WO2014009808A2 - Lipidated peptides as anti-obesity agents - Google Patents

Lipidated peptides as anti-obesity agents Download PDF

Info

Publication number
WO2014009808A2
WO2014009808A2 PCT/IB2013/001837 IB2013001837W WO2014009808A2 WO 2014009808 A2 WO2014009808 A2 WO 2014009808A2 IB 2013001837 W IB2013001837 W IB 2013001837W WO 2014009808 A2 WO2014009808 A2 WO 2014009808A2
Authority
WO
WIPO (PCT)
Prior art keywords
dpr
myr
prolactin
lipidated
palm
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2013/001837
Other languages
French (fr)
Other versions
WO2014009808A3 (en
Inventor
Lenka Maletinska
Blanka ZELEZNA
Miroslava BLECHOVA
Andrea SPOLCOVA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Institute of Organic Chemistry and Biochemistry CAS
Original Assignee
Institute of Organic Chemistry and Biochemistry CAS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Institute of Organic Chemistry and Biochemistry CAS filed Critical Institute of Organic Chemistry and Biochemistry CAS
Priority to US14/414,034 priority Critical patent/US9937235B2/en
Priority to AU2013288383A priority patent/AU2013288383B2/en
Priority to EP13767072.5A priority patent/EP2872124B1/en
Priority to CA2877594A priority patent/CA2877594C/en
Publication of WO2014009808A2 publication Critical patent/WO2014009808A2/en
Publication of WO2014009808A3 publication Critical patent/WO2014009808A3/en
Priority to IL236264A priority patent/IL236264A/en
Anticipated expiration legal-status Critical
Priority to US15/094,390 priority patent/US20160331812A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/2257Prolactin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/543Lipids, e.g. triglycerides; Polyamines, e.g. spermine or spermidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones

