WO2014004378A1 - Ompa and asp14 in vaccine compositions and as diagnostic targets - Google Patents

Abstract

Anaplasma phagocytophilum surface proteins Asp 14 and OmpA and homologous genes from Anaplasmatacaea family members are used in compositions suitable for vaccines to treat or prevent infections caused by tick-born bacteria of the Anaplasmatacaea family. Asp 14 and/or OmpA proteins or peptide fragments may be used in combination with other Anaplasmatacaea surface proteins to elicit an immune response. Furthermore, antibodies to Asp 14 and/or OmpA proteins can be used in diagnostic methods to determine whether an individual has contracted an Anaplasmatacaea infection. Because of the conserved invasin domains in the surface proteins, a wide range of Anaplasmatacaea infections may be diagnosed, treated or prevented using compositions of the invention.

Description

OMPA AND ASP14 IN VACCINE COMPOSITIONS AND AS DIAGNOSTIC

TARGETS

FIELD OF THE INVENTION

The invention generally relates to a vaccine and diagnostic for anaplasmosis in animals and humans. In particular, the invention provides Anaplasma phagocytophilum outer surface protein A (OmpA) epitopes and/or Anaplasma phagocytophilum surface protein 14 (Asp 14) epitopes.

PRIORITY

This application claims the benefit of U.S. application 61/665,223, filed June 27, 2012, and U.S. application 61/698,979, filed September 10, 2012. These applications are incorporated herein by reference in their entirety.

SEQUENCE LISTING

This document incorporates by reference an electronic sequence listing text file, which was electronically submitted along with this document. The text file is named

02940826TA_ST25.txt, is 87 kilobytes, and was created on June 17, 2013.

BACKGROUND OF THE INVENTION

Anaplasma phagocytophilum (Aph) is a tick-transmitted obligate intracellular bacterium of the family Anaplasmataceae that can infect humans, livestock, companion animals and wild animals. In addition to Aph, the Anaplasmataceae family members include Anaplasma marginale, Anaplasma platys, Ehrlichia chaffeensis, Ehrlichia canis, and Ehrlichia ruminatium, among others, and all of these cause similar infections known collectively as ehrlichiosis. When humans contract an Aph infection it is more specifically known as human granulocytic anaplasmosis (HGA). An emerging and potentially fatal disease, HGA is transmitted by the same vectors that transmit Lyme Disease, primarily ticks and deer, but other animal and human hosts can complete the vector cycle and therefore extend the spread of disease. Since HGA became a reportable disease in the U.S. in 1999, the number of cases has risen annually, reaching 1,761 in 2010. Since diagnostic tools for HGA are lacking, this number of actual cases is likely to be much higher. HGA is increasingly recognized in Europe and Asia, and Aph infection is now the most widespread tick-transmitted disease of animals in Europe.

As the name implies, an obligate intracellular bacterium must enter a target cell in its human or animal host to survive, replicate, and move to the next host. When an Anaplasma spp. or Ehrlichia spp. infected tick bites a subject, the bacteria is transferred from the tick salivary glands into the tissues of the host or into the bloodstream where they bind to the surface of host cells and are taken up into vacuoles that form around each bacterium. A resident bacterium prevents the vacuole from merging with lysosomes. In doing so, the bacterium converts the cell into a protective niche that favors bacterial survival and remains in circulation to enable it to complete its zoonotic cycle. While the hallmark of these diseases is Aph colonization of neutrophils, other pathological findings can include leukopenia, thrombocytopenia, and elevated serum transaminase levels. Anaplasmosis is marked by fever and increased susceptibility to potentially fatal opportunistic infections.

Infected neutrophils in a host can be ingested in a second tick bite/bloodmeal. In this manner the disease may be transferred to another subject bitten subsequently.

However, HGA can also be transmitted perinatally or by blood transfusion, and possibly nosocomially. Blocking infection of neutrophils could conceivably prevent all of these types of dissemination of Aph infection and the increased risk of opportunistic infections that can accompany the disease. Furthermore, targeting Aph proteins that are conserved among related Anaplasmataceae family members might also reduce or block transmission of disease caused by related Anaplasmataceae family members.

