WO2014013729A1 - Contrast agent for photoacoustic imaging - Google Patents
Contrast agent for photoacoustic imaging Download PDFInfo
- Publication number
- WO2014013729A1 WO2014013729A1 PCT/JP2013/004358 JP2013004358W WO2014013729A1 WO 2014013729 A1 WO2014013729 A1 WO 2014013729A1 JP 2013004358 W JP2013004358 W JP 2013004358W WO 2014013729 A1 WO2014013729 A1 WO 2014013729A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- contrast agent
- icg
- hsa
- formula
- photoacoustic imaging
- Prior art date
Links
- 239000002872 contrast media Substances 0.000 title claims abstract description 86
- 238000003384 imaging method Methods 0.000 title claims abstract description 61
- 102000009027 Albumins Human genes 0.000 claims abstract description 59
- 108010088751 Albumins Proteins 0.000 claims abstract description 59
- 206010028980 Neoplasm Diseases 0.000 claims description 80
- 108091006905 Human Serum Albumin Proteins 0.000 claims description 50
- 102000008100 Human Serum Albumin Human genes 0.000 claims description 50
- 239000002245 particle Substances 0.000 claims description 43
- 125000004432 carbon atom Chemical group C* 0.000 claims description 24
- -1 halide ion Chemical class 0.000 claims description 21
- 238000000034 method Methods 0.000 claims description 21
- 125000000217 alkyl group Chemical group 0.000 claims description 20
- 108090000623 proteins and genes Proteins 0.000 claims description 20
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 19
- 102000004169 proteins and genes Human genes 0.000 claims description 16
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical group [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 claims description 12
- 239000004475 Arginine Chemical group 0.000 claims description 12
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical group C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 claims description 12
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical group NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 claims description 12
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical group NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 claims description 12
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Chemical group NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 12
- 239000004472 Lysine Chemical group 0.000 claims description 12
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical group [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 claims description 12
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Chemical group OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 12
- 125000004435 hydrogen atom Chemical group [H]* 0.000 claims description 12
- 229910052700 potassium Inorganic materials 0.000 claims description 12
- 239000011591 potassium Chemical group 0.000 claims description 12
- 239000011734 sodium Substances 0.000 claims description 12
- 229910052708 sodium Inorganic materials 0.000 claims description 12
- ZMANZCXQSJIPKH-UHFFFAOYSA-O triethylammonium ion Chemical group CC[NH+](CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-O 0.000 claims description 12
- 125000003277 amino group Chemical group 0.000 claims description 10
- 229910006127 SO3X Inorganic materials 0.000 claims description 8
- 125000003545 alkoxy group Chemical group 0.000 claims description 8
- 125000003118 aryl group Chemical group 0.000 claims description 8
- 125000004122 cyclic group Chemical group 0.000 claims description 8
- 238000002296 dynamic light scattering Methods 0.000 claims description 8
- 210000001165 lymph node Anatomy 0.000 claims description 8
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 8
- 239000012634 fragment Substances 0.000 claims description 7
- 150000002500 ions Chemical class 0.000 claims description 7
- 229920001184 polypeptide Polymers 0.000 claims description 6
- 239000003795 chemical substances by application Substances 0.000 claims description 5
- FLJIWUNZRZLSME-UHFFFAOYSA-N 1h-benzo[f]indole Chemical group C1=CC=C2C=C(NC=C3)C3=CC2=C1 FLJIWUNZRZLSME-UHFFFAOYSA-N 0.000 claims description 4
- HIYWOHBEPVGIQN-UHFFFAOYSA-N 1h-benzo[g]indole Chemical group C1=CC=CC2=C(NC=C3)C3=CC=C21 HIYWOHBEPVGIQN-UHFFFAOYSA-N 0.000 claims description 4
- ALGIYXGLGIECNT-UHFFFAOYSA-N 3h-benzo[e]indole Chemical group C1=CC=C2C(C=CN3)=C3C=CC2=C1 ALGIYXGLGIECNT-UHFFFAOYSA-N 0.000 claims description 4
- 102100027211 Albumin Human genes 0.000 claims description 4
- 125000001041 indolyl group Chemical group 0.000 claims description 4
- 229910052757 nitrogen Inorganic materials 0.000 claims description 3
- 125000004433 nitrogen atom Chemical group N* 0.000 claims description 3
- 230000036326 tumor accumulation Effects 0.000 abstract description 22
- 230000001747 exhibiting effect Effects 0.000 abstract description 2
- 239000000975 dye Substances 0.000 description 115
- 239000000243 solution Substances 0.000 description 49
- BDBMLMBYCXNVMC-UHFFFAOYSA-O 4-[(2e)-2-[(2e,4e,6z)-7-[1,1-dimethyl-3-(4-sulfobutyl)benzo[e]indol-3-ium-2-yl]hepta-2,4,6-trienylidene]-1,1-dimethylbenzo[e]indol-3-yl]butane-1-sulfonic acid Chemical compound OS(=O)(=O)CCCCN1C2=CC=C3C=CC=CC3=C2C(C)(C)C1=CC=CC=CC=CC1=[N+](CCCCS(O)(=O)=O)C2=CC=C(C=CC=C3)C3=C2C1(C)C BDBMLMBYCXNVMC-UHFFFAOYSA-O 0.000 description 46
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 45
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 45
- 229960004657 indocyanine green Drugs 0.000 description 43
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 34
- 230000035508 accumulation Effects 0.000 description 30
- 238000009825 accumulation Methods 0.000 description 30
- 150000001875 compounds Chemical class 0.000 description 28
- 210000001519 tissue Anatomy 0.000 description 27
- 210000004369 blood Anatomy 0.000 description 25
- 239000008280 blood Substances 0.000 description 25
- 239000000203 mixture Substances 0.000 description 25
- 210000005005 sentinel lymph node Anatomy 0.000 description 25
- 239000000126 substance Substances 0.000 description 23
- 238000002372 labelling Methods 0.000 description 20
- 241000699670 Mus sp. Species 0.000 description 17
- 239000007864 aqueous solution Substances 0.000 description 17
- 235000018102 proteins Nutrition 0.000 description 14
- 239000011541 reaction mixture Substances 0.000 description 14
- 210000004027 cell Anatomy 0.000 description 13
- 238000011156 evaluation Methods 0.000 description 13
- 241000699666 Mus <mouse, genus> Species 0.000 description 12
- 238000000108 ultra-filtration Methods 0.000 description 12
- 238000002835 absorbance Methods 0.000 description 10
- 210000001072 colon Anatomy 0.000 description 10
- 238000005259 measurement Methods 0.000 description 10
- 229920001223 polyethylene glycol Polymers 0.000 description 10
- 229920004890 Triton X-100 Polymers 0.000 description 9
- 235000001014 amino acid Nutrition 0.000 description 9
- 150000001413 amino acids Chemical class 0.000 description 9
- 238000006243 chemical reaction Methods 0.000 description 9
- 239000008055 phosphate buffer solution Substances 0.000 description 9
- 239000013504 Triton X-100 Substances 0.000 description 8
- 229920003023 plastic Polymers 0.000 description 8
- 239000004033 plastic Substances 0.000 description 8
- PUIWPNXPCPENEL-UHFFFAOYSA-M sodium;1-[6-[2-[7-[1,1-dimethyl-3-(4-sulfonatobutyl)benzo[e]indol-2-ylidene]hepta-1,3,5-trienyl]-1,1-dimethylbenzo[e]indol-3-ium-3-yl]hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].[O-]S(=O)(=O)CCCCN1C2=CC=C3C=CC=CC3=C2C(C)(C)\C1=C\C=C\C=C\C=C\C(C(C1=C2C=CC=CC2=CC=C11)(C)C)=[N+]1CCCCCC(=O)ON1C(=O)CC(S([O-])(=O)=O)C1=O PUIWPNXPCPENEL-UHFFFAOYSA-M 0.000 description 8
- 230000000052 comparative effect Effects 0.000 description 7
- 239000000523 sample Substances 0.000 description 7
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 238000010521 absorption reaction Methods 0.000 description 6
- 238000002523 gelfiltration Methods 0.000 description 6
- 239000002502 liposome Substances 0.000 description 6
- 230000014759 maintenance of location Effects 0.000 description 6
- 238000011580 nude mouse model Methods 0.000 description 6
- 230000009467 reduction Effects 0.000 description 6
- 239000012086 standard solution Substances 0.000 description 6
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 6
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 5
- 239000002612 dispersion medium Substances 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 238000010172 mouse model Methods 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 238000000926 separation method Methods 0.000 description 5
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 101150054472 HER2 gene Proteins 0.000 description 4
- 241001662443 Phemeranthus parviflorus Species 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 102000036639 antigens Human genes 0.000 description 4
- 108091007433 antigens Proteins 0.000 description 4
- 239000007853 buffer solution Substances 0.000 description 4
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 4
- 108700020302 erbB-2 Genes Proteins 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 241000021375 Xenogenes Species 0.000 description 3
- 239000006096 absorbing agent Substances 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 210000004204 blood vessel Anatomy 0.000 description 3
- 229940098773 bovine serum albumin Drugs 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000001569 carbon dioxide Substances 0.000 description 3
- 229910002092 carbon dioxide Inorganic materials 0.000 description 3
- 239000013068 control sample Substances 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 3
- 239000000706 filtrate Substances 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000003068 molecular probe Substances 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 230000035699 permeability Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- QGKMIGUHVLGJBR-UHFFFAOYSA-M (4z)-1-(3-methylbutyl)-4-[[1-(3-methylbutyl)quinolin-1-ium-4-yl]methylidene]quinoline;iodide Chemical compound [I-].C12=CC=CC=C2N(CCC(C)C)C=CC1=CC1=CC=[N+](CCC(C)C)C2=CC=CC=C12 QGKMIGUHVLGJBR-UHFFFAOYSA-M 0.000 description 2
- AZQWKYJCGOJGHM-UHFFFAOYSA-N 1,4-benzoquinone Chemical compound O=C1C=CC(=O)C=C1 AZQWKYJCGOJGHM-UHFFFAOYSA-N 0.000 description 2
- FPKVOQKZMBDBKP-UHFFFAOYSA-N 1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 FPKVOQKZMBDBKP-UHFFFAOYSA-N 0.000 description 2
- NHJVRSWLHSJWIN-UHFFFAOYSA-N 2,4,6-trinitrobenzenesulfonic acid Chemical compound OS(=O)(=O)C1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O NHJVRSWLHSJWIN-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 2
- 0 C[*@](C=C*(C)C1=IN(*)c2ccccc2C1(*)*)C=C1N(CC(N)=O)c2ccccc2C1(*)* Chemical compound C[*@](C=C*(C)C1=IN(*)c2ccccc2C1(*)*)C=C1N(CC(N)=O)c2ccccc2C1(*)* 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-L L-tartrate(2-) Chemical compound [O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O FEWJPZIEWOKRBE-JCYAYHJZSA-L 0.000 description 2
- 241001067739 Lotis Species 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical compound C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 229940006460 bromide ion Drugs 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- MTHSVFCYNBDYFN-UHFFFAOYSA-N diethylene glycol Substances OCCOCCO MTHSVFCYNBDYFN-UHFFFAOYSA-N 0.000 description 2
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 2
- 229910000397 disodium phosphate Inorganic materials 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 238000000799 fluorescence microscopy Methods 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- XMBWDFGMSWQBCA-UHFFFAOYSA-M iodide Chemical compound [I-] XMBWDFGMSWQBCA-UHFFFAOYSA-M 0.000 description 2
- 229940006461 iodide ion Drugs 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 238000005185 salting out Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 2
- 125000003396 thiol group Chemical group [H]S* 0.000 description 2
- 230000036962 time dependent Effects 0.000 description 2
- 238000003325 tomography Methods 0.000 description 2
- 210000000689 upper leg Anatomy 0.000 description 2
- 238000012800 visualization Methods 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- GJCOSYZMQJWQCA-UHFFFAOYSA-N 9H-xanthene Chemical compound C1=CC=C2CC3=CC=CC=C3OC2=C1 GJCOSYZMQJWQCA-UHFFFAOYSA-N 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 102000002068 Glycopeptides Human genes 0.000 description 1
- 108010015899 Glycopeptides Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical group SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- YOCCSAOEKXYHLX-UHFFFAOYSA-N NON(C(CC1)=O)C1=O Chemical compound NON(C(CC1)=O)C1=O YOCCSAOEKXYHLX-UHFFFAOYSA-N 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- GAMYVSCDDLXAQW-AOIWZFSPSA-N Thermopsosid Natural products O(C)c1c(O)ccc(C=2Oc3c(c(O)cc(O[C@H]4[C@H](O)[C@@H](O)[C@H](O)[C@H](CO)O4)c3)C(=O)C=2)c1 GAMYVSCDDLXAQW-AOIWZFSPSA-N 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 238000011481 absorbance measurement Methods 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000011088 calibration curve Methods 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 239000013522 chelant Substances 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 235000019800 disodium phosphate Nutrition 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 235000020188 drinking water Nutrition 0.000 description 1
- 239000003651 drinking water Substances 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000004945 emulsification Methods 0.000 description 1
- 229930003944 flavone Natural products 0.000 description 1
- 150000002212 flavone derivatives Chemical class 0.000 description 1
- 235000011949 flavones Nutrition 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000001678 irradiating effect Effects 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- QDLAGTHXVHQKRE-UHFFFAOYSA-N lichenxanthone Natural products COC1=CC(O)=C2C(=O)C3=C(C)C=C(OC)C=C3OC2=C1 QDLAGTHXVHQKRE-UHFFFAOYSA-N 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 239000011259 mixed solution Substances 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- NRNCYVBFPDDJNE-UHFFFAOYSA-N pemoline Chemical compound O1C(N)=NC(=O)C1C1=CC=CC=C1 NRNCYVBFPDDJNE-UHFFFAOYSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- IEQIEDJGQAUEQZ-UHFFFAOYSA-N phthalocyanine Chemical compound N1C(N=C2C3=CC=CC=C3C(N=C3C4=CC=CC=C4C(=N4)N3)=N2)=C(C=CC=C2)C2=C1N=C1C2=CC=CC=C2C4=N1 IEQIEDJGQAUEQZ-UHFFFAOYSA-N 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 150000004291 polyenes Chemical class 0.000 description 1
- 150000004032 porphyrins Chemical class 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- WVIICGIFSIBFOG-UHFFFAOYSA-N pyrylium Chemical compound C1=CC=[O+]C=C1 WVIICGIFSIBFOG-UHFFFAOYSA-N 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 125000005504 styryl group Chemical group 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000013076 target substance Substances 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- AAAQKTZKLRYKHR-UHFFFAOYSA-N triphenylmethane Chemical compound C1=CC=CC=C1C(C=1C=CC=CC=1)C1=CC=CC=C1 AAAQKTZKLRYKHR-UHFFFAOYSA-N 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 229940124549 vasodilator Drugs 0.000 description 1
- 239000003071 vasodilator agent Substances 0.000 description 1
- VHBFFQKBGNRLFZ-UHFFFAOYSA-N vitamin p Natural products O1C2=CC=CC=C2C(=O)C=C1C1=CC=CC=C1 VHBFFQKBGNRLFZ-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/22—Echographic preparations; Ultrasound imaging preparations ; Optoacoustic imaging preparations
- A61K49/221—Echographic preparations; Ultrasound imaging preparations ; Optoacoustic imaging preparations characterised by the targeting agent or modifying agent linked to the acoustically-active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/22—Echographic preparations; Ultrasound imaging preparations ; Optoacoustic imaging preparations
- A61K49/222—Echographic preparations; Ultrasound imaging preparations ; Optoacoustic imaging preparations characterised by a special physical form, e.g. emulsions, liposomes
- A61K49/225—Microparticles, microcapsules
Definitions
- the present invention relates to a contrast agent for photoacoustic imaging.
- a photoacoustic tomography (hereinafter, also referred to as "PAT") apparatus is known as one of apparatuses for visualizing in-vivo information.
- PAT apparatus an image can be obtained by measuring the intensity and the time of generation of a photoacoustic signal emitted from a substance (optical absorber) that absorbs light in an object to be measured when the object is irradiated with light, and computing a distribution of the substance in the object.
- ICG indocyanine green
- PAT apparatuses any substance that absorbs light and emits an acoustic wave in a living body may be used as an optical absorber.
- a blood vessel or a malignancy in the human body may be used as an optical absorber.
- molecules of indocyanine green hereinafter, also abbreviated as "ICG"
- ICG may be administered into the body and used as contrast agents.
- ICG well absorbs light in the near-infrared wavelength region, the light having little influence on the human body when the human body is irradiated with the light and having a high permeability to a living body.
- ICG may be used as a contrast agent in PAT apparatuses.
- ICG indicates a compound represented by formula (1) described below.
- the counter ion may not be Na + . Any counter ion, e.g., H + or K + , may be used.
- NPL 1 reports a case of photoacoustic imaging of cerebral blood vessels of a rat with free ICG. According to this report, the photoacoustic signal intensity is reduced to a level equal to that of blood several tens of minutes after free ICG is administered in blood. This suggests that the administered substance is rapidly cleared from blood after administration.
- aspects of the present invention provide a contrast agent for photoacoustic imaging, the contrast agent exhibiting high tumor accumulation and high photoacoustic signal intensity even when time has passed since administration.
- a contrast agent for photoacoustic imaging comprises a complex including albumin bound to a near-infrared absorbing organic dye.
- a contrast agent for photoacoustic imaging comprises a complex represented by formula (I):
- A represents a site of albumin with one amino group removed.