Definitions

  • the embodiments described herein relate to lipidated analogs of prolactin-releasing peptides and the use of these analogs as anorexigenic compounds that lower food intake.
  • the synthesis of these lipidated peptides is described herein, as well as their pharmacological effects in vitro and in vivo.
  • Sibutramine a serotonin-norepinephrine reuptake inhibitor that induces satiety sensation was withdrawn from the market for increased risk of heart disease found during its use (Strader, A., et al, "Gastrointestinal hormones and food intake,” Gastroenterology, 128: 175-191, 2005; Heal, D.J. et al., "What is the prognosis for new centrally-acting anti-obesity drugs?"
  • Embodiments disclosed herein relate to lipidated analog of prolactin-releasing peptide having a general formula:
  • J 1 represents a fatty acid C6 to CI 8 bound by an amide bond to an amino group of a N- terminal amino acid
  • J represents a chain of 13 or 24 amino acids
  • r is isoleucine, alanine, or phenylglycine
  • s is valine or phenylglycine
  • t is phenylalanine or an amino acid with a side chain containing CH 2 -Ar or CH 2 -S-CH 2 - Ar, wherein Ar represents phenyl or naphtyl, optionally substituted by a halogen or nitro group.
  • J 1 represents a fatty acid C6 to C18 bound by an amide bond to an amino group of a N- terminal amino acid
  • k is chosen from serine, threonine or diaminopropionic acid
  • J 3 represents a chain of 23 or 12 amino acids
  • r is isoleucine, alanine, or phenylglycine
  • s is valine or phenylglycine
  • t is phenylalanine or an amino acid with a side chain containing CH 2 -Ar or CH 2 -S-CH 2 - Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group.
  • k is serine, threonine or diaminopropionic acid
  • n is chosen from threonine, alanine or methylalanine
  • n glutamine or arginine
  • q is methionine or norleucine
  • u is threonine or isoleucine
  • o is glycine or serine
  • p is glycine, alanine, proline or N-methylglycine
  • r is isoleucine, alanine or phenylglycine
  • s is valine or phenylglycine
  • t is phenylalanine or an amino acid with a side chain containing CH 2 -Ar or CH 2 -S-CH 2 - Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and
  • J 1 represents a fatty acid C6 to C18 bound by the amide bond to the amino group of the N-terminal amino acid, wherein the chain of amino acids kRmHnHSqEuRTPDlNPAWYmoRp is optionally shortened by eliminating from 1 to 10 amino acids.
  • k is serine, threonine or diaminopropionic acid
  • n is threonine, alanine or methylalanine
  • n glutamine or arginine
  • q is methionine or norleucine
  • u is threonine or isoleucine
  • o is glycine or serine
  • p is glycine, alanine, proline or N-methylglycine
  • r is isoleucine, alanine or phenylglycine
  • s is valine or phenylglycine
  • t is phenylalanine or an amino acid with side chain containing CH 2 -Ar or CH 2 -S-CH 2 - Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and J 1 represents a fatty acid C6 to C 18 bound by the amide bond to the amino group of the N-terminal amino acid, where the chain of amino acids kRmHnHSqEuRTPDINPAWYmoRp is optionally shortened from its N-terminus by eliminating from 1 to 10 amino acids.
  • Additional embodiments disclosed herein relate to lipidated analogs of prolactin- releasing peptide chosen from the group containing peptides of formula
  • k is serine, threonine or diaminopropionic acid
  • n is threonine, alanine or methylalanine
  • n glutamine or arginine
  • q is methionine or norleucine
  • u is threonine or isoleucine
  • o is glycine or serine
  • p is glycine, alanine, proline or N-methylglycine
  • r is isoleucine, alanine or phenylglycine
  • s is valine or phenylglycine
  • t is phenylalanine or an amino acid with side chain containing CH 2 -Ar or CH 2 -S-CH 2 - Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and
  • J 1 represents a fatty acid C6 to CI 8 bound by the amide bond to the amino group of the N-terminal amino acid.
  • substitutions of amino acids in positions 1-24 of formula III or in positions 1-13 of formula IV are performed that do not increase the binding affinity value of the resulting lipidated peptide to the receptor GPR10 over K; 10 "6 mol.l “1 , measured in the rat hypophyseal cell line RC-4B/C grown on 24-well plates, which had their bottom coated with polyethyleneimine, up to the optimal density of 300-450 thousand per well; then the following agents are added: binding buffer containing 20 mmol.l "1 HEPES, pH 7.4, 118 mmol.l “1 NaCl, 4.7 mmol.l “1 KC1, 5 mmol.l "1 MgCl 2 , 5.5 mmol.l "1 glucose, 1 mg/ml bovine serum albumin, 0.1 mg/ml bovine pancreatic trypsin inhibitor; unlabelled analogs of PrRP of final concentration within 10 "11 to 10 "4 mol.l "1 , and 125 I-Pr
  • n is threonine, alanine or methylalanine
  • n glutamine or arginine
  • q is methionine or norleucine
  • u is threonine or isoleucine
  • o is glycine or serine
  • p is glycine, alanine, proline or N-methylglycine
  • r is isoleucine, alanine or phenylglycine, s is chosen from valine or phenylglycine;
  • t is phenylalanine or an amino acid with side chain containing CH 2 -Ar or CH 2 -S-CH 2 -Ar, where
  • Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group
  • J 1 represents a fatty acid C6 to CI 8 bound by an amide bond to the amino group of the N- terminal amino acid.
  • the C-terminal amino acid of any of the lipidated analogs of prolactin-releasing peptide disclosed herein is naphtylalanine, benzylcystein, benzylhistidine, pentafluorophenylalanine, or nitrophenyalanine.
  • the fatty acid of any of the lipidated analogs of prolactin-releasing peptide disclosed herein is selected from the group consisting of fatty acids with 6 to 18 carbons and fatty acids with 13 to 18 carbon atoms. In some embodiments, the fatty acid is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 carbon atoms.
  • lipidated analog of prolactin-releasing peptide selected from the group consisting of:
  • More embodiments relate to a lipidated analog of prolactin-releasing peptide selected from the group consisting of:
  • n T or A
  • o G or S
  • n Q or R
  • such substitutions in amino acids may be performed that do not increase the binding affinity value of the lipidated analog to the receptor GPR10 over K; 10 "6 mol.l “1 , and its anorexic activity evaluated by the food intake test in fasted mice after both peripheral and central administration is equal or higher as compared to administered PrRP.
  • Additional embodiments relate to a lipidated analog of prolactin-releasing peptide selected from the group consisting of:
  • J 1 is palmitic acid, myristic acid or stearic acid
  • J a is palmitic acid or myristic acid.
  • Some embodiments described herein relate to the use of lipidated analogs of prolactin- releasing peptide disclosed herein as anorexigenic agents lowering food intake after peripheral administration.
  • Some embodiments described herein relate to the use of lipidated analogs of prolactin- releasing peptide disclosed herein as an agent for the treatment of obesity.
  • Additional embodiments described herein relate to a lipidated analog of prolactin- releasing peptide selected from:
  • the lipidated analog of prolactin-releasing peptide has the structure:
  • J a is palmitic acid or myristic acid; m is T or A; and o is G or S. In some embodiments, J a is myristic acid.
  • the lipidated analog of prolactin-releasing peptide has the structure:
  • lipidated analog of prolactin- releasing peptide disclosed herein is:
  • the lipidated analog of prolactin-releasing peptide is administered by a route other than a centrally administered route. In some embodiments, the lipidated analog of prolactin-releasing peptide is administered peripherally (e.g, subcutaneously).
  • Figure 1 represents the time course of food intake after ICV administration of PrRP31 in the dose of 4 and 10 nmol/mouse to the fasted C57BL/6 mice.
  • the significance is **P ⁇ 0.01, ***P ⁇ 0.001 versus saline at time points 45 and 75 minutes after injection (one-way ANOVA followed by Dunnett post-hoc test).
  • Figure 2 represents the time course of food intake after ICV administration of analogs PrRP31 with varying length of the lipid chain to fasted C57BL/6 mice at the dose of 4 nmol/mouse.
  • Figure 3 represents the time course of food intake after SC administration of analogs of PrRP31 with varying length of the lipid chain to fasted C57BL/6 mice at a dose of 5 mg/kg.
  • the significance is *P ⁇ 0.05, ***P ⁇ 0.001 versus saline throughout the time course of the test (one-way ANOVA followed by Dunnett post-hoc test).
  • Figure 4 represents the time course of food intake after SC administration of human and rat lipidated analogs of PrRP31 and PrRP20 to fasted C57BL/6 mice at a dose of 5 mg/kg.
  • the significance is ** *P ⁇ 0.001 versus saline throughout the time course of the test (one-way ANOVA followed by Dunnett post-hoc test). ⁇ - saline, ⁇ - analog 5, ⁇ - analog 10, ⁇ - analog 12, A - analog 13.
  • Figure 5 represents the time course of food intake after SC administration of
  • Figure 6 represents the time course of food intake after SC administration of
  • myristoylated analog [Dp Nal ⁇ PrRPS l (No.9) to fasted C57BL/6 mice at the doses of 1 ,2,5 and 10 mg/kg.
  • the significance is **P ⁇ 0.01 , ***P ⁇ 0.001 versus saline (one-way ANOVA followed by Dunnett post-hoc test).
  • Figure 7 represents neural activity showed as Fos immunoreactivity.
  • PrRP The neuropeptide PrRP, the prolactin-releasing peptide has been shown to fundamentally affect the regulation of energy metabolism (Hinuma, S., et al. "A prolactin-releasing peptide in the brain,” Nature 393 :272-276, 1998).
  • PrRP31 the prolactin-releasing peptide in the brain
  • PrRP20 the other of 20 amino acids
  • PrRP has multiple functions in the body. The first described biological effect was the stimulation of prolactin release (Hinuma et al.). Subsequently it was found, however, that this is not affected in male rats and therefore most likely it is not the primary function of PrRP (Jarry, H., et al., "Prolactin-releasing peptides do not stimulate prolactin release in vivo,"
  • PrRP paraventricular and dorsomedial nuclei
  • PrRP31 The anorexigenic effect of PrRP31 was demonstrated when injected into the third brain ventricle where the front wall and base are formed by the hypothalamus (so called
  • ICV intracerebro ventricular administration
  • mice with a deleted gene for the receptor GPR10 had higher food intake leading to obesity, and this effect was more pronounced in the females (Gu, W., et al, "The prolactin-releasing peptide receptor (GPR10) regulates body weight homeostasis in mice,” J Mol Neurosci, 22:93-103, 2004; Bjursell et al).
  • the food intake in the GPR10 KO mice was not reduced after the administration of cholecystokinin (CCK).
  • the presence of arginine in the position 30 is critical for the proper function of PrRP. Its modification or substitution with a different amino acid leads to a loss of binding to the receptor and of biological activity. Furthermore, for the binding of PrRP to the receptor GPR10, the position 31 is important and requires phenylalanine or other amino acid with aromatic moiety bound to at least one CH 2 group of the side chain of the amino acid (Boyle, R., et al, "Structure-activity studies on prolactin-releasing peptide (PrRP). Analogues of PrRP-(19-31)-peptide," J ept &z, 11 : 161-165, 2005).
  • PrRP prolactin releasing peptide
  • PrRP20 Modifications of the natural peptide PrRP20 which biological activity in vitro is comparable to PrRP31 (Langmead, C, et al., "Characterization of the binding of [(125)1] -human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor," Br J Pharmacol, 131 :683-688, 2000; Maixnerova et al, 2011) were used in a recent study (Maletinska, L., et al, "Biological properties of prolactin-releasing peptide analogues with a modified aromatic ring of a C-terminal phenylalanine amide," Peptides, 32: 1887-1892, 2011).
  • C-terminal phenylalanine was replaced by noncoded amino acids, phenylalanine derivatives PheCl 2 , PheF 5 and PheN0 2 , or by noncoded amino acids with bulky naphtylalanine 1-Nal and 2-Nal, or by tyrosine.
  • peripheral e.g, subcutaneously, SC.
  • peripheral e.g, peripheral
  • Some embodiments disclosed herein include lipidated analogs that are lipidated peptides formed by 20 or 31 amino acids, with the sequence of IRPVGRF-NH 2 at the C-terminus and lipidated with one or more fatty acids.
  • isoleucine may be substituted by phenylglycine or alanine
  • valine may be substituted by phenylglycine.
  • the terminal phenylalanine may be replaced by an amino acid with a side chain containing CH 2 -Ar or CH 2 -S- CH 2 -Ar, where Ar represents phenyl or naphtyl, optionally substituted by a halogen or nitro group.
  • the amino group on the N-terminal amino acid can be serine, diaminopropionic acid or threonine and the C6 to CI 8 fatty acid is bound by the amide bond.
  • amino acid substitutions can be made in the lipidated analog.
  • the methionine at position 8 in PrRP31 can be replaced by a norleucine, for example, to increase stability.
  • the amino acids in positions before the C -terminal heptapeptide are not essential for the described biological activity of the lipidated analogs. Their substitution by a different amino acid or a slight reduction of the number is possible as long as the resulting lipidated peptide has the binding affinity to the PrRP receptor with K; in the order of 10 "6 mol.l “1 or lower, (or even better 10 - " 8 mol.l - “ 1 or lower), exhibits agonist activity towards PrRP (as determined by MAPK/ERK1/2 signaling in RC-4B/C cells) and the anorexigenic activity, tested by food intake in fasted mice after central and peripheral administration, equal as PrRP or higher.
  • the lipidated analogs of PrRP20 or PrRP31 have the general formula
  • J 1 represents a fatty acid C 6 to CI 8 bound by an amide bond to an amino group of a N- terminal amino acid
  • J represents a chain of 13 or 24 amino acids
  • r is chosen from isoleucine, alanine, or phenylglycine
  • s is chosen from valine or phenylglycine
  • t is chosen from
  • the lipidated analogs of PrRP20 or PrRP31 have the general formula
  • J 1 represents a fatty acid C 6 to CI 8 bound by an amide bond to an amino group of a N- terminal amino acid
  • k is chosen from serine, threonine or diaminopropionic acid
  • J represents a chain of 23 or 12 amino acids
  • r is chosen from isoleucine, alanine, or phenylglycine
  • s is chosen from valine or phenylglycine
  • t is chosen from phenylalanine or an amino acid with a side chain containing CH 2 -Ar or CH 2 -S-CH 2 -Ar
  • Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group.
  • k is chosen from serine, threonine or diaminopropionic acid
  • m is chosen from threonine, alanine or methylalanine
  • n is chosen from glutamine or arginine
  • q is chosen from methionine or norleucine
  • u is chosen from threonine or isoleucine
  • o is chosen from glycine or serine
  • p is chosen from glycine, alanine, proline or N-methylglycine
  • r is chosen from isoleucine, alanine or phenylglycine
  • s is chosen from valine or phenylglycine
  • t is chosen from phenylalanine or an amino acid with side chain containing CH 2 -Ar or CH 2 -S-CH 2 -Ar
  • Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group
  • J 1 represents a fatty acid C
  • Additional embodiments disclosed herein relate to lipidated analogs of PrRP20 or PrRP31 described above where such substitutions of amino acids in positions 1-24 of formula III or in positions 1-13 of formula IV are performed that do not increase the binding affinity value of the resulting lipidated peptide to the receptor GPR10 over K; 10 "6 mol.l “1 , measured in the rat pituitary cell line RC-4B/C grown on 24-well plates, which had their bottom coated with polyethyleneimine, up to the optimal density of 300-450 thousand cells per well; then the following agents are added: binding buffer containing 20 mmol.l "1 HEPES, pH 7.4, 118 mmol.l “ 1 NaCl, 4.7 mmol.l “1 KC1, 5 mmol.l “1 MgCl 2 , 5.5 mmol.l "1 glucose, 1 mg/ml bovine serum albumin, 0.1 mg/ml bovine pancreatic trypsin inhibitor; unlabelled analogs of PrRP of final concentration within 10 "
  • the lipidated analogs described herein include a C-terminal amino acid selected from naphtylalanine, benzylcysteine, benzylhistidine, pentafluorophenyalanine, and nitrophenylalanine.
  • the lipidated analogs described herein include a fatty acid is selected from a group that includes fatty acids of 6 to 18, and more preferably, of 13 to 18 carbon atoms. In some embodiments, the lipidated analogs described herein include a fatty acid of 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 carbon atoms.
  • Additional embodiments include lipidated analogs selected from the group which includes the following:
  • phenylglycine Dpr is diaminopropionic acid
  • 1-Nal 1-naphtylalanine
  • Nle norleucine
  • myr is myristoyl
  • palm palmitoyl
  • oct is octanoyl
  • dodec dodecanoyl
  • tridec is tridecanoyl.
  • substitutions in amino acids may be performed that do not increase the binding affinity value of the lipidated peptide to the receptor GPR10 over K; 10 "6 mol.r 1 , and its anorectic activity evaluated by food intake test in fasted mice after both peripheral and central administration is equal or higher as compared to administered PrRP.
  • lipidated analogs selected from the group that includes:
  • m is T or A and o is G or S, n is Q or R, Dpr is diaminopropionic acid, 1-Nal is 1- naphtylalanine, Nle is norleucine, myr is myristoyl, palm is palmitoyl, oct is octanoyl, dodec is dodecanoyl, tridec is tridecanoyl.
  • Some embodiments disclosed herein include lipidated analogs of PrRP20 or PrRP31 selected from the group that includes:
  • J 1 is chosen from palmitic acid, myristic acid or stearic acid
  • J a is chosen from palmitic acid or myristic acid
  • N-oct represents N-octanoic acid
  • N-dec represents N- decanoic acid
  • N-dodec represents N-dodecanoic acid
  • N-myr represents N-myristic acid
  • N- palm palmitic acid, wherein each above mentioned fatty acid is always bound by the amide bond to the amino group of the N-terminal amino acid
  • Nle represents norleucine
  • 1-Nal represents naftylalanine
  • Me represents methyl.
  • Some embodiments disclosed herein include a lipidated analog of PrRP20 or PrRP31 or a modified PrRP20 or PrRP31 (e.g., a peptide with an amino acid substitution or reduction) selected from:
  • FIG. 1 For embodiments disclosed herein, a myristoylated analog selected from: (Dpr(myr)) RAHQHS Nle ETRTPDINP A W YTGRGIRP VGRF -NH 2 ,
  • Additional embodiments disclosed herein include a palmitoylated analog selected from:
  • Some embodiments include the stearoylated analog:
  • Additional embodiments disclosed herein include a lipidated analog selected from: (N-myr)TPDINPAWYASRGIRPVGRF-NH 2 and
  • Some embodiments relate to the use of the lipidated analogs described herein (e.g, the lipidated analogs of formulas I, II, III, IV, and V) as anorexigenic agents which lower food intake after peripheral administration (e.g, subcutaneous administration).
  • peripheral administration e.g, subcutaneous administration
  • Additional embodiments relate to the use of the lipidated analogs described herein (e.g, the lipidated analogs of formulas I, II, III, IV, and V) for the manufacturing of medication for the treatment of obesity.
  • the methods described herein include administering to a subject in need a lipidated analog described herein (e.g., a pharmaceutical composition) containing a therapeutically effective amount of one or more lipidated analogs described herein.
  • a lipidated analog described herein e.g., a pharmaceutical composition
  • the characteristics of the lipidated analogs described herein allow the analogs to be useful for preventing or treating obesity.
  • a mammal can be identified as having or being likely to develop obesity using standard clinical techniques. For example, analysis of a human's family history or eating habits can be used to determine whether or not the human is likely to develop an obesity condition.
  • a mammal identified as having or being susceptible to developing an obesity condition can be treated by administering a lipidated analog disclosed herein.
  • compositions comprising at least one lipidated analog as described herein.
  • compositions are typically formulated using one or more physiologically acceptable carriers including excipients and auxiliaries which facilitate processing of the therapeutic composition into preparations which are used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
  • a summary of pharmaceutical compositions is found, for example, in Remington: The Science and Practice of Pharmacy, Nineteenth Ed (Easton, Pa.: Mack Publishing Company, 1995); Hoover, John E., Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pennsylvania 1975; Liberman, H.A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems, Seventh Ed. (Lippincott Williams & Wilkins, 1999).
  • compositions that include one or more lipidated analogs described herein and one or more pharmaceutically acceptable diluent(s), excipient(s), or carrier(s).
  • the lipidated analog is optionally administered as pharmaceutical compositions in which it is mixed with other active ingredients, as in combination therapy.
  • the pharmaceutical composition includes other medicinal or pharmaceutical agents, carriers, adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure, and/or buffers.
  • the pharmaceutical compositions can also contain other therapeutically valuable substances.
  • a pharmaceutical composition refers to a mixture of a lipidated analog with one or more other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, and/or excipients.
  • the pharmaceutical refers to a mixture of a lipidated analog with one or more other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, and/or excipients.
  • composition facilitates administration of the lipidated analog to an organism.
  • a lipidated analog is administered in a
  • the mammal having a condition, disease, or disorder to be treated.
  • the mammal is a human.
  • the dose and dosing regimen varies depending on the severity and stage of the condition, the age and relative health of an individual, the potency of the therapeutic composition used and other factors.
  • the lipidated analog is optionally used singly or in combination with one or more therapeutic agents as components of mixtures.
  • compositions described herein can be formulated, for example, as aqueous liquid dispersions, self-emulsifying dispersions, solid solutions, liposomal dispersions, aerosols, solid dosage forms, powders, immediate release formulations, controlled release formulations, fast melt formulations, tablets, capsules, pills, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate and controlled release formulations.
  • the pharmaceutical formulations described herein are optionally administered to a individual by one or more administration routes, including but not limited to, parenteral (e.g., intravenous, subcutaneous, intramuscular, intrathecal), intracerebroventricular, intranasal, buccal, topical, rectal, oral, or transdermal administration routes.
  • parenteral e.g., intravenous, subcutaneous, intramuscular, intrathecal
  • intracerebroventricular intranasal
  • buccal topical
  • rectal oral
  • transdermal administration routes e.g., transdermal administration routes.
  • the pharmaceutical formulations described herein are not centrally administered (e.g., administered directly to the central nervous system).
  • the pharmaceutical formulations described herein are peripherally administered (e.g., subcutaneously).
  • ANOVA analysis of variance
  • BSA bovine serum albumin
  • BPTI bovine pancreatic trypsin inhibitor
  • EGF epidermal growth factor
  • HEPES 4-(2-hydroxyethyl)-l-piperazineethansulfonic acid
  • PBS phosphate buffer saline
  • SDS sodium dodecyl sulfate
  • TBS Tris-buffered saline
  • Dpr diaminopropionic acid
  • Dpr 1-naphtylalanine (1-Nal)
  • norleucine Nle
  • myristoyl myr
  • palmitoyl palm
  • octanoyl dodecanoyl
  • dodec tridecanoyl
  • the peptides were synthesized using the method of solid phase synthesis according to Maixnerova et al. (Maixnerova, J., et al, "Structure-activity relationship of CART (cocaine- and amphetamine-regulated transcript) peptide fragments," Peptides, 28: 1945-1953, 2007) utilizing the Fmoc strategy on the ABI 433A synthesizer (Applied Biosystems, Foster City, CA, USA).
  • PrRP31 was iodinated with Na I using Iodo-Gen (Pierce, Rockford, IL, USA) according to the published procedure (Maixnerova et al, 2011). Monoiodinated peptide was stored in aliquots at -20 °C and was used up in binding assays within one month.
  • Table 1 describes the structures of PrRP31, PrRP20, and analogs of PrRP31 and PrRP20 synthesized:
  • Binding experiments were conducted with rat pituitary cells and CHO cells as follows:
  • the rat pituitary cell line RC-4B/C (ATCC, Manassas, USA) was grown on 24-well plates which had their bottom coated with polyethyleneimine. The cells were grown to the optimal density of 300-450 thousand per well. The following agents were used for the experiment: binding buffer (20 mmol.l "1 HEPES, pH 7.4; 118 mmol.l “1 NaCl, 4.7 mmol.l "1 KCl, 5 mmol.
  • CHO cells with transfected human PrRP receptor, GPR10 were grown on 24-well plates coated with polyethyleneimine. The cells were grown to the optimal density of 40-80 thousand cells per well.
  • the following agents were used for the experiment: binding buffer (25 mmol.l "1 Tris, pH 7.4; 118 mmol.l “1 NaCl, 10 mmol.l “1 MgCl 2 , 1 mmol.l “1 CaCl 2 , 5.5 mmol.l “1 glucose, 0.5 mg/ml BSA), unlabelled analogs of PrRP of final concentration within 10 "11 to 10 "4 mol.l "1 , and human 125 I-PrRP31 of final concentration of 5xl0 "u mol.l “1 .
  • Plates were incubated for 60 minutes at room temperature. After incubation, the cells were solubilized in 0.1 mo 1/1 solution of NaOH and the radioactivity bound to the cells was counted using a ⁇ -counter. The experiments were performed in duplicate and repeated at least three times.
  • Example 3 Cellular signaling.
  • RC-4B/C cells which were used to determine if lipidated PrRP20 analogs are able to initiate the MAPK/ER l/2 signaling pathway, were grown in 6-well plates up to the optimal density of 700-900 cells per well. Seventeen hours before sample harvest, the growth medium was replaced by a serum-free medium lacking epidermal growth factor (EGF). The respective lipidated PrRP analog was added to each well in the final concentration of 10 "6 mol.l "1 .
  • the proteins from the SDS-PAGE gel were transferred to the ImmobilonTM-P PVDF (polyvinylidene difluoride) membrane (Sigma-Aldrich, USA). The transfer was performed in blotting buffer at pH 8.3 (25 mmol.r 1 Tris, 192 mmol.l "1 glycine and 20% methanol) for 20 hours at 4 °C at a constant voltage of 30 V.
  • ImmobilonTM-P PVDF polyvinylidene difluoride
  • the membranes were washed for 5 minutes in TBS washing buffer (20 mmol.l "1 Tris, 140 mmol.l “1 NaCl and 0.1% Tween-20) and then incubated for 1 hour in blocking buffer (TBS with 5% non-fat milk powder and 5 mmol.l “1 Na 3 V0 4 and 50 mmol.l “1 NaF) at room temperature. Further, the membranes were washed three times for 5 minutes using the TBS washing buffer. The membranes were then incubated with the primary antibody against phospho-p44/42 MAPK(Thr202/Tyr204) (Cell Signaling Technology, Beverly, USA) which was diluted in blocking buffer at 1 : 1000. After the next three washes with the TBS washing buffer for 5 minutes, the membranes were incubated for 1 hour with rabbit secondary antibody labeled with peroxidase (Sigma, St. Louis, USA) which was diluted in blocking buffer at 1 : 12,000.
  • Table 2 and 3 The values of the inhibition constant K; were calculated from IC 50 using Cheng and Prusoff s equation (for 3 ⁇ 4 the value 4.21 nmol.l "1 found in the saturation binding experiments was used and the concentration of the radioligand was 0.1 nmol.l ⁇ with relevant values of S.E.M. [0096]
  • mice Male C57BL/6 mice (An Lab, Prague 4) were bred in the accredited animal facility in the Institute of Organic Chemistry and Biochemistry, Czech Academy of Sciences, Prague, at the Institute of Molecular Genetics, Prague 4, at the temperature of 22 ⁇ 2°C with access to food and water ad libitum. The day/night cycle was 12/12 hours (light turned on at 6:00 am). Animals were treated according to the Animal Protection Act (Act No.246/1992). The males were fed standard chow diet St-1 (Mlyn Kocanda, Praha, Czech Republic) which contained 66% saccharides, 25% proteins and 9% lipids with a caloric value of 3.4 kcal/g.
  • mice Fifteen minutes after the lipidated peptide administration, the mice were given pre- weighed food. The food was then weighed every 30 minutes for 5-10 hours. The administration of every dose was performed at least twice and one group of mice consisted of at least 6 mice. The results were presented as % of food intake as compared with the control group injected with saline.
  • mice injected with saline and mice injected with the examined peptide were considered statistically significant at P ⁇ 0.05.
  • mice/group were treated SC with saline, l or [Dpr(palm) 1 ]PrRP31 (dose 5mg/kg).
  • mice were deeply anesthetized with pentobarbital (50 mg/kg, IP) and perfused transcardially with 0.1 M phosphate buffer (PB, pH 7.4) containing 4 % paraformaldehyde, 0.1 % glutaraldehyde, and 10 % picric acid (w/w).
  • PB phosphate buffer
  • picric acid w/w
  • the brains were rapidly (20 sec) frozen in cold isopentane (-30/-40 °C) and placed into a Reichert cryocut device adjusted to -16 °C for 1 h. 30 um coronal sections were cut from the brains and collected as free floating in cold (4°C) PB.
  • DAB tetrahydrochloride
  • immunolabeling included substitution of the primary antiserum with normal rabbit serum, and sequential elimination of the primary or secondary antibody from the staining series.
  • NTS, PVN, and Arc Counting of Fos immunoreactive cells within the NTS, from Bregma -7.48 mm to Bregma -7.32 mm, PVN, from Bregma -0.7 mm to -0.94 mm, and DMH, from Bregma - 1.46 mm to - 1.82 mm according to the mouse brain atlas (Franklin KBJ, Paxinos G: The mouse brain in stereotaxic coordinates. New York: Academic Press; 1997), was performed separately in each side of the sections. Quantitative assessment was performed from the images captured with a Canon digital camera (PowerShot S40) and Leica DMLS light microscope in a computer screen obtained from 5-6 brain sections per animal. Representative sections were captured by the same computerized system. The counting of Fos-positive neurons was done under blinded conditions (the counted slides from each animal were analyzed independently and randomly and encoded by other person).
  • Results are shown in Fig. 7. Neural activity presented in Fos immunoreactivity was significantly increased in a case of [Dp ⁇ myr ⁇ JPrRPS l and [Dpr(palm) 1 ]PrRP31 analogs in all brain nuclei involved in food intake regulation tested (i.e. Arc, PVN and NTS). These two analogs also significantly decreased food intake.
  • Locomotor activity was measured using the VideoMot system (TSE Systems,
  • mice were placed individually in the open field (lxl m) and their locomotor activity, total distance traveled, was measured for 10 min. Mice were administered with SC injection of saline, [Dpr ⁇ PrRPS l, [Dpr(palm) 1 ]PrRP31 or myr-PrRP20
  • mice (AnLab, Prague, Czech Republic) were housed at a temperature of 23°C under a daily cycle of 12 hours light and dark (light from 6:00 a.m.) with free access to water and food pellets (St- 1 , Mlyn Kocanda, Jesenice, Czech Republic).
  • mice were divided into a standard (St) diet-fed group (the energy content of the St-1 diet was 3.4 kcal/g, containing 25, 9, and 66% of calories from protein, fat, and carbohydrate, respectively (St-1, Mlyn Kocanda, Jesenice, Czech Republic)) and a high fat (HF) diet-fed group (the energy content of the HF diet was 5.3 kcal/g, containing 13, 60, and 27% of calories from protein, fat, and carbohydrate, respectively).
  • St standard
  • HF high fat
  • the HF diet consisted of 40%> standard St-1 diet, 34% powdered cow milk for human neonates, 25% lard, and 1%) corn starch w/w (Kopecky, J., et al, "Reduction of dietary obesity in aP2-Ucp transgenic mice: physiology and adipose tissue distribution," Am J Physiol, 270:E768-75, 1996). Food intake and body weight were monitored weekly from 9 to 20 weeks of age. Mice resistant to the HF diet were withdrawn from the experiment (approximately 10% of mice).
  • mice were fasted overnight and sacrificed the following morning. Their blood sera were isolated, and the white adipose tissue (subcutaneous, abdominal, and gonadal), and the liver of all mice were dissected, weighed, and stored at -70°C. Fat to body weight ratio was calculated as a ratio of adipose tissue weight to body weight.
  • Serum insulin and leptin concentrations were measured by RIA assays. Serum glucose levels were measured using a Glucocard glucometer (Arkray, Kyoto, Japan). Serum triglyceride levels were measured by quantitative enzymatic reactions (Sigma, St. Louis, USA).
  • Statistical analysis The data are presented as means ⁇ SEM for the number of animals indicated in the Figures and Tables. They were analyzed by a one-way ANOVA followed by a Dunnett post- hoc test (metabolic parameters, behavioral study) or two-way ANOVA followed by a Bonferroni post-hoc test (body weight evaluation) using Graph-Pad Software (San Diego, CA, USA). P ⁇ 0.05 was considered statistically significant.
  • Myr-PrRP20 15.30 ⁇ 0.42 3.60 ⁇ 39.56 ⁇ 7.52 ⁇ 3.54 ⁇ 68.71 ⁇ 4.16
  • Example 8 Test of food intake after administration of analog no. 55 to Rhesus monkeys

