloride (552 mg, 500 ⁇ ,, 7.03 mmol, Eq: 74.3) in MeOH (2mL) was added to a vial containing ((S)-l- ⁇ (S)-l-cyclohexyl-2-[(S)-l-(2,6- difluoro-phenylcarbamoyl)-3 ,4-dihydro-l H-isoquinolin-2-yl]-2-oxo-ethylcarbamoyl ⁇ - ethyl)-methyl-carbamic acid tert-butyl ester (58 mg, 94.7 ⁇ , Eq: 1.00). The mixture was stirred at RT for 1 h.
  • Step 1 To the solution of (S)-3,4-dihydro-lH-isoquinoline-l,2-dicarboxylic acid 2- tert-butyl ester (100 mg, 361 ⁇ , Eq: 1) and 2-chloro-6-fiuoroaniline (63.0 mg, 433 ⁇ , Eq: 1.2) in pyridine (2.00 mL) at 0 °C was added POCL 3 (82.9 mg, 50.4 ⁇ , 541 ⁇ , Eq: 1.5). Reaction was warmed to RT and stirred for 2 h. The mixture was evaporated and water was added to the residue.
  • Step 2 To a solution of (S)-l-(2-chloro-6-fluoro-phenylcarbamoyl)-3,4-dihydro-lH- isoquinoline-2-carboxylic acid tert-butyl ester (78 mg, 193 ⁇ , Eq: 1.00) in CH 2 CI 2 (6 mL) was added TFA (2 mL) dropwise. The reaction was stirred at RT for lh. The mixture was evaporated to afford (S)-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6- fluoro-phenyl)-amide trifluoroacetate which was used without further purification.
  • Step 3 To a solution of (S)-l,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2- chloro-6-fluoro-phenyl)-amide trifluoroacetate (80 mg, 191 ⁇ , Eq: 1.00), (S)-2-(tert- butoxycarbonylamino)-3-methylbutanoic acid (41.5 mg, 191 ⁇ , Eq: 1.00) and HATU (79.9 mg, 210 ⁇ , Eq: 1.1) in DMF (500 ⁇ ) at 0 °C was added DIEA (74.1 mg, 100 ⁇ , 573 ⁇ , Eq: 3).
  • Step 4 To a solution of ⁇ (S)-l-[(S)-l-(2-chloro-6-fiuoro-phenylcarbamoyl)-3,4- dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propyl ⁇ -carbamic acid tert-butyl ester (47 mg, 93.3 ⁇ , Eq: 1.00) in CH 2 CI 2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh.
  • Step 5 To a solution of (S)-2-((S)-2-amino-3-methyl-butyryl)-l,2,3,4-tetrahydro- isoquinoline-1 -carboxylic acid (2-chloro-6-fluoro-phenyl)-amide trifiuoroacetate (48 mg, 92.7 ⁇ , Eq: 1.00), (S)-2-(tert-butoxycarbonylamino)propanoic acid (17.5 mg, 92.7 ⁇ , Eq: 1.00), HATU (38.8 mg, 102 ⁇ , Eq: 1.1) in DMF (300 ⁇ ) at 0 °C was added DIEA (35.9 mg, 48.6 ⁇ ,, 278 ⁇ mol, Eq: 3).
  • Step 6 A solution of acetyl chloride (552 mg, 500 ⁇ ,, 7.03 mmol, Eq: 115) in MeOH (2mL) was added to a vial containing ((S)-l- ⁇ (S)-l-[(S)-l-(2-chloro-6-fluoro- phenylcarbamoyl)-3,4-dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propylcarbamoyl ⁇ - ethyl)-methyl-carbamic acid tert-butyl ester (36 mg, 61.1 ⁇ , Eq: 1.00). The mixture was stirred at RT for 1 h.
  • Step 1 In a 50 niL round-bottomed flask, 2-(tert-butoxycarbonyl)-6-chloro-l,2,3,4- tetrahydroisoquinoline-l-carboxylic acid (0.5 g, 1.6 mmol, Eq: 1.00), 2,6-difluoroaniline (228 mg, 190 ⁇ , 1.76 mmol, Eq: 1.1) and TEA (487 mg, 671 ⁇ , 4.81 mmol, Eq: 3) were combined with DCM (10 mL) to give a colorless solution and phosphorus oxychloride (295 mg, 179 ⁇ , 1.92 mmol, Eq: 1.2) was added.
  • 2-(tert-butoxycarbonyl)-6-chloro-l,2,3,4- tetrahydroisoquinoline-l-carboxylic acid 0.5 g, 1.6 mmol, Eq: 1.00
  • 2,6-difluoroaniline 2
  • Step 2 In a 50 mL pear-shaped flask, 6-chloro-l-(2,6-difluoro-phenylcarbamoyl)- 3,4-dihydro-lH-isoquinoline-2-carboxylic acid tert-butyl ester (0.6 g, 1.42 mmol, Eq: 1.00) was combined with DCM (25 mL) to give a light brown solution. TFA (4.85 g, 3.28 mL, 42.6 mmol, Eq: 30) was added. After lh, the reaction was concentrated, the residue dissolved in EtOAc and the mixture washed with 1 N NaOH and brine.
  • Step 3 In a 100 mL round-bottomed flask, BOC-VAL-OH (315 mg, 1.45 mmol, Eq: 1.2), 6-chloro-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide (0.39 g, 1.21 mmol, Eq: 1.00) and HATU (551 mg, 1.45 mmol, Eq: 1.2) were combined with DMF (10 mL) to give a brown solution and TEA (367 mg, 505 ⁇ , 3.63 mmol, Eq: 3) was added.
  • BOC-VAL-OH 315 mg, 1.45 mmol, Eq: 1.2
  • 6-chloro-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide (0.39 g, 1.21 mmol, Eq
  • Step 4 In a 100 niL pear-shaped flask, tert-butyl (2S)-l-(6-chloro-l-(2,6- difluorophenylcarbamoyl)-3 ,4-dihydroisoquinolin-2( 1 H)-yl)-3 -methyl- 1 -oxobutan-2- ylcarbamate (0.3579 g, 686 ⁇ , Eq: 1.00) was combined with DCM (20 mL) to give a light yellow solution and TFA (2.35 g, 1.58 mL, 20.6 mmol, Eq: 30) was added.
  • Step 5 In a 50 mL flask, 2-((S)-2-amino-3-methyl-butyryl)-6-chloro-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide (0.2377 g, 563 ⁇ , Eq: 1.00), BOC-N-ME-ALA-OH (137 mg, 676 ⁇ , Eq: 1.2) and HATU (257 mg, 676 ⁇ , Eq: 1.2) were combined with DMF (6 mL) to give a light yellow solution and TEA(171 mg, 236 ⁇ , 1.69 mmol, Eq: 3) was added.
  • 2-((S)-2-amino-3-methyl-butyryl)-6-chloro-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide (0.
  • the diastereomers were separated by supercritical fluid chromatography (SFC) using a 220 mm Diacel IA column, 25 % EtOH, 70 mL/min. Each diastereomer was isolated and lyophilized from MeCN/H 2 0. The first compound eluted afforded 50.2 mg of white solid. The second compound eluted afforded 47.2mg of the title compound as white solid whose structure was assigned based on the activity in the TR-FRET assay. 57.6 % MS m/z 507.2 (M+H)
  • Step 1 In a 50 niL round-bottomed flask, 6-fluoro- 1,2,3 ,4-tetrahydroisoquinoline-l- carboxylic acid hydrochloride (500 mg, 2.16 mmol, Eq: 1.00) and 2 N NaOH (3.24 mL, 6.48 mmol, Eq: 3) were combined with t-BuOH (3.00 mL) to give a light brown solution and BOC-anhydride (565 mg, 601 ⁇ , 2.59 mmol, Eq: 1.2) was added. After stirring 18 h, the reaction was diluted with water and extracted ether. The aqueous layer was acidified with saturated KHS0 4 and extracted with EtOAc.
  • Step 2 To a solution of 6-fluoro-3,4-dihydro-lH-isoquinoline-l ,2-dicarboxylic acid 2-tert-butyl ester (0.37 g, 1.25 mmol, Eq: 1.00) and 2,6-difluoroaniline (194 mg, 162 ⁇ , 1.5 mmol, Eq: 1.2) in Pyridine (7 mL) at 0 °C was added phosphorus oxychloride (288 mg, 175 ⁇ , 1.88 mmol, Eq: 1.5). The reaction was warmed to RT, stirred for 18 h, diluted with water and extracted with EtOAc.
  • Step 3 In a 50 mL round-bottomed flask, l-(2,6-difluoro-phenylcarbamoyl)-6- fluoro-3,4-dihydro-lH-isoquinoline-2-carboxylic acid tert-butyl ester (0.218 g, 536 ⁇ , Eq: 1.00) was combined with DCM (7.00 mL) to give a colorless solution and TFA (1.83 g, 1.24 mL, 16.1 mmol, Eq: 30) was added.
  • Step 4 In a 50 niL round-bottomed flask, BOC-VAL-OH (140 mg, 643 ⁇ , Eq: 1.2) and 6-fluoro-l,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide trifluoroacetate (225 mg, 536 ⁇ , Eq: 1.00) were combined with DMF (3 mL) to give a light yellow solution and TEA (217 mg, 299 ⁇ , 2.14 mmol, Eq: 4) was added.
  • BOC-VAL-OH 140 mg, 643 ⁇ , Eq: 1.2
  • 6-fluoro-l,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide trifluoroacetate 225 mg, 536 ⁇ , Eq: 1.00
  • DMF 3 mL
  • Step 5 In a 20 mL vial, ⁇ (S)-l-[l-(2,6-Difluoro-phenylcarbamoyl)-6-fluoro-3,4- dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propyl ⁇ -carbamic acid tert-butyl ester (97.8 mg, 193 ⁇ , Eq: 1.00) was combined with DCM (4 mL) to give a colorless solution and TFA (662 mg, 447 ⁇ , 5.8 mmol, Eq: 30) was added.
  • Step 6 In a 20 mL vial, 2-((S)-2-Amino-3-methyl-butyryl)-6-fluoro-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate (100 mg, 193 ⁇ , Eq: 1.00), BOC-N-ME-ALA-OH (47.1 mg, 232 ⁇ , Eq: 1.2) and HATU (88.1 mg, 232 ⁇ , Eq: 1.2) were combined with DMF (3 mL) to give a light brown solution and TEA (97.6 mg, 135 ⁇ , 965 ⁇ , Eq: 5) was added.
  • Step 7 In a 20 mL vial, ((S)-l- ⁇ (S)-l-[l-(2,6-difluoro-phenylcarbamoyl)-6-fluoro- 3,4-dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propylcarbamoyl ⁇ -ethyl)-methyl- carbamic acid tert-butyl ester (77.1 mg, 131 ⁇ , Eq: 1.00) was combined with DCM (3.00 mL) to give a colorless solution and TFA (447 mg, 302 ⁇ , 3.92 mmol, Eq: 30) was added. After 30 min.
  • Step 1 To a solution of (S)-2-(tert-butoxycarbonyl)- 1 ,2,3 ,4-tetrahydroisoquinoline-
  • Step 2 To a solution of (S)-tert-butyl 3-(2,6-difluorophenylcarbamoyl)-3,4- dihydroisoquinoline-2(lH)-carboxylate (90 mg, 232 ⁇ , Eq: 1.00) in DCM (2 mL) was added TFA (2 mL, 26.0 mmol, Eq: 112) and the resulting solution stirred at RT for 1 h.
  • Step 3 To a solution of (S)-2-(tert-butoxycarbonylamino)-3-methylbutanoic acid (60 mg, 277 ⁇ , Eq: 1.2) and DIEA (120 ⁇ ,, 693 ⁇ , Eq: 3) in DMF (1 mL) was added HATU (105 mg, 277 ⁇ , Eq: 1.2) and the resulting solution stirred at RT for 15 min.
  • Step 4 To a solution of tert-butyl (S)-l-((S)-3-(2,6-difluorophenylcarbamoyl)-3,4- dihydroisoquinolin-2(lH)-yl)-3-methyl-l-oxobutan-2-ylcarbamate (0.11 g, 226 ⁇ , Eq: 1.00) in DCM (2 mL) was added TFA (2.96 g, 2 mL, 26.0 mmol, Eq: 115) and the resulting solution was stirred at RT for 1 h.
  • Step 5 To a solution of (S)-2-(tert-butoxycarbonyl(methyl)amino)propanoic acid (53.5 mg, 263 ⁇ , Eq: 1.2) and DIEA (190 ⁇ ,, 1.1 mmol, Eq: 5) in DMF (2 mL) was added HATU (100 mg, 263 ⁇ , Eq: 1.2). The mixture was stirred for 20 min.
  • Step 6 To a solution of tert-butyl (S)-l-((S)-l-((S)-3-(2,6- difluorophenylcarbamoyl)-3 ,4-dihydroisoquinolin-2( 1 H)-yl)-3 -methyl- 1 -oxobutan-2- ylamino)-l-oxopropan-2-yl(methyl)carbamate (138 mg, 241 ⁇ , Eq: 1.00) in DCM (2 mL) was added TFA (2.96 g, 2 mL, 26.0 mmol, Eq: 108) and the resulting solution stirred at RT for 1 h.
  • test compound acts as a SMAC -mimetic resulting in reactivation of a cell's apoptotic pathway.
  • the peptide AVPIAQKSEK-(s-biotin)-OH 1 :2 TFA (“Peptide A”) was identified as a substrate for the TR-FRET assay by screening the 6x Histidine -tagged BIR2 domain and BIR3 domain of XIAP against a set of 29 peptides synthesized based on sequences reported by Sweeny et al. (Biochemistry, 2006, 45, 14740 14748). The peptides were labeled with the fluorescent tags FrfC or TAMRA and Kd values were determined by fluorescence polarization assay. The sequence AVPIAQKSEK was identified as optimal for using in an assay. The peptide sequence was derivatized with biotin to provide AVPIAQKSEK-(s- biotin)-OH 1 :2 TFA as the substrate for the TR-FRET assay.
  • the XIAP protein sequence was obtained from the SWISS-PROT protein sequence database and the BIR2 and BIR3 domains were derived from that.
  • the sequence of the BIR2 domain used for the TR-FRET assay is
  • the sequence of the BIR3 domain used for the TR-FRET assay is MRHHHHHHRSDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNK
  • TR-FRET Time -resolved fluorescence resonance energy transfer

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Other In-Based Heterocyclic Compounds (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Indole Compounds (AREA)
  • Nitrogen Condensed Heterocyclic Rings (AREA)

Abstract

Disclosed are compounds of Formula (I) or pharmaceutically acceptable salts thereof, wherein R1, R2, R3, m, n and q are described in this application, and methods of using said compounds in the treatment of cancer.