- A' represents formula (i) or (ii).
- "*" in each of formulae (i) and (ii) is bound to a nitrogen atom (N) in formula (I).
- Z's each represent a hydrogen atom, a sulfonic group, or a cyclic aromatic ring selected from the group consisting of a benz[e]indole ring, a benz[f]indole ring, and a benz[g]indole ring formed together with an indole ring bound to a corresponding one of Z's.
- the hydrogen atoms of the cyclic aromatic ring each may be replaced with an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, or a sulfonic group.
- R 1 's each represent an alkyl group having 1 to 10 carbon atoms or -(CH 2 ) b -SO 3 - (wherein b represents an integer of 1 to 10).
- R 1 's each represent an alkyl group
- a halide ion or an organic acid ion may be contained as a counter ion.
- R 2 's and R 3 's each independently represent a hydrogen atom, an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, -(CH 2 ) b -SO 3 - (wherein b represents an integer of 1 to 10), or -(CH 2 ) b -SO 3 X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine).
- a's each represent an integer of 1 to 10
- n's each represent 2 or 3.
- R 4 represents an alkyl group having 1 to 10 carbon atoms or -(CH 2 ) b -SO 3 X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine).
- a contrast agent for photoacoustic imaging contains a complex including albumin bound to an organic dye, such as ICG, the dye absorbing light in the near-infrared wavelength region; hence, the contrast agent exhibits high accumulation in a tumor and high intensity of a photoacoustic signal emitted from the tumor, compared with the case where free ICG is administered.
- an organic dye such as ICG
- Fig. 1A illustrates the results of measurements of time-dependent photoacoustic imaging of a tumor site of a tumor-bearing model mouse to which ICG-HSA (7) prepared in an example of the present invention is administered.
- Fig. 1B illustrates the results of measurements of time-dependent photoacoustic imaging of a tumor site of a tumor-bearing model mouse to which ICG-HSA (7) prepared in an example of the present invention is administered.
- Fig. 2 illustrates the result of measurement of photoacoustic imaging of a nude mouse 1 day after subcutaneous administration of ICG-HSA (7) prepared in an example of the present invention into the plantar surface of the nude mouse.
- Fig. 3 illustrates the results of measurements of photoacoustic imaging of a sentinel lymph node removed 1 day after subcutaneous administration of ICG-HSA (7) prepared in an example of the present invention into plantar surfaces of nude mice.
- a contrast agent for photoacoustic imaging (hereinafter, also abbreviated as "PAI") according to an embodiment of the present invention will be described below.
- the contrast agent for PAI includes a complex including albumin covalently bound to an organic dye that absorbs light in the near-infrared wavelength region (hereinafter, also abbreviated as a "near-infrared absorbing organic dye").
- an organic dye that absorbs light in the near-infrared wavelength region hereinafter, also abbreviated as a "near-infrared absorbing organic dye”
- light in the near-infrared wavelength region refers to light having a wavelength of 600 nm to 1300 nm.
- a near-infrared absorbing organic dye such as ICG
- the dye is easily adsorbed on protein in blood and excreted from the body.
- the near-infrared absorbing organic dye may react with water molecules in blood to decompose.
- the dye exhibits short retention in blood and low accumulation in a tumor. Accordingly, in the case where a free near-infrared absorbing organic dye is used as a contrast agent for photoacoustic imaging, the intensity of the photoacoustic signal emitted from a tumor is low.
- albumin inhibits the adsorption of protein in blood on the near-infrared absorbing organic dye because the near-infrared absorbing organic dye is covalently bound to albumin.
- the contrast agent for PAI according to this embodiment is administered in blood of a living body, the contrast agent does not easily adsorb on protein in blood and is not easily excreted from the body.
- water molecules in blood do not easily approach the near-infrared absorbing organic dye because the near-infrared absorbing organic dye and albumin are covalently bound together; hence, the near-infrared absorbing organic dye is not easily decomposed.
- albumin has a half-life of about 20 days or less and is thus stable in a living body.
- the retention in blood should be improved, compared with the case where a free near-infrared absorbing organic dye is administered.
- the contrast agent for PAI according to this embodiment exhibits longer retention in blood and high accumulation in a tumor, compared with the case of administration of a free near-infrared absorbing organic dye.
- the effect of increasing the intensity of a photoacoustic signal emitted from the tumor should be provided.
- At least one albumin and at least one near-infrared absorbing organic dye may be covalently bound together.
- a plurality of albumins and a plurality of near-infrared absorbing organic dyes may be covalently bound together.
- at least one near-infrared absorbing organic dye may be covalently bound to albumin, and the remaining near-infrared absorbing organic dyes may be noncovalently bound.
- the complex includes a near-infrared absorbing organic dye and a plurality of albumins
- at least one albumin may be covalently bound to the near-infrared absorbing organic dye, and the remaining albumins may be noncovalently bound.
- albumin and the near-infrared absorbing organic dye are covalently bound together
- a site this may also be referred to as a "group” of albumin with a portion (typically, H or OH) of albumin removed and a site of the near-infrared absorbing organic dye with a portion (typically, H or OH) of the near-infrared absorbing organic dye removed are covalently bound.
- the "complex” can also be referred to as a "molecule" from another point of view.
- the number of the near-infrared absorbing organic dyes covalently bound to one albumin is referred to as a "dye labeling index".
- the dye labeling index may be higher than 0.9 and lower than 3.1.
- the dye labeling index is preferably 1.6 or more and 3.0 or less. The reason for this is that when the dye labeling index falls within the range described above, high tumor accumulation is obtained.
- the dye labeling index was calculated by measuring concentrations of the near-infrared absorbing organic dye and albumin in a sample and determining the ratio of the concentration of the near-infrared absorbing organic dye to the concentration of albumin (the concentration of the near-infrared absorbing organic dye/the concentration of albumin).
- the concentration of the near-infrared absorbing organic dye was calculated from the absorbance at a specific absorption wavelength of the dye. For example, when ICG-Sulfo-OSu (a compound represented by formula (2) described below) is used, a wavelength of 800 nm may be used as the specific absorption wavelength. When a compound represented by formula (5) is used, a wavelength of 750 nm may be used as the specific absorption wavelength. However, another specific absorption wavelength may be used.
- the concentration of albumin may be determined by, for example, the BCA assay.
- the contrast agent for PAI may contain a complex represented by formula (I),
- A represents a site of albumin with one amino group removed.
- A' represents formula (i) or (ii).
- "*" in each of formulae (i) and (ii) is bound to a nitrogen atom (N) in formula (I).
- Z's each represent a hydrogen atom, a sulfonic group, or a cyclic aromatic ring selected from the group consisting of a benz[e]indole ring, a benz[f]indole ring, and a benz[g]indole ring formed together with an indole ring bound to a corresponding one of Z's.
- the hydrogen atoms of the cyclic aromatic ring each may be replaced with an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, or a sulfonic group.
- R 1 's each represent an alkyl group having 1 to 10 carbon atoms or -(CH 2 ) b -SO 3 - (wherein b represents an integer of 1 to 10).
- a halide ion e.g., a chloride ion, a bromide ion, or an iodide ion
- an organic acid ion e.g., an acetate ion, a tartrate ion, or a succinate ion
- a counter ion e.g., a halide ion, e.g., a chloride ion, a bromide ion, or an iodide ion
- an organic acid ion e.g., an acetate ion, a tartrate ion, or a succinate ion
- R 2 's and R 3 's each independently represent a hydrogen atom, an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, -(CH 2 ) b -SO 3 - (wherein b represents an integer of 1 to 10), or -(CH 2 ) b -SO 3 X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine).
- a's each represent an integer of 1 to 10
- n's each represent 2 or 3.
- R 4 represents an alkyl group having 1 to 10 carbon atoms or -(CH 2 ) b -SO 3 X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine).
- a portion indicated by A-N-H corresponds to the site of albumin with a portion of albumin removed.
- A' corresponds to the site of the near-infrared absorbing organic dye with a portion of the near-infrared absorbing organic dye removed.
- formula (i) may be represented by any one of formulae (i-1) to (i-6) described below.
- Y - represents a halide ion, e.g., a chloride ion, a bromide ion, or an iodide ion, or an organic acid ion, e.g., an acetate ion, a tartrate ion, or a succinate ion.
- X's each represent sodium, potassium, ammonium, triethylammonium, lysine, or arginine.
- formula (ii) may be represented by formula (ii-1) or (ii-2) described below.
- X's each represent sodium, potassium, ammonium, triethylammonium, lysine, or arginine.
- a's may each represent an integer of 2 to 6.
- b's in R 1 's, R 2 's, and R 3 's may each represent an integer of 2 to 6.
- the complex may be represented by formula (I-1) described below.
- A represents a site of albumin with one amino group of albumin removed.
- the contrast agent for PAI may contain a capture molecule that binds specifically to a target site.
- Albumin according to this embodiment is an abundant protein in blood (35 to 50 g/L), the protein having a molecular mass of 66.5 kDa and containing 585 amino acids in its complete sequence. Albumin is localized in vivo to play many roles, such as osmotic control.
- human serum albumin (HSA) and bovine serum albumin (BSA) may be used as albumin according to this embodiment.
- a variant of HSA or BSA may also be used.
- a fragment thereof may also be used.
- HSA, a variant of HSA, a fragment of HSA, or a fragment of a variant of HSA, which is believed to be safe for the human body may be used.
- Albumin according to this embodiment may be an extract from human blood or a product from Escherichia coli or the like.
- Albumin according to this embodiment has a homology of at least 95% or more, as compared with the complete sequence or a partial sequence from the complete sequence of HSA.
- Albumin has a plurality of lysine residues or a free cysteine residue at positions where the near-infrared absorbing organic dye is accessible.
- a chemical bond between albumin and the near-infrared absorbing organic dye is formed, for example, an amide bond between an amino group of a lysine residue of albumin and a carboxy group of the near-infrared absorbing organic dye is exemplified.
- the near-infrared absorbing organic dye is not particularly limited as long as it is an organic dye that absorbs light in the near-infrared wavelength region to emit an acoustic wave.
- Examples of the near-infrared absorbing organic dye in this embodiment include azine-based dyes, acridine-based dyes, triphenylmethane-based dyes, xanthene-based dyes, porphyrin-based dyes, cyanine-based dyes, phthalocyanine-based dyes, styryl-based dyes, pyrylium-based dyes, azo-based dyes, quinone-based dyes, tetracycline-based dyes, flavone-based dyes, polyene-based dyes, BODIPY (registered trademark)-based dyes, and indigoid-based dyes.
- azine-based dyes acridine-based dyes, triphenylmethane-based dyes, xanthene-based dyes, porphyrin-based dyes, cyanine-based dyes, phthalocyanine-based dyes, styryl-based dyes, pyr
- cyanine-based dyes examples include indocyanine green (ICG), Alexa Fluor (registered trademark)-based dyes, such as Alexa 750, (manufactured by Invitrogen Corporation); Cy (registered trademark)-based dyes (manufactured by GE Healthcare Biosciences K.K.); IR-783, IR-806, and IR-820 (manufactured by Sigma-Aldrich Japan K.K.); IRDye 800CW and IRDye 800RS (registered trademark) (manufactured by LI-COR, Inc.); ADS780WS, ADS795WS, ADS830WS, and ADS832WS (manufactured by American Dye Source Inc.); Hylight (manufactured by Dojindo Laboratories); and DyLight (manufactured by Thermo Fisher Scientific Inc).
- ICG indocyanine green
- Alexa Fluor registered trademark-based dyes, such as Alexa
- the near-infrared absorbing organic dye may be represented by formula (II) described below.
- B represents formula (i) or (ii) described above.
- B' represents any one of formulae (iii) to (vi) described below.
- a compound represented by formula (2) (ICG-Sulfo-OSu (registered trademark, manufactured by Dojindo Laboratories)), a compound represented by formula (3), a compound represented by formula (4), a compound represented by formula (5), a compound represented by formula (6), or a compound represented by formula (7) may be used.
- albumin and the near-infrared absorbing organic dye may be covalently bound together by a known coupling reaction with an amino group, a thiol group, a carboxy group, or a hydroxy group provided therebetween.
- a plurality of amino groups are present in albumin and react efficiently and selectively in a weak alkaline pH region.
- the near-infrared absorbing organic dye bound to albumin by the reaction may be washed and purified by a known protein purification method, for example, ultrafiltration or size-exclusion column chromatography.
- albumin and the near-infrared absorbing organic dye With respect to the bond between albumin and the near-infrared absorbing organic dye, the amino group, the thiol group, the carboxy group, or the hydroxy group present on the surface of albumin may be directly bound to a derivative of the near-infrared absorbing organic dye. Alternatively, albumin and the near-infrared absorbing organic dye may be bound together with any of a variety of cross-linkers.
- the complex may be in the form of particles.
- Each of the particles may be any of shapes, such as spherical, elliptic, planar, and one-dimensional string-like shapes.
- the hydrodynamic average particle size (hereinafter, abbreviated simply as "particle size", in some cases) may be less than 1000 nm when measured by a dynamic light scattering method. A particle size of less than 1000 nm results in the accumulation of a large number of particles in a tumor site by the enhanced permeability and retention (EPR) effect, compared with normal sites in a living body.
- EPR enhanced permeability and retention
- the contrast agent for PAI accumulated in the tumor site results in the specific visualization of the tumor site by the use of a photoacoustic imaging apparatus.
- the particle size of the particles is preferably 200 nm or less and more preferably 50 nm or less when measured by the dynamic light scattering method. The reason for this is presumably that when the particle size of the particles is 200 nm or less, the contrast agent for PAI according to this embodiment is less likely to be taken up by macrophages in blood, thereby increasing the retention in blood. In addition, when the particle size of the particles is 50 nm or less, the tissue permeability of the particles should be increased, thereby increasing the accumulation of the particles that have reached a target site.
- the particle size of the particles may be determined by measuring the hydrodynamic average particle size using the dynamic light scattering (DLS) method with a dynamic light scattering spectrophotometer (DLS-8000, manufactured by Otsuka Electronics Co., Ltd).
- DLS dynamic light scattering
- the contrast agent for PAI may contain a dispersion medium in addition to the complex.
- the PAI is a concept including photoacoustic tomography.
- the dispersion medium include physiological saline, distilled water for injection, phosphate-buffered saline, and an aqueous glucose solution.
- the contrast agent for PAI according to this embodiment may contain a pharmaceutically acceptable additive, such as a vasodilator, as needed.
- the particles may be dispersed in the dispersion medium in advance.
- the particles and the dispersion medium may be prepared as a kit, and the particles may be dispersed in the dispersion medium prior to the administration of the contrast agent into a living body.
- the contrast agent for PAI in the contrast agent for PAI according to this embodiment, a larger number of the particles can be accumulated in a tumor site than in normal sites in a living body by the EPR effect when the contrast agent is administered into a living body.
- the intensity of an acoustic wave emitted from the tumor site can be increased, compared with the intensity of acoustic waves emitted from the normal sites.
- the contrast agent for PAI according to this embodiment may be used for tumor imaging.
- the contrast agent for PAI according to this embodiment may also be used to image a lymph node.
- the contrast agent may be used as a contrast agent for a sentinel lymph node (hereinafter, abbreviated as "SLN", in some cases).
- SSN sentinel lymph node
- a near-infrared absorbing organic dye such as ICG
- ICG an intracranial pressure
- the contrast agent for PAI according to this embodiment has a larger molecular size than the near-infrared absorbing organic dye, thus reducing the rate of diffusion in tissues. As a result, the retention time in the sentinel lymph node should be extended.
- the contrast agent for PAI according to this embodiment may be used to image a lymph node, in particular, a sentinel lymph node.
- the capture molecule in this embodiment is, for example, a substance that binds specifically to a target site, such as a tumor, or a substance that binds specifically to a substance present around a target site.
- the capture molecule may be freely selected from biomolecules and chemical substances, such as pharmaceuticals. Specific examples thereof include proteins, antibodies, antibody fragments, enzymes, biologically active peptides, glycopeptides, sugar chains, lipids, and molecule-recognizing compounds. These substances may be used separately or in combination.
- the use of the particles to which the capture molecules are chemically bonded enables the specific detection of a target site and the tracing of the dynamics, localization, efficacy of medicine, metabolism, and so forth of the target substance.
- protein refers to a compound in which 90 or more natural or non-natural amino acids are connected by amide bonds.
- polypeptide refers to a compound in which 30 or more and less than 90 natural or non-natural amino acids are connected by amide bonds.
- peptide refers to a compound in which less than 30 natural or non-natural amino acids are connected by amide bonds.
- protein, polypeptide, and peptide are classified by the number of amino acids connected, regardless of the presence or absence of various modifications.
- the capture molecule may be protein, polypeptide, or peptide.
- the capture molecule may be an antibody, which is a protein.
- the capture molecule may be a single-chain antibody.
- contrast agent for photoacoustic imaging, in which the contrast agent comprises a complex which is represented by formula (III):
- ALB represents the albumin which is covalently bound by the organic dye
- C represents a capture molecule
- L represents a linker, ALB being bound to L, and L being bound to C.
- the capture molecule may be a protein, a polypeptide, or a peptide.
- the protein may be a single-chain antibody.
- L in formula (III) may include one or more succinimidyl groups at an end and one or more maleimido groups at the other end.
- L in formula (III) may include one or more succinimidyl groups at the end, one or more maleimido groups at the other end, and one or more ethylene glycol moieties.
- L in formula (III) may represent succinimidyl-[(N-maleimidopropionamido)-diethyleneglycol] ester or SUNBRIGHT MA-100TS.