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Endocrinology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Child & Adolescent Psychology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Description

LIPIDATED PEPTIDES AS ANTI-OBESITY AGENTS
CROSS-REFERENCE
[0001] This application claims the benefit of Czech Republic Application No. PV 2012-476, filed July 12, 2012, which is incorporated herein by reference.
FIELD OF THE INVENTION
[0002] The embodiments described herein relate to lipidated analogs of prolactin-releasing peptides and the use of these analogs as anorexigenic compounds that lower food intake. The synthesis of these lipidated peptides is described herein, as well as their pharmacological effects in vitro and in vivo.
BACKGROUND OF THE INVENTION
[0003] In both the developing and developed countries, obesity is an increasingly growing problem, for which no effective therapies are available. Current medications are typically associated with adverse side effects. For example, the only medication available in the Czech Republic is Orlistat, an inhibitor of intestinal lipase which lowers the absorption of lipids from the small intestine. It is, however, associated with adverse effects, such as diarrhoea.
Sibutramine, a serotonin-norepinephrine reuptake inhibitor that induces satiety sensation was withdrawn from the market for increased risk of heart disease found during its use (Strader, A., et al, "Gastrointestinal hormones and food intake," Gastroenterology, 128: 175-191, 2005; Heal, D.J. et al., "What is the prognosis for new centrally-acting anti-obesity drugs?"
Neuropharmacology, 63: 132-146, 2012).
SUMMARY OF THE INVENTION
[0004] Embodiments disclosed herein relate to lipidated analog of prolactin-releasing peptide having a general formula:
J!-J2- rRPsGRt-NH2 (I), wherein
J1 represents a fatty acid C6 to CI 8 bound by an amide bond to an amino group of a N- terminal amino acid;
J represents a chain of 13 or 24 amino acids;
r is isoleucine, alanine, or phenylglycine;
s is valine or phenylglycine; and
t is phenylalanine or an amino acid with a side chain containing CH2-Ar or CH2-S-CH2- Ar, wherein Ar represents phenyl or naphtyl, optionally substituted by a halogen or nitro group.
[0005] Additional embodiments disclosed herein relate to lipidated analogs of prolactin- releasing peptide having a general formula:
J!-k-J3- rRPsGRt-NH2 (II), wherein J1 represents a fatty acid C6 to C18 bound by an amide bond to an amino group of a N- terminal amino acid;
k is chosen from serine, threonine or diaminopropionic acid;
J3 represents a chain of 23 or 12 amino acids;
r is isoleucine, alanine, or phenylglycine;
s is valine or phenylglycine; and
t is phenylalanine or an amino acid with a side chain containing CH2-Ar or CH2-S-CH2- Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group.
[0006] Further embodiments disclosed herein relate to lipidated analogs of prolactin-releasing peptide having a general formula:
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III), wherein
k is serine, threonine or diaminopropionic acid;
m is chosen from threonine, alanine or methylalanine;
n is glutamine or arginine;
q is methionine or norleucine;
u is threonine or isoleucine;
o is glycine or serine;
p is glycine, alanine, proline or N-methylglycine;
r is isoleucine, alanine or phenylglycine;
s is valine or phenylglycine;
t is phenylalanine or an amino acid with a side chain containing CH2-Ar or CH2-S-CH2- Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and
J1 represents a fatty acid C6 to C18 bound by the amide bond to the amino group of the N-terminal amino acid, wherein the chain of amino acids kRmHnHSqEuRTPDlNPAWYmoRp is optionally shortened by eliminating from 1 to 10 amino acids.
[0007] Yet further embodiments herein relate to lipidated analogs of prolactin-releasing peptide, having a general formula
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III), wherein
k is serine, threonine or diaminopropionic acid;
m is threonine, alanine or methylalanine;
n is glutamine or arginine;
q is methionine or norleucine;
u is threonine or isoleucine;
o is glycine or serine;
p is glycine, alanine, proline or N-methylglycine; r is isoleucine, alanine or phenylglycine;
s is valine or phenylglycine;
t is phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2- Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and J1 represents a fatty acid C6 to C 18 bound by the amide bond to the amino group of the N-terminal amino acid, where the chain of amino acids kRmHnHSqEuRTPDINPAWYmoRp is optionally shortened from its N-terminus by eliminating from 1 to 10 amino acids.
[0008] Additional embodiments disclosed herein relate to lipidated analogs of prolactin- releasing peptide chosen from the group containing peptides of formula
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III), or
J1-TPDINPAWYmoRprRPsGRt-NH2 (IV), wherein
k is serine, threonine or diaminopropionic acid;
m is threonine, alanine or methylalanine;
n is glutamine or arginine;
q is methionine or norleucine;
u is threonine or isoleucine;
o is glycine or serine;
p is glycine, alanine, proline or N-methylglycine;
r is isoleucine, alanine or phenylglycine;
s is valine or phenylglycine;
t is phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2- Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and
J1 represents a fatty acid C6 to CI 8 bound by the amide bond to the amino group of the N-terminal amino acid.
[0009] In some embodiments, substitutions of amino acids in positions 1-24 of formula III or in positions 1-13 of formula IV are performed that do not increase the binding affinity value of the resulting lipidated peptide to the receptor GPR10 over K; 10"6 mol.l"1, measured in the rat hypophyseal cell line RC-4B/C grown on 24-well plates, which had their bottom coated with polyethyleneimine, up to the optimal density of 300-450 thousand per well; then the following agents are added: binding buffer containing 20 mmol.l"1 HEPES, pH 7.4, 118 mmol.l"1 NaCl, 4.7 mmol.l"1 KC1, 5 mmol.l"1 MgCl2, 5.5 mmol.l"1 glucose, 1 mg/ml bovine serum albumin, 0.1 mg/ml bovine pancreatic trypsin inhibitor; unlabelled analogs of PrRP of final concentration within 10"11 to 10"4 mol.l"1, and 125I-PrRP31 of final concentration of 10"10 mol.l"1; the plate is incubated for 60 minutes at room temperature and thereafter the cells are solubilized in 0.1 mol/1 solution of NaOH and the radioactivity bound to the cell is counted in the γ-counter. [0010] Additional embodiments relate to lipidated analogs of of prolactin-releasing peptide of formula:
J1-SRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (V), wherein
m is threonine, alanine or methylalanine;
n is glutamine or arginine;
q is methionine or norleucine;
u is threonine or isoleucine;
o is glycine or serine;
p is glycine, alanine, proline or N-methylglycine;
r is isoleucine, alanine or phenylglycine, s is chosen from valine or phenylglycine;
t is phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2-Ar, where
Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and
J1 represents a fatty acid C6 to CI 8 bound by an amide bond to the amino group of the N- terminal amino acid.
[0011] In some embodiments, the C-terminal amino acid of any of the lipidated analogs of prolactin-releasing peptide disclosed herein is naphtylalanine, benzylcystein, benzylhistidine, pentafluorophenylalanine, or nitrophenyalanine.
[0012] In some embodiments, the fatty acid of any of the lipidated analogs of prolactin-releasing peptide disclosed herein is selected from the group consisting of fatty acids with 6 to 18 carbons and fatty acids with 13 to 18 carbon atoms. In some embodiments, the fatty acid is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 carbon atoms.
[0013] Further embodiments relate to a lipidated analog of prolactin-releasing peptide selected from the group consisting of:
Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(myr)TPDINPAWYmoRGrRPsGRF-NH2;
(palm)TPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2; (myr)TPDINPAWYmoRGrRPsGR 1-Nal-NH2; and
(palm)TPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
wherein m is T or A;o is G or S; n is Q or R; r is I, A or phenylglycine; s is V or phenylglycine, and wherein at the peptide positions 1 to 24, such substitutions of amino acids may be performed that do not increase the binding affinity value of the resulting lipidated peptide to the receptor GPR10 over K; 10"6 mol.l 1, and its anorexic activity evaluated by the food intake test in fasted mice after both peripheral and central administration is equal or higher as compared to administered PrRP.
[0014] More embodiments relate to a lipidated analog of prolactin-releasing peptide selected from the group consisting of:
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(myr)TPDINPAWYmoRGIRPVGRF-NH2;
(palm)TPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(myr)TPDINPAWYmoRGIRPVGR 1-Nal-NH2; and
(palm)TPDINPAWYmoRGIRPVGR 1-Nal-NH2; wherein
m is T or A;
o is G or S;
n is Q or R, and wherein
at the peptide positions 1 to 24, such substitutions in amino acids may be performed that do not increase the binding affinity value of the lipidated analog to the receptor GPR10 over K; 10"6 mol.l"1, and its anorexic activity evaluated by the food intake test in fasted mice after both peripheral and central administration is equal or higher as compared to administered PrRP.
[0015] Additional embodiments relate to a lipidated analog of prolactin-releasing peptide selected from the group consisting of:
Ja-SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2;
Ja-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2; (N-palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NHMe;
(N-palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NOMe;
(N-myr)-TPDINPAWYTGRGIRPVGRF-NH2;
(N-myr)-TPDINPAWYASRGIRPVGRF-NH2;
(N-oct)-TPDINPAWYASRGIRPVGRF-NH2;
(N-dec)-TPDINPAWYASRGIRPVGRF-NH2;
(N-dodec)-TPDINPAWYASRGIRPVGRF-NH2;
J1 -SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheCl2-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheN02-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheF5-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGRY-NH2;
Ja-SRAHRHS Nle EIRTPDINPAWYASRGIRPVGRY-NH2;
(N-myr)-Nle-ETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-myr)-QHSMETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-myr)-QHSMETRTPDINPAWYASRGIRPVGRF-NH2; and
(N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NOMe; wherein
J1 is palmitic acid, myristic acid or stearic acid; and
Ja is palmitic acid or myristic acid.
[0016] Some embodiments described herein relate to the use of lipidated analogs of prolactin- releasing peptide disclosed herein as anorexigenic agents lowering food intake after peripheral administration.
[0017] Some embodiments described herein relate to the use of lipidated analogs of prolactin- releasing peptide disclosed herein as an agent for the treatment of obesity.
[0018] Additional embodiments described herein relate to a lipidated analog of prolactin- releasing peptide selected from:
(palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2; or (myr)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2.
[0019] In some embodiments, the lipidated analog of prolactin-releasing peptide has the structure:
(palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2.
[0020] Additional embodiments described herein relate to lipidated analog of prolactin-releasing peptide according to formula:
Ja-TPDINPAWYmoRGIRPVGRF-NH2; wherein Ja is palmitic acid or myristic acid; m is T or A; and o is G or S. In some embodiments, Ja is myristic acid.
[0021] In some embodiments, the lipidated analog of prolactin-releasing peptide has the structure:
(myr)-TPDINPAWYASRGIRPVGRF-NH2.
[0022] Further embodiments relate to a method of preventing or treating a subject diagnosed with or susceptible to having obesity comprising administering a lipidated analog of prolactin- releasing peptide disclosed herein. In some embodiments, the lipidated analog is:
(palm)-SRTHPvHSMEIRTPDINPAWYASRGIPvPVGRF-NH2; or
(myr)-TPDINPAWYASRGIRPVGRF-NH2.
In some embodiments, the lipidated analog of prolactin-releasing peptide is administered by a route other than a centrally administered route. In some embodiments, the lipidated analog of prolactin-releasing peptide is administered peripherally (e.g, subcutaneously).
INCORPORATION BY REFERENCE
[0023] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference.
BRIEF DESCRIPTION OF THE DRAWINGS
[0024] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative
embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[0025] Figure 1 represents the time course of food intake after ICV administration of PrRP31 in the dose of 4 and 10 nmol/mouse to the fasted C57BL/6 mice. On the x axis is time in minutes, on the y axis, the cumulative food intake as a % of food intake in the control group injected with the saline (n=6-7). The significance is **P<0.01, ***P<0.001 versus saline at time points 45 and 75 minutes after injection (one-way ANOVA followed by Dunnett post-hoc test). ■ - saline, o - PrRP31 (4 nmol), · - PrRP31 (10 nmol).
[0026] Figure 2 represents the time course of food intake after ICV administration of analogs PrRP31 with varying length of the lipid chain to fasted C57BL/6 mice at the dose of 4 nmol/mouse. On the x axis is time in minutes, on the y axis, the cumulative food intake as a % of food intake in the control group injected with the saline (n=6-7). The significance is
**P<0.01, ***P<0.001 versus saline throughout the time course of the test (one-way ANOVA followed by Dunnett post-hoc test).■ - saline, · - PrRP31 , Δ - analog 1 , - analog 2, A - analog 5.
[0027] Figure 3 represents the time course of food intake after SC administration of analogs of PrRP31 with varying length of the lipid chain to fasted C57BL/6 mice at a dose of 5 mg/kg. On the x axis is time in minutes, on the y axis, the cumulative food intake as a % of food intake in the control group injected with the saline (n=6). The significance is *P<0.05, ***P<0.001 versus saline throughout the time course of the test (one-way ANOVA followed by Dunnett post-hoc test).
■ - saline, Δ - analog 1 , o - analog 2, · - analog 3, C - analog 4,♦ - analog 5,▲ - analog 6.
[0028] Figure 4 represents the time course of food intake after SC administration of human and rat lipidated analogs of PrRP31 and PrRP20 to fasted C57BL/6 mice at a dose of 5 mg/kg. On the x axis is time in minutes, on the y axis, the cumulative food intake as a % of food intake in the control group injected with the saline (n=6). The significance is ** *P<0.001 versus saline throughout the time course of the test (one-way ANOVA followed by Dunnett post-hoc test).■ - saline, · - analog 5, Δ - analog 10,♦ - analog 12, A - analog 13.
[0029] Figure 5 represents the time course of food intake after SC administration of
myristoylated analog [Dp jPrRPS l (No.5) to fasted C57BL/6 mice at the doses of 1 ,2,5 and 10 mg/kg. On the x axis is time in minutes, on the y axis, the cumulative food intake as a % of food intake in the control group injected with the saline (n=6). The significance is ***P<0.001 versus saline throughout the time course of the test (one-way ANOVA followed by Dunnett post-hoc test).■ - saline, Δ - analog 5 : 1 mg/kg, o - analog 5 : 2 mg/kg, · - analog 5 : 5 mg/kg,▲ - analog 5 : 10 mg/kg.
[0030] Figure 6 represents the time course of food intake after SC administration of
myristoylated analog [Dp Nal^PrRPS l (No.9) to fasted C57BL/6 mice at the doses of 1 ,2,5 and 10 mg/kg. On the x axis is time in minutes, on the y axis, the cumulative food intake as a % of food intake in the control group injected with the saline (n=6). The significance is **P<0.01 , ***P<0.001 versus saline (one-way ANOVA followed by Dunnett post-hoc test).■ - saline, o - analog 9: 1 mg/kg, · - analog 9: 2 mg/kg, Δ - analog 9: 5 mg/kg,▲ - analog 9: 10 mg/kg.
[0031] Figure 7 represents neural activity showed as Fos immunoreactivity. Fos-immunostained cells in coronal section and number of Fos-immunopositive cells of AJ Arc, B/ PVN, C/ NTS, 90 minutes after SC application of saline,
Figure imgf000009_0001
l or [Dpr^alm^JPrRPS l (dose 5mg/kg, unilaterally per mouse (n =5) and section (n = 5-6)). Significance: AJ * p < 0.05 vs
Figure imgf000009_0002
l ,
Dpr ocf/jPrRPS l , B, CI x p < 0.05 vs Sal, [Dpr^PrRPS l , D rCoct^PrRPS l . Sal - saline, NTS - solitary tract nucleus, AP - area postrema, PVN -paraventricular nucleus. [0032] Fig. 8 represents behavioral activity of fed mice: AJ open field test, total distance traveled for 10 min and B/ analgesic test, hot plate (latency to jump) after administration with SC injection of saline, [Dpr^PrRPS l , [Dpr(palm)1]PrRP31 or myr-PrRP20 (dose 5 mg/kg, n=5 mice/group).
[0033] Fig. 9 represents long-term effect of lipidized PrRP analogs on body weight in a DIO model of mice (SC administration, dose 5 mg/kg, twice per day for 14 days) (n=10). The data were analyzed by two-way ANOVA (treatment x time after injection). ***P<0.001 vs.
respective saline-treated group.
DETAILED DESCRIPTION OF THE INVENTION
Prolactin-releasing peptide (PrRP)
[0034] The neuropeptide PrRP, the prolactin-releasing peptide has been shown to fundamentally affect the regulation of energy metabolism (Hinuma, S., et al. "A prolactin-releasing peptide in the brain," Nature 393 :272-276, 1998). There are two forms of PrRP, one composed of 31 amino acids (PrRP31), the other of 20 amino acids (PrRP20) (Hinuma et al.).
[0035] PrRP has multiple functions in the body. The first described biological effect was the stimulation of prolactin release (Hinuma et al.). Subsequently it was found, however, that this is not affected in male rats and therefore most likely it is not the primary function of PrRP (Jarry, H., et al., "Prolactin-releasing peptides do not stimulate prolactin release in vivo,"
Neuroendocrinology, 71 :262-267, 2000). Upon finding the PrRP in hypothalamic
paraventricular and dorsomedial nuclei (PVN and DMN) which are important for maintaining the metabolic equilibrium, PrRP was considered as a factor affecting food intake (Lawrence, C, at al., "Alternative role for prolactin-releasing peptide in the regulation of food intake," Nat. Neurosci, 3 :645-646, 2000).
[0036] The anorexigenic effect of PrRP31 was demonstrated when injected into the third brain ventricle where the front wall and base are formed by the hypothalamus (so called