Description

AZAHETEROCYCLES AS BIR2 AND/OR BIR3 INHIBITORS
Field of the Invention
The present invention relates to substituted isoindolines and tetrahydro- isoquinolines which act as inhibitors of SMAC protein binding to Inhibitor of Apoptosis Proteins (IAPs), and/or inhibitors of activated caspase protein binding to IAPs. These molecules are useful in the amelioration, treatment or control of cancer, especially solid tumors.
These compounds bind to the BIR2 and/or BIR3 regions of IAP proteins, including XIAP and cIAP, resulting in activation or reactivation of the caspase cascade and, as such, are useful for the treatment of proliferative diseases, including cancer.
Background of the Invention
Cancer is a disease of uncontrolled cell growth causing local expansion of a tumor and, potentially, distant metastases. One mechanism by which cancer cells grow is by avoidance of apoptosis, or programmed cell death. Alterations in apoptotic pathways have been linked to cancer cells being resistant to standard treatments, e.g., chemotherapeutics or radiation, and to the incidence and progression of cancer. See, e.g., E. Dean et al., "X- linked inhibitor of apoptosis protein as a therapeutic target," Expert Opin. Ther. Targets (2007) 11(11):1459-1471
The two basic pathways for apoptotic cell death are the intrinsic pathway and the extrinsic pathway. The intrinsic apoptotic pathway can be initiated by various mechanisms including cellular stress and drug-induced DNA damage. The extrinsic pathway can be initiated by activation of the death receptors by a chemokine. Initiation of either pathway results in the activation of a family of proteases called caspases. Once activated, the caspases can act to cleave a variety of substrates creating a cascade of events that lead to the activation of the effector caspases 3 and 7 and eventual cell death. The IAP family of proteins can bind to and inhibit the activity of caspases thus inhibiting apoptosis. See, e.g., Dean, supra at 1460.
The IAPs can contain up to three copies of homologous structural domains called baculoviral IAP repeat (BIR) domains, BIR1, BIR2 and BIR3. The BIR3 domain of the prototypical IAPs, cIAP and XIAP, can bind to and inhibit activated caspase 9. The BIR2 domain, in contrast, binds to and inhibits caspases 3 and 7. The proapoptotic protein Smac (also known as DIABLO) can block the BIR2 and BIR3 domains of IAPs competing with activated caspases resulting in release of the activated caspases from the IAPs and completion of the apoptotic program. See, e.g., S. Wang, "Design of Small-Molecule Smac Mimetics as IAP Antagonists," Current Topics in Microbiology and Immunology 348, DOI 10.1007/82 2010 111, pp. 89-113.
Peptides and small molecules have been reported to bind to the BIR3 region of XIAP and cIAP, mimicking the action of Smac protein and releasing activated caspases. See, e.g., Dean, supra; and M. Gyrd-Hanse et al., "IAPs: From caspase inhibitors to modulators of NF-κΒ, inflammation and cancer," Nature Review/Cancer, August 2010, Vol 10:561-574.
Summary of the Invention
One aspect of the present invention is a compound of Formula I
Figure imgf000003_0001
j or pharmaceutically acceptable salts thereof, wherein R 1 , R2 , R 3 , m, n and q are described in this application.
The present invention also relates to pharmaceutical compositions comprising one or more compounds of the invention, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient. The present invention further relates to a method of ameliorating, controlling or treating cancer, including specifically solid tumors, for example lung, pancreatic, colon, breast, bone and prostate cancers in a mammal, specifically a human, comprising administering to said mammal a therapeutically effective amount of a compound according to the invention or a pharmaceutically acceptable salt thereof. Detailed Description of the Invention Definitions
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. As used herein, the following terms shall have the following definitions.
"Alkyl" means a monovalent linear or branched saturated hydrocarbon of 1 to 12 carbon atoms. In particular embodiments, alkyl has 1 to 6 carbon atoms, and in more particular embodiments 1 to 4 carbon atoms. As used herein, "lower alkyl" denotes an alkyl group having from 1-6 carbon atoms ("Ci_6-alkyl"). Examples of alkyl include methyl, ethyl, propyl, isopropyl, butyl (also known as n-butyl), iso-butyl, sec-butyl, tert-butyl, pentyl, hexyl, and the like. The alkyl group can be optionally enriched in deuterium, e.g., -CD3, - CD2CD3 and the like.
"Aryl" means a monovalent aromatic carbocyclic mono- , bi- or tricyclic ring system comprising 6 to 19 carbon ring atoms. Examples of aryl moieties include, but are not limited to, phenyl, naphthyl (or naphathelenyl), tolyl, xylyl, pyridinyl, quinolinyl, pyrimidinyl, imidazolyl, thiazolyl, anthracenyl, tetrazolyl, and fluorenyl. A particular aryl is phenyl.
"Cycloalkyl" means a substituted on unsubstituted stable monovalent saturated monocyclic, bicyclic or tricyclic system which consists of 3 to 10 ring carbon atoms. In particular embodiments cycloalkyl denotes a monovalent saturated monocyclic hydrocarbon group of 3 to 8 ring carbon atoms, more particular of 3 to 7 carbon atoms ("C3_ 7-cycloalkyl"). Particular cycloalkyl groups are monocyclic. Examples for monocyclic cycloalkyl are cyclopropyl, cyclobutnyl, cyclopentyl, cyclohexyl or cycloheptyl. Bicyclic means consisting of two saturated carbocycles having one or more carbon atoms in common. Examples for bicyclic cycloalkyl are bicyclo[2.2.1]heptanyl, or bicyclo[2.2.2]octanyl. Tricyclic means consisting of three saturated carbocycles having two or more carbon atoms in common. Examples of tricyclic cycloalkyl include adamantane.
"Fused" when referring to two or more rings, e.g. aryl fused with cycloalkyl, means that the rings have at least two atoms in common. An example of aryl fused with cycloalkyl is tetrahydronaphthalenyl. "Halogen" or "Halo" means at atom selected from F, CI, Br or I. In particular embodiments Halogen means F and CI.
"Heteroatom" means at atom selected from N, O or S.
"Heteroaryl" means a substituted or unsubstituted aromatic heterocyclic ring system containing up to two rings, at least one ring of which includes 1 , 2, or 3 heteroatoms, the remaining ring atoms being carbon. Examples of heteroaryl groups include, but are not limited to, thienyl (or thiophenyl), furyl (or furanyl), indolyl, pyrrolyl, pyridinyl, pyrazinyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, quinolinyl, isoquinolinyl, indazolyl, pyrimidinyl, imidazolyl, triazolyl , tetrazolyl, triazinyl, pyrazolyl, benzo[d]isoxazolyl, 2- oxo-2H-chromen-4-yl, benzo[d]isoxazolyl, benzo[b]thiophenyl, naphthyrydinyl and cinnolinyl.
In the case of a heteroaryl that is bicyclic it should be understood that one ring may be aryl while the other is heteroaryl and both may be independently substituted or unsubstituted. "Heterocyclyl," "heterocycle" or "heterocyclic ring" means a substituted or unsubstituted monovalent saturated or partly unsaturated mono- or bicyclic ring, non- aromatic hydrocarbon system of 3 to 9 ring atoms, comprising 1 , 2, or 3 ring heteroatoms selected from N, O and S, the remaining ring atoms being carbon. In particular embodiments, heterocycloalkyl is a monovalent saturated monocyclic ring system of 4 to 7 ring atoms, comprising 1 , 2, or 3 ring heteroatoms selected from N, O and S, the remaining ring atoms being carbon. Examples for monocyclic saturated heterocycloalkyl are aziridinyl, oxiranyl, azetidinyl, oxetanyl, pyrrolidinyl, tetrahydrofuranyl, tetrahydro-thienyl, pyrazolidinyl, imidazolidinyl, oxazolidinyl, isoxazolidinyl, thiazolidinyl, piperidinyl, tetrahydropyranyl, tetrahydrothiopyranyl, tetrahydrofuranyl, piperazinyl, morpholinyl, thiomo holinyl, l,l-dioxo-thiomorpholin-4-yl, azepanyl, diazepanyl, homopiperazinyl, or oxazepanyl. Examples of partly unsaturated heterocycloalkyl are dihydrofuryl, imidazolinyl, dihydro-oxazolyl, dihydro-oxadiazolyl, dihydro-triazolyl, tetrahydro-pyridinyl, tetrahydro- triazinyl or dihydropyranyl.
In the case of a heterocycle that is bicyclic it should be understood that one ring may be heterocycle while the other is cycloalkyl, and either or both may be independently substituted. Examples for bicyclic saturated heterocycloalkyl are 8-aza-bicyclo[3.2.1]octyl, quinuclidinyl, 8-oxa-3-aza-bicyclo[3.2.1]octyl, 9-aza-bicyclo[3.3.1]nonyl, 3-oxa-9-aza- bicyclo[3.3.1]nonyl, or 3-thia-9-aza-bicyclo[3.3.1]nonyl.
"IC50" refers to the concentration of a particular compound required to inhibit 50% of a specific measured activity. IC50 can be measured, inter alia, as is described subsequently in Example 48.
"Oxo" or ("Oxy") means =0.
"Pharmaceutically acceptable," such as pharmaceutically acceptable carrier, excipient, etc., means pharmacologically acceptable and substantially non-toxic to the subject to which the particular compound is administered. "Pharmaceutically acceptable salt" refers to conventional acid-addition salts or base- addition salts that retain the biological effectiveness and properties of the compounds of the present invention and are formed from suitable non-toxic organic or inorganic acids or organic or inorganic bases. Sample acid-addition salts include those derived from inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfamic acid, phosphoric acid and nitric acid, and those derived from organic acids such as p- toluenesulfonic acid, salicylic acid, methanesulfonic acid, oxalic acid, succinic acid, citric acid, malic acid, lactic acid, fumaric acid, trifluoroacetic acid and the like. Sample base- addition salts include those derived from ammonium, potassium, sodium and, quaternary ammonium hydroxides, such as for example, tetramethylammonium hydroxide. Chemical modification of a pharmaceutical compound (i.e. drug) into a salt is a technique well known to pharmaceutical chemists to obtain improved physical and chemical stability, hygroscopicity, flowability and solubility of compounds. See, e.g., Ansel et al, Pharmaceutical Dosage Forms and Drug Delivery Systems (1995) at pgs. 456-457.
"Pharmaceutically acceptable salt" refers to conventional acid-addition salts or base- addition salts that retain the biological effectiveness and properties of the compounds of the present invention and are formed from suitable non-toxic organic or inorganic acids or organic or inorganic bases. Sample acid-addition salts include those derived from inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfamic acid, phosphoric acid and nitric acid, and those derived from organic acids such as p- toluenesulfonic acid, salicylic acid, methanesulfonic acid, oxalic acid, succinic acid, citric acid, malic acid, lactic acid, fumaric acid, trifluoro acetic acid and the like. Sample base- addition salts include those derived from ammonium, potassium, sodium and, quaternary ammonium hydroxides, such as for example, tetramethylammonium hydroxide. Chemical modification of a pharmaceutical compound (i.e. drug) into a salt is a technique well known to pharmaceutical chemists to obtain improved physical and chemical stability, hygroscopicity, flowability and solubility of compounds. See, e.g., Ansel et al, Pharmaceutical Dosage Forms and Drug Delivery Systems (1995) at pgs. 456-457.
"Substituted," as in substituted alkyl, aryl or heteroaryl means that the substitution (i.e. replacement of one hydrogen atom) can occur at one or more positions and, unless otherwise indicated, that the substituents at each substitution site are independently selected from the specified options. The term "optionally substituted" refers to the fact that one or more hydrogen atoms of a chemical group (with one or more hydrogen atoms) can be, but does not necessarily have to be, substituted with another substituent.
The definitions described herein apply irrespective of whether the terms in question appear alone or in combination. It is contemplated that the definitions described herein can be appended to form chemically-relevant combinations, such as e.g. "heterocycloalkylaryl", "haloalkylheteroaryl" or "arylalkylheterocycloalkyl". The last member of the combination is the radical which is binding to the rest of the molecule. The other members of the combination are attached to the binding radical in reversed order in respect of the literal sequence, e.g. the combination arylalkylheterocycloalkyl refers to a heterocycloalkyl- radical which is substituted by an alkyl which is substituted by an aryl. As used in this application, if a formula or group appears to be missing a substituent, that is it appears the valence is not complete, it is presumed the missing substituent is an H.
In the structural formulae presented herein a broken bond (a) denotes that the substituent is below the plane of the paper and a wedged bond (b) denotes that the substituent is above the plane of the paper. embodiment, the present invention relates to compounds of Formula I
Figure imgf000007_0001
I wherein:
R1 is selected from H and halogen; R2 is selected from
• aryl that optionally may be substituted with lower alkyl, OR4, and halogen,
• aryl that is fused with cycloalkyl, and
• heteroaryl that optionally may be substituted with lower alkyl; R3 is selected from
• lower alkyl that optionally may be substituted with OR4 and aryl,
• cycloalkyl,
• heterocyclyl, and
• aryl;
R4 is selected from H and lower alkyl; n is 1 or 2; m is 0 or 1 ; and q is 0, 1 or 2; or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates toa compound of Formula I:
Figure imgf000008_0001
I wherein:
R is selected from H and halogen;
R2 is selected from • aryl that optionally may be substituted with Ci_6-alkyl, OR4, and halogen,
• aryl that is fused with C3-7-cycloalkyl, and
• heteroaryl that optionally may be substituted with Ci_6-alkyl;
R3 is selected from
• Ci-6-alkyl that optionally may be substituted with OR4 and aryl,
• C3-7-cycloalkyl,
• heterocyclyl, and
• aryl;
R4 is selected from H and Ci_6-alkyl; n is 1 or 2; m is 0 or 1 ; and q is 0, 1 or 2; or a pharmaceutically acceptable salt of the foregoing compound.
In one embodiment, the present invention relates to a compound as described herein wherein R1 is halogen, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R1 is H.