In addition to neutrophils, Aph has been detected in the microvascular

endothelium of heart and liver in experimentally infected severe combined

immunodeficiency mice. Promyelocytic and endothelial cell lines are useful in vitro models for studying Aph- ost cell interactions. When naive neutrophils or HL-60 cells are overlaid on _f>A-infected endothelial cells, the bacterium rapidly transmigrates into the myeloid cells. These observations demonstrated that Aph infects endothelial cells in vivo and suggested that the bacterium may transmigrate between endothelial cells and neutrophils during the course of mammalian infection. Thus, targeting the Aph invasins that mediate infection of endothelial cells may prevent movement of the bacteria into the microvasculature of heart and liver in an affected subject by blocking the mechanism of endothelial cell-to-neutrophil transfer.

The Aph genome has now been sequenced and annotated. The annotated Aph genome (HZ strain, isolated from a human patient) can be found on the website at cmr.jcvi.org, and more specifically on the page found at cmr.jcvi.org/tigr- scripts/CMR/GenomePage.cgi?org_search=&org=gaph. Another website is the page found at ncbi.nlm.nih.gov, more specifically on the page found at

ncbi .nlm.nih. gov/Taxonomy/Browser/wwwtax . cgi ?mode-

Info&id=948&lvl=3&keep=l &srchmode=l &unlock. This information has promoted some progress regarding diagnosis of anaplasmosis and protecting subjects from infection. US 7,906,296 B2 to Beall et al teaches that Anaplasma platys {Apl), formerly known as Ehrlichia platys, causes tick-born anaplasmosis in dogs. Beall further teaches the uses of Apl polypeptides. The Apl sequences were amplified from a blood sample of a dog known to be infected with Apl in order to develop methods for detecting the presence of antibodies to Apl and/or Aph in dog sera. Beall also teaches that peptides including Apl P44, encoding a major surface protein, might be used to elicit an immune response in vivo and confer resistance to anaplasmosis caused by Apl or Aph. US 8,158,370 B2 to Liu el al. teaches that polypeptide sequences amplified from either ^/?/ or Aph can be used in diagnostic assays, or to induce an immune reaction that might confer protection from Apl or Aph infection. The Aph sequences used by Liu were derived from APH 0915, encoding a protein of unknown function. More recently, Liu et al., in US 8,303,959 and US 2013/0064842, teaches the use of four strain variants of Aph P44 surface proteins to diagnosis and protect against anaplasmosis.

Despite these teachings, there are currently no human or animal vaccines against anaplasmosis caused by any of the Anaplasmataceae family members. Antibiotic treatments with doxycycline or tetracycline can be effective, but tools for rapid and definitive diagnosis in any species other than dogs are lacking. The current gold standard serologic test for diagnosis of anaplasmosis in humans is indirect immunofluorescence assays (IF A) performed as timed pairs over a period of a few weeks, only available in specialized reference laboratories. This assay measures non-specific increases in IgM and IgG antibody levels. However, IgM antibodies, which usually rise at the same time as IgG near the end of the first week of illness and remain elevated for months or longer, are even less specific than IgG antibodies and more likely to result in a false positive.

Serologic tests based on enzyme immunoassay (EIA) technology are available from some commercial laboratories. However, EIA tests are qualitative rather than quantitative, meaning they only provide a positive/negative result, and are less useful to measure changes in antibody titers between paired specimens. Furthermore, some EIA assays rely on the evaluation of IgM antibody alone, which again may have a higher frequency of false positive results. Between 5-10% of currently healthy people in some areas may have elevated antibody titers due to past exposure to Aph or related family members. If only one sample is tested it can be difficult to interpret. A four-fold rise in antibody titer is needed to achieve significance in paired samples taken weeks apart.

Therefore, the need remains for compositions and methods to rapidly and accurately diagnosis new cases and to provide adequate vaccination against

Anaplasmataceae infections that cause anaplasmosis and HGA.