intracerebro ventricular administration, ICV). It led to significant lowering of food intake and subsequently to a decrease of body weight in rats (Lawrence at al, 2000; Lawrence, C, et al, "Anorectic actions of prolactin-releasing peptide are mediated by corticotrophin-releasing hormone receptors," Am J Physiol Regul Integr Comp Physiol, 286:R101-107, 2004). The decrease in food intake did not affect water consumption or behaviour of the experimental animals. Nausea or anorexia were not demonstrated (Lawrence at al., 2000). It was also found that administration of a shorter peptide, tridecapeptide PrRP 13 (containing amino acids 18 to 31 of PrRP31) is not sufficient for maintaining the anorexigenic activity in mice after central administration. (Maixnerova, J., et al, "Characterization of prolactin-releasing peptide: binding, signaling and hormone secretion in rodent pituitary cell lines endogenously expressing its receptor," Peptides, 32:811-817, 2011).
[0037] The anorexigenic function of PrRP was also shown in additional experiments. It was found that during negative energy balance, encountered for example during breast feeding or starvation, PrRP gene transcription decreased. The reduced body weight after ICV injection of PrRP is not only the consequence of lower food intake but also of the increased body
temperature and oxygen consumption which are indirect measures of increased energy output. There is also an increase in uncoupling protein 1 (UCP-1) mRNA production in the brown adipose tissue which is a further indication of an increased energy output (Ellacott, K., et al, "Repeated administration of the anorectic factor prolactin-releasing peptide leads to tolerance to its effects on energy homeostasis," Am J Physiol Regul Integr Comp Physiol, 285:R1005-1010, 2003).
[0038] Genetically modified animals were also used to determine the PrRP function in the body (knock-out (KO) animals with deleted gene coding for PrRP or its receptor GPR10) (Bjursell, M., et al, "GPR10 deficiency in mice results in altered energy expenditure and obesity," Biochem Biophys Res Commun, 363:633-638, 2007; Takayanagi, Y., et al, "Endogenous prolactin-releasing peptide regulates food intake in rodents," J Clin Invest, 118:4014-4024, 2008). Mice with the deleted PrRP gene suffered from hyperphagia. While the frequency of individual meals was not affected, the amount of each meal increased. Lowering of the energy output was not observed in these mice as body temperature and oxygen consumption are comparable to the control animals (Takayanagi et al.; Mochiduki, A., et al., "Stress response of prolactin-releasing peptide knockout mice as to glucocorticoid secretion," J Neuroendocrinal, 22:576-584, 2010).
[0039] Similarly, the mice with a deleted gene for the receptor GPR10 had higher food intake leading to obesity, and this effect was more pronounced in the females (Gu, W., et al, "The prolactin-releasing peptide receptor (GPR10) regulates body weight homeostasis in mice," J Mol Neurosci, 22:93-103, 2004; Bjursell et al). The food intake in the GPR10 KO mice was not reduced after the administration of cholecystokinin (CCK). This finding supports the hypothesis that the GPRlO-PrRP system may have a key role in the signal transfer of CCK, a peripheral peptide that induces satiety sensation during food intake (Bechtold D, et al, "Prolactin-releasing peptide mediates cholecystokinin-induced satiety in mice," Endocrinology, 147:4723-4729, 2006).
[0040] From a structural point of view, the presence of arginine in the position 30 is critical for the proper function of PrRP. Its modification or substitution with a different amino acid leads to a loss of binding to the receptor and of biological activity. Furthermore, for the binding of PrRP to the receptor GPR10, the position 31 is important and requires phenylalanine or other amino acid with aromatic moiety bound to at least one CH2 group of the side chain of the amino acid (Boyle, R., et al, "Structure-activity studies on prolactin-releasing peptide (PrRP). Analogues of PrRP-(19-31)-peptide," J ept &z, 11 : 161-165, 2005).
[0041] For binding experiments with PrRP analogs, the PrRP with 125 I on the tyrosine in position 20 is used (Satoh, F., et al., "Characterization and distribution of prolactin releasing peptide (PrRP) binding sites in the rat-evidence for a novel binding site subtype in cardiac and skeletal muscle," Br J Pharmacol, 129: 1787-1793, 2000). It was confirmed the monoiodation of tyrosine does not affect PrRP binding to the receptor (Maixnerova, J., et al, 2011).
Modifications of the natural peptide PrRP20 which biological activity in vitro is comparable to PrRP31 (Langmead, C, et al., "Characterization of the binding of [(125)1] -human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor," Br J Pharmacol, 131 :683-688, 2000; Maixnerova et al, 2011) were used in a recent study (Maletinska, L., et al, "Biological properties of prolactin-releasing peptide analogues with a modified aromatic ring of a C-terminal phenylalanine amide," Peptides, 32: 1887-1892, 2011). C-terminal phenylalanine was replaced by noncoded amino acids, phenylalanine derivatives PheCl2, PheF5 and PheN02, or by noncoded amino acids with bulky naphtylalanine 1-Nal and 2-Nal, or by tyrosine. All analogs had conserved C-terminal amide which is necessary for biological activity (Hinuma et al.; Roland, B., et al, "Anatomical distribution of prolactin-releasing peptide and its receptor suggests additional functions in the central nervous system and periphery," Endocrinology, 140:5736-5745, 1999) and in addition, they were acetyl ated at the N-terminus of the peptide chain to increase its stability, especially for the in vivo experiments. Biological activity was not dependent on the substitution of amino acids in positions before the C-terminal heptapeptide.
[0042] The analogues [Tyr31]PrRP20, [l-Nal31]PrRP20, [PheF5 31]PrRP20, [PheCl2 31]PrRP20
31
and [PheN02 ]PrRP20 bind to the pituitary cell line RC-4B/C which expresses the receptor GPR10 in the order of tens of thousands of binding sites per cell (Maixnerova et al., 2011) with Kb comparable to values for PrRP31 and PrRP20 (Maletinska et al., 2011). In addition, all the analogs increased phosphorylation of enzymes mitogen activated phosphorylase/ extracellular- regulated kinase (MAPK/ERK1/2) and the cAMP response element-binding protein (CREB), and stimulated the prolactin release into the medium with EC50 comparable to that of PrRP20 (Hinuma et al). These analogs of PrRP upon ICV administration in the dose of 10 nmol caused statistically significant reduction of food intake in fasted mice (Maletinska et al., 2011). These analogs, therefore, represent very potent anorexigenic peptides which lower food intake when centrally administered, however, not after peripheral administration such as, e.g, subcutaneous, SC, administration. [0043] Provided herein are analogs of the neuropeptides PrRP31 and PrRP20 lipidated by fatty acids (e.g. by myristoyl or palmitoyl) at the N-terminus of the peptide . The lipidated analogs can further possess modified amino acid compositions as described herein. Both types of neuropeptides with different chain length bound to the PrRP receptor with high affinity in in vitro conditions. The lipidated analogs of PrRP20 and PrRP31 significantly increased functionality. The effect was observed in experiments in vitro and in vivo. Advantageously, the lipidated analogs of PrRP20 and PrRP31 demonstrated increased functionality when
administered peripherally (e.g, subcutaneously, SC). In particular, peripheral (e.g,.
subcutaneous, SC) administration of lipidated analogs of PrRP20 and PrRP31 caused a statistically significant reduction of food intake in fasted mice. In fasted mice the lipidated analogs demonstrated a statistically significant dose-dependent reduction in food intake
(P<0.001) not only after central administration but also after peripheral administration (e.g., subcutaneous administration). Furthermore, the effect of lowering food intake was long-lasting and persisted for more than 10 hours after administration. Without being bound by theory, it is thought this is most likely due to increased resistance to degradation by proteases (e.g by introduction of fatty acid and/or noncoded amino acids), and to the binding of lipopeptide to serum albumin. Accordingly, lipidation of PrRP20 and PrRP31 presents a new alternative to deliver these peptides across the blood brain barrier after peripheral administration in order to lower food intake. Furthermore, the lipidated analogs did not induce secretion of prolactin after SC administration to mice and rats in any of the performed tests described herein.
Lipidated analogs of PrRP20 and PrRP31
[0044] Some embodiments disclosed herein include lipidated analogs that are lipidated peptides formed by 20 or 31 amino acids, with the sequence of IRPVGRF-NH2 at the C-terminus and lipidated with one or more fatty acids. In this sequence, isoleucine may be substituted by phenylglycine or alanine, and valine may be substituted by phenylglycine. The terminal phenylalanine may be replaced by an amino acid with a side chain containing CH2-Ar or CH2-S- CH2-Ar, where Ar represents phenyl or naphtyl, optionally substituted by a halogen or nitro group. The amino group on the N-terminal amino acid can be serine, diaminopropionic acid or threonine and the C6 to CI 8 fatty acid is bound by the amide bond. In some embodiments, amino acid substitutions can be made in the lipidated analog. For example, the methionine at position 8 in PrRP31 can be replaced by a norleucine, for example, to increase stability.
[0045] In some embodiments, the amino acids in positions before the C -terminal heptapeptide are not essential for the described biological activity of the lipidated analogs. Their substitution by a different amino acid or a slight reduction of the number is possible as long as the resulting lipidated peptide has the binding affinity to the PrRP receptor with K; in the order of 10"6 mol.l"1 or lower, (or even better 10 -"8 mol.l -"1 or lower), exhibits agonist activity towards PrRP (as determined by MAPK/ERK1/2 signaling in RC-4B/C cells) and the anorexigenic activity, tested by food intake in fasted mice after central and peripheral administration, equal as PrRP or higher.
[0046] In some embodiments, the lipidated analogs of PrRP20 or PrRP31 have the general formula
J1 -J2- rRPsGRt-NH2 (I)
wherein J1 represents a fatty acid C 6 to CI 8 bound by an amide bond to an amino group of a N- terminal amino acid, J represents a chain of 13 or 24 amino acids, r is chosen from isoleucine, alanine, or phenylglycine, s is chosen from valine or phenylglycine, t is chosen from
phenylalanine or an amino acid with a side chain containing CH2-Ar or CH2-S-CH2-Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group.
[0047] In additional embodiments, the lipidated analogs of PrRP20 or PrRP31 have the general formula
J!-k-J3- rRPsGRt-NH2 (II)
wherein J1 represents a fatty acid C 6 to CI 8 bound by an amide bond to an amino group of a N- terminal amino acid, k is chosen from serine, threonine or diaminopropionic acid, J represents a chain of 23 or 12 amino acids, r is chosen from isoleucine, alanine, or phenylglycine, s is chosen from valine or phenylglycine, t is chosen from phenylalanine or an amino acid with a side chain containing CH2-Ar or CH2-S-CH2-Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group.
[0048] Yet further embodiments relate to lipidated analogs of PrRP20 or PrRP31 that have the general formula
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III) wherein k is chosen from serine, threonine or diaminopropionic acid, m is chosen from threonine, alanine or methylalanine, n is chosen from glutamine or arginine, q is chosen from methionine or norleucine, u is chosen from threonine or isoleucine, o is chosen from glycine or serine, p is chosen from glycine, alanine, proline or N-methylglycine, r is chosen from isoleucine, alanine or phenylglycine, s is chosen from valine or phenylglycine, t is chosen from phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2-Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group, J1 represents a fatty acid C6 to CI 8 bound by the amide bond to the amino group of the N-terminal amino acid, where the chain of amino acids kRmHnHSqEuRTPDINPAWYmoRp is optionally shortened by eliminating from 1 to 10 amino acids. [0049] Additional embodiments relate to lipidated analogs of PrRP20 or PrRP31 that have the general formula
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III) wherein k is chosen from serine, threonine or diaminopropionic acid, m is chosen from threonine, alanine or methylalanine, n is chosen from glutamine or arginine, q is chosen from methionine or norleucine, u is chosen from threonine or isoleucine, o is chosen from glycine or serine, p is chosen from glycine, alanine, proline or N-methylglycine, r is chosen from isoleucine, alanine or phenylglycine, s is chosen from valine or phenylglycine, t is chosen from phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2-Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group, J1 represents a fatty acid C6 to CI 8 bound by the amide bond to the amino group of the N-terminal amino acid, where the chain of amino acids kRmHnHSqEuRTPDINPAWYmoRp is optionally shortened from its N-terminal by eliminating from 1 to 10 amino acids.
[0050] Further embodiments relate to lipidated analogs of PrRP20 or PrRP31 that have the general formula
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III), or
J1-TPDINPAWYmoRprRPsGRt-NH2 (IV)
wherein k is chosen from serine, threonine or diaminopropionic acid, m is chosen from threonine, alanine or methylalanine, n is chosen from glutamine or arginine, q is chosen from methionine or norleucine, u is chosen from threonine or isoleucine, o is chosen from glycine or serine, p is chosen from glycine, alanine, proline or N-methylglycine, r is chosen from isoleucine, alanine or phenylglycine, s is chosen from valine or phenylglycine, t is chosen from phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2-Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group, J1 represents a fatty acid C6 to CI 8 bound by the amide bond to the amino group of the N-terminal amino acid.
[0051] Additional embodiments disclosed herein relate to lipidated analogs of PrRP20 or PrRP31 described above where such substitutions of amino acids in positions 1-24 of formula III or in positions 1-13 of formula IV are performed that do not increase the binding affinity value of the resulting lipidated peptide to the receptor GPR10 over K; 10"6 mol.l"1, measured in the rat pituitary cell line RC-4B/C grown on 24-well plates, which had their bottom coated with polyethyleneimine, up to the optimal density of 300-450 thousand cells per well; then the following agents are added: binding buffer containing 20 mmol.l"1 HEPES, pH 7.4, 118 mmol.l" 1 NaCl, 4.7 mmol.l"1 KC1, 5 mmol.l"1 MgCl2, 5.5 mmol.l"1 glucose, 1 mg/ml bovine serum albumin, 0.1 mg/ml bovine pancreatic trypsin inhibitor; unlabelled analogs of PrRP of final concentration within 10"11 to 10"4 mol.l"1, and 125I-PrRP31 of final concentration of 10"10 mol.l"1; the plate is incubated for 60 minutes at room temperature and thereafter the cells are solubilized in 0.1 mo 1/1 solution of NaOH and the radioactivity bound to the cell is counted in the γ-counter.
[0052] Further embodiments relate to lipidated analogs of PrRP31 having the general formula
J1-SRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (V), wherein m is chosen from threonine, alanine or methylalanine, n is chosen from glutamine or arginine, q is chosen from methionine or norleucine, u is chosen from threonine or isoleucine, o is chosen from glycine or serine, p is chosen from glycine, alanine, proline or N-methylglycine, r is chosen from isoleucine, alanine or phenylglycine, s is chosen from valine or phenylglycine, t is chosen from phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S- CH2-Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group, J1 represents a fatty acid C6 to C18 bound by the amide bond to the amino group of the N-terminal amino acid.
[0053] In some embodiments, the lipidated analogs described herein (e.g, the lipidated analogs of formulas I, II, III, IV, and V) include a C-terminal amino acid selected from naphtylalanine, benzylcysteine, benzylhistidine, pentafluorophenyalanine, and nitrophenylalanine.
[0054] In additional embodiments, the lipidated analogs described herein (e.g, the lipidated analogs of formulas I, II, III, IV, and V) include a fatty acid is selected from a group that includes fatty acids of 6 to 18, and more preferably, of 13 to 18 carbon atoms. In some embodiments, the lipidated analogs described herein include a fatty acid of 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 carbon atoms.
[0055] Additional embodiments include lipidated analogs selected from the group which includes the following:
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(myr)TPDINPAWYmoRGrRPsGRF-NH2;
(palm)TPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(myr)TPDINPAWYmoRGrRPsGR 1-Nal-NH2; and (palm)TPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
where m is T or A and o is G or S, n is Q or R, r is I, A or phenylglycine, s is V or
phenylglycine, Dpr is diaminopropionic acid, 1-Nal is 1-naphtylalanine, Nle is norleucine, myr is myristoyl, palm is palmitoyl, oct is octanoyl, dodec is dodecanoyl, tridec is tridecanoyl. In the peptide positions 1 to 24, such substitutions in amino acids may be performed that do not increase the binding affinity value of the lipidated peptide to the receptor GPR10 over K; 10"6 mol.r1, and its anorectic activity evaluated by food intake test in fasted mice after both peripheral and central administration is equal or higher as compared to administered PrRP.
[0056] Further embodiments include lipidated analogs selected from the group that includes:
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(myr)TPDINPAWYmoRGIRPVGRF-NH2;
(palm)TPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(myr)TPDINPAWYmoRGIRPVGR 1-Nal-NH2; and
(palm)TPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
where m is T or A and o is G or S, n is Q or R, Dpr is diaminopropionic acid, 1-Nal is 1- naphtylalanine, Nle is norleucine, myr is myristoyl, palm is palmitoyl, oct is octanoyl, dodec is dodecanoyl, tridec is tridecanoyl. In the peptide positions 1 to 24, such substitutions in amino acids may be performed that do not increase the binding affinity value of the lipidated peptide to the receptor GPR10 over K; 10"6 mol.r1, and its anorexic activity evaluated by food intake test in fasted mice after both peripheral and central administration is equal or higher as compared to administered PrRP.
[0057] Some embodiments disclosed herein include lipidated analogs of PrRP20 or PrRP31 selected from the group that includes:
Ja-SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2,
Ja-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2,
(N-palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NHMe, (N-palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NOMe,
(N-myr)-TPDINPAWYTGRGIRPVGRF-NH2,