In one embodiment, the present invention relates to a compound as described herein wherein R2 is aryl that optionally may be substituted with OR4, halogen and Ci-6-alkyl, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R is phenyl or naphthalenyl, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R2 is heteroaryl that optionally may be substituted with Ci-6-alkyl, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R2 is selected from selected from quinolinyl, benzo[b]thiophenyl or indolyl. In one embodiment, the present invention relates to a compound as described herein wherein R3 is Ci_6-alkyl that optionally may be substituted with OR4 and aryl, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is Ci-6-alkyl substituted with phenyl, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is OR4 and R4 is H, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is C3_7-cycloalkyl, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is cyclohexyl or cyclopentyl, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R is aryl, or a pharmaceutically acceptable salt thereof. In one embodiment, the present invention relates to a compound as described herein wherein R3 is phenyl.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is heterocyclyl, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R is tetrahydropyran.
In one embodiment, the present invention relates to a compound as described herein wherein m is 0, n is 1 , and q is 0, or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R1 is H, R2 is aryl, R3 is Ci_6-alkyl, n is 1 and m and q are 0. In one embodiment, the present invention relates to a compound as described herein wherein R3 is Ci_6-alkyl, n is 1 and m is 0, said compound being selected from the group comprising: (S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro- lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride;
((S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride; (S)-N-(2-chloro-6-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(benzo[b]thiophen-4-yl)-2-((S)-3-methyl-2-((S)-2- (methylamino)propanamido) butanoyl)isoindoline-l -carboxamide hydrochloride ;
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2- (methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N- phenylisoindoline- 1 -carboxamide hydrochloride; N-(2-methoxyphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
N-(2-methoxyphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
N-benzyl-2-((S)-3-methyl-2-((S)-2- (methylamino)propanamido)butanoyl)isoindoline-l -carboxamide hydrochloride;
2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N- phenethylisoindoline-1 -carboxamide hydrochloride;
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- 1 -yl)isoindoline- 1 -carboxamide hydrochloride; (R)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- 1 -yl)isoindoline- 1 -carboxamide hydrochloride; (S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- 2-yl)isoindoline-l -carboxamide hydrochloride;
(S)-N-(2-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride; (S)-N-(2-chlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(5,6,7,8- tetrahydronaphthalen-1 -yl)isoindoline-l -carboxamide hydrochloride;
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(quinolin-8- yl)isoindoline-l -carboxamide hydrochloride;
N-(isoquinolin-l-yl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(l-methyl-lH-indol-4-yl)-2-((S)-3-methyl-2-((S)-2- (methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride; (S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methoxy-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((2S,3R)-3-hydroxy-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((S)-4-methyl-2-((S)-2-(methylamino)propanamido) pentanoyl)isoindoline-l -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-2-((S)-2-(methylamino)propanamido)-3- phenylbutanoyl)isoindoline-l -carboxamide hydrochloride; and
(S)-N-(2-fluoro-6-methylphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride; or a pharmaceutically acceptable salt of any of the foregoing compounds. In one embodiment, the present invention relates to a compound as described herein wherein R3 is Ci_6-alkyl, n is 2 and m is 0, said compound being selected from the group comprising:
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6-fluoro-phenyl)-amide hydrochloride;
6-Chloro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide;
6- Fluoro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide; (S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l -carboxamide hydrochloride;
(S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2- (methylamino)propanamido) butanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((2S,3R)-3-methoxy-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l -carboxamide hydrochloride;
N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide;
N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; N-(2,6-difluorophenyl)-6-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide;
7- chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; 7-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; and
6-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; or a pharmaceutically acceptable salt of any of the foregoing compounds.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is Ci_6-alkyl, n is 1 and m is 1, said compound being
(S)-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline-3 -carboxamide ; or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is C3-7-cycloalkyl and n is 1, said compound being selected from the group comprising:
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-2,3- dihydro-1 H-isoindole- 1 -carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride; and
(S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)isoindoline-l -carboxamide hydrochloride; or a pharmaceutically acceptable salt of either of the foregoing compounds.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is C3-7-cycloalkyl and n is 2, said compound being selected from the group comprising:
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-l, 2,3,4- tetrahydro-isoquinoline-1 -carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride; and
(S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)-l ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride; or a pharmaceutically acceptable salt of either of the foregoing compounds. In one embodiment, the present invention relates to a compound as described herein wherein R3 is heterocyclyl, said compound being selected from the group comprising:
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)isoindoline- 1 -carboxamide hydrochloride; and (S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride; or a pharmaceutically acceptable salt of either of the foregoing compounds.
In one embodiment, the present invention relates to a compound as described herein wherein R3 is aryl, said compound being
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- phenylacetyl)isoindoline-l -carboxamide hydrochloride; or a pharmaceutically acceptable salt of the foregoing compound.
In one embodiment, the present invention relates to a compound as described herein selected from the group comprising:
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro- lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride;
((S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-2,3- dihydro-lH-isoindole-l-carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride ; (S)-N-(2,6-difiuorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6-fluoro-phenyl)-amide hydrochloride;
6-Chloro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difiuoro-phenyl)-amide;
6-Fluoro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difiuoro-phenyl)-amide; (S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2-chloro-6-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride; (S)-N-(benzo[b]thiophen-4-yl)-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difiuorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difiuorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2-(methylamino)
propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)isoindoline-l -carboxamide hydrochloride; (S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difiuorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)-l ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride; and N-(2,6-difiuorophenyl)-7-fiuoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; or a pharmaceutically acceptable salt of each of the foregoing compounds.
In one embodiment, the present invention relates to a pharmaceutical composition comprising any of the compounds as described herein, or a pharmaceutically acceptable salt thereof, as an active ingredient together with a pharmaceutically acceptable carrier or excipient.
In one embodiment, the present invention relates to a compound as described herein for use as a therapeutically active substance. In one embodiment, the present invention relates to the use of a compound as described herein, or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for the therapeutic and/or prophylactic treatment of cancer.
In one embodiment, the present invention relates to the use of a compound as described herein, or a pharmaceutically acceptable salt thereof, for the therapeutic and/or prophylactic treatment of cancer.
In one embodiment, the present invention relates to a method of treating or ameliorating cancer comprising administering to a subject in need of such treatment a therapeutically effective amount of a compound as described herein. embodiment, the present invention relates to compounds of Formula I
Figure imgf000017_0001
I wherein:
R1 is selected from H, CI and F;
R2 is selected from
• phenyl,
• phenyl that is substituted once ore twice by a substituent selected from with F, CI, -CH3 and -OCH3,
• naphthyl,
• 5,6,7,8-tetrahydronaphthyl,
• benzo[b]thiophenyl,
• quinolinyl,
• isoquinolinyl, and
• indolyl that optionally may be substituted with -CH3;
R3 is selected from • isopropyl,
• tert-butyl,
• CH3-CH2-C(H,CH3)-,
• CH(CH3)2-CH2-,
• CH3-CH2-C(H,OCH3)-,
• CH3-C(H,OH)-,
• CH3-C(H,OCH3)-
• phenyl,
• phenyl-C(H,CH3)-,
• tetrahydro-2H-pyranyl,
• cyclopentyl, and
• cyclohexyl;
R4 is selected from H and lower alkyl; n is 1 or 2; m is 0 or 1 ; and q is 0, 1 or 2; or a pharmaceutically acceptable salt thereof.
In one embodiment, the present invention relates to compounds of Formula I
Figure imgf000018_0001
I wherein:
R1 is H;
R2 is selected from
• phenyl, • phenyl that is substituted once ore twice by a substituent selected from with F, CI, -CH3 and -OCH3, and
• naphthyl,
R3 is selected from
• isopropyl,
• tert-butyl,
• CH3-CH2-C(H,CH3)-,
• CH(CH3)2-CH2-,
• CH3-CH2-C(H,OCH3)-,
• CH3-C(H,OH)-, and
• CH3-C(H,OCH3)-
R4 is selected from H and lower alkyl; n is 1; m is 0; and q is 0; or a pharmaceutically acceptable salt thereof.
One embodiment of the invention relates to compounds of Formula I where R1 is halogen, or a pharmaceutically acceptable salt thereof. In a particular embodiment, R1 is F or CI.
Another embodiment of the invention relates to compounds of Formula I where R1 is H, or a pharmaceutically acceptable salt thereof.
Another embodiment of the invention relates to compounds of Formula I where R2 is aryl that optionally may be substituted with OR4, halogen and lower alkyl, or a pharmaceutically acceptable salt thereof. In a particular embodiment R2 is phenyl or naphthalenyl, each of which optionally may be substituted as defined above.
Another embodiment of the invention relates to compounds of Formula I where R is heteroaryl that optionally may be substituted with lower alkyl, or a pharmaceutically acceptable salt thereof. In a particular embodiment R2 is selected from quinolinyl, benzo[b]thiophenyl or indolyl.
Another embodiment of the invention relates to compounds of Formula I where R3 lower alkyl that optionally may be substituted with OR4 and aryl, or a pharmaceutically acceptable salt thereof. In a particular embodiment R3 is lower alkyl substituted with phenyl. In another embodiment R4 is H.
Another embodiment of the invention relates to compounds of Formula I where R is cycloalkyl, or a pharmaceutically acceptable salt thereof. In a particular embodiment R is cyclohexyl or cyclopentyl.
Another embodiment of the invention relates to compounds of Formula I where R3 is aryl, or a pharmaceutically acceptable salt thereof. In a particular embodiment R3 is phenyl.
Another embodiment of the invention relates to compounds of Formula I where R3 is heterocyclyl, or a pharmaceutically acceptable salt thereof. In a particular embodiment R3 is tetrahydropyran.
Another embodiment of the invention relates to compounds of Formula I where m is
0, or a pharmaceutically acceptable salt thereof.
Another embodiment of the invention relates to compounds of Formula I where n is
1, or a pharmaceutically acceptable salt thereof.
Another embodiment of the invention relates to compounds of Formula I where n is
2, or a pharmaceutically acceptable salt thereof.
Another embodiment of the invention relates to compounds of Formula I where q is 0, or a pharmaceutically acceptable salt thereof.
Another embodiment of the invention relates to compounds of Formula I where R1 is H, R2 is aryl, R3 is lower alkyl, n is 1 and m and q are 0.
Compounds according to the invention wherein R3 is alkyl that optionally may be substituted as defined above, n is 1, and m is 0 include: (S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro- lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride (Example 1);
((S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 7); (S)-N-(2-chloro-6-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline-l-carboxamide hydrochloride (Example 8);
(S)-N-(benzo[b]thiophen-4-yl)-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 9);
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)isoindoline-l-carboxamide hydrochloride (Example 10);
(S)-N-(2,6-difluorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2-(methylamino)
propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 11);
2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N- phenylisoindoline-l-carboxamide hydrochloride (Example 16); N-(2-methoxyphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 17);
N-(2-methoxyphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 18);
N-benzyl-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)isoindoline-l-carboxamide hydrochloride (Example 19);
2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N- phenethylisoindoline-l-carboxamide hydrochloride (Example 20);
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- l-yl)isoindoline-l-carboxamide hydrochloride (Example 21); (R)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- l-yl)isoindoline-l-carboxamide hydrochloride (Example 22); (S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- 2-yl)isoindoline-l-carboxamide hydrochloride (Example 23);