SUMMARY

An embodiment of the invention is a composition including one or more isolated polypeptides, wherein at least one of said one or more polypeptides is or includes SEQ ID NO:03 or SEQ ID NO:06. The one or more polypeptides may be linked to an amino acid spacer, an amino acid linker, a signal sequence, a stop transfer sequence, a

transmembrane domain, a protein purification ligand, a heterologous protein, or one or more additional polypeptides comprising SEQ ID NO:01 , 02, 03, 04, 05 or 06, or a combination thereof. An exemplary embodiment is one or more polypeptides linked to a protein purification ligand, and protein purification ligands are a peptide encoding a histidine tag. Another embodiment of the invention comprises one or more polypeptides selected from the group consisting of SEQ ID NO:01, SEQ ID NO:02, and SEQ ID NO:03. Another embodiment of the invention comprises one or more polypeptides selected from the group consisting of SEQ ID NO:04, SEQ ID NO:05, and SEQ ID NO:06.

Another embodiment of the invention is a method of protecting a subject from acquiring a zoonotic disease and/or treating a zoonotic disease in a subject by the step of administering a composition including one or more isolated polypeptides, wherein at least one of said one or more polypeptides is or includes SEQ ID NO:03 or SEQ ID NO:06. The one or more polypeptides may be linked to an amino acid spacer, an amino acid linker, a signal sequence, a stop transfer sequence, a transmembrane domain, a protein purification ligand, a heterologous protein, or one or more additional polypeptides comprising SEQ ID NO:01, 02, 03, 04, 05 or 06; or a combination thereof. The zoonotic disease may be one caused by an obligate intracellular Anaplasmataceae bacterium selected from the group consisting of Anaplasma phagocytophilum, Anaplasma marginale, Anaplasma platys, Ehrlichia chaffeensis, Ehrlichia canis, and Ehrlicia ruminatium. When the subject is a human, and the zoonotic disease may be human granulocytic anaplasmosis (HGA). When the subject is an animal, the zoonotic disease may be anaplasmosis.

Another embodiment of the invention is a method of detecting antibodies that specifically bind an Anaplasmataceae polypeptide in a test sample. The method may include the steps of contacting a test sample, under conditions that allow polypeptide- antibody complexes to form, with a composition that includes at least one or more polypeptides encoding all or a portion of SEQ ID NO:01 or SEQ ID NO:04, and detecting said polypeptide-antibody complexes, wherein the detection is an indication that antibodies specific for Anaplasmataceae Asp 14 or OmpA are present in the test sample. The method may be an assay selected from the group consisting of an

immunoblot and an enzyme-linked immunosorbent assay (ELISA). An exemplary embodiment of this methodology may include using at least one polypeptide which is or includes SEQ ID NO:03 or SEQ ID NO:06 in the assay, whereby infection with obligate intracellular Anaplasmataceae is determined from a serum sample exhibiting antibody binding with the at least one polypeptide.

BRIEF DESCRIPTION OF THE FIGURES

Figure 1 A and B. Timeline of Aph infection cycle and differential transcription profiling of OMP candidate genes throughout the Aph infection cycle.

Figure 1C-E. Differential transcription profiling of OMP candidate genes throughout the Aph infection cycle.

Figure 2A-D. Differential expression analyses of ompA and aspl4 during Aph invasion of HL-60 and RF/6A cells, during ^ ? binding to PSGL-1 CHO cells, and during transmission feeding of Aph infected I. scapularis ticks.

Figure 3A-G. Aph expresses OmpA and Asp 14 during infection of HL-60 cells and during murine and human infection.

Figure 4A and B. Trypsin treatment abolishes detection of Aph surface proteins and surface proteins Aspl4 and OmpA are detected in Aph DC organisms.