(N-myr)-TPDINPAWYASRGIRPVGRF-NH2,
(N-oct)-TPDINPAWYASRGIRPVGRF-NH2,
(N-dec)-TPDINPAWYASRGIRPVGRF-NH2,
(N-dodec)-TPDINPAWYASRGIRPVGRF-NH2,
J1 -SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2,
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2,
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheCl2-NH2,
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheN02-NH2,
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheF5-NH2,
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGRY-NH2,
Ja-SRAHRHS Nle EIRTPDINPAWYASRGIRPVGRY-NH2,
(N-myr)-Nle-ETRTPDINPAWYTGRGIRPVGRF-NH2,
(N-myr)-QHSMETRTPDINPAWYTGRGIRPVGRF-NH2,
(N-myr)-QHSMETRTPDINPAWYASRGIRPVGRF-NH2, and
(N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NOMe
where J1 is chosen from palmitic acid, myristic acid or stearic acid, and Ja is chosen from palmitic acid or myristic acid, whereinN-oct represents N-octanoic acid, N-dec represents N- decanoic acid, N-dodec represents N-dodecanoic acid, N-myr represents N-myristic acid, N- palm represents palmitic acid, wherein each above mentioned fatty acid is always bound by the amide bond to the amino group of the N-terminal amino acid; and wherein Nle represents norleucine, 1-Nal represents naftylalanine, and Me represents methyl.
[0058] Some embodiments disclosed herein include a lipidated analog of PrRP20 or PrRP31 or a modified PrRP20 or PrRP31 (e.g., a peptide with an amino acid substitution or reduction) selected from:
(Dpr) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(Dpr(oct)) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(Dpr(dodec)) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(Dpr(tridec)) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(Dpr(myr)) RAHQHS Nle ETRTPDINP A W YTGRGIRP VGRF -NH2 ;
(Dpr(palm)) RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2;
(Dpr) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2;
(Dpr(oct)) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2;
(Dpr(myr)) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2; (myr)TPDINPAWYTGRGIRPVGRF-NH2;
(Dpr) RTHRHS Nle EIRTPDINPAWYASRGIRPVGRF-NH2;
(Dpr(myr)) RTHRHS Nle EIRTPDINPAWYASRGIRPVGRF-NH2;
(myr)TPDINPAWYASRGIRPVGRF-NH2;
(N-oct) S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-dec) S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-dodec) S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-myr) S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-stear)S RAHQHS Nle ETRTPD INP A W YTGRGIRP VGRF -NH2 ;
(N-myr)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2;
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2;
(N-myr)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheCl2 -NH2;
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheCl2 -NH2;
(N-myr)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheN02-NH2;
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheN02-NH2;
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheF5 -NH2;
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR Tyr-NH2;
(N-myr)TPDF PAWYTGR Sar IRPVGRF-NH2;
(N-myr)TPDINPAWY N-Me-Ala SRGIRPVGRF-NH2;
(N-myr)TPDINPAWYTGRGARPFGRF-NH2;
(N-myr)TPDINPAWYASRPFRPVGRF-NH2;
(N-myr)Nle-ETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-myr)QHSMETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-oct)TPDINPAWYASRGIRPVGRF-NH2;
(N-dec)TPDINPAWYASRGIRPVGRF-NH2;
(N-dodec)TPDINPAWYASRGIRPVGRF-NH2;
(N-myr)TPDF PAWYASRGIRPVGRF-NH2;
(N-myr)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2;
(N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2;
(N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NHMe;
(N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NOMe;
(N-myr)SRAHQ HS METRTPD INP AW YTGRGIRP VGRF -NH2 ; and
(N-palm)SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2.
[0059] Further embodiments disclosed herein include a myristoylated analog selected from: (Dpr(myr)) RAHQHS Nle ETRTPDINP A W YTGRGIRP VGRF -NH2 ,
(Dpr(myr)) RAHQHS Nle ETRTPDINP AWYTGRGIRPVGR 1-Nal-NH2, and
(myr)S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
[0060] Additional embodiments disclosed herein include a palmitoylated analog selected from:
(Dpr(palm)) RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2, and
(palm)S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2,
[0061] Some embodiments include the stearoylated analog:
(stear)S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
[0062] Further embodiments disclosed herein include the myristoylated analog:
(myr)TPDINPAWYTGRGIRPVGRF-NH2
[0063] Additional embodiments disclosed herein include a lipidated analog selected from: (N-myr)TPDINPAWYASRGIRPVGRF-NH2 and
(N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
[0064] Some embodiments relate to the use of the lipidated analogs described herein (e.g, the lipidated analogs of formulas I, II, III, IV, and V) as anorexigenic agents which lower food intake after peripheral administration (e.g, subcutaneous administration).
[0065] Additional embodiments relate to the use of the lipidated analogs described herein (e.g, the lipidated analogs of formulas I, II, III, IV, and V) for the manufacturing of medication for the treatment of obesity.
Methods of Use
[0066] The methods described herein include administering to a subject in need a lipidated analog described herein (e.g., a pharmaceutical composition) containing a therapeutically effective amount of one or more lipidated analogs described herein. Without being bound by theory, the characteristics of the lipidated analogs described herein allow the analogs to be useful for preventing or treating obesity. A mammal can be identified as having or being likely to develop obesity using standard clinical techniques. For example, analysis of a human's family history or eating habits can be used to determine whether or not the human is likely to develop an obesity condition. As described herein, a mammal identified as having or being susceptible to developing an obesity condition can be treated by administering a lipidated analog disclosed herein.
Pharmaceutical Compositions, Routes of Administration, and Dosing
[0067] Provided herein, in certain embodiments, are pharmaceutical compositions comprising at least one lipidated analog as described herein.
[0068] Pharmaceutical compositions are typically formulated using one or more physiologically acceptable carriers including excipients and auxiliaries which facilitate processing of the therapeutic composition into preparations which are used pharmaceutically. Proper formulation is dependent upon the route of administration chosen. A summary of pharmaceutical compositions is found, for example, in Remington: The Science and Practice of Pharmacy, Nineteenth Ed (Easton, Pa.: Mack Publishing Company, 1995); Hoover, John E., Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pennsylvania 1975; Liberman, H.A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems, Seventh Ed. (Lippincott Williams & Wilkins, 1999).
[0069] Provided herein are pharmaceutical compositions that include one or more lipidated analogs described herein and one or more pharmaceutically acceptable diluent(s), excipient(s), or carrier(s). In addition, the lipidated analog is optionally administered as pharmaceutical compositions in which it is mixed with other active ingredients, as in combination therapy. In some embodiments, the pharmaceutical composition includes other medicinal or pharmaceutical agents, carriers, adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure, and/or buffers. In addition, the pharmaceutical compositions can also contain other therapeutically valuable substances.
[0070] A pharmaceutical composition, as used herein, refers to a mixture of a lipidated analog with one or more other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, and/or excipients. The pharmaceutical
composition facilitates administration of the lipidated analog to an organism. In practicing the methods of treatment or use provided herein, a lipidated analog is administered in a
pharmaceutical composition to a mammal having a condition, disease, or disorder to be treated. Preferably, the mammal is a human. The dose and dosing regimen varies depending on the severity and stage of the condition, the age and relative health of an individual, the potency of the therapeutic composition used and other factors. The lipidated analog is optionally used singly or in combination with one or more therapeutic agents as components of mixtures.
[0071] The pharmaceutical compositions described herein can be formulated, for example, as aqueous liquid dispersions, self-emulsifying dispersions, solid solutions, liposomal dispersions, aerosols, solid dosage forms, powders, immediate release formulations, controlled release formulations, fast melt formulations, tablets, capsules, pills, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate and controlled release formulations. The pharmaceutical formulations described herein are optionally administered to a individual by one or more administration routes, including but not limited to, parenteral (e.g., intravenous, subcutaneous, intramuscular, intrathecal), intracerebroventricular, intranasal, buccal, topical, rectal, oral, or transdermal administration routes. In some embodiments, the pharmaceutical formulations described herein are not centrally administered (e.g., administered directly to the central nervous system). In some embodiments, the pharmaceutical formulations described herein are peripherally administered (e.g., subcutaneously).
[0072] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.
EXAMPLES
[0073] The following specific and non-limiting examples are to be construed as merely illustrative, and do not limit the present disclosure in any way whatsoever. Without further elaboration, it is believed that one skilled in the art can, based on the description herein, utilize the present disclosure to its fullest extent.
[0074] The following abbreviations are used herein: analysis of variance (ANOVA); bovine serum albumin (BSA); bovine pancreatic trypsin inhibitor (BPTI); epidermal growth factor (EGF); 4-(2-hydroxyethyl)-l-piperazineethansulfonic acid (HEPES); phosphate buffer saline (PBS); sodium dodecyl sulfate (SDS); Tris-buffered saline (TBS); diaminopropionic acid (Dpr); 1-naphtylalanine (1-Nal); norleucine (Nle); myristoyl (myr); palmitoyl (palm); octanoyl (oct); dodecanoyl (dodec); and tridecanoyl (tridec).
Example 1: Synthesis of the PrRP peptides and PrRPanalogs
[0075] The peptides were synthesized using the method of solid phase synthesis according to Maixnerova et al. (Maixnerova, J., et al, "Structure-activity relationship of CART (cocaine- and amphetamine-regulated transcript) peptide fragments," Peptides, 28: 1945-1953, 2007) utilizing the Fmoc strategy on the ABI 433A synthesizer (Applied Biosystems, Foster City, CA, USA). Lipidation with the appropriate fatty acid was performed before cleaving the peptide off the resin as reported in Maletinska, L., et al., "Characterization of new stable ghrelin analogs with prolonged orexigenic potency," J Pharmacol Exp Ther, 340:781-786, 2012.
125
[0076] The peptide PrRP31 was iodinated with Na I using Iodo-Gen (Pierce, Rockford, IL, USA) according to the published procedure (Maixnerova et al, 2011). Monoiodinated peptide was stored in aliquots at -20 °C and was used up in binding assays within one month. [0077] Table 1 describes the structures of PrRP31, PrRP20, and analogs of PrRP31 and PrRP20 synthesized:
Table 1. Structures of PrRP31, PrRP20, and Hpidated analogs of PrRP31 and PrRP20
Rat PrRP31 and Hpidated PrRP31 analogs
PrRP31 SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2
1 (Dpr) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2
2 (Dpr(oct)) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2
3 (Dpr(dodec)) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2
4 (Dpr(tridec)) RAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2
5 (Dpr(myr)) RAHQHS Nle ETRTPDINP A W YTGRGIRP VGRF -NH2
6 (Dpr(palm)) RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
7 (Dpr) RAHQHS Nle ETRTPDINP AWYTGRGIRPVGR 1-Nal-NH2
8 (Dpr(oct)) RAHQHS Nle ETRTPDINP AWYTGRGIRPVGR 1-Nal-NH2
9 (Dpr(myr)) RAHQHS Nle ETRTPDINP AWYTGRGIRPVGR 1-Nal-NH2
Rat PrRP20 and Hpidated PrRP20 analog
Analog Sequence
no.
PrRP20 TPDINPAWYTGRGIRPVGRF-NH2
10 (myr)TPDINPAWYTGRGIRPVGRF-NH2
Human PrRP31 Hpidated PrRP31 and PrRP20 analogs:
Analog Sequence
no.
hPrRP31 SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
11 (Dpr) RTHRHS Nle EIRTPDINPAWYASRGIRPVGRF-NH2
12 (Dpr(myr)) RTHRHS Nle EIRTPDINPAWYASRGIRPVGRF-NH2
13 (myr)TPDINPAWYASRGIRPVGRF-NH2
Other rat and human PrRP peptides and Hpidated PrRP31 and PrRP20 analogs tested:
Analog Sequence
no.
14 S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
15 (N-oct) S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
16 (N-dec) S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
17 (N-dodec) S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
18 (N-myr) S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
19 (N-palm)S RAHQHS Nle ETRTPDINP AW YTGRGIRP VGRF -NH2
20 (N-stear)S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGRF-NH2
21 S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGR 1-Nal-NH2
22 (N-myr)S RAHQHS Nle ETRTPDINP AWYTGRGIRPVGR 1-Nal-NH2 (N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2
S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheCl2 -NH2
(N-myr)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheCl2 - NH2
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheCl2 -NH2
S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheN02-NH2
(N-myr)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheN02 -NH2
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheNO 2-NH2
SHQRPADTHWYPRG Nle FPTIGRITARNGEVSR
(N-myr)SHQRPADTHWYPRG Nle FPTIGRITARNGEVSR
S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheF5 -NH2
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheF5 - NH2
S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR Tyr-NH2
(N-palm)S RAHQHS Nle ETRTPDINPAWYTGRGIRPVGR Tyr-NH2 f r GVPRIGRGTYWAPNIDPT-NH2
(N-myr)f r GVPRIGRGTYWAPNIDPT-NH2
TPDINPAWYTGR Sar IRPVGRF-NH2
(N-myr)TPDINPAWYTGR Sar IRPVGRF-NH2
TPDINPAWY N-Me-Ala SRGIRPVGRF-NH2
(N-myr)TPDINPAWY N-Me-Ala SRGIRPVGRF-NH2
TPDINPAWYTGRGARPFGRF-NH2
(N-myr)TPDINPAWYTGRGARPFGRF-NH2
TPDINPAWYASRPFRPVGRF-NH2
(N-myr)TPDINPAWYASRPFRPVGRF-NH2
Nle-ETRTPDINPAWYTGRGIRPVGRF-NH2
(N-myr)Nle-ETRTPDINPAWYTGRGIRPVGRF-NH2
QHSMETRTPDINPAWYTGRGIRPVGRF-NH2
(N-myr)QHSMETRTPDINPAWYTGRGIRPVGRF-NH2
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
TPDINPAWYASRGIRPVGRF-NH2
(N-oct)TPDINPAWYASRGIRPVGRF-NH2
(N-dec)TPDINPAWYASRGIRPVGRF-NH2
(N-dodec)TPDINPAWYASRGIRPVGRF-NH2
(N-myr)TPDINPAWYASRGIRPVGRF-NH2
(N-myr)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 57 (N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
58 (N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NHMe
59 (N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NOMe
60 (N-myr)SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2
61 (N-palm)SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2
Example 2: Competitive binding experiments
[0078] Competitive binding experiments were performed according to Motulsky and Neubig (Motulsky, A., et al, "Analyzing radioligand binding data," Curr Protoc Neurosci, Chapter 7, Unit 7.5, 2002).
[0079] Binding experiments were conducted with rat pituitary cells and CHO cells as follows:
[0080] The rat pituitary cell line RC-4B/C (ATCC, Manassas, USA) was grown on 24-well plates which had their bottom coated with polyethyleneimine. The cells were grown to the optimal density of 300-450 thousand per well. The following agents were used for the experiment: binding buffer (20 mmol.l"1 HEPES, pH 7.4; 118 mmol.l"1 NaCl, 4.7 mmol.l"1 KCl, 5 mmol. 1 MgCl2, 5.5 mmol.l" 1 glucose, 1 mg/ml BSA, 0.1 mg/ml BPTI), unlabelled analogs of PrRP of final concentration within 10"11 to 10"4 mol.l"1, and rat 125I-PrRP31 of final concentration of 10"10 mol.l"1 (Maixnerova et al, 2011).
[0081] CHO cells with transfected human PrRP receptor, GPR10 (Perkin Elmer, USA) were grown on 24-well plates coated with polyethyleneimine. The cells were grown to the optimal density of 40-80 thousand cells per well. The following agents were used for the experiment: binding buffer (25 mmol.l"1 Tris, pH 7.4; 118 mmol.l"1 NaCl, 10 mmol.l"1 MgCl2, 1 mmol.l"1 CaCl2, 5.5 mmol.l"1 glucose, 0.5 mg/ml BSA), unlabelled analogs of PrRP of final concentration within 10"11 to 10"4 mol.l"1, and human 125I-PrRP31 of final concentration of 5xl0"u mol.l"1.
[0082] Plates were incubated for 60 minutes at room temperature. After incubation, the cells were solubilized in 0.1 mo 1/1 solution of NaOH and the radioactivity bound to the cells was counted using a γ-counter. The experiments were performed in duplicate and repeated at least three times.
[0083] All the tested rat and human PrRP analogs (for structures, see Table 1), the lipidated peptides, bound with high affinity to the rat receptor in RC-4B/C cells (Table 2, 5) and the human receptor GPR10 in CHO cells (Table 5) (on the order of nmol.l"1). With the lengthening of the fatty acid chain, the value of K; decreased, indicating the affinity was stronger with the lipidated PrRP analogs, up to an order of magnitude as compared to the original unlipidated peptide (see Table 2, 5). [0084] The results indicate the lipidation of the tested peptides led to the increase in receptor binding and the lipidated analogs lowered the Ki in binding to rat RC-4B/C cells and human GPR10 receptor in correlation with the chain length of the fatty acid present on the lipidated analog. The addition of fatty acid not only preserved receptor binding (as a result of N-terminal lipidation, whereas the receptor binding depends on the C-terminal RF-amide), it increased the binding affinity by up to an order of magnitude.
[0085] Human lipidated PrRP analogs (for structures, see Table 1 , analog nos: 1 1-13) displaced
125
to a similar extent the binding of both the rat and human I-PrRP to the RC-4B/C cells with the rat PrRP receptor and human GPR10 receptor in the nmol.l Vange (see Table 3). Lipidized shortened PrRP31 analogs (21-30 amino acids, C-terminal heptapeptide preserved) showed binding afmities similar to both native forms of PrRP.
[0086] For evaluation of competitive binding experiments, the program Graph Pad Prism Software (San Diego, CA, USA) was used. A method of nonlinear regression assuming one-site binding was used. The value of Kt was calculated using the equation of Cheng and Prussof (Cheng, Y., et al., "Relationship between the inhibition constant (Kl) and the concentration of inhibitor which causes 50 percent inhibition (150) of an enzymatic reaction," Biochem
Pharmacol, 22:33099-3108, 1973), using the value of Kd 4.21 nmol.l"1 and concentration of radioligand was 0.1 nmol.l"1 (Maixnerova et al., 201 1).