(S)-N-(2-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 24); (S)-N-(2-chlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 26);
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(5,6,7,8- tetrahydronaphthalen-l-yl)isoindoline-l-carboxamide hydrochloride (Example 27);
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(quinolin-8- yl)isoindoline-l-carboxamide hydrochloride (Example 28);
N-(isoquinolin-l-yl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 29);
(S)-N-(l-methyl-lH-indol-4-yl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 30); (S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methoxy-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline-l-carboxamide hydrochloride (Example 32);
(S)-N-(2,6-difluorophenyl)-2-((2S,3R)-3-hydroxy-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline-l-carboxamide hydrochloride (Example 33);
(S)-N-(2,6-difluorophenyl)-2-((S)-4-methyl-2-((S)-2-(methylamino)propanamido) pentanoyl)isoindoline-l-carboxamide hydrochloride (Example 35);
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-2-((S)-2-(methylamino)propanamido)-3- phenylbutanoyl)isoindoline-l-carboxamide hydrochloride (Example 40); and
(S)-N-(2-fluoro-6-methylphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline-l-carboxamide hydrochloride (Example 47); or a pharmaceutically acceptable salt of any of the foregoing compounds.
Compounds according to the invention wherein R3 is alkyl that optionally may be substituted as defined above, n is 2 and m is 0 include: (S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6-fluoro-phenyl)-amide hydrochloride (Example 4);
6-Chloro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide (Example 5);
6-Fluoro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide (Example 6);
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride (Example 15);
(S)-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l -carboxamide hydrochloride (Example 25);
(S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)-l,2,3,4-tetrahydroisoquinoline-l-carboxamide hydrochloride (Example 36);
(S)-N-(2,6-difluorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2- (methylamino)propanamido) butanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride (Example 38);
(S)-N-(2,6-difluorophenyl)-2-((2S,3R)-3-methoxy-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l -carboxamide hydrochloride (Example 39);
N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide (Example 41);
N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l-carboxamide (Example 42);
N-(2,6-difluorophenyl)-6-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l -carboxamide (Example 43); 7-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l-carboxamide (Example 44);
7-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l-carboxamide (Example 45); and
6-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l-carboxamide (Example 46); or a pharmaceutically acceptable salt of any of the foregoing compounds.
Compounds according to the invention wherein R3 is alkyl that optionally may be substituted as defined above, n is 1 and m is 1 include:
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-3-carboxylic acid (2,6-difiuoro-phenyl)-amide (Example 31); or a pharmaceutically acceptable salt thereof.
Compounds according to the invention wherein R3 is cycloalkyl and n is 1 include:
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-2,3- dihydro-lH-isoindole-l-carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride (Example 2); and
(S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)isoindoline-l-carboxamide hydrochloride (Example 13); or a pharmaceutically acceptable salt of either of the foregoing compounds.
Compounds according to the invention wherein R is cycloalkyl and n is 2 include:
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride (Example 3); and
(S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride (Example 37); or a pharmaceutically acceptable salt of either of the foregoing compounds.
Compounds according to the invention wherein R3 is heterocyclyl and n is 1 include:
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)isoindoline-l-carboxamide hydrochloride (Example 12); or a pharmaceutically acceptable salt thereof.
Compounds according to the invention wherein R3 is heterocyclyl and n is 2 include:
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride (Example 14); or a pharmaceutically acceptable salt of the foregoing compound.
Compounds according to the invention wherein R3 is aryl and n is 1 include:
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- phenylacetyl)isoindoline- 1 -carboxamide hydrochloride (Example 34); or a pharmaceutically acceptable salt of the foregoing compound.
Another embodiment of the invention relates to the following compounds:
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro- lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride (Example 1); ((S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-2,3- dihydro-lH-isoindole-l-carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride (Example 2);
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride (Example 3); (S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6-fluoro-phenyl)-amide hydrochloride (Example 4);
6-Chloro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide (Example 5);
6-Fluoro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide (Example 6);
(S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l-carboxamide hydrochloride (Example 7); (S)-N-(2-chloro-6-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline-l-carboxamide hydrochloride (Example 8);
(S)-N-(benzo[b]thiophen-4-yl)-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)isoindoline-l-carboxamide hydrochloride (Example 9);
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)isoindoline-l-carboxamide hydrochloride (Example 10);
(S)-N-(2,6-difluorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2-(methylamino)
propanamido)butanoyl)isoindoline-l-carboxamide hydrochloride (Example 11);
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)isoindoline-l-carboxamide hydrochloride (Example 12); (S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)isoindoline-l-carboxamide hydrochloride (Example 13);
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride (Example 14); (S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride (Example 15); and N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l-carboxamide (Example 42); or a pharmaceutically acceptable salt of any of the foregoing compounds.
The compounds of Formula I as well as their salts have at least one asymmetric carbon atom and therefore may be present as mixtures of different stereoisomers. The various isomers can be isolated by known separation methods, e.g., chromatography.
Compounds disclosed herein and covered by formula I above may exhibit tautomerism or structural isomerism. It is intended that the invention encompasses any tautomeric or structural isomeric form of these compounds, or mixtures of such forms, and is not limited to any one tautomeric or structural isomeric form depicted in the formulas above.
Dosages
The compounds of the invention preferably bind to BIR domains of an IAP preventing the IAP from binding to other proteins. Examples of Bir binding proteins include, but are not limited to, caspase 3, caspase 7, caspase 9, Smac and the like. Examples of IAPs include, but are not limited to, XIAP, cIAPl , cIAP2 or NAIP. In one aspect, the compound of the invention bind to the BIR2 and/or BIR3 domains of XIAP, cIAPland/or cIAP2. In another aspect, the compounds of the invention bind to the BIR2 domain of XIAP, cIAP land/or cIAP2. Compounds of the invention are useful for inducing apoptosis in cells or sensitizing cells to apoptotic signals, in particular cancer cells. Apoptotic signals can be induced in cancer cells by, e.g., radiation therapy or antineoplastic chemotherapy. Alternatively, apoptotic signals can be induced in cancer cells by activation of the death receptors by death receptor agonists. Death receptor agonists can be naturally occurring, e.g., tumor necrosis factor a, (TNF-a) or non-naturally occurring, e.g., a synthetic antibody such as a DR4 or DR5 antibody.
The compounds of the present invention are thus useful in the amelioration, control or treatment of cell proliferative disorders such as, in particular, oncological disorders. These compounds and formulations containing said compounds are anticipated to be useful in the treatment or control of blood cancers, such as, for example, acute myeloid leukemia, or solid tumors, such as, for example, breast, colon, lung and prostate tumors. A "therapeutically effective amount" or "effective amount" of a compound in accordance with this invention means an amount of compound that is effective to prevent, alleviate or ameliorate symptoms of disease or prolong the survival of the subject being treated. Determination of a therapeutically effective amount is within the skill in the art. The therapeutically effective amount or dosage of a compound according to this invention can vary within wide limits and may be determined in a manner known in the art. Such dosage will be adjusted to the individual requirements in each particular case including the specific compound(s) being administered, the route of administration, the condition being treated, as well as the patient being treated. In general, in the case of oral or parenteral administration to adult humans weighing approximately 70 Kg, a daily dosage of about 10 mg to about 10,000 mg, preferably from about 200 mg to about 1 ,000 mg, should be appropriate, although the upper limit may be exceeded when indicated. The daily dosage can be administered as a single dose or in divided doses, or for parenteral administration, it may be given as one or more bolus injections or as a continuous infusion. Pharmaceutical preparations useful in the practice of the invention, i.e., comprising the compounds of the invention can be administered internally, such as orally (e.g. in the form of tablets, coated tablets, dragees, hard and soft gelatin capsules, solutions, emulsions or suspensions), nasally (e.g. in the form of nasal sprays) or rectally (e.g. in the form of suppositories). However, the administration can also be effected parentally, such as intramuscularly or intravenously (e.g. in the form of injection solutions). Moreover, administration can be effected topically (e.g. in the form of ointments, creams or oils).
Compositions/Formulations
In an alternative embodiment, the present invention includes pharmaceutical compositions comprising at least one compound of formula I, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient and/or carrier.
These pharmaceutical compositions can be suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration. The formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated, as well as the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of a formula I compound which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 1 percent to about ninety-nine percent of active ingredient, preferably from about 5 percent to about 70 percent, most preferably from about 10 percent to about 30 percent. Methods of preparing these formulations or compositions include the step of bringing into association a compound of the present invention with the carrier and, optionally, one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association a compound of the present invention with liquid carriers, or finely divided solid carriers, or both, and then, if necessary, shaping the product.
The compounds of Formula I and their pharmaceutically acceptable salts and esters can be processed with pharmaceutically inert, inorganic or organic adjuvants for the production of tablets, coated tablets, dragees and hard gelatin capsules. Lactose, polyvinylpyrrolidone, hydroxypropylmethylcellulose, hydroxypropyl-cellulose, microcrystalline cellulose, corn starch or derivatives thereof, talc, stearic acid or its salts etc. can be used, for example, as such adjuvants for tablets, dragees and hard gelatin capsules.
Suitable adjuvants for soft gelatin capsules, are, for example, vegetable oils, waxes, fats, semi-solid substances and liquid polyols, etc. Suitable adjuvants for the production of solutions and syrups are, for example, H20, polyols, saccharose, invert sugar, glucose, etc. Suitable adjuvants for injection solutions are, for example, H20, alcohols, polyols, glycerol, vegetable oils, etc. Suitable adjuvants for suppositories are, for example, natural or hardened oils, waxes, fats, semi-solid or liquid polyols, etc. Suitable adjuvants for topical preparations are glycerides, semi-synthetic and synthetic glycerides, hydrogenated oils, liquid waxes, liquid paraffins, liquid fatty alcohols, sterols, polyethylene glycols and cellulose derivatives.
Moreover, the pharmaceutical preparations can contain preservatives, solubilizers, viscosity-increasing substances, stabilizers, wetting agents, emulsifiers, sweeteners, colorants, flavors, salts for varying the osmotic pressure, buffers, masking agents or antioxidants. They can also contain other therapeutic substances. The compounds in the present invention (compounds of general Formula I) can be prepared using the general reaction scheme set out in Scheme 1 below.
Scheme 1 Deprot
Figure imgf000030_0001
Deprotection
Figure imgf000030_0002
The amino group in compounds of general formula 2 can be protected with a suitable protecting group, PGl , to provide compounds of general formula 3. Compounds of general formula 3 can be reacted with a chlorinating agent, e.g., POCI3, and an amine of general formula 4 to afford compounds of general formula 5. The protecting group PGl in compounds of general formula 5 can be removed to afford compounds of general formula 6. Compounds of general formula 6 can treated with a suitably protected a-amino acid of general formula 7 under dehydrating conditions to provide compounds of general formula 8. The protecting group PG2 in compounds of general formula 8 can be removed to afford compounds of general formula 9. Compounds of general formula 9 can treated with a suitably protected a-amino acid of general formula 10 under dehydrating conditions to provide compounds of general formula 11. The protecting group PG3 in compounds of general formula 11 can be removed to afford compounds of general formula I.