Figure 5A-D. Anti-OmpA does not disrupt bacterial cellular adherence or bacterial interaction with PSGL-1, but does partially neutralize Aph infection of HL-60 cells. Figure 6A and B. Alignment of OmpA (SEQ ID NO:04) with Anaplasma and Ehrlichia species homologs AM854 (SEQ ID NO: 31), ACHIS 00486 (SEQ ID NO:33),

ECH 0462 (SEQ ID NO:39), Ecaj_0563 (SEQ ID NO:45), and Erum 5620 (SEQ ID NO:51) with regions of identity and similarity shaded, and predicted 3D structure with extracellular loop and helix are indicated by arrows.

Figure 7A and B. Pretreatment ofAph with anti-OmpA reduces infection of HL-60 cells. Figure 8A-D. Model for how Aph OmpA interacts with its receptor to promote infection of host cells

Figure 9A-D. Pretreatment of Aph with anti-Aspl4 reduces infection of HL-60 cells. Figure 10A-D. Asp 14 residues 101-124 are required to competitively inhibit Aph infection of mammalian host cells.

Figure 1 1. An alignment of Asp 14 residues 101-1 15, which constitute a conserved domain among homologs from Anaplasma and Ehrlichia species Asp 14 (SEQ ID

NO:01), AM936 (SEQ ID NO: 13), ACHIS_00403 (SEQ ID NO: 15), ECH 0377 (SEQ ID NO: 19), Ecaj_0636 (SEQ ID NO:23), and Erum6320 (SEQ ID NO:27) with regions of identity and similarity shaded.

Figure 12A and B. Recombinant forms of Asp 14 and OmpA cooperatively block Aph infection of HL-60 cells, either as full-length proteins or fragments identified as critical conserved effector domains.

Figure 13A-C. Peptide antisera blocking reveals that the OmpA invasin domain lies within amino acids 59-74.

Figure 14. Locations of linker insertion mutations that identify regions required to disrupt the ability of OmpA to antagonize Aph infection, showing alignment of OmpA (SEQ ID NO: 10) with Anaplasma and Ehrlichia species homologs AM854 (SEQ ID NO: 32), ACHIS_00486 (SEQ ID NO: 34), ECH 0462 (SEQ ID NO:40), Ecaj_0563 (SEQ ID NO:46), and Erum 5620 (SEQ ID NO:52) with regions of identity and similarity shaded. Figure 15. Percent of infection using linker insertion mutants of OmpA.

Figure 16. Percent of infection in alanine substitution experiments that identified that OmpA aa59-74 are important for infection.

Figure 17 A and B. ELISA results showing the specificity of antiserum raised against Aspl4 aa98-1 12 or aal 13-124.

Figure 18. Percent of bacterial infection inhibited by pretreatment of Aph with antiserum specific for Asp 14 invasin domain.

Figure 19. Percent of infection reduced by antisera specific for the OmpA invasin domain, Asp 14 invasin domain, or combinations thereof.

Figure 20A and B. Western blot and ELISA showing that A. phagocytophilum OmpA and A. marginale OmpA share B-cell epitopes.

DETAILED DESCRIPTION

Aspects of the invention are related to diagnosing, preventing, and treating zoonotic diseases caused by Anaplasmataceae bacteria. The diseases affect both animals and humans and are collectively referred to as anaplasmosis, but more specifically known as HGA when transmitted to humans. Aph surface proteins OmpA and Asp 14 have been identified as mediating bacteria-host cell binding and entry. Thus, the surface proteins OmpA and Asp 14 and fragments thereof can be used for diagnosing whether a patient has been suffering from Aph infection. Specifically, if antibodies to one or more of OmpA or Asp 14 are identified in serum or other biological material from a subject suspected of an Aph infection by suitable assay, such as ELIS A or immunoblot, where, for example, the antibodies bind to or interact with OmpA or Asp 14 proteins or fragments thereof, then it can be determined that the subject has been exposed to, infected with, or is currently infected with Aph. Furthermore, administration of OmpA or Asp 14 proteins or fragments, or nucleic acids encoding for OmpA or Asp 14 proteins, such as in forms where the nucleic acids are present with a vector such as a viral vector, or are present as purified peptides, polypeptides or proteins in a pharmaceutically acceptable carrier, can provide an immunogenic response in the subject and protection from subsequent Aph infection, or provide for treatment by the production of antibodies to Aph infection in a subject that is already infected.