Example 3: Cellular signaling.
[0087] RC-4B/C cells, which were used to determine if lipidated PrRP20 analogs are able to initiate the MAPK/ER l/2 signaling pathway, were grown in 6-well plates up to the optimal density of 700-900 cells per well. Seventeen hours before sample harvest, the growth medium was replaced by a serum-free medium lacking epidermal growth factor (EGF). The respective lipidated PrRP analog was added to each well in the final concentration of 10"6 mol.l"1. After a 5 minute incubation at 37 °C, the plate was placed on ice and each well was rinsed three times with PBS pH 7.4 (137 mmol.l"1 NaCl, 2.7 mmol.l"1 KC1, 8 mmol.l"1 Na2HP04.2H20 a 1.76 mmol.r1 KH2P04) and cooled to 4 °C. The cells were then solubilized in a sample buffer (62.5 mmol.l"1 Tris-HCl pH 6.8, 10% glycerol, 2% SDS, 0.01% bromophenol blue, 5%
merkaptoethanol, 50 mmol.l"1 NaF and 1 mmol.l"1 Na3V04), and collected into microtubes and frozen at -20 °C. Samples were collected in at least three independent experiments.
[0088] To determine if the lipidated PrRP20 analogs initiated the MAPK/ERKl/2 signaling pathway, Western blot analysis was used. Electrophoresis was performed on 5%> / 12%> polyacrylamide gel in the presence of SDS (SDS-PAGE) on the instrument MiniProtean 3 (BioRad, Herkules, CA, USA). Samples that were loaded on the gel were first disintegrated by ultrasound, then heated at 100 °C for 2 minutes, and centrifuged for 5 minutes at 500 x g at room temperature. PrRP20, which was shown to initiate MAPK/ERKl/2 signaling (Maixnerova et al., 2011), was used as a positive control. Electrophoresis was performed at a constant voltage of 100 V for 10 minutes, or for 60 minutes at 150 V.
[0089] To show the presence of phosphorylated proteins in the samples, the proteins from the SDS-PAGE gel were transferred to the Immobilon™-P PVDF (polyvinylidene difluoride) membrane (Sigma-Aldrich, USA). The transfer was performed in blotting buffer at pH 8.3 (25 mmol.r1 Tris, 192 mmol.l"1 glycine and 20% methanol) for 20 hours at 4 °C at a constant voltage of 30 V.
[0090] After the protein transfer to the PVDF membrane, the membranes were washed for 5 minutes in TBS washing buffer (20 mmol.l"1 Tris, 140 mmol.l"1 NaCl and 0.1% Tween-20) and then incubated for 1 hour in blocking buffer (TBS with 5% non-fat milk powder and 5 mmol.l"1 Na3V04 and 50 mmol.l"1 NaF) at room temperature. Further, the membranes were washed three times for 5 minutes using the TBS washing buffer. The membranes were then incubated with the primary antibody against phospho-p44/42 MAPK(Thr202/Tyr204) (Cell Signaling Technology, Beverly, USA) which was diluted in blocking buffer at 1 : 1000. After the next three washes with the TBS washing buffer for 5 minutes, the membranes were incubated for 1 hour with rabbit secondary antibody labeled with peroxidase (Sigma, St. Louis, USA) which was diluted in blocking buffer at 1 : 12,000.
[0091] The membranes were then washed three times in TBS washing buffer for 5 minutes and then the solution Femto (Pierce SuperSignal, Thermo Fisher Scientific, Rockford, IL, USA) was applied. The induced chemiluminiscence was detected by a CCD camera (LAS 3000, Fuji Photo Film GmBH, Dusseldorf, Germany).
[0092] To assess the initiation of signaling pathways, a densitometric analysis using the program Quantity One (BioRad, Hercules, CA, USA) was used. For statistical evaluation of the statistically significant response of the cellular signaling, one-way ANOVA with subsequent Dunnett post-hoc test was used. Data was statistically significant at P<0.05.
[0093] The results of the MAPK/ERKl/2 signaling analysis are shown in Table 2. Table 2
The affinity of lipidated peptidic analogs of the rat PrRP31 and PrRP20 to the rat receptor, and biological activity in RC-4B/C cells.
Analog mI-rat PrRP31 ER signaling
Ki (nM) % of PrRP31
binding
PrRP31 4.93 ± 0.61 100 agonist
1 3.74 ± 0.29 132 agonist
2 2.86 ± 0.17 172 agonist
3 1.12 ± 0.12 440 agonist
4 0.51 ± 0.03 967 agonist
5 0.82 ± 0.13 601 agonist
6 0.46 ± 0.06 1072 agonist
7 60.07 ± 2.10 8 agonist
8 39.24 ± 2.71 13 agonist
9 2.95 ± 0.62 167 agonist
PrRP20 3.44 ± 0.85 143 agonist
10 0.78 ± 0.45 632 agonist
[0094] All of the tested lipidated peptides displayed a positive result for signaling in RC-4B/C cells which was comparable or higher to the effect of PrRP31. All of the lipidated peptides were therefore agonists in vitro.
Table 3.
Affinity of lipidated analogs of rat and human PrRP to the rat receptor in RC-4B/C cells
Analog mI-rat PrRP31 mI-human PrRP31
Ki (nM) Ki (nM)
hPrRP31 1.54 ± 0,42 3.01 ± 0.70
11 2.28 ± 1.30 2.00 ± 1.26
12 4.13 ± 2.57 3.16 ± 0.83
13 0.41 ± 0.13 0.66 ± 0.14
[0095] Table 2 and 3: The values of the inhibition constant K; were calculated from IC50 using Cheng and Prusoff s equation (for ¾ the value 4.21 nmol.l"1 found in the saturation binding experiments was used and the concentration of the radioligand was 0.1 nmol.l^with relevant values of S.E.M. [0096] Example 4. Test of food intake after SC or ICV administration of lipidated PrRP analogs
[0097] Male C57BL/6 mice (An Lab, Prague 4) were bred in the accredited animal facility in the Institute of Organic Chemistry and Biochemistry, Czech Academy of Sciences, Prague, at the Institute of Molecular Genetics, Prague 4, at the temperature of 22 ± 2°C with access to food and water ad libitum. The day/night cycle was 12/12 hours (light turned on at 6:00 am). Animals were treated according to the Animal Protection Act (Act No.246/1992). The males were fed standard chow diet St-1 (Mlyn Kocanda, Praha, Czech Republic) which contained 66% saccharides, 25% proteins and 9% lipids with a caloric value of 3.4 kcal/g.
[0098] The food was withdrawn 17 hours prior to injection of lipidated peptide and free access to water was maintained. The administration of saline, PrRP or lipidated analogs was performed either by SC injection at doses of 1-10 mg/kg (volume 0.2 ml/mouse), or by ICV using infusion pump (cannulae were inserted into the third brain ventricle 4 days before the experiment following the procedure of Maixnerova et al. (Maixnerova et al., 2011)). The single dose of peptide was 4 nmol/mouse (5 μΐ/mouse).
[0099] Fifteen minutes after the lipidated peptide administration, the mice were given pre- weighed food. The food was then weighed every 30 minutes for 5-10 hours. The administration of every dose was performed at least twice and one group of mice consisted of at least 6 mice. The results were presented as % of food intake as compared with the control group injected with saline.
[00100] Statistical evaluation was performed using program Graph-Pad Prism Software
(San Diego, CA, USA), and the one-way ANOVA with a subsequent Dunnettovym post-hoc test. The difference in food intake between mice injected with saline and mice injected with the examined peptide were considered statistically significant at P<0.05.
[00101] The results are summarized in Table 4 and 5 and Figures 1-6.
Table 4. Biological activity of lipidated peptides - rat PrRP analogs in vivo
Figure imgf000029_0001
5 0.05 25 0.18 21 0.35 62 0.96 73
6 0 0 0.14 14 0.38 71 1.3 100
7 0.16 49 0.88 81 NT
8 0.17 76 0.78 90 0.34 60 1.05 79
9 0.01 2 0.22 25 0.28 51 1.03 78
PrRP20 0.32 100 1.1 100 0.32 68 1.29 100
10 0.11 32 44 44 0.28 51 1.1 86
[00102] The food intake was evaluated at 300 minutes after administration of the compound. At 45 minutes after administration, the effect was at the maximum. Compounds 1, 2, 5, 7, 9 were administered at the dose of 10 mg/kg, and compounds 3, 4, 6, 10 were administered at the dose of 5 mg/kg (SC administration). NT indicates not tested.
Table 5
Competitive binding to rat RC-4B/C cells and CHO cells with transfected human GPR10 receptor and food intake in fasted C57BL/6 mice (5 mg/kg SC)
Figure imgf000030_0001
Figure imgf000031_0001
Figure imgf000032_0001
[00103] Lipidated analogs of PrRP31 and PrRP20 lowered food intake in fasted mice after ICV administration to a comparable degree as PrRP31 (Figure 1) but the effect was prolonged (see, e.g., Figure 2). The effect of lipidated analogs of PrRP after ICV administration was not dependent on the length or presence of the fatty acid.
[00104] Lipidated analogs of the rat PrRP31 and PrRP20 with bound myristic or palmitic acid (Figure 3) significantly lowered (and for a prolonged period of time) the food intake in fasted mice after SC administration. The analog with tridecanoic acid partially lowered the food intake, however. The analogs lacking fatty acid or containing octanoyl or dodecanoyl had no effect or did not significantly lower food intake. This was most likely caused by a poor penetration through the hematocephalic barrier.
[00105] Myristoylated analogs of human PrRP31 and PrRP20 significantly lowered food intake in fasted mice, comparable to the effect of corresponding rat analogs (Figure 4). The lowering of food intake in mice after SC administration of the lipidated PrRP analogs was dose dependent (Figure 5 demonstrates the effect of compound 5 and Figure 6, the effect of compound 9). Doses of 2-10 mg/kg significantly lowered food intake.
Example 5. Fos Immunohistochemistry
Tissue Processing
[00106] For Fos immunohistochemical processing, overnight fasted mice (n=5
mice/group) were treated SC with saline,
Figure imgf000032_0002
l or [Dpr(palm)1]PrRP31 (dose 5mg/kg). Ninety minutes after SC injection, the mice were deeply anesthetized with pentobarbital (50 mg/kg, IP) and perfused transcardially with 0.1 M phosphate buffer (PB, pH 7.4) containing 4 % paraformaldehyde, 0.1 % glutaraldehyde, and 10 % picric acid (w/w). Then the brains were removed, postfixed in the same fixative overnight at 4 °C, and infiltrated with 30 % sucrose in 0.1 M PB for 48 h at 4 °C. Before sectioning, the brains were rapidly (20 sec) frozen in cold isopentane (-30/-40 °C) and placed into a Reichert cryocut device adjusted to -16 °C for 1 h. 30 um coronal sections were cut from the brains and collected as free floating in cold (4°C) PB.
Immunohistochemistry
[00107] Free floating sections were repeatedly washed in cold PB followed by
preincubation in 3 % Η202 for 40 min at room temperature. They were incubated with polyclonal Fos protein antiserum (1 :2000), diluted in 0.1 M PB containing 4 % normal goat serum (Gibco, Grand Island, NY, USA), 0.5 % Triton X-100 (Koch-Light Lab. Ltd., Colnbrook, Berks, England), and 0.1 % sodium azide for 48 h at 4 °C. After several rinses in PB, the sections were incubated with biotinylated goat-anti-rabbit IgG (1 :500, VectorStain Elite ABC, Vector Lab., Burlingame, CA, USA) for 90 min at room temperature. Next PB rinses were followed by incubation with the avidin-biotin peroxidase complex (1 :250) for 90 min at room temperature. PB washing was followed by washing in 0.05 M sodium acetate buffer (SAB, pH 6.0). The Fos antigenic sites were visualized with 0.0266 % 3,3'-diaminobenzidine
tetrahydrochloride (DAB) dissolved in SAB containing 0.0042 % H202 and 2.5 % nickel ammonium sulfate, for 7 min. The metal-intensification of DAB produced black staining in the labeled nuclei. Finally, the sections were rinsed in 0.05 M SAB, mounted into 0.1 % of gelatine dissolved in 0.0125 M SAB, air-dried and coverslipped with Permount (Sigma, St. Louis, MO, USA). Immunostaining of negative controls, which did not show any antiserum
immunolabeling, included substitution of the primary antiserum with normal rabbit serum, and sequential elimination of the primary or secondary antibody from the staining series.
Evaluation of the immunostaining
[00108] An identical set of mice was used for determination of Fos immunoreactivity in
NTS, PVN, and Arc. Counting of Fos immunoreactive cells within the NTS, from Bregma -7.48 mm to Bregma -7.32 mm, PVN, from Bregma -0.7 mm to -0.94 mm, and DMH, from Bregma - 1.46 mm to - 1.82 mm according to the mouse brain atlas (Franklin KBJ, Paxinos G: The mouse brain in stereotaxic coordinates. New York: Academic Press; 1997), was performed separately in each side of the sections. Quantitative assessment was performed from the images captured with a Canon digital camera (PowerShot S40) and Leica DMLS light microscope in a computer screen obtained from 5-6 brain sections per animal. Representative sections were captured by the same computerized system. The counting of Fos-positive neurons was done under blinded conditions (the counted slides from each animal were analyzed independently and randomly and encoded by other person).
[00109] Results are shown in Fig. 7. Neural activity presented in Fos immunoreactivity was significantly increased in a case of [Dp^myr^JPrRPS l and [Dpr(palm)1]PrRP31 analogs in all brain nuclei involved in food intake regulation tested (i.e. Arc, PVN and NTS). These two analogs also significantly decreased food intake.
Example 6. Open field locomotor activity and hot-plate analgesic test
[00110] Locomotor activity was measured using the VideoMot system (TSE Systems,
Bad Homburg, Germany). Ad libitum fed mice were placed individually in the open field (lxl m) and their locomotor activity, total distance traveled, was measured for 10 min. Mice were administered with SC injection of saline, [Dpr^PrRPS l, [Dpr(palm)1]PrRP31 or myr-PrRP20
(dose 5 mg/kg, n=5 mice/group). [00111] Analgesia was measured by a hot-plate analgesia meter (TSE Systems, Bad
Homburg, Germany) set at 53°C after completion of the locomotor activity test. The end-point was the latency to jump, after which the animals were immediately removed from the plate.
[00112] Results of behavioral tests in mice are described in Fig. 8. Administration of lipidized PrRP analogs caused mild sedative effect similar as an effect accompanying satiety induced by, for example, cholecystokinin. PrRP analogs also showed some analgesic effect. Example 7. 14-day administration of lipopeptides in model of diet-induced (DIO) mice
[00113] Inbred C57BL/6 male mice (AnLab, Prague, Czech Republic) were housed at a temperature of 23°C under a daily cycle of 12 hours light and dark (light from 6:00 a.m.) with free access to water and food pellets (St- 1 , Mlyn Kocanda, Jesenice, Czech Republic).
[00114] At 8 weeks of age, mice were divided into a standard (St) diet-fed group (the energy content of the St-1 diet was 3.4 kcal/g, containing 25, 9, and 66% of calories from protein, fat, and carbohydrate, respectively (St-1, Mlyn Kocanda, Jesenice, Czech Republic)) and a high fat (HF) diet-fed group (the energy content of the HF diet was 5.3 kcal/g, containing 13, 60, and 27% of calories from protein, fat, and carbohydrate, respectively). The HF diet consisted of 40%> standard St-1 diet, 34% powdered cow milk for human neonates, 25% lard, and 1%) corn starch w/w (Kopecky, J., et al, "Reduction of dietary obesity in aP2-Ucp transgenic mice: physiology and adipose tissue distribution," Am J Physiol, 270:E768-75, 1996). Food intake and body weight were monitored weekly from 9 to 20 weeks of age. Mice resistant to the HF diet were withdrawn from the experiment (approximately 10% of mice).
[00115] At the age of 20 weeks, mice were placed into separate cages with free access to food and water. The following week, mice were subjected to a 14-day food intake experiment. They were injected with palm-PrRP31 or myr-PrRP20 dissolved in saline at doses of 5 mg/kg (n=10) or saline twice a day (at 8:00 and 18:00) for 14 days. Consumption of the St or HF diet and the weight of the mice were simultaneously followed.
[00116] After 14 days of treatment, mice were fasted overnight and sacrificed the following morning. Their blood sera were isolated, and the white adipose tissue (subcutaneous, abdominal, and gonadal), and the liver of all mice were dissected, weighed, and stored at -70°C. Fat to body weight ratio was calculated as a ratio of adipose tissue weight to body weight.
Determination of hormonal and biochemical parameters
[00117] Serum insulin and leptin concentrations were measured by RIA assays. Serum glucose levels were measured using a Glucocard glucometer (Arkray, Kyoto, Japan). Serum triglyceride levels were measured by quantitative enzymatic reactions (Sigma, St. Louis, USA). Statistical analysis [00118] The data are presented as means ± SEM for the number of animals indicated in the Figures and Tables. They were analyzed by a one-way ANOVA followed by a Dunnett post- hoc test (metabolic parameters, behavioral study) or two-way ANOVA followed by a Bonferroni post-hoc test (body weight evaluation) using Graph-Pad Software (San Diego, CA, USA). P < 0.05 was considered statistically significant.
[00119] Results of long-term administration of myr-PrRP20 and palm-PrRP31 into DIO mice are shown in Fig. 9 (body weight change) and Table 6 (metabolic parameters). Body weight of DIO mice significantly decreased both after myr-PrRP20 and palm-PrRP31 treatment. Fat/body weight, liver weight, leptin and insulin were also significantly lowered, especially after palm-PrRP31 administration.
Table 6
Metabolic parameters after 14-days SC administration of lipidized PrRP analogs in 17h fasted DIO male mice
Treatment Fat/body weight Liver/body Leptin Glucose Insulin Triglycerides weight
[%] [%] [ng/ml] [mmol/1] [ng/ml] [mg/dl]
Saline 16.15 ± 0.40 4.07 ± 53.26 ± 6.94 ± 4.09 ± 72.25 ± 3.20
0.19 3.49 0.28 0.55
Myr-PrRP20 15.30 ± 0.42 3.60 ± 39.56 ± 7.52 ± 3.54 ± 68.71 ± 4.16
0.18* 0.16 0.47
Palm-PrRP31 12.69 ± 0.71 *** 3.56 ± 24.71 ± 7.26 ± 2.37 ± 66.81 ± 8.74
0.07** 3 39*** 0.29 0.47**
All values are expressed as mean±SEM (n=10 per group).
Significance (one-way ANOVA following by Dunnett post-hoc test) is *P<0.05, **P<0.01, *** PO.001 vs saline.
Example 8: Test of food intake after administration of analog no. 55 to Rhesus monkeys
[00120] Food intake (amount of pellets consumed) was measured in Rhesus monkey
(n=4) after a single subcutaneous administration of myristoylated human PrRP20 (analog no. 55).
[00121] The study was conducted on overnight fasted animals in Meditox breeding facility (Konarovice, Czech Republic). Each animal received a subcutaneous injection of saline, or of analog 55 in a dose of 1.0 mg/kg or 2.0 mg/kg. Test item formulation was prepared in saline solution as a fresh solution, just before dosing. [00122] All of the animals were observed for clinical signs, morbidity or mortality once a day during acclimatisation and frequently after the administration. Food intake monitoring was performed 2, 4, 8 and 24 hours after single administration.
[00123] All of the animals were in good health throughout the acclimatisation, treatment period, no clinical symptoms of toxicity were observed after the administration of analog 55. Significantly lower food intake after both injected doses of the peptide in comparison to the saline-treated animals was observed between 1-6 hours after the single subcutaneous administration of analog 55.
[00124] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.