Methods to perform the above described reactions and processes would be apparent to those of ordinary skill in the art based on the present disclosure, or can be deduced in analogy from the examples. Starting materials are commercially available or can be made by methods analogous to those described in the Examples below.
Crystal Forms
When the compounds of the invention are solids, it is understood by those skilled in the art that these compounds, and their salts, may exist in different crystal or polymorphic forms, all of which are intended to be within the scope of the present invention and specified formulas.
Examples
The compounds of the present invention may be synthesized according to known techniques. The following examples and references are provided to aid the understanding of the present invention. The examples are not intended, however, to limit the invention, the true scope of which is set forth in the appended claims. The names of the final products in the examples were generated using AutoNom 2000 Add-in v4.0 SP2 (function in ISIS Draw, Elsevier/MDL), or AutoNom 2000 TT v4.01.305 (Elsevier/MDL), or functions available in ChemDraw Pro Control 11.0.2 (Cambridge Soft Corp.), or Struct=Name feature of electronic notebooks.
Example 1
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro- lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride
Figure imgf000031_0001
Step 1 : To a solution of 2-(tert-butoxycarbonyl)isoindoline-l-carboxylic acid (500 mg, 1.9 mmol, Eq: 1.00) and 2,6-difluoroaniline (294 mg, 2.28 mmol, Eq: 1.2) in pyridine (10 mL) at 0 °C was added POCI3 (437 mg, 266 μί, 2.85 mmol, Eq: 1.5). The reaction was warmed to RT and stirred for 2 h. The mixture was evaporated and water was added and the resulting mixture was extracted with EtOAc. The combined organics were washed with water, brine, dried with MgSC>4 and concentrated in vacuo. The crude material was purified by flash chomatography to give l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro-isoindole-2- carboxylic acid tert-butyl ester (462 mg) as a light yellow foam.
Step 2: To a solution of l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro-isoindole-2- carboxylic acid tert-butyl ester (460 mg, 1.23 mmol, Eq: 1.00) in CH2CI2 (6 mL) was added TFA (2 mL) dropwise. The reaction was stirred at RT for 1 h. The solvent was evaporated to afford 2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate which was used without further purification.
Step 3: To a solution of 2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6-difluoro- phenyl)-amide trifluoroacetate (477 mg, 1.23 mmol, Eq: 1.00), (S)-2-(tert- butoxycarbonylamino)-3-methylbutanoic acid (267 mg, 1.23 mmol, Eq: 1.00) and HATU (514 mg, 1.35 mmol, Eq: 1.1) in DMF (1.85 mL) at 0 °C was added DIEA
(476 mg, 644 μί, 3.69 mmol, Eq: 3). The reaction was stirred at RT for 1 h. Water was added and the mixture was extracted with EtOAc. The combined organics were washed with water, brine, dried with MgSC>4 and concentrated in vacuo. The crude material was purified by flash chomatography to afford two diastereomers. The less polar diastereomer was assigned as {(S)-l-[(S)-l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro-isoindole-2- carbonyl]-2-methyl-propyl}-carbamic acid tert-butyl ester (220 mg) which was isolated as a white foam. Step 4: To a solution of {(S)-l-[(S)-l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro- isoindole-2-carbonyl]-2-methyl-propyl} -carbamic acid tert-butyl (210 mg, 443 μηιοΐ, Eq: 1.00) in CH2CI2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh. The solution was evaporated to afford (S)-2-((S)-2-amino-3-methyl-butyryl)-2,3- dihydro-lH-isoindole-1 -carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate which was used without further purification.
Step 5: To a solution of (S)-2-((S)-2-amino-3-methyl-butyryl)-2,3-dihydro-lH- isoindole-1 -carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate (216 mg, 443 μηιοΐ, Eq: 1.00), (S)-2-(tert-butoxycarbonyl-methyl-amino)-propionic acid (83.8 mg, 443 μηιοΐ, Eq: 1.00), HATU (185 mg, 487 μιηοΐ, Eq: 1.1) in DMF (500 μί) at 0 °C was added DIEA (172 mg, 232 μΐ,, 1.33 mmol, Eq: 3). The reaction was stirred at RT for 1 h, diluted with water and extracted with EtOAc. The combined organics were washed with water, brine, dried with MgS04 and concentrated in vacuo. The crude material was purified by flash chomatography to give ((S)-l-{(S)-l-[(S)-l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro- isoindole-2-carbonyl]-2-methyl-propylcarbamoyl} -ethyl)-methyl-carbamic acid tert-butyl ester ester (220 mg) as a white foam.
Step 6; A solution of acetyl chloride (552 mg, 500 μΐ,, 7.03 mmol, Eq: 18.0) in MeOH (2 mL) was added to a vial containing ((S)-l-{(S)-l-[(S)-l-(2,6-difluoro- phenylcarbamoyl)- 1 ,3-dihydro-isoindole-2-carbonyl]-2-methyl-propylcarbamoyl} -ethyl)- methyl-carbamic acid tert-butyl ester ester (218 mg, 390 μηιοΐ, Eq: 1.00). The mixture was stirred at RT for 1 h. The mixture was evaporated and the resulting solid was dissolved in MeCN (3mL) and water (1 mL) and the solution lyophilized to give (S)-2-[(S)-3-methyl-2- ((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride (175 mg) as a white powder, m/z = 459 (M+H).
Example 2
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-2,3- dihydro-lH-isoindole-l-carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride
Figure imgf000033_0001
Step 1 : To the solution of (S)-2-(tert-butoxycarbonyl)isoindoline-l-carboxylic acid (300 mg, 1.14 mmol, Eq: 1.00) and 2,6-difiuoroaniline (177 mg, 1.37 mmol, Eq: 1.2) in pyridine (3.00 mL) at 0 °C was added POCl3 (262 mg, 159 μί, 1.71 mmol, Eq: 1.5). The mixture was warmed to RT and stirred for 2 h. The mixture was evaporated, water was added and the mixture extracted with EtOAc. The combined organics were washed with water, brine, dried with MgS04 and concentrated in vacuo. The crude material was purified by flash chomatography to give (S)-l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro- isoindole-2-carboxylic acid tert-butyl ester (298 mg) as a light yellow foam.
Step 2: To a solution of (S)-l-(2,6-difluoro-phenylcarbamoyl)-l,3-dihydro- isoindole-2-carboxylic acid tert-butyl ester in CH2CI2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh and the mixture evaporated to afford (S)- 2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide which was used without further purification.
Step 3: To a solution of (S)-2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6- difluoro-phenyl)-amide (160 mg, 412 μηιοΐ, Eq: 1.00), (S)-2-(tert-butoxycarbonylamino)-2- cyclohexylacetic acid (106 mg, 412 μηιοΐ, Eq: 1.00) and HATU (172 mg, 453 μηιοΐ, Eq: 1.1) in DMF (500 μί) at 0 °C was added DIEA (160 mg, 216 μί, 1.24 mmol, Eq: 3). The reaction was stirred at RT for 1 h, diluted with water and extracted with EtOAc. The combined organics were washed with water, brine, dried with MgSC>4 and concentrated in vacuo. The crude material was purified by flash chomatography to give {(S)-l-cyclohexyl- 2-[(S)-l -(2,6-difluoro-phenyl-carbamoyl)-l ,3-dihydro-isoindol-2-yl]-2-oxo-ethyl} - carbamic acid tert-butyl ester (174 mg) as a white foam.
Step 4: To a solution of {(S)-l-cyclohexyl-2-[(S)-l-(2,6-difiuoro-phenylcarbamoyl)- l,3-dihydro-isoindol-2-yl]-2-oxo-ethyl} -carbamic acid tert-butyl ester (174mg, 339 μηιοΐ, Eq: 1.00) in CH2CI2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh. The mixture was evaporated to afford (S)-2-((S)-2-amino-2-cyclohexyl-acetyl)- 2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate which was used without further purification.
Step 5: To a solution of (S)-2-((S)-2-amino-2-cyclohexyl-acetyl)-2,3-dihydro-lH- isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate (179 mg, 339 μηιοΐ, Eq: 1.00), (S)-2-(tert-butoxycarbonyl-methyl-amino)-propionic acid (64.2 mg, 339 μηιοΐ, Eq: 1.00), HATU (142 mg, 373 μιηοΐ, Eq: 1.1) in DMF (1 mL) at 0 °C was added DIEA (132 mg, 178 μΐ,, 1.02 mmol, Eq: 3). The reaction was stirred at RT for 1 h, diluted with water and extracted with EtOAc. The combined organics were washed with water, brine, dried with MgS04 and concentrated in vacuo. The crude material was purified by flash chomatography to give ((S)-l-{(S)-l-cyclohexyl-2-[(S)-l-(2,6-difluoro-phenylcarbamoyl)- 1 ,3-dihydro-isoindol-2-yl]-2-oxo-ethylcarbamoyl} -ethyl)-methyl-carbamic acid tert-butyl ester (174 mg) as a white foam. Step 6: A solution of acetyl chloride (552 mg, 500 μΐ., 7.03 mmol, Eq: 24.2) in MeOH (2mL) was added to a vial containing ((S)-l-{(S)-l-Cyclohexyl-2-[(S)-l-(2,6- difluoro-phenylcarbamoyl)-l ,3-dihydro-isoindol-2-yl]-2-oxo-ethylcarbamoyl}-ethyl)- methyl-carbamic acid tert-butyl ester (174 mg, 291 μηιοΐ, Eq: 1.00). The mixture was stirred at RT for 1 h. The solvent was evaporated and the resulting solid was redissolved in MeCN (3mL) and water (1 mL). It was lyophilized to give (S)-2-[(S)-2-Cyclohexyl-2-((S)- 2-methylamino-propionylamino)-acetyl]-2,3-dihydro-lH-isoindole-l-carboxylic acid (2,6- difluoro-phenyl)-amide hydrochloride (148 mg) as a white powder, m/z= 499 (M+H).
Example 3
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride
Figure imgf000035_0001
Step 1 : To the solution of (S)-3,4-dihydro-lH-isoquinoline-l,2-dicarboxylic acid 2- tert-butyl ester (500 mg, 1.8 mmol, Eq: 1.00) and 2,6-difiuoroaniline (279 mg, 2.16 mmol, Eq: 1.2) in pyridine (10.0 mL) at 0 °C was added POCl3 (415 mg, 252 μΐ,, 2.7 mmol, Eq: 1.5). The mixture was warmed to RT and stirred for 2 h. The solvent was evaporated, water was added and the mixture extracted with EtOAc. The combined organics were washed with water, brine, dried with MgSC>4 and concentrated in vacuo. The crude material was purified by flash chomatography to give (S)-l-(2,6-difluoro-phenylcarbamoyl)-3,4-dihydro- lH-isoquinoline-2-carboxylic acid tert-butyl ester (380 mg) as a white foam.
Step 2: To a solution of (S)-l-(2,6-difluoro-phenylcarbamoyl)-3,4-dihydro-lH- isoquinoline-2-carboxylic acid tert-butyl ester (50 mg, 129 μηιοΐ, Eq: 1.00) in CH2CI2 (6 mL) was added TFA (2 mL) dropwise. The reaction was stirred at RT for lh. The mixture was evaporated to provide (S)-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6- difluoro-phenyl)-amide trifluoroacetate which was used without further purification. Step 3: To a solution of (S)-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6- difluoro-phenyl)-amide trifluoroacetate (52 mg, 129 μηιοΐ, Eq: 1.00), (S)-2-(tert- butoxycarbonylamino)-2-cyclohexylacetic acid (33.3 mg, 129 μηιοΐ, Eq: 1.00) and HATU (54.1 mg, 142 μιηοΐ, Eq: 1.1) in DMF (300 μί) at 0 °C was added DIEA (50.1 mg, 67.7 μί, 388 μηιοΐ, Eq: 3). The reaction was stirred at RT for 1 h diluted with water and extracted with EtOAc. The combined organics were washed with water, brine, dried with MgS04 and concentrated in vacuo. The crude material was purified by flash chomatography to give {(S)-l-cyclohexyl-2-[(S)-l-(2,6-difiuoro-phenylcarbamoyl)-3,4-dihydro-lH-isoquinolin-2- yl]-2-oxo-ethyl}-carbamic acid tert-butyl ester (62 mg) as a white foam. Step 4: To a solution of {(S)-l-cyclohexyl-2-[(S)-l-(2,6-difiuoro-phenylcarbamoyl)-
3,4-dihydro-lH-isoquinolin-2-yl]-2-oxo-ethyl}-carbamic acid tert-butyl ester (62 mg, 118 μηιοΐ, Eq: 1.00) in CH2CI2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh. The mixture was evaporated to afford (S)-2-((S)-2-amino-2- cyclohexyl-acetyl)-l,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide trifluoroacetate which was used without further purification.
Step 5: To a solution of (S)-2-((S)-2-amino-2-cyclohexyl-acetyl)-l,2,3,4-tetrahydro- isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate (63.6 mg, 117 μηιοΐ, Eq: 1.00), (S)-2-(tert-butoxycarbonyl-methyl-amino)-propionic acid (22.2 mg, 117 μιηοΐ, Eq: 1.00), HATU (49.1 mg, 129 μιηοΐ, Eq: 1.1) in DMF (500 £L) at 0 °C was added DIEA (45.5 mg, 61.5 μΐ,, 352 μηιοΐ, Eq: 3). The reaction was stirred at RT for 1 h diluted with water and extracted with EtOAc. The combined organics were washed with water, brine, dried with MgS04 and concentrated in vacuo. The crude material was purified by flash chomatography to give ((S)-l-{(S)-l-cyclohexyl-2-[(S)-l-(2,6-difiuoro- phenylcarbamoyl)-3 ,4-dihydro- 1 H-isoquinolin-2-yl]-2-oxo-ethylcarbamoyl} -ethyl)-methyl- carbamic acid tert-butyl ester (58 mg) as a white foam.
Step 6: A solution of acetyl chloride (552 mg, 500 μΐ,, 7.03 mmol, Eq: 74.3) in MeOH (2mL) was added to a vial containing ((S)-l-{(S)-l-cyclohexyl-2-[(S)-l-(2,6- difluoro-phenylcarbamoyl)-3 ,4-dihydro-l H-isoquinolin-2-yl]-2-oxo-ethylcarbamoyl} - ethyl)-methyl-carbamic acid tert-butyl ester (58 mg, 94.7 μηιοΐ, Eq: 1.00). The mixture was stirred at RT for 1 h. The solvent was evaporated and the resulting solid was dissolved in MeCN (3mL) and water (1 mL) and the solution lyophilized to give (S)-2-[(S)-2- cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-l,2,3,4-tetrahydro-isoquinoline- 1-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride (50 mg) as a white powder (50 mg), m/z = 513 (M+H). Example 4
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l ,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6-fluoro-phenyl)-amide hydrochloride
Figure imgf000037_0001
Step 1 : To the solution of (S)-3,4-dihydro-lH-isoquinoline-l,2-dicarboxylic acid 2- tert-butyl ester (100 mg, 361 μηιοΐ, Eq: 1) and 2-chloro-6-fiuoroaniline (63.0 mg, 433 μηιοΐ, Eq: 1.2) in pyridine (2.00 mL) at 0 °C was added POCL3 (82.9 mg, 50.4 μί, 541 μιηοΐ, Eq: 1.5). Reaction was warmed to RT and stirred for 2 h. The mixture was evaporated and water was added to the residue. The mixture was extracted with EtOAc, the combined organics were washed with water, brine, dried with MgS04 and concentrated in vacuo. The crude material was purified by flash chomatography to give (S)-l-(2-chloro-6-fiuoro- phenylcarbamoyl)-3,4-dihydro-lH-isoquinoline-2-carboxylic acid tert-butyl ester (79 mg) as a white solid.
Step 2: To a solution of (S)-l-(2-chloro-6-fluoro-phenylcarbamoyl)-3,4-dihydro-lH- isoquinoline-2-carboxylic acid tert-butyl ester (78 mg, 193 μηιοΐ, Eq: 1.00) in CH2CI2 (6 mL) was added TFA (2 mL) dropwise. The reaction was stirred at RT for lh. The mixture was evaporated to afford (S)-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6- fluoro-phenyl)-amide trifluoroacetate which was used without further purification.