The critical regions of Asp 14 and OmpA that mediate infection are highly conserved among family members Aph, A. marginale, and closely related Ehrlichia species, such as E. chaffeensis, E. canis, and E. ruminatium, and may be highly conserved in A. platys. In particular, Aph and A. marginale are closely related and express many gene homologs, including Asp 14, OmpA and other surface antigens. The high degree of conservation makes these surface proteins ideal for producing a vaccine or immunogenic composition to provide protection from or therapy for multiple pathogens in humans and animals.

In one embodiment, the composition of the invention comprises one or more isolated and purified recombinant polypeptides. Each polypeptide comprises amino acid sequences encoding an Asp 14 or an OmpA invasin domain that mediates uptake of Aph bacteria into host cells. The Aspl4 invasin domain lies within aal 13-124 (SEQ ID NO:03). In other embodiments, polypeptide fragments such as Aspl4 aalOl-124 (SEQ ID NO:02) or the full length protein (SEQ ID NO:01) are used. In another embodiment, the composition of the invention comprises the invasin domain of OmpA, which lies within aa59-74 (SEQ ID NO:04). In other embodiments, a larger fragment of OmpA encompassing aal 9-74 (SEQ ID NO:05), or the full length OmpA protein (SEQ ID NO:06) is used. It is contemplated that virtually any protein sequence, as well as its corresponding nucleic acid sequence coding for the protein sequence that is or includes SEQ ID NO: 04 may be used. This would include the full length sequence (e.g., SEQ ID NO:06) as well as any sequence of, for example 5-50 (or less than 5 or more than 50) amino acids before the beginning or at the end of the amino acid sequence defined by of SEQ ID NO:04, and this can include amino acids which are present in SEQ ID NO:06 as well as amino acids which are from different species (e.g., a chimera) or from a synthetic sequence, e.g., a histidine or GST tag. While the invention may comprise one, or a plurality, or multiple copies of any single one of these polypeptides, yet another embodiment is a mixture of at least two of the polypeptides encoded by SEQ ID NO:01 , 02, 03, 04, 05 and 06. Any of these polypeptides may be produced by means of chemical synthesis or recombinant techniques well-known to those of ordinary skill in the art of molecular biology.

There is currently no means for preventing transmission of the bacteria causing anaplasmosis or HGA. While antibiotic treatments exist, these treatments are not advised for some groups of patients. In one embodiment, the invention is a vaccine for prevention or treatment of anaplasmosis and HGA. One embodiment of the invention is a pharmaceutically acceptable composition comprising one or a plurality of any one of or a mixture of at least two amino acid sequences which are or include the amino acid sequences which are identified as SEQ ID NO:01, 02, 03, 04, 05 and 06. Administration of the composition of the invention stimulates an immune response in a subject and production of antibodies against Asp 14, OmpA, or both. Because Asp 14 and OmpA are on the outer surface of Aph bacteria, antibodies produced by the subject will block binding of bacteria to host cells and interfere with uptake into vacuoles. Bacteria unable to enter host cells will be detected by the host immune system and cleared from the body. Blockade can occur at the point of entry into neutrophils or endothelial cells or transfer between these two host cell types. Interruption of the zoonotic life cycle provides a further benefit to public health and well-being by breaking the chain of disease transmission to others.