Claims

CLAIMS WHAT IS CLAIMED IS :
1. A lipidated analog of prolactin-releasing peptide having a general formula:
J!-J2- rRPsGRt-NH2 (I), wherein
J1 represents a fatty acid C6 to CI 8 bound by an amide bond to an amino group of a N- terminal amino acid;
J represents a chain of 13 or 24 amino acids;
r is isoleucine, alanine, or phenylglycine;
s is valine or phenylglycine; and
t is phenylalanine or an amino acid with a side chain containing CH2-Ar or CH2-S-CH2- Ar, wherein Ar represents phenyl or naphtyl, optionally substituted by a halogen or nitro group.
2. A lipidated analog of prolactin-releasing peptide according to claim 1 , having a general formula:
J!-k-J3- rRPsGRt-NH2 (II), wherein
J1 represents a fatty acid C6 to C 18 bound by an amide bond to an amino group of a N- terminal amino acid;
k is chosen from serine, threonine or diaminopropionic acid;
J3 represents a chain of 23 or 12 amino acids;
r is isoleucine, alanine, or phenylglycine;
s is valine or phenylglycine; and
t is phenylalanine or an amino acid with a side chain containing CH2-Ar or CH2-S-CH2- Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group.
3. A lipidated analog of prolactin-releasing peptide according to claim 1 or 2, having a general formula:
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III), wherein
k is serine, threonine or diaminopropionic acid;
m is chosen from threonine, alanine or methylalanine;
n is glutamine or arginine;
q is methionine or norleucine;
u is threonine or isoleucine;
o is glycine or serine;
p is glycine, alanine, proline or N-methylglycine;
r is isoleucine, alanine or phenylglycine;
s is valine or phenylglycine; t is phenylalanine or an amino acid with a side chain containing CH2-Ar or CH2-S-CH2- Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and
J1 represents a fatty acid C6 to CI 8 bound by the amide bond to the amino group of the N-terminal amino acid, wherein the chain of amino acids kRmHnHSqEuRTPDlNPAWYmoRp is optionally shortened by eliminating from 1 to 10 amino acids.
4. A lipidated analog of prolactin-releasing peptide according to claim 1 or 2, having a general formula
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III), wherein
k is serine, threonine or diaminopropionic acid;
m is threonine, alanine or methylalanine;
n is glutamine or arginine;
q is methionine or norleucine;
u is threonine or isoleucine;
o is glycine or serine;
p is glycine, alanine, proline or N-methylglycine;
r is isoleucine, alanine or phenylglycine;
s is valine or phenylglycine;
t is phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2- Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and J1 represents a fatty acid C6 to C 18 bound by the amide bond to the amino group of the N-terminal amino acid, where the chain of amino acids kRmHnHSqEuRTPDlNPAWYmoRp is optionally shortened from its N-terminus by eliminating from 1 to 10 amino acids.
5. A lipidated analog of prolactin-releasing peptide according to claim 1 or 2, chosen from the group containing peptides of formula
J1-kRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (III), or
J1-TPDINPAWYmoRprRPsGRt-NH2 (IV), wherein
k is serine, threonine or diaminopropionic acid;
m is threonine, alanine or methylalanine;
n is glutamine or arginine;
q is methionine or norleucine;
u is threonine or isoleucine;
o is glycine or serine;
p is glycine, alanine, proline or N-methylglycine;
r is isoleucine, alanine or phenylglycine;
s is valine or phenylglycine; t is phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2- Ar, where Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and
J1 represents a fatty acid C6 to CI 8 bound by the amide bond to the amino group of the N-terminal amino acid.
6. A lipidated analog of prolactin-releasing peptide according to claim 5,
where such substitutions of amino acids in positions 1-24 of formula III or in positions 1- 13 of formula IV are performed that do not increase the binding affinity value of the resulting lipidated peptide to the receptor GPR10 over K; 10"6 mol.l"1, measured in the rat hypophyseal cell line RC-4B/C grown on 24-well plates, which had their bottom coated with
polyethyleneimine, up to the optimal density of 300-450 thousand per well; then the following agents are added: binding buffer containing 20 mmol.l"1 HEPES, pH 7.4, 118 mmol.l"1 NaCl, 4.7 mmol.l"1 KC1, 5 mmol.l"1 MgCl2, 5.5 mmol.l"1 glucose, 1 mg/ml bovine serum albumin, 0.1 mg/ml bovine pancreatic trypsin inhibitor; unlabelled analogs of PrRP of final concentration within 10"11 to 10"4 mol.l"1, and 125I-PrRP31 of final concentration of 10"10 mol.l"1; the plate is incubated for 60 minutes at room temperature and thereafter the cells are solubilized in 0.1 mol/1 solution of NaOH and the radioactivity bound to the cell is counted in the γ-counter.
7. A lipidated analog of of prolactin-releasing peptide according to any of claims 1, 2, 5, 6, chosen from the group containing peptides of formula
J1-SRmHnHSqEuRTPDINPAWYmoRprRPsGRt-NH2 (V), wherein
m is threonine, alanine or methylalanine;
n is glutamine or arginine;
q is methionine or norleucine;
u is threonine or isoleucine;
o is glycine or serine;
p is glycine, alanine, proline or N-methylglycine;
r is isoleucine, alanine or phenylglycine, s is chosen from valine or phenylglycine;
t is phenylalanine or an amino acid with side chain containing CH2-Ar or CH2-S-CH2-Ar, where
Ar represents phenyl or naphtyl, optionally substituted by halogen or nitro group; and
J1 represents a fatty acid C6 to CI 8 bound by an amide bond to the amino group of the N- terminal amino acid.
8. A lipidated analog of prolactin-releasing peptide according to any of the preceding claims, wherein the C-terminal amino acid is naphtylalanine, benzylcystein, benzylhistidine, pentafluorophenylalanine, or nitrophenyalanine.
9. A lipidated analog of prolactin-releasing peptide according to any of the preceding claims, wherein the fatty acid is selected from the group consisting of fatty acids with 6 to 18 carbons and fatty acids with 13 to 18 carbon atoms.
10. A lipidated analog of prolactin-releasing peptide according to claim 1 selected from the group consisting of:
Dpr(oct))RmHnHSNleETRTPDI PAWYmoRGrRPsGRF-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGrRPsGRF-NH2;
(myr)TPDI PAWYmoRGrRPsGRF-NH2;
(palm)TPDI PAWYmoRGrRPsGRF-NH2;
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(dodec))RmHnHSNleETRTPDINP AWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(myr))RmHnHSNleETRTPDINP AWYmoRGrRPsGR 1 -Nal-NH2;
(Dpr(palm))RmHnHSNleETRTPDI P AWYmoRGrRPsGR 1 -Nal-NH2;
(myr)TPDI P AWYmoRGrRPsGR 1-Nal-NH2; and
(palm)TPDINP AWYmoRGrRPsGR 1 -Nal-NH2;
wherein m is T or A;o is G or S; n is Q or R; r is I, A or phenylglycine; s is V or phenylglycine, and wherein at the peptide positions 1 to 24, such substitutions of amino acids may be performed that do not increase the binding affinity value of the resulting lipidated peptide to the receptor GPR10 over K; 10"6 moll"1, and its anorexic activity evaluated by the food intake test in fasted mice after both peripheral and central administration is equal or higher as compared to administered PrRP.
11. A lipidated analog of prolactin-releasing peptide according to the claim 1 selected from the group consisting of:
(Dpr(oct))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(dodec))RmHnHSNleETRTPDI PAWYmoRGIRPVGRF-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(myr))RmHnHSNleETRTPDF PAWYmoRGIRPVGRF-NH2;
(Dpr(palm))RmHnHSNleETRTPDF PAWYmoRGIRPVGRF-NH2;
(myr)TPDF PAWYmoRGIRPVGRF-NH2;
(palm)TPDINPAWYmoRGIRPVGRF-NH2;
(Dpr(oct))RmHnHSNleETRTPDI PAWYmoRGIRPVGR 1 -Nal-NH2; (Dpr(dodec))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(tridec))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(myr))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(Dpr(palm))RmHnHSNleETRTPDINPAWYmoRGIRPVGR 1 -Nal-NH2;
(myr)TPDINPAWYmoRGIRPVGR 1-Nal-NH2; and
(palm)TPDINPAWYmoRGIRPVGR 1-Nal-NH2; wherein
m is T or A;
o is G or S;
n is Q or R, and wherein
at the peptide positions 1 to 24, such substitutions in amino acids may be performed that do not increase the binding affinity value of the lipidated analog to the receptor GPR10 over K; 10"6 mol.l"1, and its anorexic activity evaluated by the food intake test in fasted mice after both peripheral and central administration is equal or higher as compared to administered PrRP.
12. A lipidated analog of prolactin-releasing peptide according to any of the claims 1, 2, 5, 6, 7, selected from the group consisting of:
Ja-SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2;
Ja-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2;
(N-palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NHMe;
(N-palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NOMe;
(N-myr)-TPDINPAWYTGRGIRPVGRF-NH2;
(N-myr)-TPDINPAWYASRGIRPVGRF-NH2;
(N-oct)-TPDINPAWYASRGIRPVGRF-NH2;
(N-dec)-TPDINPAWYASRGIRPVGRF-NH2;
(N-dodec)-TPDINPAWYASRGIRPVGRF-NH2;
J1 -SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGRF-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR 1-Nal-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheCl2-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheN02-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGR PheF5-NH2;
Ja-SRAHQHS Nle ETRTPDINPAWYTGRGIRPVGRY-NH2;
Ja-SRAHRHS Nle EIRTPDINPAWYASRGIRPVGRY-NH2;
(N-myr)-Nle-ETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-myr)-QHSMETRTPDINPAWYTGRGIRPVGRF-NH2;
(N-myr)-QHSMETRTPDINPAWYASRGIRPVGRF-NH2; and
(N-palm)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NOMe; wherein J1 is palmitic acid, myristic acid or stearic acid; and
Ja is palmitic acid or myristic acid.
13. The use of the lipidated analog of prolactin-releasing peptide described in any of the preceding claims as anorexigenic agents lowering food intake after peripheral administration.
14. The use of the lipidated analog of prolactin-releasing peptide described in any of the preceding claims as an agent for the treatment of obesity.
15. A lipidated analog of prolactin-releasing peptide selected from:
(palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2; or (myr)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2.
16. A lipidated analog of prolactin-releasing peptide having the structure:
(palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2.
17. A lipidated analog of prolactin-releasing peptide according to formula:
Ja-TPDINPAWYmoRGIRPVGRF-NH2; wherein
Ja is palmitic acid or myristic acid; m is T or A; and o is G or S.
18. A lipidated analog of prolactin-releasing peptide according to claim 17, wherein Ja is myristic acid.
19. A lipidated analog of prolactin-releasing peptide having the structure:
(myr)-TPDINPAWYASRGIRPVGRF-NH2.
20. A method of preventing or treating a subject diagnosed with or susceptible to having obesity comprising administering a lipidated analog of prolactin-releasing peptide according to any one of claims 1-12 or 15-19.
21. The method of claim 20, wherein the lipidated analog is:
(palm)-SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2; or (myr)-TPDINPAWYASRGIRPVGRF-NH2.
PCT/IB2013/001837 2012-07-12 2013-07-11 Lipidated peptides as anti-obesity agents Ceased WO2014009808A2 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
US14/414,034 US9937235B2 (en) 2012-07-12 2013-07-11 Lipidated peptides as anti-obesity agents
AU2013288383A AU2013288383B2 (en) 2012-07-12 2013-07-11 Popelova, AndreaLipidated peptides as anti-obesity agents
EP13767072.5A EP2872124B1 (en) 2012-07-12 2013-07-11 Lipidated peptides as anti-obesity agents
CA2877594A CA2877594C (en) 2012-07-12 2013-07-11 Lipidated peptides as anti-obesity agents
IL236264A IL236264A (en) 2012-07-12 2014-12-15 Lipidated peptides as anti-obesity agents
US15/094,390 US20160331812A1 (en) 2012-07-12 2016-04-08 Lipidated peptides as anti-obesity agents