Step 3: To a solution of (S)-l,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2- chloro-6-fluoro-phenyl)-amide trifluoroacetate (80 mg, 191 μηιοΐ, Eq: 1.00), (S)-2-(tert- butoxycarbonylamino)-3-methylbutanoic acid (41.5 mg, 191 μηιοΐ, Eq: 1.00) and HATU (79.9 mg, 210 μιηοΐ, Eq: 1.1) in DMF (500 μί) at 0 °C was added DIEA (74.1 mg, 100 μί, 573 μηιοΐ, Eq: 3). The reaction was stirred at RT for 1 h, diluted with water and extracted with EtOAc. The combined organics were washed with water, brine, dried with MgS04 and concentrated in vacuo. The crude material was purified by flash chomatography to give {(S)-l -[(S)- 1 -(2-chloro-6-fluoro-phenylcarbamoyl)-3 ,4-dihydro- lH-isoquinoline-2- carbonyl]-2-methyl-propyl}-carbamic acid tert-butyl ester (47 mg) as a white foam. Step 4: To a solution of {(S)-l-[(S)-l-(2-chloro-6-fiuoro-phenylcarbamoyl)-3,4- dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propyl}-carbamic acid tert-butyl ester (47 mg, 93.3 μηιοΐ, Eq: 1.00) in CH2CI2 (3 mL) was added TFA (1 mL) dropwise. The reaction was stirred at RT for lh. The mixture was evaporated to provide (S)-2-((S)-2-amino-3- methyl-butyryl)-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6-fiuoro- phenyl)-amide trifiuoroacetate which was used without further purification.
Step 5: To a solution of (S)-2-((S)-2-amino-3-methyl-butyryl)-l,2,3,4-tetrahydro- isoquinoline-1 -carboxylic acid (2-chloro-6-fluoro-phenyl)-amide trifiuoroacetate (48 mg, 92.7 μηιοΐ, Eq: 1.00), (S)-2-(tert-butoxycarbonylamino)propanoic acid (17.5 mg, 92.7 μηιοΐ, Eq: 1.00), HATU (38.8 mg, 102 μιηοΐ, Eq: 1.1) in DMF (300μί) at 0 °C was added DIEA (35.9 mg, 48.6 μΐ,, 278 μmol, Eq: 3). The reaction was stirred at RT for 1 h, diluted with water and extracted with EtOAc. The combined organics were washed with water, brine, dried with MgSC>4 and concentrated in vacuo. The crude material was purified by flash chomatography to give ((S)-l-{(S)-l-[(S)-l-(2-chloro-6-fluoro-phenylcarbamoyl)-3,4- dihydro-1 H-isoquinoline-2-carbonyl]-2-methyl-propylcarbamoyl} -ethyl)-methyl-carbamic acid tert-butyl ester (36 mg) as a white foam.
Step 6: A solution of acetyl chloride (552 mg, 500 μΐ,, 7.03 mmol, Eq: 115) in MeOH (2mL) was added to a vial containing ((S)-l-{(S)-l-[(S)-l-(2-chloro-6-fluoro- phenylcarbamoyl)-3,4-dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propylcarbamoyl}- ethyl)-methyl-carbamic acid tert-butyl ester (36 mg, 61.1 μηιοΐ, Eq: 1.00). The mixture was stirred at RT for 1 h. The solvent was evaporated and the resulting solid was dissolved in MeCN (3mL) and water (1 mL) which was lyophilized to give (S)-2-[(S)-3-methyl-2-((S)- 2-methylamino-propionylamino)-butyryl]- 1 ,2 ,3 ,4-tetrahydro-isoquinoline- 1 -carboxylic acid (2-chloro-6-fiuoro-phenyl)-amide hydrochloride (30 mg) as a white powder, m/z = 489 (M+H).
Example 5
6-Chloro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-1 -carboxylic acid (2,6-difiuoro-phenyl)-amide
Figure imgf000039_0001
Step 1 : In a 50 niL round-bottomed flask, 2-(tert-butoxycarbonyl)-6-chloro-l,2,3,4- tetrahydroisoquinoline-l-carboxylic acid (0.5 g, 1.6 mmol, Eq: 1.00), 2,6-difluoroaniline (228 mg, 190 μΐ, 1.76 mmol, Eq: 1.1) and TEA (487 mg, 671 μΐ, 4.81 mmol, Eq: 3) were combined with DCM (10 mL) to give a colorless solution and phosphorus oxychloride (295 mg, 179 μΐ, 1.92 mmol, Eq: 1.2) was added. After 2 d, the reaction was diluted with DCM and washed with 1 N HC1, water and brine. The organic layer was dried over Na2S04 and concentrated in vacuo to afford 0.6076g 6-chloro-l-(2,6-difluoro-phenylcarbamoyl)-3,4- dihydro-lH-isoquinoline-2-carboxylic acid tert-butyl ester as a brown foam which was used without purification. 89.6 % MS m/z 322.9 (M-BOC)
Step 2: In a 50 mL pear-shaped flask, 6-chloro-l-(2,6-difluoro-phenylcarbamoyl)- 3,4-dihydro-lH-isoquinoline-2-carboxylic acid tert-butyl ester (0.6 g, 1.42 mmol, Eq: 1.00) was combined with DCM (25 mL) to give a light brown solution. TFA (4.85 g, 3.28 mL, 42.6 mmol, Eq: 30) was added. After lh, the reaction was concentrated, the residue dissolved in EtOAc and the mixture washed with 1 N NaOH and brine. The organic layer was dried over Na2S04 and concentrated in vacuo to afford 0.3937g 6-chloro-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide as a brown oil which was used without purification. 86.0 % MS m/z 323.0 (M+H)
Step 3: In a 100 mL round-bottomed flask, BOC-VAL-OH (315 mg, 1.45 mmol, Eq: 1.2), 6-chloro-l ,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide (0.39 g, 1.21 mmol, Eq: 1.00) and HATU (551 mg, 1.45 mmol, Eq: 1.2) were combined with DMF (10 mL) to give a brown solution and TEA (367 mg, 505 μΐ, 3.63 mmol, Eq: 3) was added. After 3h, the reaction mixture was diluted with EtOAc and washed with 1 :1 sat NaHCCVbrine and brine. The organic layer was dried over Na2S04 and concentrated in vacuo. The crude material was purified by flash chromatography to afford 0.3579 g {(S)-l-[6-chloro-l-(2,6-difluoro-phenylcarbamoyl)-3,4-dihydro-lH-isoquinoline- 2-carbonyl]-2-methyl-propyl}-carbamic acid tert-butyl ester as light yellow foam. 56.7 % MS m/z 522.0 (M+H) Step 4: In a 100 niL pear-shaped flask, tert-butyl (2S)-l-(6-chloro-l-(2,6- difluorophenylcarbamoyl)-3 ,4-dihydroisoquinolin-2( 1 H)-yl)-3 -methyl- 1 -oxobutan-2- ylcarbamate (0.3579 g, 686 μηιοΐ, Eq: 1.00) was combined with DCM (20 mL) to give a light yellow solution and TFA (2.35 g, 1.58 mL, 20.6 mmol, Eq: 30) was added. After 1 h, the reaction was concentrated, the residue dissolved in EtOAc and the mixture washed with 1 N NaOH and brine. The organic layer was dried over Na2S04 and concentrated in vacuo to afford 0.2377g 2-((S)-2-amino-3-methyl-butyryl)-6-chloro-l,2,3,4-tetrahydro- isoquinoline-l-carboxylic acid (2,6-difiuoro-phenyl)-amide as light yellow foam which was used without purification. 82.2 % MS m/z 422.1 (M+H) Step 5: In a 50 mL flask, 2-((S)-2-amino-3-methyl-butyryl)-6-chloro-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide (0.2377 g, 563 μηιοΐ, Eq: 1.00), BOC-N-ME-ALA-OH (137 mg, 676 μιηοΐ, Eq: 1.2) and HATU (257 mg, 676 μηιοΐ, Eq: 1.2) were combined with DMF (6 mL) to give a light yellow solution and TEA(171 mg, 236 μΐ, 1.69 mmol, Eq: 3) was added. After 2 h, the reaction mixture was diluted with EtOAc and washed with brine. The organic layer was dried over Na2S04 and concentrated in vacuo. The crude material was purified by flash chromatography to afford 0.1976 g ((S) - 1 - { (S)- 1 -[6-chloro-l -(2,6-difiuoro-phenylcarbamoyl)-3 ,4-dihydro- 1 H- isoquinoline-2-carbonyl]-2-methyl-propylcarbamoyl} -ethyl)-methyl-carbamic acid tert- butyl ester as white foam. 57.8 % MS m/z 607.1 (M+H) Step 6: In a 20 mL vial, ((S)-1-{(S)-1 -[6-chloro-l -(2,6-difluoro-phenylcarbamoyl)-
3,4-dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propylcarbamoyl} -ethyl)-methyl- carbamic acid tert-butyl ester (0.1976 g, 325 μηιοΐ, Eq: 1.00) was combined with DCM (6 mL) to give a colorless solution and TFA (1.11 g, 752 μΐ, 9.76 mmol, Eq: 30) was added. After 1 h, the reaction was concentrated, the residue dissolved in EtOAc, washed with 1 N NaOH and brine. The organic layer was dried over Na2S04 and concentrated in vacuo to afford 125.8 mg of a mixture of diastereomers as white foam. The diastereomers were separated by supercritical fluid chromatography (SFC) using a 220 mm Diacel IA column, 25 % EtOH, 70 mL/min. Each diastereomer was isolated and lyophilized from MeCN/H20. The first compound eluted afforded 50.2 mg of white solid. The second compound eluted afforded 47.2mg of the title compound as white solid whose structure was assigned based on the activity in the TR-FRET assay. 57.6 % MS m/z 507.2 (M+H)
Example 6 6-Fluoro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide
Figure imgf000041_0001
Step 1 : In a 50 niL round-bottomed flask, 6-fluoro- 1,2,3 ,4-tetrahydroisoquinoline-l- carboxylic acid hydrochloride (500 mg, 2.16 mmol, Eq: 1.00) and 2 N NaOH (3.24 mL, 6.48 mmol, Eq: 3) were combined with t-BuOH (3.00 mL) to give a light brown solution and BOC-anhydride (565 mg, 601 μΐ, 2.59 mmol, Eq: 1.2) was added. After stirring 18 h, the reaction was diluted with water and extracted ether. The aqueous layer was acidified with saturated KHS04 and extracted with EtOAc. The combined organic extracts were washed with brine, dried over Na2S04, filtered and concentrated to give 0.6448g 6-fluoro- 3,4-dihydro-lH-isoquinoline-l ,2-dicarboxylic acid 2-tert-butyl ester as white foam which was used without purification. 100 % MS m/z 193.9 (M-BOC)
Step 2: To a solution of 6-fluoro-3,4-dihydro-lH-isoquinoline-l ,2-dicarboxylic acid 2-tert-butyl ester (0.37 g, 1.25 mmol, Eq: 1.00) and 2,6-difluoroaniline (194 mg, 162 μΐ, 1.5 mmol, Eq: 1.2) in Pyridine (7 mL) at 0 °C was added phosphorus oxychloride (288 mg, 175 μΐ, 1.88 mmol, Eq: 1.5). The reaction was warmed to RT, stirred for 18 h, diluted with water and extracted with EtOAc. The combined organics were washed with 1 N HC1, water, brine, dried with Na2S04 and concentrated in vacuo. The crude material was purified by flash chromatography to afford 0.2181 g l-(2,6-difluoro-phenylcarbamoyl)-6-fluoro-3,4- dihydro-lH-isoquinoline -2 -carboxylic acid tert-butyl ester as white foam. 42.8 % MS m/z 428.9 (M+H)
Step 3: In a 50 mL round-bottomed flask, l-(2,6-difluoro-phenylcarbamoyl)-6- fluoro-3,4-dihydro-lH-isoquinoline-2-carboxylic acid tert-butyl ester (0.218 g, 536 μηιοΐ, Eq: 1.00) was combined with DCM (7.00 mL) to give a colorless solution and TFA (1.83 g, 1.24 mL, 16.1 mmol, Eq: 30) was added. After 1 h, the mixture was concentrated to afford 0.2867 g 6-fluoro-l,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide trifluoroacetate as a yellow oil which was used without purification. 127 % MS m/z 307.1 (M+H) Step 4: In a 50 niL round-bottomed flask, BOC-VAL-OH (140 mg, 643 μπιοΐ, Eq: 1.2) and 6-fluoro-l,2,3,4-tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide trifluoroacetate (225 mg, 536 μηιοΐ, Eq: 1.00) were combined with DMF (3 mL) to give a light yellow solution and TEA (217 mg, 299 μΐ, 2.14 mmol, Eq: 4) was added. To this solution was added a solution of HBTU (244 mg, 643 μηιοΐ, Eq: 1.2) and ΗΟΒΤ·Η20 (98.5 mg, 643 μηιοΐ, Eq: 1.2) in DMF (3 mL). After 2 h, the reaction mixture was diluted with EtOAc and washed with 1 :1 sat NaHCCVbrine, brine and the organic layer was dried over Na2S04 and concentrated in vacuo. The crude material was purified by flash chromatography to afford 97.8 mg {(S)-l-[l-(2,6-difluoro-phenylcarbamoyl)-6-fluoro-3,4- dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propyl}-carbamic acid tert-butyl ester as white foam. 36.1 % MS m/z 506.0 (M+H)
Step 5: In a 20 mL vial, {(S)-l-[l-(2,6-Difluoro-phenylcarbamoyl)-6-fluoro-3,4- dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propyl}-carbamic acid tert-butyl ester (97.8 mg, 193 μηιοΐ, Eq: 1.00) was combined with DCM (4 mL) to give a colorless solution and TFA (662 mg, 447 μΐ, 5.8 mmol, Eq: 30) was added. After 1 h, the mixture was concentrated to afford 0.1346 g 2-((S)-2-amino-3-methyl-butyryl)-6-fiuoro-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate as a light brown oil which was used without purification. 134 % MS m/z 406.1 (M+H)
Step 6: In a 20 mL vial, 2-((S)-2-Amino-3-methyl-butyryl)-6-fluoro-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide trifluoroacetate (100 mg, 193 μιηοΐ, Eq: 1.00), BOC-N-ME-ALA-OH (47.1 mg, 232 μιηοΐ, Eq: 1.2) and HATU (88.1 mg, 232 μηιοΐ, Eq: 1.2) were combined with DMF (3 mL) to give a light brown solution and TEA (97.6 mg, 135 μΐ, 965 μηιοΐ, Eq: 5) was added. After 2.5 h, the mixture was diluted with EtOAc and washed with brine. The organic layer was dried over Na2S04 and concentrated in vacuo. The crude material was purified by flash chromatography to afford 77.1 mg ((S)-l-{(S)-l-[l-(2,6-difluoro-phenylcarbamoyl)-6-fluoro-3,4-dihydro-lH- isoquinoline-2-carbonyl]-2-methyl-propylcarbamoyl} -ethyl)-methyl-carbamic acid tert- butyl ester as a white solid. 67.6 % MS m/z 591.1 (M+H)
Step 7: In a 20 mL vial, ((S)-l-{(S)-l-[l-(2,6-difluoro-phenylcarbamoyl)-6-fluoro- 3,4-dihydro-lH-isoquinoline-2-carbonyl]-2-methyl-propylcarbamoyl} -ethyl)-methyl- carbamic acid tert-butyl ester (77.1 mg, 131 μηιοΐ, Eq: 1.00) was combined with DCM (3.00 mL) to give a colorless solution and TFA (447 mg, 302 μΐ, 3.92 mmol, Eq: 30) was added. After 30 min. the mixture was concentrated, the residue dissolved in EtOAc and washed with 1 N NaOH, water, dried over Na2S04 and concentrated in vacuo to give 47.9 mg of a mixture of diastereomers as a white foam. Each diastereomer was isolated and lyophilized from MeCN/F^O. The first compound eluted afforded 22.6 mg of white solid. The second compound eluted afforded 13.7mg of the title compound as a white solid whose structure was assigned based on the activity in the TR-FRET assay. 21.4 % MS m/z 491.3 (M+H)
The compounds listed in Table 1 below were prepared following the procedures described above for Example 1, where the amines listed in the table were used in place of 2,6-difluoroaniline in Step 1.
Table 1
Figure imgf000043_0001
Figure imgf000044_0001
Figure imgf000045_0001
The compounds listed in Table 2 below were prepared following the procedures described above for Example 1, where the amines listed in the table were used in place of 2,6-difluoroaniline in Step 1 and the separation of diastereomers described in Step 3 was omitted.
Table 2
Figure imgf000046_0001
The compounds listed in Table 3 were prepared following the procedures described above for Example 2, where the carboxylic acids listed in the table were used in place of (S)-2-(tert-butoxycarbonylamino)-2-cyclohexylacetic acid in Step 3.
Table 3
Figure imgf000047_0001
Figure imgf000048_0001
The compounds listed in Table 4 below were prepared following the procedures described above for Example 3, where the carboxylic acids listed in the table were used in place of (S)-2-(tert-butoxycarbonylamino)-2-cyclohexylacetic acid in Step 3.
Table 4
Figure imgf000048_0002
Figure imgf000049_0001
Figure imgf000050_0001
The compound listed in Table 5 below was prepared following the procedures described above for Example 4, where the amine listed in the table was used in place of 2- chloro-6-fluoroaniline in Step 1.
Table 5
Figure imgf000050_0002
The compounds listed in Table 6 below were prepared following the procedures described above for Example 5, where the 1,2,3,4-tetrahydro-isoquinoline-l-carboxylic acids listed in the table were used in place of 2-(tert-butoxycarbonyl)-6-chloro-l,2,3,4- tetrahydroisoquinoline-l-carboxylic acid in Step 1.
Table 6
Figure imgf000050_0003
Figure imgf000051_0001
The compounds listed in Table 7 below were prepared following the procedures described above for Example 6, where the 1,2,3,4-tetrahydro-isoquinoline-l-carboxylic acids listed in the table were used in place of 2-(tert-butoxycarbonyl)-6-chloro-l,2,3,4- tetrahydroisoquinoline-l-carboxylic acid in Step 1.