- L in formula (III) may represent succinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate.
- L in formula (III) may include two or more succinimidyl groups at an end.
- L in formula (III) may include two or more succinimidyl groups at an end and one or more ethylene glycol moieties.
- L in formula (III) may represent bis-N-succinimidyl-(pentaethylene glycol) ester.
- the contrast agent for photoacoustic imaging according to the present embodiment may contain an addition agent used in freeze-drying.
- addition agents include glucose, lactose, mannitol, polyethylene glycol, glycine, sodium chloride, and sodium hydrogen phosphate.
- One type of addition agent may be used alone or some types may be used in combination.
- a method for detecting the contrast agent for PAI according to this embodiment, the contrast agent being administered into a living body, with a photoacoustic imaging apparatus will be described below.
- the method for detecting the contrast agent for PAI according to this embodiment includes steps (a) and (b) described below.
- the photoacoustic imaging method according to this embodiment may include a step other than the following steps: (a) a step of irradiating a subject into which the contrast agent for PAI according to this embodiment has been administered with light in a wavelength region of 600 nm to 1300 nm; and (b) a step of detecting an acoustic wave emitted from the contrast agent present in the subject.
- the photoacoustic imaging method may include a step of reconstituting a spatial photoacoustic signal intensity distribution on the basis of the wavelength, the phase, the time information, and so forth of the resulting acoustic wave obtained in step (b).
- Three-dimensional image reconstruction may be performed on the basis of the wavelength, the phase, and the time information of the acoustic wave obtained in step (b).
- Data obtained by the image reconstruction may be in any form as long as the positional information on the photoacoustic signal intensity distribution can be determined.
- the photoacoustic signal intensity may be expressed in three-dimensional space or on a two-dimensional surface.
- the information of the same observation object is acquired by another imaging method, and the positional relationship between the information and the photoacoustic signal intensity distribution can be acquired.
- step (a) described above a subject to which the contrast agent for PAI according to this embodiment is administered by a method, for example, oral administration or injection may be used.
- an apparatus configured to generate light with which the subject is irradiated and an apparatus configured to detect an acoustic wave emitted from the contrast agent for PAI according to this embodiment are not particularly limited.
- any light source may be used without limitation as long as the subject can be irradiated with pulsed laser light having at least one wavelength selected from the range of 600 nm to 1300 nm.
- the apparatus configured to emit pulsed laser light for example, a titanium-sapphire laser (LT-2211-PC, manufactured by Lotis Ltd.), OPO laser (LT-2214 OPO, manufactured by Lotis Ltd.), or an alexandrite laser may be used.
- the apparatus configured to detect an acoustic wave is not particularly limited, and any of a variety of apparatuses may be used.
- a commercially available photoacoustic imaging apparatus (Nexus128, manufactured by Endra Inc.) may be used.
- a target site for example, a tumor, a lymph node, or a blood vessel, can be imaged through steps (a) and (b).
- the photoacoustic signal intensity was measured as described below.
- a commercially available photoacoustic imaging apparatus (Nexus128, manufactured by Endra Inc.) was used. Photoacoustic signals were measured at predetermined timings before and after the administration of a prepared contrast agent for PAI, and three-dimensional reconstruction data was acquired for each timing. The photoacoustic signal intensity in a region of interest (ROI) was measured on the basis of the resulting three-dimensional reconstruction data using software (GEHC MICROVIEW, GE Healthcare) or the like. Calculation of dye labeling index
- the dye labeling index to albumin was calculated by measuring the absorbance of a sample.
- a dye concentration in the sample was calculated from absorbance at a specific absorption wavelength of the dye used. Specifically, when ICG-Sulfo-OSu (compound represented by formula (2) described above) was used, the absorbance was measured at 800 nm. When the compound represented by formula (5) described above was used, the absorbance was measured at 750 nm.
- the concentration of ICG was determined by diluting the sample with 5% SDS, measuring the absorbance, and calculating the concentration of ICG from a previously formed calibration curve of the dye in SDS.
- the concentration of HSA was calculated by the BCA assay.
- the evaluation of the contrast agent for PAI into a tumor mass was performed using tumor-bearing mice.
- the tumor-bearing mice were prepared by subcutaneously implanting a human gastric cancer cell line (N87) or a human cervical cancer cell line (HeLa) into nude mice. Then 130 nmol of a contrast agent in terms of the amount of the dye was administered into each of the tumor-bearing mice.
- Photoacoustic imaging was performed 5 minutes after the administration and 1 day after the administration.
- fluorescence imaging of the tumor-bearing mice was performed 1 day after the administration. Fluorescence imaging was performed with IVIS (registered trademark) Imaging System to measure fluorescence intensity in a region of interest (ROI) of the tumor site.
- IVIS registered trademark
- the transfer of the contrast agent for PAI into a sentinel lymph node was evaluated by the use of a mouse popliteal lymph node. Ten microliters of the contrast agent was administered subcutaneously into the plantar surface of a nude mouse. Photoacoustic imaging of the mouse popliteal lymph node was performed after 1 day.
- mouse popliteal lymph nodes were removed 1 day after the administration of various contrast agents, homogenized, and extracted. The resulting extracts were subjected to absorbance measurement.
- the accumulation ratios of various materials were calculated when the accumulation 1 day after the administration of ICG was defined as 1.
- a compound according to this embodiment is a compound in which an amino group on the surface of HSA is covalently bound to a near-infrared absorbing organic dye.
- a typical structure of ICG-HSA is represented by formula (IV).
- a typical structure of ICG'-HSA is represented by formula (V).
- HSA Human serum albumin
- bicarbonate buffer solutions pH: 9.4
- DMSO dimethyl sulfoxide
- the dye labeling index can be changed in any range by changing the feed molar ratio of the dye derivative to HSA.
- the filtrates obtained by sterile filtration did not exhibit absorbance at the specific absorption wavelength of the dye; hence, the dye labeling index was not calculated.
- the hydrodynamic average particle size of ICG-HSA (7) prepared by the foregoing method was measured with a dynamic light scattering spectrophotometer (DLS-8000, manufactured by Otsuka Electronics Co., Ltd). Table 3 describes the results.
- the average particle sizes of ICG available from Pharmaceutical and Medical Device Regulatory Science of Japan
- HSA HSA
- ICG-HSA (7)-encapsulating liposome particles and ICG-encapsulating micellar particles are also described.
- the ICG-HSA (7)-encapsulating liposome particles refer to particles in which ICG-HSA (7) prepared by the foregoing method is encapsulated in phospholipid liposome by a known method.
- the ICG-encapsulating micellar particles refer to micellar particles in which ICG is contained in surfactant micelles by a known emulsification technique.
- ICG-HSA contrast agents were administered to tumor-bearing mice into which the N87 cell line was implanted.
- ICG-HSA (7) and various contrast agents were administered in blood of the tumor-bearing mice.
- the tumor accumulation 1 day after the administration was evaluated by fluorescence.
- the accumulation in ROI of the tumor site was calculated.
- Table 5 describes the result of the relative tumor accumulation with respect to the ROI value of ICG.
- the relative tumor accumulation values of ICG, ICG-HSA (7)-encapsulating liposome particles, and ICG-encapsulating micellar particles are also described. The results demonstrated that ICG-HSA (7) had higher tumor accumulation than other comparative materials.
- the accumulation in a sentinel lymph node was evaluated by photoacoustic imaging.
- 130 nmol of ICG-HSA (7) in terms of the amount of the dye was administered subcutaneously into the plantar surface of a nude mouse.
- an evaluation was made as to whether the sentinel lymph node was visualized 1 day after the administration by photoacoustic imaging.
- Table 6 and Fig. 2 illustrate the results.
- substantially no photoacoustic signal was observed from the sentinel lymph nodes 1 day after the administration, so that the sentinel lymph nodes were not visualized.
- the SLN was clearly visualized (see Fig.
- ICG-HSA (7) had visualization properties substantially the same as ICG-HSA-encapsulating liposome.
- the SLN was removed.
- the removed SLN and an SLN into which no contrast agent was administered were juxtaposed to each other and subjected to photoacoustic imaging.
- Fig. 3 illustrates the results. A significant photoacoustic signal was observed from the SLN 1 day after the administration of ICG-HSA (7), as compared with the unadministered SLN.
- Aqueous solutions of ICG-HSA (2), ICG-HSA (7), ICG-HSA (21), and ICG-HSA (50) were prepared by the method described in EXAMPLE.
- Tumor model mice were prepared by subcutaneously implanting Colon 26 cells into BALB/c Slc-nu/nu mice.
- the aqueous ICG-HSA solutions were intravenously injected in volumes of 100 microliters each (13 nmol in terms of ICG) into the tumor model mice to evaluate the tumor accumulation.
- ICG-Gly a compound was synthesized by the reaction of ICG-Sulfo-OSu with glycine in a molar ratio of 1:1 (hereinafter, abbreviated as "ICG-Gly") and used as a control sample.
- mice were euthanized with carbon dioxide 24 hours after administration.
- the tumor tissues were removed and transferred to plastic tubes.
- An aqueous solution of 1% Triton X-100 was added to each of the tubes in an amount 1.25 times the weight of the tumor tissues.
- Each of the resulting mixtures was homogenized with a plastic pestle.
- DMSO was added to each mixture in an amount 20.25 times the weight of the tumor tissues to prepare a solution of the dye extracted from the tumor tissues.
- An aqueous ICG-HSA solution having a known concentration and an aqueous ICG-Gly solution serving as a control were diluted with the solution of the tumor tissues in Triton X-100 to various concentrations.
- DMSO was added to each of the resulting dilute solutions in an amount 20.25 times the amount of each dilute solution to prepare standard solutions for calibration.
- the fluorescence intensity of the solutions of the dye extracted from the tumor tissues and the standard solutions for calibration was measured with the solutions in the tubes using IVIS (registered trademark) Imaging System 200 Series (XENOGEN Corporation) to quantitatively determine the amount of the dye (%ID/g) in the tumor tissues.
- Aqueous solutions of ICG-HSA (2), ICG-HSA (7), ICG-HSA (21), and ICG-HSA (50) were prepared by the method described in EXAMPLE.
- Tumor model mice were prepared by subcutaneously implanting Colon 26 cells into BALB/c Slc-nu/nu mice.
- the aqueous ICG-HSA solutions were intravenously injected in volumes of 100 microliters each (13 nmol in terms of ICG) into the tumor model mice to evaluate the tumor accumulation.
- an aqueous solution of ICG available from Pharmaceutical and Medical Device Regulatory Science of Japan was used as a control sample.
- mice were euthanized with carbon dioxide 24 hours after administration.
- the tumor tissues were removed and transferred to plastic tubes.
- An aqueous solution of 1% Triton X-100 was added to each of the tubes in an amount 1.25 times the weight of the tumor tissues.
- Each of the resulting mixtures was homogenized with a plastic pestle.
- DMSO was added to each mixture in an amount 20.25 times the weight of the tumor tissues to prepare a solution of the dye extracted from the tumor tissues.
- An aqueous ICG-HSA solution having a known concentration and an aqueous ICG solution were diluted with the solution of the tumor tissues in Triton X-100 to various concentrations.
- DMSO was added to each of the resulting dilute solutions in an amount 20.25 times the amount of each dilute solution to prepare standard solutions for calibration.
- the fluorescence intensity of the solutions of the dye extracted from the tumor tissues and the standard solutions for calibration was measured with the solutions in the tubes using IVIS (registered trademark) Imaging System 200 Series (XENOGEN Corporation) to quantitatively determine the amount of the dye (%ID/g) in the tumor tissues.
- Table 8 describes the accumulation in the Colon 26 cell mass 24 hours after the administration of the aqueous ICG-HSA solutions and the control.
- the results suggested that the tumor accumulation was improved by covalently binding the dye to HSA, compared with the aqueous ICG solution serving as a control sample.
- ICG-HSA (7) and ICG-HSA (15) exhibited high values of the ratio of tumor accumulation to blood accumulation 24 hours after the administration. This suggested that they were specifically accumulated in tumor, compared with blood.
- ICG-HSA (7) also exhibited high photoacoustic signal intensity at the tumor site 1 day after the administration. Among these samples, thus, ICG-HSA (7) was most effective in visualizing the tumor.
- a gene fragment encoding a single-chain antibody (scFv) moiety was prepared on the basis of the gene sequence of the variable region of IgG binding to HER2.
- a 6 x His tag comprising six consecutive histidine residues for protein purification was bound to the C-terminus of the prepared gene.
- two glycine residues serving as a spacer and a cysteine residue to introduce a signal generating molecule were arranged downstream thereof (SEQ. ID. NO: 1).
- a plasmid pET-22b (+) (Novagen) in which the foregoing gene fragment was inserted downstream of the T7 promoter was introduced into Escherichia coli BL21 (DE3) to give a strain for expression.
- the solution subjected to salting out was allowed to stand overnight at 4 degrees Celsius and centrifuged at 8000 x g for 30 minutes at 4 degrees Celsius to collect precipitates.
- the resulting precipitates were dissolved in 20 mM Tris HCl/500 mM NaCl buffer. The mixture was dialyzed against 1 L of the buffer. After the dialysis, the protein solution was added to a column filled with His Bind (registered trademark) Resin (Novagen) and purified by metal chelate affinity chromatography using a Ni ion.
- Human serum albumin (albumin from human serum: HSA, SIGMA) was dissolved in a bicarbonate buffer solution (pH: 8.5) in a concentration of 10 mg/mL to prepare an HSA solution. Then 1 mg of an ICG derivative (ICG-Sulfo-Osu, Dojindo Laboratories) was dissolved in 0.1 mL of DMSO. The resulting DMSO solution was added to the HSA solution in an amount 7 times the molar amount of HSA. The reaction mixture was allowed to stand at 37 degrees Celsius for 2 hours. The reaction mixture was subjected to ultrafiltration (30 kDa) to remove unreacted substances, thereby preparing an aqueous solution of ICG-HSA.
- Sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1- carboxylate (Sulfo-SMCC, PIERCE) was added thereto in an amount 60 times the molar amount of ICG-HSA.
- the mixture was allowed to stand at 4 degrees Celsius for 1 hour.
- the resulting reaction mixture was subjected to gel filtration (PD-10), so that the replacement with a phosphate buffer solution (PBS) and the separation of unreacted substances were performed, thereby preparing an aqueous solution of Sulfo-SMCC-modified ICG-HSA.
- PBS phosphate buffer solution
- Tris(2-carboxyethyl)phosphine (TCEP) hydrochloride was added to the single-chain scFv in an amount 14 times the molar amount of the single-chain antibody, scFv. The mixture was reacted at room temperature for 2 hours. Then scFv was mixed with Sulfo-SMCC-modified ICG-HSA prepared as described above in an amount 1 or 2 times the molar amount of Sulfo-SMCC-modified ICG-HSA. The mixture was reacted at room temperature for 5 hours.
- scFv-ICG-HSA scFv-ICG-HSA
- a compound prepared by the reaction of scFv in an amount 1 time the molar amount of Sulfo-SMCC-modified ICG-HSA is referred to as "scFv-ICG-HSA-1”.
- a compound prepared by the reaction of scFv in an amount 2 times the molar amount of Sulfo-SMCC-modified ICG-HSA is referred to as "scFv-ICG-HSA-2".
- Sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1- carboxylate (Sulfo-SMCC, PIERCE) was added to HSA in an amount 60 times the molar amount of HSA. The mixture was allowed to stand at 4 degrees Celsius for 1 hour. The resulting reaction mixture was subjected to gel filtration (PD-10), so that the replacement with a phosphate buffer solution (PBS) and the separation of unreacted substances were performed, thereby preparing an aqueous solution of Sulfo-SMCC-modified HSA.
- PBS phosphate buffer solution
- Tris(2-carboxyethyl)phosphine (TCEP) hydrochloride was added to the single-chain scFv in an amount 14 times the molar amount of the single-chain scFv. The mixture was reacted at room temperature for 2 hours. Then scFv was mixed with Sulfo-SMCC-modified HSA prepared as described above in an amount 3 times the molar amount of Sulfo-SMCC-modified HSA. The mixture was reacted at room temperature for 5 hours. The reaction mixture was subjected to ultrafiltration (50 kDa) to remove unreacted substances, thereby providing scFv-immobilized HSA (scFv-HSA).
- ICG was added to scFv-HSA prepared as described above in an amount 7, 21, or 70 times the molar amount of scFv-HSA.
- the mixture was reacted for 2 hours and subjected to ultrafiltration (30 kDa) to remove unreacted substances, thereby preparing ICG-labeled scFv-HSA (scFv-HSA-ICG).
- Compounds prepared by the reaction of ICG in amounts 7, 21, and 70 times the molar amount of scFv-HSA are referred to as scFv-HSA-ICG-7, scFv-HSA-ICG-21, and scFv-HSA-ICG-70, respectively.
- the dye labeling indices to HSA were calculated.
- the dye labeling indices were calculated by the quantitative determination of protein using the BCA assay and by the measurement of the concentrations on the basis of the absorbance of ICG. Table 9 describes the results.
- scFv-ICG-HSA and scFv-HSA prepared as described above the number of single-chain antibody molecules (scFv's) immobilized to HSA was calculated. Table 9 describes the results. The number of scFv's immobilized was calculated by performing sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and measuring Coomassie staining intensity of bands.
- HER2 which is an antigen
- scFv-ICG-HSA and scFv-HSA-ICG complexes prepared as described above were measured with a Biacore X System (GE Healthcare Corp.) to measure HER2-binding capacities.
- the antigen Recombinant Human ErbB2/Fc Chimera (R&D Systems, Inc.) was used.