Aside from commercial assays to detect Apl in dogs, there is no specific assay to rapidly or confirm Anaplasmataceae infection, or accurately diagnose HGA or anaplasmosis. In another embodiment, the invention provides a method to detect the presence of Aph Aspl4 or OmpA in assays of biological samples obtained from subjects to bind to antibodies produced by an Anaplasmataceae-infected individual, either of which would be diagnostic for HGA or anaplasmosis. The preferred composition for diagnostic testing may comprise either full length Amp 14 (SEQ ID NO: 3) or OmpA (SEQ ID NO:06). However, compositions comprising fragments of Ampl4, such as SEQ ID NO:01 and/or 02, are also contemplated, as are any mixtures of at least two of SEQ ID NO:01, 02, and 03. Likewise, composition comprising fragments of OmpA, such as SEQ ID NO:04 and/or 05, and any mixtures of at least two of SEQ ID NO:04, 05, and 06. The assay used to detect antibodies may be any type of immunoassay, such as an immunoblot or an enzyme-linked immunosorbent assay. The test sample may be any type of body fluid, such as blood, plasma, serum, urine, saliva, or other body fluid. Tissues or cells may also be used, such as tissue sections or cell preparations adhered to slides or coverslips for immunohistochemical staining. The preferred embodiment is an ELISA with each protein type to independently detect antibodies to Asp 14, and OmpA, however, a combination to detect Asp 14 and OmpA antibodies in one ELISA is also contemplated.

In order to facilitate the understanding of the present invention, the following definitions are provided:

Aph: Anaplasma phagocytophilum or A. phagocytophilum, an Anaplasmataseae family bacterium that is tick-born and causes anaplasmosis in humans and animals.

Apl: Anaplasma platys or A. platys, an Anaplasmataseae family member bacterium that is tick-born and causes anaplasmosis that is restricted to dogs.

Anaplasmataceae: a family of closely related bacteria, including Anaplasma and

Ehrlichia species. The genera Neorickettsia and Wolbachhia are also Anaplasmataceae, bacteria but do not cause anaplasmosis.

Antigen: term used historically to designate an entity that is bound by an antibody, and also to designate the entity that induces the production of the antibody. More current usage limits the meaning of antigen to that entity bound by an antibody, while the word "immunogen" is used for the entity that induces antibody production. Where an entity discussed herein is both immunogenic and antigenic, reference to it as either an immunogen or antigen will typically be made according to its intended utility. The terms "antigen", "antigenic region" "immunogen" and "epitope" may be used interchangeably herein. As used herein, an antigen, immunogen or epitope is generally a portion of a protein (e.g. a peptide or polypeptide).

Asp 14: 14-kilodalton Aph surface protein. OmpA homologs are expressed by

Anaplasmataceae family members, including Aph, A. marginale, Ehrlichia chaffeensis, E. canis, E. ewingii, and E. ruminatium.

OmpA: Outer membrane protein A. OmpA homologs are expressed by Anaplasmataceae family members, including Aph, A. marginale, Ehrlichia chaffeensis, E. canis, E. ewingii, and E. ruminatium.

DC and RC: Aph undergoes a biphasic developmental cycle, the kinetics of which have been tracked in promyelocytic HL-60 cells. The cycle begins with attachment and entry of an infectious dense-cored (DC) organism. Once intracellular, the DC differentiates to the non-infectious reticulate cell (RC) form and replicates by binary fission to produce a bacteria-filled organelle called a morula. Later, the RCs transition back to DCs, which initiate the next round of infection.

Epitope: a specific chemical domain on an antigen that is recognized by a B-cell receptor, and which can be bound by secreted antibody. The term as used herein is interchangeable with "antigenic determinant".

Immunodominant epitope: The epitope on a molecule that induces the dominant, or most intense, immune response. The immunodominant epitope would elicit the greatest antibody titer during infection or immunization, as measured by, for example, the fraction of reactivity attributable to a certain antigen or epitope in an enzyme-linked

immunosorbant assay as compared with the total responsiveness to an antigen set or entire protein.

Invasin domain: An invasin domain is a region of a pathogen's protein that binds a host cell and mediates intracellular signaling and pathogen entry into the host cell. In some cases, uptake of the pathogen results in the formation of a vacuole in which the intracellular pathogen will reside. The invasin domains of the invention are linear amino acid sequences within Asp 14, OmpA, or other surface proteins that are found on the outer membrane of the bacteria Aph and other Anaplasmataceae family members, and can vary slightly from one family member to the next. However, the invasin domain in each Asp 14 homolog is critical for uptake of bacteria into host cells (known to be neutrophils and endothelial cells in the case of Anaplasmataceae).