Table 7
Figure imgf000051_0002
Figure imgf000052_0001
Example 31
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-3-carboxylic acid (2,6-difluoro-phenyl)-amide
Figure imgf000052_0002
Step 1 : To a solution of (S)-2-(tert-butoxycarbonyl)- 1 ,2,3 ,4-tetrahydroisoquinoline-
3-carboxylic acid (200 mg, 721 μηιοΐ, Eq: 1.00) and 2,6-difiuoroaniline (121 mg, 101 μΐ,, 938 μηιοΐ, Eq: 1.3) in pyridine (2 mL) at 0 °C was added dropwise phosphorus oxychloride (166 mg, 101 μί, 1.08 mmol, Eq: 1.5). The cooling bath was removed and the reaction stirred at RT overnight. The reaction mixture was concentrated in vacuo and water was added to the residue. The resulting mixture was extracted with EtOAc and the combined organic layers were washed with 0.1 M HC1, 0.1 M NaOH, and brine and concentrated in vacuo. The crude material was purified by flash chromatography to give (S)-tert -butyl 3- (2,6-difluorophenylcarbamoyl)-3,4-dihydroisoquinoline-2(lH)-carboxylate as a colorless oil (90 mg), m/z = 411 (M+Na). Step 2: To a solution of (S)-tert-butyl 3-(2,6-difluorophenylcarbamoyl)-3,4- dihydroisoquinoline-2(lH)-carboxylate (90 mg, 232 μηιοΐ, Eq: 1.00) in DCM (2 mL) was added TFA (2 mL, 26.0 mmol, Eq: 112) and the resulting solution stirred at RT for 1 h. The reaction mixture was concentrated in vacuo and the residue azeotroped with n-heptanes to give (S)-N-(2 ,6-difluorophenyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline-3-carboxamide trifluoro acetate which was used without purification (93 mg), m/z = 289 (M+H).
Step 3: To a solution of (S)-2-(tert-butoxycarbonylamino)-3-methylbutanoic acid (60 mg, 277 μιηοΐ, Eq: 1.2) and DIEA (120 μΐ,, 693 μιηοΐ, Eq: 3) in DMF (1 mL) was added HATU (105 mg, 277 μηιοΐ, Eq: 1.2) and the resulting solution stirred at RT for 15 min. (S)-N-(2,6-Difluorophenyl)-l ,2,3,4-tetrahydroisoquinoline-3-carboxamide trifluoro acetate (93 mg, 231 μηιοΐ, Eq: 1.00) in DMF (1 mL) was then added and stirring was continued at rt. After 1 h, the reaction mixture was diluted with EtOAc and washed with 0.1 M NaOH, 0.1 M HCl, and brine. The organic layer was concentrated in vacuo and the residue azeotroped with n-heptanes to give tert-butyl (S)-l-((S)-3-(2,6- difluorophenylcarbamoyl)-3 ,4-dihydroisoquinolin-2( 1 H)-yl)-3 -methyl- 1 -oxobutan-2- ylcarbamate as a white solid which was used without purification (130 mg), m/z = 488 (M+H).
Step 4: To a solution of tert-butyl (S)-l-((S)-3-(2,6-difluorophenylcarbamoyl)-3,4- dihydroisoquinolin-2(lH)-yl)-3-methyl-l-oxobutan-2-ylcarbamate (0.11 g, 226 μηιοΐ, Eq: 1.00) in DCM (2 mL) was added TFA (2.96 g, 2 mL, 26.0 mmol, Eq: 115) and the resulting solution was stirred at RT for 1 h. The reaction mixture was concentrated in vacuo and the residue azeotroped with n-heptanes to give (S)-2-((S)-2-amino-3-methylbutanoyl)-N-(2,6- difluorophenyl)-l ,2,3,4-tetrahydroisoquinoline-3-carboxamide trifiuoroacetate which was used without purification (0.11 g).
Step 5: To a solution of (S)-2-(tert-butoxycarbonyl(methyl)amino)propanoic acid (53.5 mg, 263 μιηοΐ, Eq: 1.2) and DIEA (190 μΐ,, 1.1 mmol, Eq: 5) in DMF (2 mL) was added HATU (100 mg, 263 μηιοΐ, Eq: 1.2). The mixture was stirred for 20 min. and (S)-2- ((S)-2-amino-3-methylbutanoyl)-N-(2,6-difluorophenyl)-l,2,3,4-tetrahydroisoquinoline-3- carboxamide trifiuoroacetate (0.11 g, 219 μηιοΐ, Eq: 1.00) in DMF (1 mL) was added and the resulting solution stirred at RT overnight.
The reaction mixture was diluted with EtOAc, washed with 0.1 M HCl, 0.1 M NaOH, and brine. The organic layer was concentrated in vacuo and the residue azeotroped with n-heptanes. The resulting material was purified by flash chromatography to give tert- butyl (S)-l-((S)-l-((S)-3-(2,6-difluorophenylcarbamoyl)-3,4-dihydroisoquinolin-2(lH)-yl)- 3-methyl-l-oxobutan-2-ylamino)-l-oxopropan-2-yl(methyl)carbamate as a colorless oil (0.14 g), m/z = 573 (M+H). Step 6: To a solution of tert-butyl (S)-l-((S)-l-((S)-3-(2,6- difluorophenylcarbamoyl)-3 ,4-dihydroisoquinolin-2( 1 H)-yl)-3 -methyl- 1 -oxobutan-2- ylamino)-l-oxopropan-2-yl(methyl)carbamate (138 mg, 241 μηιοΐ, Eq: 1.00) in DCM (2 mL) was added TFA (2.96 g, 2 mL, 26.0 mmol, Eq: 108) and the resulting solution stirred at RT for 1 h. The mixture was concentrated in vacuo, saturated NaHC03 was added to the residue and the resulting mixture extracted with DCM. The combined extracts were dried over Na2S04 and concentrated in vacuo. The residue was treated with ether/hexanes to give (S)-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l,2,3,4-tetrahydro- isoquinoline-3-carboxylic acid (2,6-difiuoro-phenyl)-amide as a white solid which was used without purification (70 mg), m/z = 473 (M+H).
Example 48
Biochemical Assays
TR-FRET Assay for BIR2 and BIR3
The ability of a test compound to inhibit the binding of BIR2 and/or BIR3 domains of the XIAP protein to Peptide A (a SMAC-derived peptide described below) evidences that the test compound acts as a SMAC -mimetic resulting in reactivation of a cell's apoptotic pathway.
The peptide AVPIAQKSEK-(s-biotin)-OH 1 :2 TFA ("Peptide A") was identified as a substrate for the TR-FRET assay by screening the 6x Histidine -tagged BIR2 domain and BIR3 domain of XIAP against a set of 29 peptides synthesized based on sequences reported by Sweeny et al. (Biochemistry, 2006, 45, 14740 14748). The peptides were labeled with the fluorescent tags FrfC or TAMRA and Kd values were determined by fluorescence polarization assay. The sequence AVPIAQKSEK was identified as optimal for using in an assay. The peptide sequence was derivatized with biotin to provide AVPIAQKSEK-(s- biotin)-OH 1 :2 TFA as the substrate for the TR-FRET assay.
The XIAP protein sequence was obtained from the SWISS-PROT protein sequence database and the BIR2 and BIR3 domains were derived from that. The sequence of the BIR2 domain used for the TR-FRET assay is
MRHHHHHHRDHFALDRPSETHADYLLRTGQWDISDTIYPRNPAMYSEEARLKSF QNWPD YAHLTPRELAS AGLYYTGIGDQ VQCF ACGGKLKNWEPGDRAWSEHRRHF PNCFFVLGRNLNIRSE . The sequence of the BIR3 domain used for the TR-FRET assay is MRHHHHHHRSDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNK
EQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYL
L EQKGQE YIN IHLTHSLEECLVRTT .
Ten nanomolar of 6x Histidine -tagged BIR2 domain, corresponding to amino acids 124-240 of XIAP, or BIR3 domain, corresponding to amino acids 241-356 of XIAP, was mixed with 20 nM of the peptide AVPIAQKSEK-(s-biotin)-OH 1 :2 TFA, in the presence of 50 mM Tris-Cl, pH 7.5, 100 mM NaCl, 1 mM dithiothreitol (DTT) and 0.1 mg/niL bovine serum albumin (BSA). Following a 45 min. incubation at 37 °C, Europium-Streptavidin and Allophycocyanin conjugated anti-Histidine antibody were added to a final concentration of 1.5 nM and 15 nM, respectively. Time -resolved fluorescence resonance energy transfer (TR-FRET) signals were measured 1 hour later at room temperature. Test compound potency was assessed at 10 serially diluted concentrations. Percentage of inhibition at each concentration was determined to generate an IC50 value for each test compound.
These values are listed below in Table 8.
Table 8
Figure imgf000055_0001
BIR2 BIR3
IC50 IC50
Example Name (μΜ) (μΜ)
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-
Example 3 propionylamino)-acetyl]-l,2,3,4-tetrahydro-
0.026 46.8 isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide hydrochloride
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-
Example 4 propionylamino)-butyryl] -1 ,2,3 ,4-tetrahy dro-
0.006 9.942 isoquinoline-l-carboxylic acid (2-chloro-6-fluoro- phenyl)-amide hydrochloride
6-Chloro-2-[(S)-3-methyl-2-((S)-2-methylamino-
Example 5 propionylamino)-butyryl] -1 ,2,3 ,4-tetrahy dro-
0.021 38.3 isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide
6-Fluoro-2-[(S)-3-methyl-2-((S)-2-methylamino-
Example 6 propionylamino)-butyryl] -1 ,2,3 ,4-tetrahy dro-
0.025 >54.8 isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)- amide
(S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-
Example 7
(methylamino)propanamido)butanoyl)isoindoline-l- 0.009 7.746 carboxamide hydrochloride
(S)-N-(2-chloro-6-fluorophenyl)-2-((S)-3-methyl-2-((S)-
Example 8
2-(methylamino)propanamido)butanoyl)isoindoline-l- 0.010 4.304 carboxamide hydrochloride BIR2 BIR3
IC50 IC50
Example Name (μΜ) (μΜ)
(S)-N-(benzo[b]thiophen-4-yl)-2-((S)-3-methyl-2-((S)-2-
Example 9
(methylamino)propanamido)butanoyl)isoindoline-l- 0.043 14.83 carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-
Example 10
(methylamino)propanamido)pentanoyl)isoindoline-l- 0.006 15.2 carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2-
Example 11
(methylamino)propanamido)butanoyl)isoindoline-l- 0.013 >54.8 carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-
Example 12
(methylamino)propanamido)-2-(tetrahydro-2H-pyran- 0.014 4-yl)acetyl)isoindoline-l-carboxamide hydrochloride
(S)-2-((S)-2-cyclopentyl-2-((S)-2-
Example 13 (methylamino)propanamido)acetyl)-N-(2,6-
0.023 19.81 difluorophenyl)isoindoline-l-carboxamide
hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-
Example 14 (methylamino)propanamido)-2-(tetrahydro-2H-pyran-
0.016 43.9 4-yl)acetyl)-l,2,3?4-tetrahydroisoquinoline-l- carboxamide hydrochloride BIR2 BIR3
IC50 IC50
Example Name (μΜ) (μΜ)
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-
Example 15
(methylamino)propanamido)pentanoyl)-l,2,3?4- 0.013 >54.8 tetrahydroisoquinoline-l-carboxamide hydrochloride
2-((S)-3-methyl-2-((S)-2-
Example 16
(methylamino)propanamido)butanoyl)-N- 0.233 >54.8 phenylisoindoline-l-carboxamide hydrochloride
N-(2-methoxyphenyl)-2-((S)-3-methyl-2-((S)-2-
Example 17
(methylamino)propanamido)butanoyl)isoindoline-l- 0.177 3.364 carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-
Example 18
(methylamino)propanamido)butanoyl)isoindoline-l- 0.139 >54.8 carboxamide hydrochloride
N-benzyl-2-((S)-3-methyl-2-((S)-2-
Example 19
(methylamino)propanamido)butanoyl)isoindoline-l- 0.210 0.692 carboxamide hydrochloride
2-((S)-3-methyl-2-((S)-2-
Example 20
(methylamino)propanamido)butanoyl)-N- 0.810 1.914 phenethylisoindoline-l-carboxamide hydrochloride
(S)-2-((S)-3-methyl-2-((S)-2-
Example 21
(methylamino)propanamido)butanoyl)-N-(naphthalen- 0.005 2.466 l-yl)isoindoline-l-carboxamide hydrochloride BIR2 BIR3
IC50 IC50
Example Name (μΜ) (μΜ)
(R)-2-((S)-3-methyl-2-((S)-2-
Example 22
(methylamino)propanamido)butanoyl)-N-(naphthalen- 2.794 >54.8 l-yl)isoindoline-l-carboxamide hydrochloride
(S)-2-((S)-3-methyl-2-((S)-2-
Example 23
(methylamino)propanamido)butanoyl)-N-(naphthalen- 0.117 19.76 2-yl)isoindoline-l-carboxamide hydrochloride
(S)-N-(2-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-
Example 24
(methylamino)propanamido)butanoyl)isoindoline-l- 0.022 17.31 carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-
Example 25
(methylamino)propanamido)butanoyl)-l,2,3?4- 0.027 >54.8 tetrahydroisoquinoline-l-carboxamide hydrochloride
(S)-N-(2-chlorophenyl)-2-((S)-3-methyl-2-((S)-2-
Example 26
(methylamino)propanamido)butanoyl)isoindoline-l- 0.021 6.076 carboxamide hydrochloride
(S)-2-((S)-3-methyl-2-((S)-2-
Example 27 (methylamino)propanamido)butanoyl)-N-(5,6,7,8-
0.106 14.84 tetrahydronaphthalen-l-yl)isoindoline-l-carboxamide
hydrochloride
(S)-2-((S)-3-methyl-2-((S)-2-
Example 28
(methylamino)propanamido)butanoyl)-N-(quinolin-8- 6.589 27.93 yl)isoindoline-l-carboxamide hydrochloride BIR2 BIR3
IC50 IC50
Example Name (μΜ) (μΜ)
N-(isoquinolin-l-yl)-2-((S)-3-methyl-2-((S)-2-
Example 29
(methylamino)propanamido)butanoyl)isoindoline-l- 0.345 16.03 carboxamide hydrochloride
(S)-N-(l-methyl-lH-indol-4-yl)-2-((S)-3-methyl-2-((S)-2-
Example 30
(methylamino)propanamido)butanoyl)isoindoline-l- 0.040 9.264 carboxamide hydrochloride
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-
Example 31 propionylamino)-butyryl] -1 ,2,3 ,4-tetrahy dro-
0.037 13.44 isoquinoline-3-carboxylic acid (2,6-difluoro-phenyl)- amide
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methoxy-2-((S)-
Example 32
2-(methylamino)propanamido)butanoyl)isoindoline-l- 0.024 51.74 carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((2S,3R)-3-hydroxy-2-((S)-
Example 33
2-(methylamino)propanamido)butanoyl)isoindoline-l- 0.016 >54.8 carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-
Example 34
(methylamino)propanamido)-2- 0.032 phenylacetyl)isoindoline-l-carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((S)-4-methyl-2-((S)-2-
Example 35
(methylamino)propanamido)pentanoyl)isoindoline-l- 0.027 33.67 carboxamide hydrochloride BIR2 BIR3
IC50 IC50
Example Name (μΜ) (μΜ)
(S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-
Example 36
(methylamino)propanamido)butanoyl)-l,2,3?4- 0.025 >54.8 tetrahydroisoquinoline-l-carboxamide hydrochloride
(S)-2-((S)-2-cyclopentyl-2-((S)-2-
Example 37 (methylamino)propanamido)acetyl)-N-(2,6-
0.034 >54.8 difluorophenyl)-l,2,3?4-tetrahydroisoquinoline-l- carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2-
Example 38
(methylamino)propanamido)butanoyl)-l,2,3?4- 0.062 >54.8 tetrahydroisoquinoline-l-carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((2S,3R)-3-methoxy-2-((S)-
Example 39
2-(methylamino)propanamido)butanoyl)-l,2,3?4- 0.093 >54.8 tetrahydroisoquinoline-l-carboxamide hydrochloride
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-2-((S)-2-
Example 40 (methylamino)propanamido)-3-
0.117 >54.8 phenylbutanoyl)isoindoline-l-carboxamide
hydrochloride
N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-
Example 41
2-(methylamino)propanamido)butanoyl)-l,2,3?4- 2.353 >54.8 tetrahydroisoquinoline-l-carboxamide BIR2 BIR3
IC50 IC50
Example Name (μΜ) (μΜ)
N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-
Example 42
2-(methylamino)propanamido)butanoyl)-l,2,3?4- 0.027 >54.8 tetrahydroisoquinoline-l-carboxamide
N-(2,6-difluorophenyl)-6-fluoro-2-((S)-3-methyl-2-((S)-
Example 43
2-(methylamino)propanamido)butanoyl)-l,2,3?4- 3.483 >54.8 tetrahydroisoquinoline-l-carboxamide
7-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-
Example 44
2-(methylamino)propanamido)butanoyl)-l,2,3?4- 4.706 >54.8 tetrahydroisoquinoline-l-carboxamide
7-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-
Example 45
2-(methylamino)propanamido)butanoyl)-l,2,3?4- 0.047 >54.8 tetrahydroisoquinoline-l-carboxamide
6-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-
Example 46
2-(methylamino)propanamido)butanoyl)-l,2,3?4- 3.995 >54.8 tetrahydroisoquinoline-l-carboxamide BIR2 BIR3
IC50 IC50
Example Name (μΜ) (μΜ)
(S)-N-(2-fluoro-6-methylphenyl)-2-((S)-3-methyl-2-((S)-
Example 47
2-(methylamino)propanamido)butanoyl)isoindoline-l- 0.019 >54.8 carboxamide hydrochloride