- the antigen was immobilized by amine coupling to a carboxymethyldextran chain on a surface of Chip CM5 according to the manufacturer's recommendation. The amount of the antigen immobilized was about 5000 RU.
- PBS-T (2.68 mM KCl/137 mM NaCl/1.47 mM KH 2 PO 4 /1 mM Na 2 HPO 4 / 0.005% Tween 20, pH: 7.4) was used as a running buffer. Concentrations of samples were set to 100 nM to 800 nM. The samples were injected at a flow rate of 20 microliters per minutes to evaluate HER2-binding capacities (dissociation constants K D [M]). Table 9 describes the results. The results demonstrated that a larger number of scFv's immobilized resulted in a higher HER2-binding capacity.
- HER2-specific tumor accumulation of the molecular probes (ICG-HSA, scFv-ICG-HSA, and scFv-HSA-ICG) prepared as described above, an experiment was performed as described below.
- the molecular probes were administered to tumor-bearing model mice into which the HER2-positive N87 cell line and the HER2-negative SUIT-2 cell line were implanted. The tumors were removed 1 day after the administration. To the tumors, 1% Triton X-100 was added. The mixtures were homogenized. Dimethyl sulfoxide (DMSO) was added to each resulting homogenate in an amount 9 times the amount of the homogenate, thereby preparing a solution.
- DMSO Dimethyl sulfoxide
- the fluorescence intensity of these solutions was measured to calculate the tumor accumulation [%ID/g] per tumor weight of the molecular probes administered to the mice. Furthermore, a value obtained by dividing the tumor accumulation in N87 by the tumor accumulation in SUIT-2 (N87/SUIT-2) was calculated as a value indicating HER2 specificity. Table 9 describes the results. The results demonstrated that scFv-ICG-HSA-1, scFv-ICG-HSA-2, and scFv-HSA-ICG-7 exhibited HER2-specific accumulation.
- Comparison of scFv-HSA-ICG-7, scFv-HSA-ICG-21, and scFv-HSA-ICG-70 revealed that when the dye labeling index was 6.6 or more, HER2-specific accumulation was not observed.
- the results demonstrated that at a dye labeling index of 1.9, when the number of scFv's immobilized was 0.69 or more, HER2-specific accumulation was exhibited, and when the number of scFv's immobilized was 1.7, higher HER2 specificity was exhibited.
- the results demonstrated that when the number of scFv's immobilized was 2.9, the dye labeling index was required to be less than at least 6.6. Accordingly, the results suggested that the following conditions were required to achieve HER2-specific tumor accumulation: the number of scFv's immobilized was 0.69 or more and preferably about 1.7 or more, and the dye labeling index was less than 6.6.
- Human serum albumin (albumin from human serum: HSA, SIGMA) was dissolved in a bicarbonate buffer solution (pH: 8.5) in a concentration of 10 mg/mL to prepare an HSA solution. Then 1 mg of an ICG derivative (ICG-Sulfo-Osu, Dojindo Laboratories) was dissolved in 0.1 mL of DMSO. The resulting DMSO solution was added to the HSA solution in an amount 7 times the molar amount of HSA. The reaction mixture was allowed to stand at 37 degrees Celsius for 2 hours. The reaction mixture was subjected to ultrafiltration (30 kDa) to remove unreacted substances, thereby preparing an aqueous solution of ICG-HSA.
- SM(PEG)2 succinimidyl[(N-maleimidopropionamido) -diethyleneglycol] ester, PIERCE
- SUNBRIGHT MA-100TS NOF CORPORATION
- the number of molecules of each linker attached to ICG-HSA was calculated from a change in the number of amino acids in ICG-HSA before and after the attachment of the linker.
- the number of amino acids was quantitatively determined by a color reaction with 2,4,6-trinitrobenzenesulfonic acid.
- Affibody (registered trademark, Affibody) is a polypeptide serving as a HER2 capture molecule.
- Dithiothreitol NACALAI TESQUE, INC.
- PD-10 gel filtration
- This aqueous solution was mixed with each of the aqueous solutions of ICG-HSA modified with two types of linkers in different ratios. The mixtures were stirred at 25 degrees Celsius for 2 hours or more. Then the mixtures were subjected to ultrafiltration (30kDa) to remove unreacted Affibody (registered trademark), thereby preparing Affibody (registered trademark)-immobilized ICG-HSA. The number of Affibody (registered trademark) molecules immobilized was calculated by quantitatively determining unfixed molecules eluted in the filtrate by the ultrafiltration.
- Affibody (registered trademark)-immobilized ICG-HSA prepared by the use of SM(PEG)2 as the linker in an amount 10 times the molar amount of ICG-HSA is referred to as L1-ICG-HSA.
- Affibody (registered trademark)-immobilized ICG-HSA prepared by the use of SM(PEG)2 as the linker in an amount 100 times the molar amount of ICG-HSA is referred to as L2-ICG-HSA.
- Affibody (registered trademark)-immobilized ICG-HSA prepared by the use of SUNBRIGHT MA-100TS as the linker in an amount 10 times the molar amount of ICG-HSA is referred to as L3-ICG-HSA.
- Affibody (registered trademark)-immobilized ICG-HSA prepared by the use of SUNBRIGHT MA-100TS as the linker in an amount 100 times the molar amount of ICG-HSA is referred to as L4-ICG-HSA.
- SPR surface plasmon resonance
- Human serum albumin (albumin from human serum: HSA, SIGMA) was dissolved in a bicarbonate buffer solution (pH: 8.5) in a concentration of 10 mg/mL to prepare an HSA solution. Then 1 mg of an ICG derivative (ICG-Sulfo-Osu, Dojindo Laboratories) was dissolved in 0.1 mL of DMSO. The resulting DMSO solution was added to the HSA solution in an amount 7 times the molar amount of HSA. The reaction mixture was allowed to stand at 37 degrees Celsius for 2 hours. The reaction mixture was subjected to ultrafiltration (30 kDa) to remove unreacted substances, thereby preparing an aqueous solution of ICG-HSA.
- SM(PEG)2, SMCC succinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate, PIERCE
- BS(PEG)5 bis-N-succinimidyl-(pentaethylene glycol) ester, PIERCE
- PD-10 gel filtration
- the number of molecules of each linker attached to ICG-HSA was calculated from a change in the number of amino acids in ICG-HSA before and after the attachment of the linker.
- the number of amino acids was quantitatively determined by a color reaction with 2,4,6-trinitrobenzenesulfonic acid.
- the number of linker molecules in ICG-HSA modified with SM(PEG)2 (hereinafter, abbreviated as "SM-ICG-HSA") was 13.
- the number of linker molecules in ICG-HSA modified with SMCC (hereinafter, abbreviated as "CC-ICG-HSA”) was 9.
- the number of linker molecules in ICG-HSA modified with BS(PEG)5 was 15.
- scFv, Affibody (registered trademark), or HER2-binding peptides were immobilized to ICG-HSA modified with the three types of linkers described above.
- the sequences of the HER2-binding peptide were described below.
- MARSGLGGKGSC SEQ. ID. NO: 3
- scFv was subjected to reduction treatment with TCEP, and Affibody (registered trademark) was subjected to reduction treatment with dithiothreitol, in the same ways as described above in advance.
- One of the linker-modified ICG-HSA samples was mixed with the HER2-binding peptide, Affibody (registered trademark) subjected to reduction treatment, or scFv subjected to reduction treatment. The mixture was stirred at 25 degrees Celsius for 2 hours or more.
- the mixture was subjected to ultrafiltration (30 kDa) to remove unreacted HER2-binding molecules, thereby preparing HER2-binding-molecule-immobilized ICG-HSA.
- the number of the HER2-binding molecules immobilized was calculated by quantitatively determining unfixed molecules eluted in the filtrate by the ultrafiltration.
- BS-ICG-HSA to which the peptide of SEQ. ID. NO: 2 was immobilized is referred to as L5-ICG-HSA.
- SM-ICG-HSA to which the peptide of SEQ. ID. NO: 3 was immobilized is referred to as L6-ICG-HSA.
- L7-ICG-HSA L7-ICG-HSA
- BS-ICG-HSA to which the peptide of SEQ. ID. NO: 3 was immobilized is referred to as L8-ICG-HSA
- SM-ICG-HSA to which Affibody (registered trademark) was immobilized is referred to as L9-ICG-HSA
- CC-ICG-HSA to which Affibody (registered trademark) was immobilized is referred to as L10-ICG-HSA.
- BS-ICG-HSA to which Affibody (registered trademark) was immobilized is referred to as L11-ICG-HSA.
- scFv-immobilized SM-ICG-HSA is referred to as L12-ICG-HSA.
- scFv-immobilized CC-ICG-HSA is referred to as L13-ICG-HSA.
- scFv-immobilized BS-ICG-HSA is referred to as L14-ICG-HSA.
- SPR surface plasmon resonance
- mice Female outbred BALB/c Slc-nu/nu mice (6 weeks old on purchase) (Japan SLC Inc.) were used. The mice were acclimated using standard feeds and beddings and given food and drinking water ad libitum for 1 week before cancer cells were transplanted. At approximately 1 week before an imaging experiment, 1 x 10 6 Colon 26 mouse colon cancer cells (Riken, Japan) were subcutaneously injected into the right shoulder and the right thigh of each mouse, and 1 x 10 6 Colon 26 mouse colon cancer cells into which the HER2 gene was artificially transferred were subcutaneously injected into the left shoulder and the left thigh of each mouse. Tumor cells had been all established by the time of the experiment.
- mice The body weights of the mice were between 17 and 22 g. Then 200 microliters (13 nmol in terms of ICG) of HER2-bindig-molecule-immobilized ICG-HSA or ICG-HSA to which nothing was immobilized was intravenously injected into the tumor-bearing mice. The mice were euthanized with carbon dioxide 24 hours after administration. The tumor tissues were removed and transferred to plastic tubes. An aqueous solution of 1% Triton X-100 was added to each of the tubes in an amount 1.25 times the weight of the tumor tissues. Each of the resulting mixtures was homogenized with a plastic pestle.
- DMSO was added to each mixture in an amount 20.25 times the weight of the tumor tissues to prepare a solution of the dye extracted from the tumor tissues.
- the tumor tissues were removed from tumor-bearing mice into which HER2-binding-molecule-immobilized ICG-HSA was not administered.
- the tumor tissues were transferred to plastic tubes.
- An aqueous solution of 1% Triton X-100 was added to each of the tubes in an amount 1.25 times the weight of the tumor tissues.
- Each of the resulting mixtures was homogenized with a plastic pestle to prepare a solution of the tumor tissues in Triton-X100.
- a HER2-binding-molecule-immobilized ICG-HSA solution having a known concentration was diluted with the solution of the tumor tissues in Triton X-100 to various concentrations. Then DMSO was added to each of the resulting dilute solutions in an amount 20.25 times the amount of each dilute solution to prepare standard solutions for calibration. The fluorescence intensity of the solutions of the dye extracted from the tumor tissues and the standard solutions for calibration was measured with the solutions in the tubes using IVIS (registered trademark) Imaging System 200 Series (XENOGEN Corporation) to quantitatively determine the amount of the dye in the tumor tissues.
- IVIS registered trademark
- Imaging System 200 Series XENOGEN Corporation
- Table 11 summarizes the number of linkers immobilized to HER2-binding-molecule-immobilized ICG-HSA, the number of HER2-binding molecules, the binding affinity to HER2 in vitro, the accumulation in the Colon 26 tumor into which the HER2 gene was transferred, and the ratio of the accumulation in the Colon 26 tumor into which the HER2 gene was transferred to the accumulation in the wild-type Colon 26 tumor.
- HER2-binding-molecule-immobilized ICG-HSA samples except L11-ICG-HSA, although the accumulation was reduced, selective accumulation in the Colon 26 tumor into which the HER2 gene was transferred was observed with respect to the wild-type Colon 26 tumor, compared with ICG-HSA into which nothing was immobilized.
Landscapes
- Health & Medical Sciences (AREA)
- Physics & Mathematics (AREA)
- Acoustics & Sound (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Radiology & Medical Imaging (AREA)
- Epidemiology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
There is provided a contrast agent for photoacoustic imaging, the contrast agent exhibiting high tumor accumulation and high photoacoustic signal intensity even when time has passed since administration. A contrast agent for photoacoustic imaging comprises a complex including albumin covalently bound to an organic dye that absorbs light in the near-infrared wavelength region.
Description
The present invention relates to a contrast agent for photoacoustic imaging.
A photoacoustic tomography (hereinafter, also referred to as "PAT") apparatus is known as one of apparatuses for visualizing in-vivo information. In the measurement using a PAT apparatus, an image can be obtained by measuring the intensity and the time of generation of a photoacoustic signal emitted from a substance (optical absorber) that absorbs light in an object to be measured when the object is irradiated with light, and computing a distribution of the substance in the object.
Any substance that absorbs light and emits an acoustic wave in a living body may be used as an optical absorber. For example, a blood vessel or a malignancy in the human body may be used as an optical absorber. In addition, for example, molecules of indocyanine green (hereinafter, also abbreviated as "ICG"), may be administered into the body and used as contrast agents. ICG well absorbs light in the near-infrared wavelength region, the light having little influence on the human body when the human body is irradiated with the light and having a high permeability to a living body. Thus, ICG may be used as a contrast agent in PAT apparatuses. In this specification, ICG indicates a compound represented by formula (1) described below.
The counter ion may not be Na+. Any counter ion, e.g., H+ or K+, may be used.
However, it is known that ICG has a short half-life of about several minutes in blood. NPL 1 reports a case of photoacoustic imaging of cerebral blood vessels of a rat with free ICG. According to this report, the photoacoustic signal intensity is reduced to a level equal to that of blood several tens of minutes after free ICG is administered in blood. This suggests that the administered substance is rapidly cleared from blood after administration.
As described above, free ICG is cleared from blood several tens of minutes after administration in blood, thus possibly resulting in a low tumor accumulation when time has passed since administration.
Optics Letters, Vol. 29, Issue 7, pp. 730-732 (2004)
Accordingly, aspects of the present invention provide a contrast agent for photoacoustic imaging, the contrast agent exhibiting high tumor accumulation and high photoacoustic signal intensity even when time has passed since administration.
A contrast agent for photoacoustic imaging according to an aspect of the present invention comprises a complex including albumin bound to a near-infrared absorbing organic dye.
A contrast agent for photoacoustic imaging according to another aspect of the present invention comprises a complex represented by formula (I):
In formula (I), A represents a site of albumin with one amino group removed. A' represents formula (i) or (ii). "*" in each of formulae (i) and (ii) is bound to a nitrogen atom (N) in formula (I).
In formulae (i) and (ii), Z's each represent a hydrogen atom, a sulfonic group, or a cyclic aromatic ring selected from the group consisting of a benz[e]indole ring, a benz[f]indole ring, and a benz[g]indole ring formed together with an indole ring bound to a corresponding one of Z's. The hydrogen atoms of the cyclic aromatic ring each may be replaced with an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, or a sulfonic group.
In formulae (i) and (ii), R1's each represent an alkyl group having 1 to 10 carbon atoms or -(CH2)b-SO3
- (wherein b represents an integer of 1 to 10).
When R1's each represent an alkyl group, a halide ion or an organic acid ion may be contained as a counter ion. R2's and R3's each independently represent a hydrogen atom, an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, -(CH2)b-SO3
- (wherein b represents an integer of 1 to 10), or -(CH2)b-SO3X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine).
In formulae (i) and (ii), a's each represent an integer of 1 to 10, and n's each represent 2 or 3.
In formula (ii), R4 represents an alkyl group having 1 to 10 carbon atoms or -(CH2)b-SO3X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine).
A contrast agent for photoacoustic imaging according to aspects of the present invention contains a complex including albumin bound to an organic dye, such as ICG, the dye absorbing light in the near-infrared wavelength region; hence, the contrast agent exhibits high accumulation in a tumor and high intensity of a photoacoustic signal emitted from the tumor, compared with the case where free ICG is administered.
A contrast agent for photoacoustic imaging (hereinafter, also abbreviated as "PAI") according to an embodiment of the present invention will be described below.
The contrast agent for PAI according to this embodiment includes a complex including albumin covalently bound to an organic dye that absorbs light in the near-infrared wavelength region (hereinafter, also abbreviated as a "near-infrared absorbing organic dye"). In this specification, light in the near-infrared wavelength region refers to light having a wavelength of 600 nm to 1300 nm.
In the case where a near-infrared absorbing organic dye, such as ICG, is administered in blood, the dye is easily adsorbed on protein in blood and excreted from the body. Furthermore, the near-infrared absorbing organic dye may react with water molecules in blood to decompose. Thus, even if a free near-infrared absorbing organic dye is administered in blood of a living body, the dye exhibits short retention in blood and low accumulation in a tumor. Accordingly, in the case where a free near-infrared absorbing organic dye is used as a contrast agent for photoacoustic imaging, the intensity of the photoacoustic signal emitted from a tumor is low.
In the contrast agent for PAI according to this embodiment, albumin inhibits the adsorption of protein in blood on the near-infrared absorbing organic dye because the near-infrared absorbing organic dye is covalently bound to albumin. Thus, in the case where the contrast agent for PAI according to this embodiment is administered in blood of a living body, the contrast agent does not easily adsorb on protein in blood and is not easily excreted from the body. Furthermore, water molecules in blood do not easily approach the near-infrared absorbing organic dye because the near-infrared absorbing organic dye and albumin are covalently bound together; hence, the near-infrared absorbing organic dye is not easily decomposed. In addition, albumin has a half-life of about 20 days or less and is thus stable in a living body. Thus, the retention in blood should be improved, compared with the case where a free near-infrared absorbing organic dye is administered. For these reasons, the contrast agent for PAI according to this embodiment exhibits longer retention in blood and high accumulation in a tumor, compared with the case of administration of a free near-infrared absorbing organic dye. Thus, the effect of increasing the intensity of a photoacoustic signal emitted from the tumor should be provided.