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
CZPV2012-476 2012-07-12
CZ2012-476A CZ2012476A3 (en) 2012-07-12 2012-07-12 Lipided peptides functioning as anti-obesity agents

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/414,034 A-371-Of-International US9937235B2 (en) 2012-07-12 2013-07-11 Lipidated peptides as anti-obesity agents
US15/094,390 Division US20160331812A1 (en) 2012-07-12 2016-04-08 Lipidated peptides as anti-obesity agents

Publications (2)

Publication Number Publication Date
WO2014009808A2 true WO2014009808A2 (en) 2014-01-16
WO2014009808A3 WO2014009808A3 (en) 2014-03-06

Family

ID=49253347

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2013/001837 Ceased WO2014009808A2 (en) 2012-07-12 2013-07-11 Lipidated peptides as anti-obesity agents

Country Status (7)

Country Link
US (2) US9937235B2 (en)
EP (1) EP2872124B1 (en)
AU (1) AU2013288383B2 (en)
CA (1) CA2877594C (en)
CZ (1) CZ2012476A3 (en)
IL (1) IL236264A (en)
WO (1) WO2014009808A2 (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015107428A3 (en) * 2014-01-15 2015-11-26 Fyziologicky Ustav Akademie Ved Cr, V.V.I. Lipidated peptides for lowering blood glucose
WO2015180698A1 (en) 2014-05-27 2015-12-03 Ustav Organicke Chemie A Biochemie Av Cr, V.V.I. Lipidated peptides as neuroprotective agents
WO2016025459A3 (en) * 2014-08-11 2016-05-12 Albany Medical College Myristoylated leptin-related peptides and uses thereof
US9937235B2 (en) 2012-07-12 2018-04-10 USTAV ORGANICKE CHEMIE A BIOCHEMIE AKADEMIE VED CR, v.v.i. Lipidated peptides as anti-obesity agents
US20220153782A1 (en) * 2019-03-27 2022-05-19 Memoryplus Ltd. Compounds, compositions and methods for treating a neurological condition

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CZ2022499A3 (en) 2022-11-29 2024-06-05 Ústav organické chemie a biochemie AV ČR, v. v. i. A palmitoylated analogue of peptide releasing prolactin designed for intranasal administration

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6383764B1 (en) * 2000-04-28 2002-05-07 The Regents Of The University Of California Methods of identifying compounds for controlling absence seizures in a mammal relating to prolactin-releasing peptide(PrRP)
WO2006066258A2 (en) * 2004-12-17 2006-06-22 Neose Technologies, Inc. Lipoconjugation of peptides
RU2010114049A (en) * 2007-09-11 2011-10-20 Мондобайотек Лабораториз Аг (Li) CGRP AS A THERAPEUTIC
WO2009126132A1 (en) * 2008-03-31 2009-10-15 Mark Rosenberg Formulations and methods for modulating satiety
PT2723363T (en) 2011-06-24 2018-11-08 Nono Inc Combination therapy for ischemia
CZ2012476A3 (en) 2012-07-12 2014-01-22 Ústav organické chemie a biochemie Akademie věd ČR, v. v. i. Lipided peptides functioning as anti-obesity agents

Non-Patent Citations (28)

* Cited by examiner, † Cited by third party
Title
"Pharmaceutical Dosage Forms and Drug Delivery Systems", 1999, LIPPINCOTT WILLIAMS & WILKINS
"Pharmaceutical Dosage Forms", 1980, MARCEL DECKER
"Remington: The Science and Practice of Pharmacy", 1995, MACK PUBLISHING COMPANY
BECHTOLD D ET AL.: "Prolactin-releasing peptide mediates cholecystokinin-induced satiety in mice", ENDOCRINOLO P, vol. 147, 2006, pages 4723 - 4729
BJURSELL, M. ET AL.: "GPR10 deficiency in mice results in altered energy expenditure and obesity", BIOCHEM BIOPHYS RES COMMUN, vol. 363, 2007, pages 633 - 638, XP022288906, DOI: doi:10.1016/j.bbrc.2007.09.016
BOYLE, R. ET AL.: "Structure-activity studies on prolactin-releasing peptide (PrRP). Analogues of PrRP-(19-31)-peptide", JPEPT SCI, vol. 11, 2005, pages 161 - 165, XP055092287, DOI: doi:10.1002/psc.612
CHENG, Y. ET AL.: "Relationship between the inhibition constant (K1) and the concentration of inhibitor which causes 50 percent inhibition (150) of an enzymatic reaction", BIOCHEM PHARMACOL, vol. 22, 1973, pages 33099 - 3108
ELLACOTT, K. ET AL.: "Repeated administration of the anorectic factor prolactin-releasing peptide leads to tolerance to its effects on energy homeostasis", AM JPHYSIOL REGUL INTEGR COMP PHYSIOL, vol. 285, 2003, pages R1005 - 1010
FRANKLIN KBJ; PAXINOS G: "The mouse brain in stereotaxic coordinates", 1997, ACADEMIC PRESS
GU, W. ET AL.: "The prolactin-releasing peptide receptor (GPR10) regulates body weight homeostasis in mice", JMOL NEUROSCI, vol. 22, 2004, pages 93 - 103, XP009049345, DOI: doi:10.1385/JMN:22:1-2:93
HEAL, D.J. ET AL.: "What is the prognosis for new centrally-acting anti-obesity drugs?", NEUROPHARMACOLOGY, vol. 63, 2012, pages 132 - 146
HINUMA, S. ET AL.: "A prolactin-releasing peptide in the brain", NATURE, vol. 393, 1998, pages 272 - 276, XP002084793, DOI: doi:10.1038/30515
HOOVER, JOHN E.: "Remington's Pharmaceutical Sciences", 1975, MACK PUBLISHING CO.
JARRY, H. ET AL.: "Prolactin-releasing peptides do not stimulate prolactin release in vivo", NEUROENDOCRINOLOGY, vol. 71, 2000, pages 262 - 267, XP009021603, DOI: doi:10.1159/000054544
KOPECKÝ, J. ET AL.: "Reduction of dietary obesity in aP2-Ucp transgenic mice: physiology and adipose tissue distribution", AM JPHYSIOL, vol. 270, 1996, pages E768 - 75
LANGMEAD, C. ET AL.: "Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor", BR J PHARMACOL, vol. 131, 2000, pages 683 - 688
LAWRENCE, C. ET AL.: "Anorectic actions of prolactin-releasing peptide are mediated by corticotrophin-releasing hormone receptors", AM JPHYSIOL REGUL INTEGR COMP PHYSIOL, vol. 286, 2004, pages R101 - 107
LAWRENCE, C.: "Alternative role for prolactin-releasing peptide in the regulation of food intake", NAT. NEUROSCI, vol. 3, 2000, pages 645 - 646, XP009006962, DOI: doi:10.1038/76597
MAIXNEROVÁ, J. ET AL.: "Characterization of prolactin-releasing peptide: binding, signaling and hormone secretion in rodent pituitary cell lines endogenously expressing its receptor", PEPTIDES, vol. 32, 2011, pages 811 - 817
MAIXNEROVÁ, J. ET AL.: "Structure-activity relationship of CART (cocaine- and amphetamine-regulated transcript) peptide fragments", PEPTIDES, vol. 28, 2007, pages 1945 - 1953, XP022261270, DOI: doi:10.1016/j.peptides.2007.07.022
MALETINSKA, L. ET AL.: "Biological properties of prolactin-releasing peptide analogues with a modified aromatic ring of a C-terminal phenylalanine amide", PEPTIDES, vol. 32, 2011, pages 1887 - 1892, XP028288556, DOI: doi:10.1016/j.peptides.2011.08.011
MALETINSKA, L. ET AL.: "Characterization of new stable ghrelin analogs with prolonged orexigenic potency", J PHARMACOL EXP THER, vol. 340, 2012, pages 781 - 786, XP002743563, DOI: doi:10.1124/jpet.111.185371
MOCHIDUKI, A. ET AL.: "Stress response of prolactin-releasing peptide knockout mice as to glucocorticoid secretion", J NEUROENDOCRžNOL, vol. 22, 2010, pages 576 - 584
MOTULSKY, A. ET AL.: "Curr Protoc Neurosci", 2002, article "Analyzing radioligand binding data"
ROLAND, B. ET AL.: "Anatomical distribution of prolactin-releasing peptide and its receptor suggests additional functions in the central nervous system and periphery", ENDOCRINOLOGY, vol. 140, 1999, pages 5736 - 5745, XP002262206, DOI: doi:10.1210/en.140.12.5736
SATOH, F. ET AL.: "Characterization and distribution of prolactin releasing peptide (PrRP) binding sites in the rat-evidence for a novel binding site subtype in cardiac and skeletal muscle", BR J PHARMACOL, vol. 129, 2000, pages 1787 - 1793
STRADER, A. ET AL.: "Gastrointestinal hormones and food intake", GASTROENTEROLOGY, vol. 128, 2005, pages 175 - 191, XP005313258, DOI: doi:10.1053/j.gastro.2004.10.043
TAKAYANAGI, Y. ET AL.: "Endogenous prolactin-releasing peptide regulates food intake in rodents", J CLIN INVEST, vol. 118, 2008, pages 4014 - 4024, XP055092449, DOI: doi:10.1172/JCI34682

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9937235B2 (en) 2012-07-12 2018-04-10 USTAV ORGANICKE CHEMIE A BIOCHEMIE AKADEMIE VED CR, v.v.i. Lipidated peptides as anti-obesity agents
WO2015107428A3 (en) * 2014-01-15 2015-11-26 Fyziologicky Ustav Akademie Ved Cr, V.V.I. Lipidated peptides for lowering blood glucose
AU2015207776B2 (en) * 2014-01-15 2017-06-15 Fyziologicky Ustav Akademie Ved Cr, V.V.I. Lipidated peptides for lowering blood glucose
WO2015180698A1 (en) 2014-05-27 2015-12-03 Ustav Organicke Chemie A Biochemie Av Cr, V.V.I. Lipidated peptides as neuroprotective agents
AU2015266464B2 (en) * 2014-05-27 2017-08-17 Ustav Organicke Chemie A Biochemie Av Cr, V.V.I. Lipidated peptides as neuroprotective agents
US10751390B2 (en) 2014-05-27 2020-08-25 Ustav Organicke Chemie A Biochemie Av Cr, V.V.I. Lipidated peptides as neuroprotective agents
WO2016025459A3 (en) * 2014-08-11 2016-05-12 Albany Medical College Myristoylated leptin-related peptides and uses thereof
US20220153782A1 (en) * 2019-03-27 2022-05-19 Memoryplus Ltd. Compounds, compositions and methods for treating a neurological condition

Also Published As

Publication number Publication date
US20150175674A1 (en) 2015-06-25
IL236264A0 (en) 2015-02-26
CA2877594A1 (en) 2014-01-16
AU2013288383A8 (en) 2015-03-19
IL236264A (en) 2017-10-31
CA2877594C (en) 2018-01-02
CZ2012476A3 (en) 2014-01-22
US9937235B2 (en) 2018-04-10
AU2013288383A1 (en) 2015-01-22
AU2013288383B2 (en) 2015-12-10
EP2872124B1 (en) 2017-11-08
US20160331812A1 (en) 2016-11-17
EP2872124A2 (en) 2015-05-20
WO2014009808A3 (en) 2014-03-06

Similar Documents

Publication Publication Date Title
US12252524B2 (en) GIP/GLP1 co-agonist compounds
US20160331812A1 (en) Lipidated peptides as anti-obesity agents
Catzeflis et al. Neuropeptide Y administered chronically into the lateral ventricle profoundly inhibits both the gonadotropic and the somatotropic axis in intact adult female rats
JP5645339B2 (en) Correction of eating behavior
AU2003201998B2 (en) Modification of feeding behavior
US20150051140A1 (en) Modification of feeding behavior
CN1688696A (en) GHRH analogs
US10350271B2 (en) Lipidated peptides for lowering blood glucose
Hiejima et al. Regional distribution and the dynamics of n-decanoyl ghrelin, another acyl-form of ghrelin, upon fasting in rodents
WO2000078805A1 (en) Peptide having preptin functionality
Ohinata et al. Proadrenomedullin N-terminal 20 peptide (PAMP) inhibits food intake and gastric emptying in mice
Szylberg et al. Oxytocin and its role and effects-recent findings
EP4176934A1 (en) Lipidized cocaine- and amphetamine-regulated transcript peptide analogues as anti-obesity and neuroprotective agents

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13767072

Country of ref document: EP

Kind code of ref document: A2

REEP Request for entry into the european phase

Ref document number: 2013767072

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2013767072

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2877594

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 14414034

Country of ref document: US

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13767072

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2013288383

Country of ref document: AU

Date of ref document: 20130711

Kind code of ref document: A