Claims

Claims
1. A compound of Formula I:
Figure imgf000064_0001
I wherein:
R1 is selected from H and halogen; R2 is selected from
• aryl that optionally may be substituted with Ci_6-alkyl, OR4, and halogen,
• aryl that is fused with C3-7-cycloalkyl, and
• heteroaryl that optionally may be substituted with Ci_6-alkyl;
R3 is selected from
• Ci-6-alkyl that optionally may be substituted with OR4 and aryl,
• C3-7-cycloalkyl,
• heterocyclyl, and
• aryl;
R4 is selected from H and Ci_6-alkyl; n is 1 or 2; m is 0 or 1 ; and q is 0, 1 or 2; or a pharmaceutically acceptable salt of the foregoing compound.
2. The compound of claim 1 wherein R1 is halogen, or a pharmaceutically acceptable salt thereof.
3. The compound of claim 1 wherein R1 is H.
4. The compound according to claims 1-3 wherein R2 is aryl that optionally may be substituted with OR4, halogen and Ci_6-alkyl, or a pharmaceutically acceptable salt thereof.
5. The compound of claim 4 wherein R is phenyl or naphthalenyl, or a pharmaceutically acceptable salt thereof.
6. The compound according to claims 1-3 wherein R2 is heteroaryl that optionally may be substituted with Ci_6-alkyl, or a pharmaceutically acceptable salt thereof.
7. The compound of claim 6 wherein R2 is selected from selected from quinolinyl, benzo [b]thiophenyl or indolyl.
8. The compound according to claims 1-7 wherein R is Ci-6-alkyl that optionally may be substituted with OR4 and aryl, or a pharmaceutically acceptable salt thereof.
9. The compound of claim 8 wherein R3 is Ci_6-alkyl substituted with phenyl, or a pharmaceutically acceptable salt thereof.
10. The compound of claim 8 wherein R3 is OR4 and R4 is H, or a pharmaceutically acceptable salt thereof.
11. The compound according to claims 1-7 wherein R is C3_7-cycloalkyl, or a pharmaceutically acceptable salt thereof.
12. The compound of claim 11 wherein R3 is cyclohexyl or cyclopentyl, or a pharmaceutically acceptable salt thereof.
13. The compound according to claims 1-7 wherein R3 is aryl, or a pharmaceutically acceptable salt thereof.
14. The compound of claim 13 wherein R is phenyl.
15. The compound according to claims 1-7 wherein R3 is heterocyclyl, or a pharmaceutically acceptable salt thereof.
16. The compound of claim 15 wherein R3 is tetrahydropyran.
17. The compound according to claims 1-16 wherein m is 0, n is 1, and q is 0, or a pharmaceutically acceptable salt thereof.
18. The compound of claim 1 wherein R1 is H, R2 is aryl, R3 is Ci-6-alkyl, n is 1 and m and q are 0.
19. The compound of claim 1 wherein R3 is Ci_6-alkyl, n is 1 and m is 0, said compound being selected from the group comprising:
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro- lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride;
((S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l -carboxamide hydrochloride;
(S)-N-(2-chloro-6-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(benzo[b]thiophen-4-yl)-2-((S)-3-methyl-2-((S)-2- (methylamino)propanamido) butanoyl)isoindoline-l -carboxamide hydrochloride ; (S)-N-(2,6-difiuorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difiuorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2- (methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N- phenylisoindoline-1 -carboxamide hydrochloride;
N-(2-methoxyphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
N-(2-methoxyphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride; N-benzyl-2-((S)-3-methyl-2-((S)-2-
(methylamino)propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride; 2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N- phenethylisoindoline-1 -carboxamide hydrochloride;
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- 1 -yl)isoindoline- 1 -carboxamide hydrochloride; (R)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- 1 -yl)isoindoline- 1 -carboxamide hydrochloride;
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(naphthalen- 2-yl)isoindoline-l -carboxamide hydrochloride;
(S)-N-(2-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline-l -carboxamide hydrochloride;
(S)-N-(2-chlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(5,6,7,8- tetrahydronaphthalen-1 -yl)isoindoline-l -carboxamide hydrochloride; (S)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido)butanoyl)-N-(quinolin-8- yl)isoindoline-l -carboxamide hydrochloride;
N-(isoquinolin-l-yl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(l-methyl-lH-indol-4-yl)-2-((S)-3-methyl-2-((S)-2- (methylamino)propanamido) butanoyl)isoindoline-l -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methoxy-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((2S,3R)-3-hydroxy-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride; (S)-N-(2,6-difluorophenyl)-2-((S)-4-methyl-2-((S)-2-(methylamino)propanamido) pentanoyl)isoindoline- 1 -carboxamide hydrochloride; (S)-N-(2,6-difluorophenyl)-2-((2S,3S)-2-((S)-2-(methylamino)propanamido)-3- phenylbutanoyl)isoindoline-l -carboxamide hydrochloride; and
(S)-N-(2-fluoro-6-methylphenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride; or a pharmaceutically acceptable salt of any of the foregoing compounds.
20. The compound of claim 1 wherein R3 is Ci_6-alkyl, n is 2 and m is 0, said compound being selected from the group comprising:
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6-fluoro-phenyl)-amide hydrochloride; 6-Chloro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difiuoro-phenyl)-amide;
6-Fluoro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difiuoro-phenyl)-amide;
(S)-N-(2,6-difiuorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difiuorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l -carboxamide hydrochloride;
(S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride; (S)-N-(2,6-difiuorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2-
(methylamino)propanamido) butanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difiuorophenyl)-2-((2S,3R)-3-methoxy-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l -carboxamide hydrochloride; N-(2,6-difiuorophenyl)-7-fiuoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide;
N-(2,6-difluorophenyl)-6-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; 7-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide;
7-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; and
6-chloro-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)- 1 ,2,3 ,4-tetrahydroisoquinoline- 1 -carboxamide; or a pharmaceutically acceptable salt of any of the foregoing compounds.
21. The compound of claim 1 wherein R3 is Ci_6-alkyl, n is 1 and m is 1 , said compound being
(S)-N-(2,6-difluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline-3 -carboxamide ; or a pharmaceutically acceptable salt thereof.
22. The compound of claim 1 wherein R3 is C3_7-cycloalkyl and n is 1, said compound being selected from the group comprising:
(S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-2,3- dihydro-lH-isoindole-l-carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride; and
(S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)isoindoline-l -carboxamide hydrochloride; or a pharmaceutically acceptable salt of either of the foregoing compounds.
23. The compound of claim 1 wherein R3 is C3_7-cycloalkyl and n is 2, said compound being selected from the group comprising: (S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride; and
(S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride; or a pharmaceutically acceptable salt of either of the foregoing compounds.
24. The compound of claim 1 wherein R3 is heterocyclyl, said compound being selected from the group comprising:
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)isoindoline- 1 -carboxamide hydrochloride; and (S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride; or a pharmaceutically acceptable salt of either of the foregoing compounds.
25. The compound of claim 1 wherein R3 is aryl, said compound being (S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- phenylacetyl)isoindoline-l -carboxamide hydrochloride; or a pharmaceutically acceptable salt of the foregoing compound.
26. A compound selected from the group comprising:
(S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-2,3-dihydro- lH-isoindole-l-carboxylic acid (2,6-difluoro-phenyl)-amide hydrochloride;
((S)-2-[(S)-2-Cyclohexyl-2-((S)-2-methylamino-propionylamino)-acetyl]-2,3- dihydro-lH-isoindole-l-carboxylic acid (2,6-difiuoro-phenyl)-amide hydrochloride ;
(S)-N-(2,6-difiuorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)
propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride; (S)-2-[(S)-3-Methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l,2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2-chloro-6-fluoro-phenyl)-amide hydrochloride; 6-Chloro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide;
6-Fluoro-2-[(S)-3-methyl-2-((S)-2-methylamino-propionylamino)-butyryl]-l, 2,3,4- tetrahydro-isoquinoline-l-carboxylic acid (2,6-difluoro-phenyl)-amide; (S)-N-(2,6-dichlorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino)propanamido) butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2-chloro-6-fluorophenyl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(benzo[b]thiophen-4-yl)-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((S)-3,3-dimethyl-2-((S)-2-(methylamino) propanamido)butanoyl)isoindoline- 1 -carboxamide hydrochloride; (S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)isoindoline- 1 -carboxamide hydrochloride;
(S)-2-((S)-2-cyclopentyl-2-((S)-2-(methylamino)propanamido)acetyl)-N-(2,6- difluorophenyl)isoindoline-l -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((S)-2-((S)-2-(methylamino)propanamido)-2- (tetrahydro-2H-pyran-4-yl)acetyl)- 1 ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride;
(S)-N-(2,6-difluorophenyl)-2-((2S,3S)-3-methyl-2-((S)-2-(methylamino) propanamido)pentanoyl)-l ,2 ,3 ,4-tetrahydroisoquinoline- 1 -carboxamide hydrochloride; and
N-(2,6-difluorophenyl)-7-fluoro-2-((S)-3-methyl-2-((S)-2-(methylamino) propanamido)butanoyl)-l,2,3,4-tetrahydroisoquinoline-l -carboxamide; or a pharmaceutically acceptable salt of each of the foregoing compounds.
27. A pharmaceutical composition comprising any of the compounds according to claims 1-26, or a pharmaceutically acceptable salt thereof, as an active ingredient together with a pharmaceutically acceptable carrier or excipient.
28. Compounds according to any of claims 1-26 for use as a therapeutically active substance.
29. Use of a compound according to any of claims 1-26, or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for the therapeutic and/or prophylactic treatment of cancer.
30. Use of a compound according to any of claims 1-26, or a pharmaceutically acceptable salt thereof, for the therapeutic and/or prophylactic treatment of cancer.
31. A method of treating or ameliorating cancer comprising administering to a subject in need of such treatment a therapeutically effective amount of a compound according to any of claims 1-26.
32. The invention as described hereinabove.
PCT/EP2013/066458 2012-08-15 2013-08-06 Azaheterocycles as bir2 and/or bir3 inhibitors WO2014026882A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
MA37896A MA37896A1 (en) 2012-08-15 2013-08-06 Azaheterocycles used as inhibitors of bir2 and / or bir3
CA2878106A CA2878106A1 (en) 2012-08-15 2013-08-06 Azaheterocycles as bir2 and/or bir3 inhibitors
CN201380035682.3A CN104540806B (en) 2012-08-15 2013-08-06 Azaheterocycles as BIR2 and/or BIR3 inhibitors
EP13745838.6A EP2885275A1 (en) 2012-08-15 2013-08-06 Azaheterocycles as bir2 and/or bir3 inhibitors
AU2013304214A AU2013304214A1 (en) 2012-08-15 2013-08-06 Azaheterocycles as BIR2 and/or BIR3 inhibitors
SG11201500581WA SG11201500581WA (en) 2012-08-15 2013-08-06 Azaheterocycles as bir2 and/or bir3 inhibitors
JP2015526932A JP6203261B2 (en) 2012-08-15 2013-08-06 Nitrogen-containing heterocyclic compounds as BIR2 and / or BIR3 inhibitors
US14/419,288 US9422332B2 (en) 2012-08-15 2013-08-06 Azaheterocycles as BIR2 and/or BIR3 inhibitors
KR20157003782A KR20150042792A (en) 2012-08-15 2013-08-06 Azaheterocycles as bir2 and/or bir3 inhibitors
MX2015001905A MX2015001905A (en) 2012-08-15 2013-08-06 Azaheterocycles as bir2 and/or bir3 inhibitors.
BR112015003201A BR112015003201A2 (en) 2012-08-15 2013-08-06 compound, pharmaceutical composition, use of a compound and method for treating or ameliorating cancer
EA201590347A EA201590347A1 (en) 2012-08-15 2013-08-06 AZHETEROCYCLES AS BIR2 AND / OR BIR3 INHIBITORS
ZA2015/00342A ZA201500342B (en) 2012-08-15 2015-01-16 Azaheterocycles as bir2 and/or bir3 inhibitors
PH12015500185A PH12015500185B1 (en) 2012-08-15 2015-01-28 Azaheterocycles as bir2 and/or bir3 inhibitors
CR20150041A CR20150041A (en) 2012-08-15 2015-01-29 AZAHETEROCICLOS AS INHIBITORS OF BIR2 AND / OR BIR3
IL237063A IL237063A0 (en) 2012-08-15 2015-02-02 Azaheterocycles as bir2 and/or bir3 inhibitors
HK15110299.0A HK1209427A1 (en) 2012-08-15 2015-10-20 Azaheterocycles as bir2 and/or bir3 inhibitors bir2 / bir3

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261683253P 2012-08-15 2012-08-15
US61/683,253 2012-08-15

Publications (1)

Publication Number Publication Date
WO2014026882A1 true WO2014026882A1 (en) 2014-02-20

Family

ID=48948413

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/066458 WO2014026882A1 (en) 2012-08-15 2013-08-06 Azaheterocycles as bir2 and/or bir3 inhibitors

Country Status (21)

Country Link
US (1) US9422332B2 (en)
EP (1) EP2885275A1 (en)
JP (1) JP6203261B2 (en)
KR (1) KR20150042792A (en)
CN (1) CN104540806B (en)
AU (1) AU2013304214A1 (en)
BR (1) BR112015003201A2 (en)
CA (1) CA2878106A1 (en)
CL (1) CL2015000333A1 (en)
CO (1) CO7180196A2 (en)
CR (1) CR20150041A (en)
EA (1) EA201590347A1 (en)
HK (1) HK1209427A1 (en)
IL (1) IL237063A0 (en)
MA (1) MA37896A1 (en)
MX (1) MX2015001905A (en)
PE (1) PE20150674A1 (en)
PH (1) PH12015500185B1 (en)
SG (1) SG11201500581WA (en)
WO (1) WO2014026882A1 (en)
ZA (1) ZA201500342B (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016079527A1 (en) 2014-11-19 2016-05-26 Tetralogic Birinapant Uk Ltd Combination therapy
WO2016097773A1 (en) 2014-12-19 2016-06-23 Children's Cancer Institute Therapeutic iap antagonists for treating proliferative disorders
WO2017162674A1 (en) * 2016-03-22 2017-09-28 Institut National De La Sante Et De La Recherche Medicale (Inserm) Novel derivatives and their use as selective inhibitors of caspase-2
WO2017194390A1 (en) * 2016-05-09 2017-11-16 F. Hoffmann-La Roche Ag Dimeric compounds
WO2018033129A1 (en) 2016-08-18 2018-02-22 Guangzhou Virotech Pharmaceutical Co., Ltd. Use of iap inhibitor and oncolytic virus in preparation of anti-tumor drug

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024191988A1 (en) * 2023-03-14 2024-09-19 Cyteir Therapeutics, Inc. 3,4-fused bicyclic pyrrolidine and 3,4-fused bicyclic pyrrolidinone compounds

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006017295A2 (en) * 2004-07-12 2006-02-16 Idun Pharmaceuticals, Inc. Tetrapeptide analogs
WO2011059763A2 (en) * 2009-10-28 2011-05-19 Joyant Pharmaceuticals, Inc. Dimeric smac mimetics

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101094833A (en) * 2004-07-12 2007-12-26 伊邓药品公司 Tetrapeptide analogs

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006017295A2 (en) * 2004-07-12 2006-02-16 Idun Pharmaceuticals, Inc. Tetrapeptide analogs
WO2011059763A2 (en) * 2009-10-28 2011-05-19 Joyant Pharmaceuticals, Inc. Dimeric smac mimetics

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
ANSEL ET AL., PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY SYSTEMS, 1995, pages 456 - 457
E. DEAN ET AL.: "X- linked inhibitor of apoptosis protein as a therapeutic target", EXPERT OPIN. THER. TARGETS, vol. 11, no. 11, 2007, pages 1459 - 1471, XP009171900, DOI: doi:10.1517/14728222.11.11.1459
M. C. MAILLARD ET AL.: "Exploiting differences in caspase-2 and -3 S2 subsites for selectivity: Structure-based design, solid-phase synthesis and in vitro activity of novel substrate-based caspase-2 inhibitors", BIOORG. MED. CHEM., vol. 19, no. 19, 16 August 2011 (2011-08-16), pages 5833 - 5851, XP002715860, ISSN: 0968-0896 *
M. GYRD-HANSE ET AL.: "IAPs: From caspase inhibitors to modulators ofNF-KB, inflammation and cancer", NATURE REVIEW/CANCER, vol. 10, August 2010 (2010-08-01), pages 561 - 574
S. WANG: "Design of Small-Molecule Smac Mimetics as IAP Antagonists", CURRENT TOPICS IN MICROBIOLOGY AND IMMUNOLOGY, vol. 348, pages 89 - 113
SWEENY ET AL., BIOCHEMISTRY, vol. 45, 2006, pages 14740 - 14748

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016079527A1 (en) 2014-11-19 2016-05-26 Tetralogic Birinapant Uk Ltd Combination therapy
WO2016097773A1 (en) 2014-12-19 2016-06-23 Children's Cancer Institute Therapeutic iap antagonists for treating proliferative disorders
WO2017162674A1 (en) * 2016-03-22 2017-09-28 Institut National De La Sante Et De La Recherche Medicale (Inserm) Novel derivatives and their use as selective inhibitors of caspase-2
CN109476631A (en) * 2016-03-22 2019-03-15 国家健康与医学研究院 The purposes of new derivative and its selective depressant as Caspase-2
US10961219B2 (en) 2016-03-22 2021-03-30 Institut National De La Sante Et De La Recherche Medicale (Inserm) Derivatives and their use as selective inhibitors of caspase-2
WO2017194390A1 (en) * 2016-05-09 2017-11-16 F. Hoffmann-La Roche Ag Dimeric compounds
WO2018033129A1 (en) 2016-08-18 2018-02-22 Guangzhou Virotech Pharmaceutical Co., Ltd. Use of iap inhibitor and oncolytic virus in preparation of anti-tumor drug

Also Published As

Publication number Publication date
AU2013304214A1 (en) 2015-02-12
ZA201500342B (en) 2017-09-27
CN104540806B (en) 2017-05-03
JP2015526436A (en) 2015-09-10
IL237063A0 (en) 2015-03-31
BR112015003201A2 (en) 2017-07-04
CO7180196A2 (en) 2015-02-09
CN104540806A (en) 2015-04-22
CR20150041A (en) 2015-03-13
KR20150042792A (en) 2015-04-21
EA201590347A1 (en) 2015-05-29
CL2015000333A1 (en) 2015-11-06
SG11201500581WA (en) 2015-04-29
PE20150674A1 (en) 2015-05-06
EP2885275A1 (en) 2015-06-24
US9422332B2 (en) 2016-08-23
PH12015500185A1 (en) 2015-04-20
CA2878106A1 (en) 2014-02-20
JP6203261B2 (en) 2017-09-27
US20150210739A1 (en) 2015-07-30
MA37896A1 (en) 2016-09-30
MX2015001905A (en) 2015-06-05
HK1209427A1 (en) 2016-04-01
PH12015500185B1 (en) 2015-04-20

Similar Documents

Publication Publication Date Title
EP2897972B1 (en) 2-oxo-2,3,4,5-tetrahydro-1h-benzo[b]diazepines and their use in the treatment of cancer
US9422332B2 (en) Azaheterocycles as BIR2 and/or BIR3 inhibitors
TWI551596B (en) Diacylglycerol acyltransferase 2 inhibitors
CA2925084A1 (en) Tetrahydro-benzodiazepinones
CA2887497A1 (en) Dimeric compounds
JP6333267B2 (en) Azaindoline
JP6333826B2 (en) Azaindoline
EP2906535B1 (en) Indolines

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13745838

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2878106

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2013745838

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 15017272

Country of ref document: CO

Ref document number: 12015500185

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: CR2015-000041

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: 237063

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 14419288

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 2015000333

Country of ref document: CL

ENP Entry into the national phase

Ref document number: 2013304214

Country of ref document: AU

Date of ref document: 20130806

Kind code of ref document: A

Ref document number: 20157003782

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 000194-2015

Country of ref document: PE

Ref document number: MX/A/2015/001905

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2015526932

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: IDP00201500868

Country of ref document: ID

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 201590347

Country of ref document: EA

Ref document number: 37896

Country of ref document: MA

WWE Wipo information: entry into national phase

Ref document number: A201502133

Country of ref document: UA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015003201

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112015003201

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150212

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112015003201

Country of ref document: BR

Kind code of ref document: A2

ENPW Started to enter national phase and was withdrawn or failed for other reasons

Ref document number: 112015003201

Country of ref document: BR

Kind code of ref document: A2

Free format text: PEDIDO RETIRADO POR NAO CUMPRIMENTO DA EXIGENCIA PUBLICADA NA RPI 2470 DE 08/05/2018