With respect to the complex of the contrast agent for PAI according to this embodiment, at least one albumin and at least one near-infrared absorbing organic dye may be covalently bound together. A plurality of albumins and a plurality of near-infrared absorbing organic dyes may be covalently bound together. In the case where the complex includes albumin and a plurality of near-infrared absorbing organic dyes, at least one near-infrared absorbing organic dye may be covalently bound to albumin, and the remaining near-infrared absorbing organic dyes may be noncovalently bound. Similarly, in the case where the complex includes a near-infrared absorbing organic dye and a plurality of albumins, at least one albumin may be covalently bound to the near-infrared absorbing organic dye, and the remaining albumins may be noncovalently bound.
Strictly speaking, "albumin and the near-infrared absorbing organic dye are covalently bound together" used in an embodiment of the present invention and in this specification indicates that a site (this may also be referred to as a "group") of albumin with a portion (typically, H or OH) of albumin removed and a site of the near-infrared absorbing organic dye with a portion (typically, H or OH) of the near-infrared absorbing organic dye removed are covalently bound. The "complex" can also be referred to as a "molecule" from another point of view.
In this specification, the number of the near-infrared absorbing organic dyes covalently bound to one albumin is referred to as a "dye labeling index". In the contrast agent for PAI according to this embodiment, the dye labeling index may be higher than 0.9 and lower than 3.1. Furthermore, in this embodiment, the dye labeling index is preferably 1.6 or more and 3.0 or less. The reason for this is that when the dye labeling index falls within the range described above, high tumor accumulation is obtained. The dye labeling index was calculated by measuring concentrations of the near-infrared absorbing organic dye and albumin in a sample and determining the ratio of the concentration of the near-infrared absorbing organic dye to the concentration of albumin (the concentration of the near-infrared absorbing organic dye/the concentration of albumin). The concentration of the near-infrared absorbing organic dye was calculated from the absorbance at a specific absorption wavelength of the dye. For example, when ICG-Sulfo-OSu (a compound represented by formula (2) described below) is used, a wavelength of 800 nm may be used as the specific absorption wavelength. When a compound represented by formula (5) is used, a wavelength of 750 nm may be used as the specific absorption wavelength. However, another specific absorption wavelength may be used. The concentration of albumin may be determined by, for example, the BCA assay.
The contrast agent for PAI according to this embodiment may contain a complex represented by formula (I),
In formula (I), A represents a site of albumin with one amino group removed. A' represents formula (i) or (ii). "*" in each of formulae (i) and (ii) is bound to a nitrogen atom (N) in formula (I).
In this specification, "*" is equivalent to the following symbol:
The symbol is illustrated in the structural formulae:
In formulae (i) and (ii), Z's each represent a hydrogen atom, a sulfonic group, or a cyclic aromatic ring selected from the group consisting of a benz[e]indole ring, a benz[f]indole ring, and a benz[g]indole ring formed together with an indole ring bound to a corresponding one of Z's. The hydrogen atoms of the cyclic aromatic ring each may be replaced with an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, or a sulfonic group.
In formulae (i) and (ii), R1's each represent an alkyl group having 1 to 10 carbon atoms or -(CH2)b-SO3
- (wherein b represents an integer of 1 to 10). When R1's each represent an alkyl group, a halide ion, e.g., a chloride ion, a bromide ion, or an iodide ion, or an organic acid ion, e.g., an acetate ion, a tartrate ion, or a succinate ion, may be contained as a counter ion. R2's and R3's each independently represent a hydrogen atom, an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, -(CH2)b-SO3
- (wherein b represents an integer of 1 to 10), or -(CH2)b-SO3X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine).
In formulae (i) and (ii), a's each represent an integer of 1 to 10, and n's each represent 2 or 3.
In formula (ii), R4 represents an alkyl group having 1 to 10 carbon atoms or -(CH2)b-SO3X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine). In formula (I), a portion indicated by A-N-H corresponds to the site of albumin with a portion of albumin removed. A' corresponds to the site of the near-infrared absorbing organic dye with a portion of the near-infrared absorbing organic dye removed.
In the contrast agent for PAI according to this embodiment, formula (i) may be represented by any one of formulae (i-1) to (i-6) described below.
In formula (i-2), Y- represents a halide ion, e.g., a chloride ion, a bromide ion, or an iodide ion, or an organic acid ion, e.g., an acetate ion, a tartrate ion, or a succinate ion.
In formulae (i-3) to (i-6), X's each represent sodium, potassium, ammonium, triethylammonium, lysine, or arginine.
In the contrast agent for PAI according to this embodiment, formula (ii) may be represented by formula (ii-1) or (ii-2) described below.
In formulae (ii-1) and (ii-2), X's each represent sodium, potassium, ammonium, triethylammonium, lysine, or arginine.
In formulae (i) and (ii), a's may each represent an integer of 2 to 6. In formulae (i) and (ii), b's in R1's, R2's, and R3's may each represent an integer of 2 to 6.
In formulae (i) and (ii), when a's and b's each represent 6 or less, the hydrophobicity of the complex is not high. Thus, the nonspecific adsorption of the complex is less likely to occur in a living body.
In this embodiment, the complex may be represented by formula (I-1) described below.
In formula (I-1), A represents a site of albumin with one amino group of albumin removed.
The contrast agent for PAI according to this embodiment may contain a capture molecule that binds specifically to a target site.
Albumin according to this embodiment is an abundant protein in blood (35 to 50 g/L), the protein having a molecular mass of 66.5 kDa and containing 585 amino acids in its complete sequence. Albumin is localized in vivo to play many roles, such as osmotic control. As albumin according to this embodiment, human serum albumin (HSA) and bovine serum albumin (BSA) may be used. A variant of HSA or BSA may also be used. A fragment thereof may also be used. As albumin according to this embodiment, HSA, a variant of HSA, a fragment of HSA, or a fragment of a variant of HSA, which is believed to be safe for the human body, may be used. Albumin according to this embodiment may be an extract from human blood or a product from Escherichia coli or the like. Albumin according to this embodiment has a homology of at least 95% or more, as compared with the complete sequence or a partial sequence from the complete sequence of HSA. Albumin has a plurality of lysine residues or a free cysteine residue at positions where the near-infrared absorbing organic dye is accessible. In the case where a chemical bond between albumin and the near-infrared absorbing organic dye is formed, for example, an amide bond between an amino group of a lysine residue of albumin and a carboxy group of the near-infrared absorbing organic dye is exemplified.
In this embodiment, the near-infrared absorbing organic dye is not particularly limited as long as it is an organic dye that absorbs light in the near-infrared wavelength region to emit an acoustic wave.
Examples of the near-infrared absorbing organic dye in this embodiment include azine-based dyes, acridine-based dyes, triphenylmethane-based dyes, xanthene-based dyes, porphyrin-based dyes, cyanine-based dyes, phthalocyanine-based dyes, styryl-based dyes, pyrylium-based dyes, azo-based dyes, quinone-based dyes, tetracycline-based dyes, flavone-based dyes, polyene-based dyes, BODIPY (registered trademark)-based dyes, and indigoid-based dyes.
Examples of the cyanine-based dyes include indocyanine green (ICG), Alexa Fluor (registered trademark)-based dyes, such as Alexa 750, (manufactured by Invitrogen Corporation); Cy (registered trademark)-based dyes (manufactured by GE Healthcare Biosciences K.K.); IR-783, IR-806, and IR-820 (manufactured by Sigma-Aldrich Japan K.K.); IRDye 800CW and IRDye 800RS (registered trademark) (manufactured by LI-COR, Inc.); ADS780WS, ADS795WS, ADS830WS, and ADS832WS (manufactured by American Dye Source Inc.); Hylight (manufactured by Dojindo Laboratories); and DyLight (manufactured by Thermo Fisher Scientific Inc).
In this embodiment, the near-infrared absorbing organic dye may be represented by formula (II) described below.
In formula (II), B represents formula (i) or (ii) described above. B' represents any one of formulae (iii) to (vi) described below.
*'s in formulae (i) and (ii) each bind to B' of formula (II). *'s in formulae (iii) to (vi) each bind to B of formula (II).
As an example of formula (II), a compound represented by formula (2) (ICG-Sulfo-OSu (registered trademark, manufactured by Dojindo Laboratories)), a compound represented by formula (3), a compound represented by formula (4), a compound represented by formula (5), a compound represented by formula (6), or a compound represented by formula (7) may be used.
In this embodiment, albumin and the near-infrared absorbing organic dye may be covalently bound together by a known coupling reaction with an amino group, a thiol group, a carboxy group, or a hydroxy group provided therebetween. A plurality of amino groups are present in albumin and react efficiently and selectively in a weak alkaline pH region. The near-infrared absorbing organic dye bound to albumin by the reaction may be washed and purified by a known protein purification method, for example, ultrafiltration or size-exclusion column chromatography. With respect to the bond between albumin and the near-infrared absorbing organic dye, the amino group, the thiol group, the carboxy group, or the hydroxy group present on the surface of albumin may be directly bound to a derivative of the near-infrared absorbing organic dye. Alternatively, albumin and the near-infrared absorbing organic dye may be bound together with any of a variety of cross-linkers.
In the contrast agent for PAI according to this embodiment, the complex may be in the form of particles. Each of the particles may be any of shapes, such as spherical, elliptic, planar, and one-dimensional string-like shapes. In the case where the complex is in the form of particles, the hydrodynamic average particle size (hereinafter, abbreviated simply as "particle size", in some cases) may be less than 1000 nm when measured by a dynamic light scattering method. A particle size of less than 1000 nm results in the accumulation of a large number of particles in a tumor site by the enhanced permeability and retention (EPR) effect, compared with normal sites in a living body. The contrast agent for PAI accumulated in the tumor site results in the specific visualization of the tumor site by the use of a photoacoustic imaging apparatus. The particle size of the particles is preferably 200 nm or less and more preferably 50 nm or less when measured by the dynamic light scattering method. The reason for this is presumably that when the particle size of the particles is 200 nm or less, the contrast agent for PAI according to this embodiment is less likely to be taken up by macrophages in blood, thereby increasing the retention in blood. In addition, when the particle size of the particles is 50 nm or less, the tissue permeability of the particles should be increased, thereby increasing the accumulation of the particles that have reached a target site.
In this embodiment, the particle size of the particles may be determined by measuring the hydrodynamic average particle size using the dynamic light scattering (DLS) method with a dynamic light scattering spectrophotometer (DLS-8000, manufactured by Otsuka Electronics Co., Ltd).
The contrast agent for PAI according to this embodiment may contain a dispersion medium in addition to the complex. The PAI is a concept including photoacoustic tomography. Examples of the dispersion medium include physiological saline, distilled water for injection, phosphate-buffered saline, and an aqueous glucose solution. The contrast agent for PAI according to this embodiment may contain a pharmaceutically acceptable additive, such as a vasodilator, as needed.
In the contrast agent for PAI according to this embodiment, the particles may be dispersed in the dispersion medium in advance. Alternatively, the particles and the dispersion medium may be prepared as a kit, and the particles may be dispersed in the dispersion medium prior to the administration of the contrast agent into a living body.
In the contrast agent for PAI according to this embodiment, a larger number of the particles can be accumulated in a tumor site than in normal sites in a living body by the EPR effect when the contrast agent is administered into a living body. Thus, after the particles are administered into the body, in the case where the body is irradiated with light and where an acoustic wave emitted from the body is detected, the intensity of an acoustic wave emitted from the tumor site can be increased, compared with the intensity of acoustic waves emitted from the normal sites. Hence, the contrast agent for PAI according to this embodiment may be used for tumor imaging.
The contrast agent for PAI according to this embodiment may also be used to image a lymph node. In particular, the contrast agent may be used as a contrast agent for a sentinel lymph node (hereinafter, abbreviated as "SLN", in some cases). When a near-infrared absorbing organic dye, such as ICG, is used as a contrast agent for the sentinel lymph node, the near-infrared absorbing organic dye administered into the body is rapidly transferred into blood and cleared from the body. This disadvantageously limits the period of observation. The contrast agent for PAI according to this embodiment has a larger molecular size than the near-infrared absorbing organic dye, thus reducing the rate of diffusion in tissues. As a result, the retention time in the sentinel lymph node should be extended. Thus, the contrast agent for PAI according to this embodiment may be used to image a lymph node, in particular, a sentinel lymph node.
The capture molecule in this embodiment is, for example, a substance that binds specifically to a target site, such as a tumor, or a substance that binds specifically to a substance present around a target site. The capture molecule may be freely selected from biomolecules and chemical substances, such as pharmaceuticals. Specific examples thereof include proteins, antibodies, antibody fragments, enzymes, biologically active peptides, glycopeptides, sugar chains, lipids, and molecule-recognizing compounds. These substances may be used separately or in combination. The use of the particles to which the capture molecules are chemically bonded enables the specific detection of a target site and the tracing of the dynamics, localization, efficacy of medicine, metabolism, and so forth of the target substance. In this embodiment, protein refers to a compound in which 90 or more natural or non-natural amino acids are connected by amide bonds. In this embodiment, polypeptide refers to a compound in which 30 or more and less than 90 natural or non-natural amino acids are connected by amide bonds. In this embodiment, peptide refers to a compound in which less than 30 natural or non-natural amino acids are connected by amide bonds. In this embodiment, protein, polypeptide, and peptide are classified by the number of amino acids connected, regardless of the presence or absence of various modifications. In this embodiment, the capture molecule may be protein, polypeptide, or peptide. In this embodiment, the capture molecule may be an antibody, which is a protein. In particular, the capture molecule may be a single-chain antibody.
Another embodiment according to the present invention is a contrast agent for photoacoustic imaging, in which the contrast agent comprises a complex which is represented by formula (III):
In formula (III), ALB represents the albumin which is covalently bound by the organic dye; C represents a capture molecule; and L represents a linker, ALB being bound to L, and L being bound to C.
In this embodiment, the capture molecule may be a protein, a polypeptide, or a peptide. The protein may be a single-chain antibody.
In this embodiment, L in formula (III) may include one or more succinimidyl groups at an end and one or more maleimido groups at the other end.
In this embodiment, L in formula (III) may include one or more succinimidyl groups at the end, one or more maleimido groups at the other end, and one or more ethylene glycol moieties.
In this embodiment, L in formula (III) may represent succinimidyl-[(N-maleimidopropionamido)-diethyleneglycol] ester or SUNBRIGHT MA-100TS.
In this embodiment, L in formula (III) may represent succinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate.
In this embodiment, L in formula (III) may include two or more succinimidyl groups at an end.
In this embodiment, L in formula (III) may include two or more succinimidyl groups at an end and one or more ethylene glycol moieties.
In this embodiment, L in formula (III) may represent bis-N-succinimidyl-(pentaethylene glycol) ester.
The contrast agent for photoacoustic imaging according to the present embodiment may contain an addition agent used in freeze-drying. Examples of addition agents include glucose, lactose, mannitol, polyethylene glycol, glycine, sodium chloride, and sodium hydrogen phosphate. One type of addition agent may be used alone or some types may be used in combination.
A method for detecting the contrast agent for PAI according to this embodiment, the contrast agent being administered into a living body, with a photoacoustic imaging apparatus will be described below. The method for detecting the contrast agent for PAI according to this embodiment includes steps (a) and (b) described below. However, the photoacoustic imaging method according to this embodiment may include a step other than the following steps:
(a) a step of irradiating a subject into which the contrast agent for PAI according to this embodiment has been administered with light in a wavelength region of 600 nm to 1300 nm; and
(b) a step of detecting an acoustic wave emitted from the contrast agent present in the subject.
(a) a step of irradiating a subject into which the contrast agent for PAI according to this embodiment has been administered with light in a wavelength region of 600 nm to 1300 nm; and
(b) a step of detecting an acoustic wave emitted from the contrast agent present in the subject.
The photoacoustic imaging method according to this embodiment may include a step of reconstituting a spatial photoacoustic signal intensity distribution on the basis of the wavelength, the phase, the time information, and so forth of the resulting acoustic wave obtained in step (b). Three-dimensional image reconstruction may be performed on the basis of the wavelength, the phase, and the time information of the acoustic wave obtained in step (b). Data obtained by the image reconstruction may be in any form as long as the positional information on the photoacoustic signal intensity distribution can be determined. For example, the photoacoustic signal intensity may be expressed in three-dimensional space or on a two-dimensional surface. Furthermore, the information of the same observation object is acquired by another imaging method, and the positional relationship between the information and the photoacoustic signal intensity distribution can be acquired.
In step (a) described above, a subject to which the contrast agent for PAI according to this embodiment is administered by a method, for example, oral administration or injection may be used.
In step (b) described above, an apparatus configured to generate light with which the subject is irradiated, and an apparatus configured to detect an acoustic wave emitted from the contrast agent for PAI according to this embodiment are not particularly limited.
As a light source configured to emit light with which the subject is irradiated in step (b), any light source may be used without limitation as long as the subject can be irradiated with pulsed laser light having at least one wavelength selected from the range of 600 nm to 1300 nm. As the apparatus configured to emit pulsed laser light, for example, a titanium-sapphire laser (LT-2211-PC, manufactured by Lotis Ltd.), OPO laser (LT-2214 OPO, manufactured by Lotis Ltd.), or an alexandrite laser may be used.