Linker sequences: short peptide sequences encoding functional units that may be engineered or otherwise added at the ends or within recombinant proteins, polypeptides, peptides of interest. Linker sequences may be used as "handles" for protein purification, as detectable signals of expression or binding to other proteins or macromolecules, to modulate tertiary structure, or enhance antigenicity. Examples of linker sequences include but are not limited to an amino acid spacer, an amino acid linker, a signal sequence, a stop transfer sequence, a transmembrane domain, and a protein purification ligand.

LINKER: a program to generate linker sequences for fusion proteins. Protein Engineering 13(5): 309-312, which is a reference that describes unstructured linkers. Structured (e.g. helical) sequence linkers may also be designed using, for example, existing sequences that are known to have that secondary structure, or using basic known biochemical principles to design the linkers.

Tags: Recombinant protein sequences that can be added to the N- or C-terminus of a recombinant protein for the purpose of identification or for purifying the recombinant protein for subsequent uses. Examples of recombinant protein tags that may be useful in practicing the invention include but are not limited to glutathione-S-transferease (GST), poly-histidine, maltose binding protein (MBP), FLAG, V5, halo, myc, hemaglutinin (HA), S-tag, calmodulin, tag, streptavidin binding protein (SBP), Softagl™, Softag3™, Xpress tag, isopeptag, Spy Tag, biotin carboxyl carrier protein (BCCP), GFP, Nus-tag, strep-tag, thioredoxin tag, TC tag, and Ty tag. All such tags are well-known to those of ordinary skill in the art of recombinant protein production.

Epitope: An epitope may comprise a single, non-interrupted, contiguous chain of amino acids joined together by peptide bonds to form a peptide or polypeptide. Such an epitope can be described by its primary structure, i.e. the linear sequence of amino acids in the peptide chain. Epitope may also refer to conformational epitopes, which are comprised of at least some amino acids that are not part of an uninterrupted, linear sequence of amino acids, but which are brought into proximity to other residues in the epitope by secondary, tertiary and/or quaternary interactions of the protein. Residues in conformational epitopes may be located far from other resides in the epitope with respect to primary sequence, but may be spatially located near other residues in the conformational epitope due to protein folding.

Protein: Generally means a linear sequence of about 100 or more amino acids covalently joined by peptide bonds.

Polypeptide: Generally means a linear sequence of about 55 to about 100 amino acids covalently joined by peptide bonds.

Peptide: Generally means a linear sequence of about 55 or fewer amino acids covalently joined by peptide bonds.

Note: The terms "peptide", "polypeptide" and "protein" may be used interchangeably herein.

Chimeric or fusion peptide or polypeptide: a recombinant or synthetic peptide or polypeptide whose primary sequence comprises two or more linear amino acid sequences which do not occur together in a single molecule in nature. The two or more sequences may be, for example, a peptide (e.g. an epitope or antigenic region) and a linker sequence, or two or more peptides (which may be the same or different) which are either contiguous or separated by a linker sequences, etc.

Tandem repeats: two or more copies of nucleic acid or amino acid sequences encoding the same peptide, which are arranged in a linear molecule and are either contiguous or separated by a linker sequences, etc.

Original or native or wild type sequence: The sequence of a peptide, polypeptide, protein or nucleic acid as found in nature.

Recombinant peptide, polypeptide, protein or nucleic acid: peptide, polypeptide, protein or nucleic acid that has been produced and/or manipulated using molecular biology techniques such as cloning, polymerase chain reaction (PC ), etc.

Synthetic peptide, polypeptide, protein or nucleic acid: peptide, polypeptide, protein or nucleic acid that has been produced using chemical synthesis procedures.

Type-specific: associated primarily with a single phyletic group.

Surface protein: A protein located on the outer surface membrane of a cell or bacterium. Table 1. Aph Sequence Listing with SEQ ID Numbers.