The apparatus configured to detect an acoustic wave is not particularly limited, and any of a variety of apparatuses may be used. For example, a commercially available photoacoustic imaging apparatus (Nexus128, manufactured by Endra Inc.) may be used.
By employing the imaging method using the contrast agent for PAI according to this embodiment, a target site, for example, a tumor, a lymph node, or a blood vessel, can be imaged through steps (a) and (b).
While the present invention is described in more detail below by examples, the present invention is not limited to these examples. Materials, composition conditions, reaction conditions, and so forth may be freely changed to the extent that dye-modified albumin having an equivalent function and effect is prepared.
In examples of the present invention, the photoacoustic signal intensity was measured as described below.
A commercially available photoacoustic imaging apparatus (Nexus128, manufactured by Endra Inc.) was used. Photoacoustic signals were measured at predetermined timings before and after the administration of a prepared contrast agent for PAI, and three-dimensional reconstruction data was acquired for each timing. The photoacoustic signal intensity in a region of interest (ROI) was measured on the basis of the resulting three-dimensional reconstruction data using software (GEHC MICROVIEW, GE Healthcare) or the like.
Calculation of dye labeling index
Calculation of dye labeling index
In examples of the present invention, the dye labeling index to albumin was calculated by measuring the absorbance of a sample. A dye concentration in the sample was calculated from absorbance at a specific absorption wavelength of the dye used. Specifically, when ICG-Sulfo-OSu (compound represented by formula (2) described above) was used, the absorbance was measured at 800 nm. When the compound represented by formula (5) described above was used, the absorbance was measured at 750 nm. The concentration of ICG was determined by diluting the sample with 5% SDS, measuring the absorbance, and calculating the concentration of ICG from a previously formed calibration curve of the dye in SDS. The concentration of HSA was calculated by the BCA assay.
In examples of the present invention, the evaluation of the contrast agent for PAI into a tumor mass was performed using tumor-bearing mice. The tumor-bearing mice were prepared by subcutaneously implanting a human gastric cancer cell line (N87) or a human cervical cancer cell line (HeLa) into nude mice. Then 130 nmol of a contrast agent in terms of the amount of the dye was administered into each of the tumor-bearing mice. Photoacoustic imaging was performed 5 minutes after the administration and 1 day after the administration. As a comparative example, fluorescence imaging of the tumor-bearing mice was performed 1 day after the administration. Fluorescence imaging was performed with IVIS (registered trademark) Imaging System to measure fluorescence intensity in a region of interest (ROI) of the tumor site.
In examples of the present invention, the transfer of the contrast agent for PAI into a sentinel lymph node (SLN) was evaluated by the use of a mouse popliteal lymph node. Ten microliters of the contrast agent was administered subcutaneously into the plantar surface of a nude mouse. Photoacoustic imaging of the mouse popliteal lymph node was performed after 1 day.
As a comparative example, mouse popliteal lymph nodes were removed 1 day after the administration of various contrast agents, homogenized, and extracted. The resulting extracts were subjected to absorbance measurement.
Accumulation rates were each calculated on the basis of the following formula:
Accumulation rate = {(absorbance of removed mouse popliteal lymph node)/(absorbance corresponding to amount of sample administered)} x 100
Accumulation rate = {(absorbance of removed mouse popliteal lymph node)/(absorbance corresponding to amount of sample administered)} x 100
After the calculation of the accumulation, the accumulation ratios of various materials were calculated when the accumulation 1 day after the administration of ICG was defined as 1.
A compound according to this embodiment is a compound in which an amino group on the surface of HSA is covalently bound to a near-infrared absorbing organic dye. A typical structure of ICG-HSA is represented by formula (IV). A typical structure of ICG'-HSA is represented by formula (V).
Human serum albumin (albumin from human serum: HSA, available from SIGMA, hereinafter, abbreviated simply as "HSA") was dissolved in bicarbonate buffer solutions (pH: 9.4) in a concentration of 10 mg/mL to prepare HSA solutions. Then 1 mg of the compound represented by formula (2) (ICG-Sulfo-OSu, registered trademark, manufactured by Dojindo Laboratories) was dissolved in 0.1 mL of dimethyl sulfoxide (DMSO), and 1 mg of the compound represented by formula (5) was dissolved in 0.1 mL of DMSO. These solutions were added to the respective HSA solutions. The resulting mixtures were allowed to stand at 37 degrees Celsius for 3 hours. The resulting reaction mixtures were subjected to gel filtration (PD-10) and ultrafiltration (50 kDa), so that the replacement with HEPES buffer solutions (pH: 7.6) and the separation of unreacted substances were performed. Ultimately, compounds in which near-infrared absorbing organic dyes and HSA were covalently bound were prepared. Tables 1 and 2 describe dye labeling indices of the compounds prepared at different molar concentrations of the raw materials fed for reaction. The specific chemical structure of the compound according to this embodiment is represented by formula (IV). In Table 2, the compound in which the compound represented by formula (5) is bound to HSA is expressed as ICG'-HSA. The specific chemical structure of ICG'-HSA is represented by formula (V).
As is clear from Tables 1 and 2, the dye labeling index can be changed in any range by changing the feed molar ratio of the dye derivative to HSA. With respect to samples in which the molar ratios of the dye to HSA were 80:1 and 100:1, the filtrates obtained by sterile filtration did not exhibit absorbance at the specific absorption wavelength of the dye; hence, the dye labeling index was not calculated.
The hydrodynamic average particle size of ICG-HSA (7) prepared by the foregoing method was measured with a dynamic light scattering spectrophotometer (DLS-8000, manufactured by Otsuka Electronics Co., Ltd). Table 3 describes the results. As comparative examples, the average particle sizes of ICG (available from Pharmaceutical and Medical Device Regulatory Science of Japan), HSA, ICG-HSA (7)- encapsulating liposome particles, and ICG-encapsulating micellar particles are also described. The ICG-HSA (7)-encapsulating liposome particles refer to particles in which ICG-HSA (7) prepared by the foregoing method is encapsulated in phospholipid liposome by a known method. The ICG-encapsulating micellar particles refer to micellar particles in which ICG is contained in surfactant micelles by a known emulsification technique.
First, 130 nmol of ICG-HSA (7) in terms of the amount of the dye was administered to a tumor-bearing mouse into which a HeLa cell line was implanted. Photoacoustic imaging was performed with a commercially available photoacoustic imaging apparatus (Nexus128, manufactured by Endra Inc.) before the administration, 5 minutes after the administration, and 1 day after the administration. The measurement wavelength was 800 nm. Table 4 describes the relative photoacoustic signal intensity at the tumor site when the photoacoustic signal intensity measured before the administration of ICG-HSA (7) was defined as 1. Table 4 demonstrates that the photoacoustic signal intensity at the tumor site increased markedly immediately after (5 minutes after) the administration of ICG-HSA (7) and that the photoacoustic signal intensity immediately after the administration was maintained even 1 day after the administration.
To check the tumor accumulation of ICG-HSA, contrast agents were administered to tumor-bearing mice into which the N87 cell line was implanted. ICG-HSA (7) and various contrast agents were administered in blood of the tumor-bearing mice. The tumor accumulation 1 day after the administration was evaluated by fluorescence. The accumulation in ROI of the tumor site was calculated. Table 5 describes the result of the relative tumor accumulation with respect to the ROI value of ICG. As comparative examples, the relative tumor accumulation values of ICG, ICG-HSA (7)-encapsulating liposome particles, and ICG-encapsulating micellar particles are also described. The results demonstrated that ICG-HSA (7) had higher tumor accumulation than other comparative materials.
The accumulation in a sentinel lymph node (SLN) was evaluated by photoacoustic imaging. First, 130 nmol of ICG-HSA (7) in terms of the amount of the dye was administered subcutaneously into the plantar surface of a nude mouse. Then an evaluation was made as to whether the sentinel lymph node was visualized 1 day after the administration by photoacoustic imaging. Table 6 and Fig. 2 illustrate the results. For ICG and the ICG-containing nanomicelles, substantially no photoacoustic signal was observed from the sentinel lymph nodes 1 day after the administration, so that the sentinel lymph nodes were not visualized. In contrast, for ICG-HSA (7), the SLN was clearly visualized (see Fig. 2), and ICG-HSA (7) had visualization properties substantially the same as ICG-HSA-encapsulating liposome. After the measurement, the SLN was removed. The removed SLN and an SLN into which no contrast agent was administered were juxtaposed to each other and subjected to photoacoustic imaging. Fig. 3 illustrates the results. A significant photoacoustic signal was observed from the SLN 1 day after the administration of ICG-HSA (7), as compared with the unadministered SLN.
According to "Evaluation example of accumulation in sentinel lymph node", the accumulation in a sentinel lymph node was evaluated. In this example, 10 nmol of the contrast agent in terms of the amount of the dye was administered to a mouse. Table 7 summarizes the relative accumulation of the contrast agents. As comparative examples, the relative accumulation of ICG, a mixed solution of ICG and HSA, ICG-HSA (7)-encapsulating liposome particles, and ICG-encapsulating micellar particles are also described. The results demonstrated that ICG-HSA (7) exhibited high accumulation in the SLN, compared with the comparative examples.
Aqueous solutions of ICG-HSA (2), ICG-HSA (7), ICG-HSA (21), and ICG-HSA (50) were prepared by the method described in EXAMPLE. Tumor model mice were prepared by subcutaneously implanting Colon 26 cells into BALB/c Slc-nu/nu mice. The aqueous ICG-HSA solutions were intravenously injected in volumes of 100 microliters each (13 nmol in terms of ICG) into the tumor model mice to evaluate the tumor accumulation. Furthermore, in this example, a compound was synthesized by the reaction of ICG-Sulfo-OSu with glycine in a molar ratio of 1:1 (hereinafter, abbreviated as "ICG-Gly") and used as a control sample.
The evaluation of the tumor accumulation was performed as described below. The mice were euthanized with carbon dioxide 24 hours after administration. The tumor tissues were removed and transferred to plastic tubes. An aqueous solution of 1% Triton X-100 was added to each of the tubes in an amount 1.25 times the weight of the tumor tissues. Each of the resulting mixtures was homogenized with a plastic pestle. Then DMSO was added to each mixture in an amount 20.25 times the weight of the tumor tissues to prepare a solution of the dye extracted from the tumor tissues. An aqueous ICG-HSA solution having a known concentration and an aqueous ICG-Gly solution serving as a control were diluted with the solution of the tumor tissues in Triton X-100 to various concentrations. Then DMSO was added to each of the resulting dilute solutions in an amount 20.25 times the amount of each dilute solution to prepare standard solutions for calibration. The fluorescence intensity of the solutions of the dye extracted from the tumor tissues and the standard solutions for calibration was measured with the solutions in the tubes using IVIS (registered trademark) Imaging System 200 Series (XENOGEN Corporation) to quantitatively determine the amount of the dye (%ID/g) in the tumor tissues.
Aqueous solutions of ICG-HSA (2), ICG-HSA (7), ICG-HSA (21), and ICG-HSA (50) were prepared by the method described in EXAMPLE. Tumor model mice were prepared by subcutaneously implanting Colon 26 cells into BALB/c Slc-nu/nu mice. The aqueous ICG-HSA solutions were intravenously injected in volumes of 100 microliters each (13 nmol in terms of ICG) into the tumor model mice to evaluate the tumor accumulation. Furthermore, in this example, an aqueous solution of ICG (available from Pharmaceutical and Medical Device Regulatory Science of Japan) was used as a control sample.
The evaluation of the tumor accumulation was performed as described below. The mice were euthanized with carbon dioxide 24 hours after administration. The tumor tissues were removed and transferred to plastic tubes. An aqueous solution of 1% Triton X-100 was added to each of the tubes in an amount 1.25 times the weight of the tumor tissues. Each of the resulting mixtures was homogenized with a plastic pestle. Then DMSO was added to each mixture in an amount 20.25 times the weight of the tumor tissues to prepare a solution of the dye extracted from the tumor tissues. An aqueous ICG-HSA solution having a known concentration and an aqueous ICG solution were diluted with the solution of the tumor tissues in Triton X-100 to various concentrations. Then DMSO was added to each of the resulting dilute solutions in an amount 20.25 times the amount of each dilute solution to prepare standard solutions for calibration. The fluorescence intensity of the solutions of the dye extracted from the tumor tissues and the standard solutions for calibration was measured with the solutions in the tubes using IVIS (registered trademark) Imaging System 200 Series (XENOGEN Corporation) to quantitatively determine the amount of the dye (%ID/g) in the tumor tissues.
Table 8 describes the accumulation in the Colon 26 cell mass 24 hours after the administration of the aqueous ICG-HSA solutions and the control. The results suggested that the tumor accumulation was improved by covalently binding the dye to HSA, compared with the aqueous ICG solution serving as a control sample. Furthermore, ICG-HSA (7) and ICG-HSA (15) exhibited high values of the ratio of tumor accumulation to blood accumulation 24 hours after the administration. This suggested that they were specifically accumulated in tumor, compared with blood. Moreover, ICG-HSA (7) also exhibited high photoacoustic signal intensity at the tumor site 1 day after the administration. Among these samples, thus, ICG-HSA (7) was most effective in visualizing the tumor.
A gene fragment encoding a single-chain antibody (scFv) moiety was prepared on the basis of the gene sequence of the variable region of IgG binding to HER2. A 6 x His tag comprising six consecutive histidine residues for protein purification was bound to the C-terminus of the prepared gene. Furthermore, two glycine residues serving as a spacer and a cysteine residue to introduce a signal generating molecule were arranged downstream thereof (SEQ. ID. NO: 1). A plasmid pET-22b (+) (Novagen) in which the foregoing gene fragment was inserted downstream of the T7 promoter was introduced into Escherichia coli BL21 (DE3) to give a strain for expression. After the resulting strain was precultured overnight in 4 mL of an LB-Amp medium, the total volume was added to 250 mL of 2xYT medium and cultured at 28 degrees Celsius with shaking at 120 rpm for 8 hours. Then IPTG was added at a final concentration of 1 mM. The bacteria were cultured overnight at 28 degrees Celsius. The culture of Escherichia coli was centrifuged at 8000 x g for 30 minutes at 4 degrees Celsius. The supernatant of the culture was collected. Ammonium sulfate of 60% of the weight of the obtained culture was added thereto. Proteins were precipitated by salting out. The solution subjected to salting out was allowed to stand overnight at 4 degrees Celsius and centrifuged at 8000 x g for 30 minutes at 4 degrees Celsius to collect precipitates. The resulting precipitates were dissolved in 20 mM Tris HCl/500 mM NaCl buffer. The mixture was dialyzed against 1 L of the buffer. After the dialysis, the protein solution was added to a column filled with His Bind (registered trademark) Resin (Novagen) and purified by metal chelate affinity chromatography using a Ni ion.
MDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSAAALEHHHHHHGGC (SEQ. ID. NO: 1)
Human serum albumin (albumin from human serum: HSA, SIGMA) was dissolved in a bicarbonate buffer solution (pH: 8.5) in a concentration of 10 mg/mL to prepare an HSA solution. Then 1 mg of an ICG derivative (ICG-Sulfo-Osu, Dojindo Laboratories) was dissolved in 0.1 mL of DMSO. The resulting DMSO solution was added to the HSA solution in an amount 7 times the molar amount of HSA. The reaction mixture was allowed to stand at 37 degrees Celsius for 2 hours. The reaction mixture was subjected to ultrafiltration (30 kDa) to remove unreacted substances, thereby preparing an aqueous solution of ICG-HSA.
Sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1- carboxylate (Sulfo-SMCC, PIERCE) was added thereto in an amount 60 times the molar amount of ICG-HSA. The mixture was allowed to stand at 4 degrees Celsius for 1 hour. The resulting reaction mixture was subjected to gel filtration (PD-10), so that the replacement with a phosphate buffer solution (PBS) and the separation of unreacted substances were performed, thereby preparing an aqueous solution of Sulfo-SMCC-modified ICG-HSA.
Tris(2-carboxyethyl)phosphine (TCEP) hydrochloride was added to the single-chain scFv in an amount 14 times the molar amount of the single-chain antibody, scFv. The mixture was reacted at room temperature for 2 hours. Then scFv was mixed with Sulfo-SMCC-modified ICG-HSA prepared as described above in an amount 1 or 2 times the molar amount of Sulfo-SMCC-modified ICG-HSA. The mixture was reacted at room temperature for 5 hours. The reaction mixture was subjected to ultrafiltration (50 kDa) to remove unreacted substances, thereby providing scFv-modified ICG-HSA (scFv-ICG-HSA). A compound prepared by the reaction of scFv in an amount 1 time the molar amount of Sulfo-SMCC-modified ICG-HSA is referred to as "scFv-ICG-HSA-1". A compound prepared by the reaction of scFv in an amount 2 times the molar amount of Sulfo-SMCC-modified ICG-HSA is referred to as "scFv-ICG-HSA-2".
Sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1- carboxylate (Sulfo-SMCC, PIERCE) was added to HSA in an amount 60 times the molar amount of HSA. The mixture was allowed to stand at 4 degrees Celsius for 1 hour. The resulting reaction mixture was subjected to gel filtration (PD-10), so that the replacement with a phosphate buffer solution (PBS) and the separation of unreacted substances were performed, thereby preparing an aqueous solution of Sulfo-SMCC-modified HSA.
Tris(2-carboxyethyl)phosphine (TCEP) hydrochloride was added to the single-chain scFv in an amount 14 times the molar amount of the single-chain scFv. The mixture was reacted at room temperature for 2 hours. Then scFv was mixed with Sulfo-SMCC-modified HSA prepared as described above in an amount 3 times the molar amount of Sulfo-SMCC-modified HSA. The mixture was reacted at room temperature for 5 hours. The reaction mixture was subjected to ultrafiltration (50 kDa) to remove unreacted substances, thereby providing scFv-immobilized HSA (scFv-HSA).
ICG was added to scFv-HSA prepared as described above in an amount 7, 21, or 70 times the molar amount of scFv-HSA. The mixture was reacted for 2 hours and subjected to ultrafiltration (30 kDa) to remove unreacted substances, thereby preparing ICG-labeled scFv-HSA (scFv-HSA-ICG). Compounds prepared by the reaction of ICG in amounts 7, 21, and 70 times the molar amount of scFv-HSA are referred to as scFv-HSA-ICG-7, scFv-HSA-ICG-21, and scFv-HSA-ICG-70, respectively.
Calculation of dye labeling index
Calculation of dye labeling index
With respect to ICG-HSA, scFv-ICG-HSA, and scFv-HSA-ICG prepared by the foregoing methods, the dye labeling indices to HSA were calculated. The dye labeling indices were calculated by the quantitative determination of protein using the BCA assay and by the measurement of the concentrations on the basis of the absorbance of ICG. Table 9 describes the results.
With respect to scFv-ICG-HSA and scFv-HSA prepared as described above, the number of single-chain antibody molecules (scFv's) immobilized to HSA was calculated. Table 9 describes the results. The number of scFv's immobilized was calculated by performing sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and measuring Coomassie staining intensity of bands.
The interaction between HER2, which is an antigen, and each of the scFv-ICG-HSA and scFv-HSA-ICG complexes prepared as described above was measured with a Biacore X System (GE Healthcare Corp.) to measure HER2-binding capacities. As the antigen, Recombinant Human ErbB2/Fc Chimera (R&D Systems, Inc.) was used. The antigen was immobilized by amine coupling to a carboxymethyldextran chain on a surface of Chip CM5 according to the manufacturer's recommendation. The amount of the antigen immobilized was about 5000 RU. PBS-T (2.68 mM KCl/137 mM NaCl/1.47 mM KH2PO4/1 mM Na2HPO4/ 0.005% Tween 20, pH: 7.4) was used as a running buffer. Concentrations of samples were set to 100 nM to 800 nM. The samples were injected at a flow rate of 20 microliters per minutes to evaluate HER2-binding capacities (dissociation constants KD [M]). Table 9 describes the results. The results demonstrated that a larger number of scFv's immobilized resulted in a higher HER2-binding capacity. Furthermore, comparison of scFv-HSA-ICG-7, scFv-HSA-ICG-21, and scFv-HSA-ICG-70 revealed that the HER2-binding capacity was markedly reduced at a dye labeling index of 21.
To check HER2-specific tumor accumulation of the molecular probes (ICG-HSA, scFv-ICG-HSA, and scFv-HSA-ICG) prepared as described above, an experiment was performed as described below. The molecular probes were administered to tumor-bearing model mice into which the HER2-positive N87 cell line and the HER2-negative SUIT-2 cell line were implanted. The tumors were removed 1 day after the administration. To the tumors, 1% Triton X-100 was added. The mixtures were homogenized. Dimethyl sulfoxide (DMSO) was added to each resulting homogenate in an amount 9 times the amount of the homogenate, thereby preparing a solution. The fluorescence intensity of these solutions was measured to calculate the tumor accumulation [%ID/g] per tumor weight of the molecular probes administered to the mice. Furthermore, a value obtained by dividing the tumor accumulation in N87 by the tumor accumulation in SUIT-2 (N87/SUIT-2) was calculated as a value indicating HER2 specificity. Table 9 describes the results. The results demonstrated that scFv-ICG-HSA-1, scFv-ICG-HSA-2, and scFv-HSA-ICG-7 exhibited HER2-specific accumulation. Comparison of scFv-ICG-HSA-1 and scFv-ICG-HSA-2 revealed that scFv-ICG-HSA-2 having a large number of scFv's immobilized exhibited higher HER2 specificity. This suggested that a larger number of scFv's immobilized resulted in higher HER2 specificity. Comparison of scFv-HSA-ICG-7, scFv-HSA-ICG-21, and scFv-HSA-ICG-70 revealed that when the dye labeling index was 6.6 or more, HER2-specific accumulation was not observed. The reason for this is as follows: scFv-HSA-ICG-7 and scFv-HSA-ICG-21 had the same HER2-binding capacity. Thus, for example, labeling with a large number of ICG molecules possibly promoted hepatic elimination with ICG.
That is, regarding scFv-immobilized ICG-HSA, the results demonstrated that at a dye labeling index of 1.9, when the number of scFv's immobilized was 0.69 or more, HER2-specific accumulation was exhibited, and when the number of scFv's immobilized was 1.7, higher HER2 specificity was exhibited. Regarding ICG-labeled scFv-HSA, the results demonstrated that when the number of scFv's immobilized was 2.9, the dye labeling index was required to be less than at least 6.6. Accordingly, the results suggested that the following conditions were required to achieve HER2-specific tumor accumulation: the number of scFv's immobilized was 0.69 or more and preferably about 1.7 or more, and the dye labeling index was less than 6.6.
Human serum albumin (albumin from human serum: HSA, SIGMA) was dissolved in a bicarbonate buffer solution (pH: 8.5) in a concentration of 10 mg/mL to prepare an HSA solution. Then 1 mg of an ICG derivative (ICG-Sulfo-Osu, Dojindo Laboratories) was dissolved in 0.1 mL of DMSO. The resulting DMSO solution was added to the HSA solution in an amount 7 times the molar amount of HSA. The reaction mixture was allowed to stand at 37 degrees Celsius for 2 hours. The reaction mixture was subjected to ultrafiltration (30 kDa) to remove unreacted substances, thereby preparing an aqueous solution of ICG-HSA.
SM(PEG)2 (succinimidyl[(N-maleimidopropionamido) -diethyleneglycol] ester, PIERCE) or SUNBRIGHT MA-100TS (NOF CORPORATION) was added thereto in an amount 10 or 100 times the molar amount of ICG-HSA. The mixture was allowed to stand at 4 degrees Celsius for 1 hour. The resulting reaction mixture was subjected to gel filtration (PD-10), so that the replacement with a phosphate buffer solution (PBS) and the separation of unreacted substances were performed, thereby preparing aqueous solutions of ICG-HSA modified with two types of linkers in different ratios. The number of molecules of each linker attached to ICG-HSA was calculated from a change in the number of amino acids in ICG-HSA before and after the attachment of the linker. The number of amino acids was quantitatively determined by a color reaction with 2,4,6-trinitrobenzenesulfonic acid.
Affibody (registered trademark, Affibody) is a polypeptide serving as a HER2 capture molecule. Dithiothreitol (NACALAI TESQUE, INC.) was added at a final concentration of 20 mM to a phosphate buffer solution containing Affibody (registered trademark) dissolved therein. The mixture was stirred at 25 degrees Celsius for 2 hours. The reaction mixture was subjected to gel filtration (PD-10) to remove dithiothreitol, thereby preparing an aqueous solution of Affibody (registered trademark) subjected to reduction treatment. This aqueous solution was mixed with each of the aqueous solutions of ICG-HSA modified with two types of linkers in different ratios. The mixtures were stirred at 25 degrees Celsius for 2 hours or more. Then the mixtures were subjected to ultrafiltration (30kDa) to remove unreacted Affibody (registered trademark), thereby preparing Affibody (registered trademark)-immobilized ICG-HSA. The number of Affibody (registered trademark) molecules immobilized was calculated by quantitatively determining unfixed molecules eluted in the filtrate by the ultrafiltration. Here, Affibody (registered trademark)-immobilized ICG-HSA prepared by the use of SM(PEG)2 as the linker in an amount 10 times the molar amount of ICG-HSA is referred to as L1-ICG-HSA. Affibody (registered trademark)-immobilized ICG-HSA prepared by the use of SM(PEG)2 as the linker in an amount 100 times the molar amount of ICG-HSA is referred to as L2-ICG-HSA. Similarly, Affibody (registered trademark)-immobilized ICG-HSA prepared by the use of SUNBRIGHT MA-100TS as the linker in an amount 10 times the molar amount of ICG-HSA is referred to as L3-ICG-HSA. Affibody (registered trademark)-immobilized ICG-HSA prepared by the use of SUNBRIGHT MA-100TS as the linker in an amount 100 times the molar amount of ICG-HSA is referred to as L4-ICG-HSA. The binding affinity of Affibody (registered trademark)-immobilized ICG-HSA for HER2, which was a target molecule, was evaluated by a surface plasmon resonance (SPR) method. SPR was measured with ProteOn (registered trademark) XPR36 (Bio-Rad Laboratories, Inc). Recombinant Human ErbB2/Fc Chimera (R&D Systems, Inc.) was dissolved in an acetic acid buffer (pH: 5.0) and immobilized by amine coupling to carboxy groups on a surface of a GLM sensor chip. The amount immobilized was about 3000 RU (resonance unit). Each sample of Affibody (registered trademark)-immobilized ICG-HSA was diluted with a phosphate buffer containing 0.005% Tween 20 (pH: 7.4) to various concentrations and injected into a flow cell at a flow rate of 50 microliters per minute. With respect to the measurement time, the injection time (binding) was 120 seconds, and the elapsed time after termination of the injection (dissociation) was 120 seconds. In experiments for the analysis of binding kinetics, sensorgrams were analyzed by a 1:1 Langmuir fitting model. Table 10 summarizes calculated binding dissociation constants (KD). Each of the samples had a binding affinity to HER2. It was suggested that in particular, the sample in which a large number of HER2 capture molecules were immobilized by the use of SM(PEG)2 in an amount 100 times had a higher binding affinity to HER2.
Human serum albumin (albumin from human serum: HSA, SIGMA) was dissolved in a bicarbonate buffer solution (pH: 8.5) in a concentration of 10 mg/mL to prepare an HSA solution. Then 1 mg of an ICG derivative (ICG-Sulfo-Osu, Dojindo Laboratories) was dissolved in 0.1 mL of DMSO. The resulting DMSO solution was added to the HSA solution in an amount 7 times the molar amount of HSA. The reaction mixture was allowed to stand at 37 degrees Celsius for 2 hours. The reaction mixture was subjected to ultrafiltration (30 kDa) to remove unreacted substances, thereby preparing an aqueous solution of ICG-HSA.
SM(PEG)2, SMCC (succinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate, PIERCE), or BS(PEG)5 (bis-N-succinimidyl-(pentaethylene glycol) ester, PIERCE) was added thereto in an amount 100 times the molar amount of ICG-HSA. The mixture was allowed to stand at 4 degrees Celsius for 1 hour. The resulting reaction mixture was subjected to gel filtration (PD-10), so that the replacement with a phosphate buffer solution (PBS) and the separation of unreacted substances were performed, thereby preparing aqueous solutions of ICG-HSA modified with three types of linkers. The number of molecules of each linker attached to ICG-HSA was calculated from a change in the number of amino acids in ICG-HSA before and after the attachment of the linker. The number of amino acids was quantitatively determined by a color reaction with 2,4,6-trinitrobenzenesulfonic acid. The number of linker molecules in ICG-HSA modified with SM(PEG)2 (hereinafter, abbreviated as "SM-ICG-HSA") was 13. The number of linker molecules in ICG-HSA modified with SMCC (hereinafter, abbreviated as "CC-ICG-HSA") was 9. The number of linker molecules in ICG-HSA modified with BS(PEG)5 (hereinafter, abbreviated as "BS-ICG-HSA") was 15.
Next, scFv, Affibody (registered trademark), or HER2-binding peptides were immobilized to ICG-HSA modified with the three types of linkers described above. The sequences of the HER2-binding peptide were described below.
YCDGFYACYMDVGGKGSK (SEQ. ID. NO: 2)
MARSGLGGKGSC (SEQ. ID. NO: 3)
In the case of the immobilization to ICG-HSA modified with the linkers, scFv was subjected to reduction treatment with TCEP, and Affibody (registered trademark) was subjected to reduction treatment with dithiothreitol, in the same ways as described above in advance. One of the linker-modified ICG-HSA samples was mixed with the HER2-binding peptide, Affibody (registered trademark) subjected to reduction treatment, or scFv subjected to reduction treatment. The mixture was stirred at 25 degrees Celsius for 2 hours or more. Then the mixture was subjected to ultrafiltration (30 kDa) to remove unreacted HER2-binding molecules, thereby preparing HER2-binding-molecule-immobilized ICG-HSA. The number of the HER2-binding molecules immobilized was calculated by quantitatively determining unfixed molecules eluted in the filtrate by the ultrafiltration. Here, BS-ICG-HSA to which the peptide of SEQ. ID. NO: 2 was immobilized is referred to as L5-ICG-HSA. SM-ICG-HSA to which the peptide of SEQ. ID. NO: 3 was immobilized is referred to as L6-ICG-HSA. CC-ICG-HSA to which the peptide of SEQ. ID. NO: 3 was immobilized is referred to as L7-ICG-HSA. BS-ICG-HSA to which the peptide of SEQ. ID. NO: 3 was immobilized is referred to as L8-ICG-HSA. SM-ICG-HSA to which Affibody (registered trademark) was immobilized is referred to as L9-ICG-HSA. CC-ICG-HSA to which Affibody (registered trademark) was immobilized is referred to as L10-ICG-HSA. BS-ICG-HSA to which Affibody (registered trademark) was immobilized is referred to as L11-ICG-HSA. scFv-immobilized SM-ICG-HSA is referred to as L12-ICG-HSA. scFv-immobilized CC-ICG-HSA is referred to as L13-ICG-HSA. scFv-immobilized BS-ICG-HSA is referred to as L14-ICG-HSA. The binding affinities of these HER2-binding-molecule-immobilized ICG-HSA samples for HER2, which was a target molecule, were evaluated by the surface plasmon resonance (SPR) method. SPR was measured with ProteOn (registered trademark) XPR36 (Bio-Rad Laboratories, Inc.) as described above.
In the evaluation of tumor accumulation, female outbred BALB/c Slc-nu/nu mice (6 weeks old on purchase) (Japan SLC Inc.) were used. The mice were acclimated using standard feeds and beddings and given food and drinking water ad libitum for 1 week before cancer cells were transplanted. At approximately 1 week before an imaging experiment, 1 x 106 Colon 26 mouse colon cancer cells (Riken, Japan) were subcutaneously injected into the right shoulder and the right thigh of each mouse, and 1 x 106 Colon 26 mouse colon cancer cells into which the HER2 gene was artificially transferred were subcutaneously injected into the left shoulder and the left thigh of each mouse. Tumor cells had been all established by the time of the experiment. The body weights of the mice were between 17 and 22 g. Then 200 microliters (13 nmol in terms of ICG) of HER2-bindig-molecule-immobilized ICG-HSA or ICG-HSA to which nothing was immobilized was intravenously injected into the tumor-bearing mice. The mice were euthanized with carbon dioxide 24 hours after administration. The tumor tissues were removed and transferred to plastic tubes. An aqueous solution of 1% Triton X-100 was added to each of the tubes in an amount 1.25 times the weight of the tumor tissues. Each of the resulting mixtures was homogenized with a plastic pestle. Then DMSO was added to each mixture in an amount 20.25 times the weight of the tumor tissues to prepare a solution of the dye extracted from the tumor tissues. Meanwhile, the tumor tissues were removed from tumor-bearing mice into which HER2-binding-molecule-immobilized ICG-HSA was not administered. The tumor tissues were transferred to plastic tubes. An aqueous solution of 1% Triton X-100 was added to each of the tubes in an amount 1.25 times the weight of the tumor tissues. Each of the resulting mixtures was homogenized with a plastic pestle to prepare a solution of the tumor tissues in Triton-X100. A HER2-binding-molecule-immobilized ICG-HSA solution having a known concentration was diluted with the solution of the tumor tissues in Triton X-100 to various concentrations. Then DMSO was added to each of the resulting dilute solutions in an amount 20.25 times the amount of each dilute solution to prepare standard solutions for calibration. The fluorescence intensity of the solutions of the dye extracted from the tumor tissues and the standard solutions for calibration was measured with the solutions in the tubes using IVIS (registered trademark) Imaging System 200 Series (XENOGEN Corporation) to quantitatively determine the amount of the dye in the tumor tissues. Table 11 summarizes the number of linkers immobilized to HER2-binding-molecule-immobilized ICG-HSA, the number of HER2-binding molecules, the binding affinity to HER2 in vitro, the accumulation in the Colon 26 tumor into which the HER2 gene was transferred, and the ratio of the accumulation in the Colon 26 tumor into which the HER2 gene was transferred to the accumulation in the wild-type Colon 26 tumor. In all HER2-binding-molecule-immobilized ICG-HSA samples except L11-ICG-HSA, although the accumulation was reduced, selective accumulation in the Colon 26 tumor into which the HER2 gene was transferred was observed with respect to the wild-type Colon 26 tumor, compared with ICG-HSA into which nothing was immobilized. In the case of L11-ICG-HSA, it is thought that HER2 selectivity was not provided because of the effects of an increase in molecular weight and a reduction in binding affinity to HER2. Comparison of the HER2-binding molecules revealed that scFv had the highest HER2 selectivity. Comparison of the linkers attached to ICG-HSA revealed that SM(PEG)2 or SMCC tended to provide high HER2 selectivity.
While the present invention has been described with reference to exemplary embodiments, it is to be understood that the invention is not limited to the disclosed exemplary embodiments. The scope of the following claims is to be accorded the broadest interpretation so as to encompass all such modifications and equivalent structures and functions.
This application claims the benefit of Japanese Patent Application No. 2012-161643, filed July 20, 2012, which is hereby incorporated by reference herein in its entirety.
Claims (17)
- A contrast agent for photoacoustic imaging, comprising:
a complex including albumin covalently bound to an organic dye that absorbs light in the near-infrared wavelength region. - A contrast agent for photoacoustic imaging, comprising:
a complex represented by formula (I):
wherein in formulae (i) and (ii), R1's each represent an alkyl group having 1 to 10 carbon atoms or -(CH2)b-SO3 - (wherein b represents an integer of 1 to 10); when R1's each represent an alkyl group, a halide ion or an organic acid ion may be contained as a counter ion; and R2's and R3's each independently represent a hydrogen atom, an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, -(CH2)b-SO3 - (wherein b represents an integer of 1 to 10), or -(CH2)b-SO3X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine),
wherein in formulae (i) and (ii), a's each represent an integer of 1 to 10; and n's each represent 2 or 3, and
wherein in formula (ii), R4 represents an alkyl group having 1 to 10 carbon atoms or -(CH2)b-SO3X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine). - The contrast agent for photoacoustic imaging according to claim 2, wherein formula (i) is represented by any one of formulae (i-1) to (i-6):
- The contrast agent for photoacoustic imaging according to claim 1, wherein the organic dye that absorbs light in the near-infrared wavelength region is represented by formula (II):
wherein *'s in formulae (i) and (ii) each bind to B' of formula (II); and *'s in formulae (iii) to (vi) each bind to B of formula (II):
wherein in formulae (i) and (ii), R1's each represent an alkyl group having 1 to 10 carbon atoms or -(CH2)b-SO3 - (wherein b represents an integer of 1 to 10); when R1's each represent an alkyl group, a halide ion or an organic acid ion may be contained as a counter ion; and R2's and R3's each independently represent a hydrogen atom, an alkyl group having 1 to 10 carbon atoms, an alkoxy group having 1 to 10 carbon atoms, -(CH2)b-SO3 - (wherein b represents an integer of 1 to 10), or -(CH2)b-SO3X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine),
wherein in formulae (i) and (ii), a's each represent an integer of 1 to 10; and n's each represent 2 or 3, and
wherein in formula (ii), R4 represents an alkyl group having 1 to 10 carbon atoms or -(CH2)b-SO3X (wherein b represents an integer of 1 to 10, and X represents sodium, potassium, ammonium, triethylammonium, lysine, or arginine):
- The contrast agent for photoacoustic imaging according to any one of claims 1 to 7, wherein the albumin is human serum albumin, a variant of human serum albumin, a fragment of human serum albumin, or a fragment of a variant of human serum albumin.
- The contrast agent for photoacoustic imaging according to any one of claims 1 to 8, wherein the complex is in the form of particles, and the hydrodynamic average particle size of the particles is 200 nm or less when measured by a dynamic light scattering method.
- The contrast agent for photoacoustic imaging according to claim 9, wherein the hydrodynamic average particle size of the particles is 50 nm or less when measured by a dynamic light scattering method.
- The contrast agent for photoacoustic imaging according to any one of claims 1 to 10, further comprising:
a capture molecule. - The contrast agent for photoacoustic imaging according to claim 1, wherein the contrast agent comprises a complex which is represented by formula (III):
- The contrast agent for photoacoustic imaging according to claim 11 or 12, wherein the capture molecule is a protein, a polypeptide, or a peptide.
- The contrast agent for photoacoustic imaging according to claim 13, wherein the protein is a single-chain antibody.
- The contrast agent for photoacoustic imaging according to any one of claims 1 to 14, wherein the contrast agent is used for tumor imaging.
- The contrast agent for photoacoustic imaging according to any one of claims 1 to 14, wherein the contrast agent is used for lymph node imaging.
- The contrast agent for photoacoustic imaging according to any one of claims 1 to 16, further comprising an addition agent.
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201380038562.9A CN104487098B (en) | 2012-07-20 | 2013-07-17 | Photoacoustic imaging contrast agent |
US14/413,402 US9675715B2 (en) | 2012-07-20 | 2013-07-17 | Contrast agent for photoacoustic imaging |
EP13750954.3A EP2861264B1 (en) | 2012-07-20 | 2013-07-17 | Contrast agent for photoacoustic imaging |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2012161643 | 2012-07-20 | ||
JP2012-161643 | 2012-07-20 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2014013729A1 true WO2014013729A1 (en) | 2014-01-23 |
Family
ID=49003957
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/JP2013/004358 WO2014013729A1 (en) | 2012-07-20 | 2013-07-17 | Contrast agent for photoacoustic imaging |
Country Status (4)
Country | Link |
---|---|
US (1) | US9675715B2 (en) |
EP (1) | EP2861264B1 (en) |
CN (1) | CN104487098B (en) |
WO (1) | WO2014013729A1 (en) |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105985431A (en) * | 2015-03-23 | 2016-10-05 | 佳能株式会社 | Near-infrared dye-bound transferrin, and contrast agent for photoacoustic imaging, including the near-infrared dye-bound transferrin |
US9517278B2 (en) | 2012-07-20 | 2016-12-13 | Canon Kabushiki Kaisha | Compound and photoacoustic imaging contrast medium containing the compound |
US9592307B2 (en) | 2012-07-20 | 2017-03-14 | Canon Kabushiki Kaisha | Compound and photoacoustic imaging contrast medium containing the compound |
CN113861717A (en) * | 2021-11-09 | 2021-12-31 | 西安康福诺生物科技有限公司 | Water-soluble indocyanine green dye for fluorescent labeling and synthetic method thereof |
Families Citing this family (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105008402B (en) | 2013-02-22 | 2018-09-18 | 佳能株式会社 | The derivatives of hyaluronic acids that near-infrared pigment combines and the optical imagery contrast agent including it |
US10245329B2 (en) | 2014-09-08 | 2019-04-02 | Canon Kabushiki Kaisha | Composition having dye and conjugate of polyethyleneglycol and additive and contrast agent for photoacoustic imaging having the same |
WO2016060277A1 (en) | 2014-10-16 | 2016-04-21 | Canon Kabushiki Kaisha | Polymer, and contrast agent for photoacoustic imaging, including the polymer |
JP6736278B2 (en) | 2014-10-24 | 2020-08-05 | キヤノン株式会社 | Polymer, contrast agent for photoacoustic imaging having the polymer |
KR20160142199A (en) | 2015-06-02 | 2016-12-12 | 삼성메디슨 주식회사 | Contrast composition for photoacoustic imaging and method for photoacoustic imaging using the same |
JP6789636B2 (en) | 2015-09-30 | 2020-11-25 | キヤノン株式会社 | Polymer, contrast agent for photoacoustic imaging having the polymer |
JP6752582B2 (en) | 2016-02-08 | 2020-09-09 | キヤノン株式会社 | Contrast agent for photoacoustic imaging |
CN107022350A (en) * | 2017-04-20 | 2017-08-08 | 深圳大学 | A kind of fluoroscopic visualization material and preparation method and application |
US20200054771A1 (en) * | 2018-08-17 | 2020-02-20 | Endra Life Sciences Inc. | Thermoacoustic imaging method and system and thermoacoustic imaging contrast agent |
CN110201189B (en) * | 2019-06-03 | 2021-12-07 | 沈阳药科大学 | Albumin-binding near-infrared fluorescent dye-maleimide conjugate |
WO2021048390A1 (en) * | 2019-09-13 | 2021-03-18 | Datalase Ltd. | Compositions |
CN113149967B (en) * | 2021-03-09 | 2022-11-08 | 中国药科大学 | NIR/MRI bimodal contrast agent and preparation method and application thereof |
CN113004254B (en) * | 2021-03-09 | 2022-08-05 | 中国药科大学 | Ligand with indocyanine green derivative as carrier, and preparation method and application thereof |
CN113149966B (en) * | 2021-03-09 | 2022-11-18 | 中国药科大学 | NIR/PET bimodal contrast agent and preparation method and application thereof |
CN114019155B (en) * | 2021-10-25 | 2024-09-24 | 复旦大学 | Immune probe based on anti-tyrosine hydroxylase antibody and preparation and application thereof |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005082423A2 (en) * | 2003-11-18 | 2005-09-09 | Beth Israel Deaconess Medical Center | Serum albumin conjugated to fluorescent substances for imaging |
US20110294987A1 (en) * | 2010-06-01 | 2011-12-01 | Canon Kabushiki Kaisha | Composite particle, contrast agent for photoacoustic imaging, and method for producing the composite particle |
Family Cites Families (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP4098839B2 (en) | 1995-01-30 | 2008-06-11 | 株式会社同仁化学研究所 | Indocyanine compounds |
US5968479A (en) | 1995-01-30 | 1999-10-19 | Daiichi Pure Chemicals Co., Ltd. | Diagnostic marker |
AU2003268537A1 (en) | 2002-09-10 | 2004-04-30 | University Of Maryland, Baltimore | Use of metallic particles to improve fluorescence imaging |
JP2008531755A (en) | 2005-01-05 | 2008-08-14 | ボード オブ リージェンツ, ザ ユニバーシティ オブ テキサス システム | Conjugates for dual imaging and radiation chemotherapy: composition, manufacture and indication |
GB2449433B (en) * | 2007-05-21 | 2009-12-09 | Clairair Ltd | Optical gas sensor |
WO2009148121A1 (en) | 2008-06-05 | 2009-12-10 | 株式会社 島津製作所 | Novel molecular assembly, molecular probe for molecular imaging and molecular probe for drug delivery system using the same, and molecular imaging system and drug delivery system |
US8652441B2 (en) | 2009-10-05 | 2014-02-18 | Canon Kabushiki Kaisha | Contrast agent for photoacoustic imaging and photoacoustic imaging method |
EA201270620A1 (en) | 2009-11-13 | 2012-12-28 | Мерк Патент Гмбх | INTEGRINE ANTIBODIES ASSOCIATED WITH NANOPARTICLES CONTAINING CHEMOTHERAPEUTIC AGENTS |
JP2011184329A (en) | 2010-03-05 | 2011-09-22 | Canon Inc | Compound, particle comprising the compound and contrast agent comprising the particle |
US8753608B2 (en) | 2010-08-24 | 2014-06-17 | Canon Kabushiki Kaisha | Complex and contrast agent for photoimaging using the same |
WO2012026608A1 (en) | 2010-08-24 | 2012-03-01 | Canon Kabushiki Kaisha | Polymeric particle and hydrophilic dye having a sulfonate group encapsulated within the particle |
US9138492B2 (en) | 2012-02-23 | 2015-09-22 | Canon Kabushiki Kaisha | Particle containing hydrophobic dye having cyanine structure, and contrast agent containing the particle |
WO2014013730A1 (en) | 2012-07-20 | 2014-01-23 | Canon Kabushiki Kaisha | Compound and photoacoustic imaging contrast medium containing the compound |
US9517278B2 (en) | 2012-07-20 | 2016-12-13 | Canon Kabushiki Kaisha | Compound and photoacoustic imaging contrast medium containing the compound |
-
2013
- 2013-07-17 EP EP13750954.3A patent/EP2861264B1/en not_active Not-in-force
- 2013-07-17 CN CN201380038562.9A patent/CN104487098B/en not_active Expired - Fee Related
- 2013-07-17 WO PCT/JP2013/004358 patent/WO2014013729A1/en active Application Filing
- 2013-07-17 US US14/413,402 patent/US9675715B2/en active Active
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005082423A2 (en) * | 2003-11-18 | 2005-09-09 | Beth Israel Deaconess Medical Center | Serum albumin conjugated to fluorescent substances for imaging |
US20110294987A1 (en) * | 2010-06-01 | 2011-12-01 | Canon Kabushiki Kaisha | Composite particle, contrast agent for photoacoustic imaging, and method for producing the composite particle |
Non-Patent Citations (4)
Title |
---|
CHULHONG KIM ET AL: "Handheld array-based photoacoustic probe for guiding needle biopsy of sentinel lymph nodes", JOURNAL OF BIOMEDICAL OPTICS, vol. 15, no. 4, 1 January 2010 (2010-01-01), pages 046010, XP055065232, ISSN: 1083-3668, DOI: 10.1117/1.3469829 * |
VINITA M. ALEXANDER ET AL: "Galactosyl Human Serum Albumin-NMP1 Conjugate: A Near Infrared (NIR)-Activatable Fluorescence Imaging Agent to Detect Peritoneal Ovarian Cancer Metastases", BIOCONJUGATE CHEMISTRY, vol. 23, no. 8, 16 July 2012 (2012-07-16), pages 1671 - 1679, XP055081842, ISSN: 1043-1802, DOI: 10.1021/bc3002419 * |
WANG ET AL: "Combined Photoacoustic and Molecular Fluorescence Imaging In Vivo", ENGINEERING IN MEDICINE AND BIOLOGY SOCIETY, 2005. IEEE-EMBS 2005. 27T H ANNUAL INTERNATIONAL CONFERENCE OF THE SHANGHAI, CHINA 01-04 SEPT. 2005, PISCATAWAY, NJ, USA,IEEE, 1 January 2005 (2005-01-01), pages 190 - 192, XP031000945, ISBN: 978-0-7803-8741-6, DOI: 10.1109/IEMBS.2005.1616374 * |
XUEDING WANG ET AL: "Noninvasive photoacoustic angiography of animal brains in vivo with near-infrared light and an optical contrast agent", OPTICS LETTERS, 1 January 2004 (2004-01-01), pages 730 - 732, XP055079408, Retrieved from the Internet <URL:http://www.opticsinfobase.org/DirectPDFAccess/8790AC7B-DE53-328C-43088A52B47005F3_79394/ol-29-7-730.pdf?da=1&id=79394&seq=0&mobile=no> [retrieved on 20130916] * |
Cited By (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9517278B2 (en) | 2012-07-20 | 2016-12-13 | Canon Kabushiki Kaisha | Compound and photoacoustic imaging contrast medium containing the compound |
US9592307B2 (en) | 2012-07-20 | 2017-03-14 | Canon Kabushiki Kaisha | Compound and photoacoustic imaging contrast medium containing the compound |
CN105985431A (en) * | 2015-03-23 | 2016-10-05 | 佳能株式会社 | Near-infrared dye-bound transferrin, and contrast agent for photoacoustic imaging, including the near-infrared dye-bound transferrin |
US10646596B2 (en) | 2015-03-23 | 2020-05-12 | Canon Kabushiki Kaisha | Near-infrared dye-bound transferrin, and contrast agent for photoacoustic imaging, including the near-infrared dye-bound transferrin |
CN113861717A (en) * | 2021-11-09 | 2021-12-31 | 西安康福诺生物科技有限公司 | Water-soluble indocyanine green dye for fluorescent labeling and synthetic method thereof |
Also Published As
Publication number | Publication date |
---|---|
EP2861264B1 (en) | 2019-02-06 |
US20150290345A1 (en) | 2015-10-15 |
EP2861264A1 (en) | 2015-04-22 |
CN104487098B (en) | 2017-12-15 |
US9675715B2 (en) | 2017-06-13 |
CN104487098A (en) | 2015-04-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9675715B2 (en) | Contrast agent for photoacoustic imaging | |
US9592307B2 (en) | Compound and photoacoustic imaging contrast medium containing the compound | |
US9517278B2 (en) | Compound and photoacoustic imaging contrast medium containing the compound | |
JP6959616B2 (en) | Site-specific RI-labeled antibody with IgG-binding peptide | |
JP5815990B2 (en) | Composite particle, contrast agent for photoacoustic imaging, and method for producing the composite particle | |
US9782497B2 (en) | Synthesis and composition of amino acid linking groups conjugated to compounds used for the targeted imaging of tumors | |
Ding et al. | HER2-positive breast cancer targeting and treatment by a peptide-conjugated mini nanodrug | |
TWI780082B (en) | Novel anti-human MUC1 antibody Fab fragment | |
KR20180002645A (en) | Nanoparticle immunoconjugate | |
JP6177036B2 (en) | Contrast agent for photoacoustic imaging | |
Wang et al. | Emergent fluorous molecules and their uses in molecular imaging | |
JP6552236B2 (en) | Near-infrared dye-bound transferrin, contrast agent for photoacoustic imaging comprising the near-infrared dye-bound transferrin | |
JP6288970B2 (en) | Compound and contrast agent for photoacoustic imaging having the compound | |
CN107949385B (en) | Fluorescent conjugates | |
US8974830B2 (en) | Particles and contrast agent including the same for optical imaging | |
JP6789636B2 (en) | Polymer, contrast agent for photoacoustic imaging having the polymer | |
US10172964B2 (en) | Compound or salt thereof and contrast agent for optical imaging | |
JP6300460B2 (en) | Compound, and contrast agent for photoacoustic imaging having the compound | |
JP6711601B2 (en) | Contrast agent for photoacoustic imaging | |
Privat et al. | Development of an Immuno-SPECT/Fluorescent Bimodal Tracer Targeting Human or Murine PD-L1 on Preclinical Models | |
CN117777237A (en) | BCMA-targeted polypeptide and application thereof | |
ES2371426B1 (en) | OLIGOMERIC PROTEINS AND ITS APPLICATIONS | |
Patil et al. | HER2-positive breast cancer targeting and treatment by |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13750954 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 14413402 Country of ref document: US |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2013750954 Country of ref document: EP |
|
NENP | Non-entry into the national phase |
Ref country code: DE |