RGKAEPEVLVYSTDAQEVEKANAQN

RRAVIVVE

FAHIPRSGVADM

SEQ ID Aspl4 aal01- APH_0248 LRAIKRRILKLE

NO: 11 112

SEQ ID Aspl4 aal9-60 APH_0248 DEYKEIIKQCIGSVKEVFGEGRFDDVV

ASIMKMQE VLASSM NO: 12

Table 2. Aspl4 Homologs Sequence Listing with SEQ ID Numbers

NO: 19 chaffeensis VIDNGDQVKRIGSSTSESISNTEYKELM

EELKVIKKRILRLERKIL PKEEV

SEQ ID E. chaffeensis ECH_0377 M AEDD YKG VIKQ YIDTV EI VGD SKTF

DQMFESVVRIQERVM NO:20

SEQ ID E. chaffeensis ECH_0377 ELKVIKKRILRLE

NO:21

SEQ ID E. chaffeensis ECH 0377 RKILKPKEEV

NO:22

SEQ ID E. canis EcajJ)636 MADDEY GVIQQYINTVKEIVSDS TF

DQMFESVVKIQERVMEANAQNDDGSQ NO:23

VKRIGSSTSDSISDSQYKELIEELKVIKK RLLRLEHKVLKPKEGA

SEQ ID E. canis Ecaj_0636 MADDEYKGVIQQYINTVKEIVSDSKTF

DQMFESVVKIQERVM NO:24

SEQ ID E. canis Ecaj_0636 ELKVIKKRLLRLE

NO:25

SEQ ID E. canis Ecaj_0636 HKVLKPKEGA

NO:26

SEQ ID E. ruminantium Erum6320 MADEDYKGVIKQYIDTVKEIVGDSKTF

DQMFESVVKIQERVMAASAQNEANGA NO:27

LVEGDSKMKRIRSADDSIAYTQSQELL EELKVLKKRIARLERHVFKSNKTEA

SEQ ID E. ruminantium Erum6320 MADEDYKGVIKQYIDTVKEIVGDSKTF

DQMFESVVKIQERVM NO:28

SEQ ID E. ruminantium Eruni6320 ELKVLKKRIARLE

NO:29

SEQ ID E. ruminantium Eram6320 RHVFKSNKTEA

NO:30

Table 3. OmpA Homologs Sequence Listing with SEQ ID Numbers SEQ ID Anaplasma AM854 MLHRWLALCFLASFAVTGCGLFSKEKV

GMDIVGVPFSAGRVEKVYFDFNKYEIKG NO:31 marginale

SGKKVLLGLVERMKADKRSTLLIIGHTD

SRGTEEYNLALGERRANAVKEFILGCDR

S LSPRISTQSRGKAEPE VLVYS SDFKE AE

KAHAQNRRWLIVECQHSVSPKKKMAI

KWPFSFGRSAAKQDDVGSSEVSDENPV

DDSSEGIASEEAAPEEGVVSEEAAEEAPE

VAQDSSAGWAPE

SEQ ID A. marginale AM854 LFSKEKVGMDIVGVPFSAGRVEKVYFDF NO:32 NKYEIKGS GKK VLLGL VERMKADKRST

LLII

SEQ ID A. marginale ACIS 0048 MLHRWLALCLLASLAVTGCELFNKEKV

6 NIDIGGVPLSAGRVEKVYFDFNKYEIKGS NO:33 subspecies

GKKVLLGLVERMKADKMSTLLIVGHTD

Centrale SRGTEEYNLALGERRANAVKEFILGCDR

SLSPRISTQSRGKAEPEILVYSSDFKEAEK

AHAQNRRVVLIMECQHAASPKKARVSR

WPFSFGRSSATQQDNGGGTVAAGSPGE

DAPAEVVEPEETQEAGE

SEQ ID A. marginale ACIS 0048 LFNKEKVNIDIGGVPLSAGRVEKVYFDF

6 NKYEIKGS GKKVLLGLVERMKADKM ST NO:34 subspecies

LLIV

Centrale

SEQ ID A. marginale & AM854 & AGRVEKVYFDFNKYEIKGSGKKVLLGL

VERMKAD NO:35 A. marginale ACIS- subspecies 00486

Centrale

SEQ ID A. marginale & AM936 & GHTDSRGTEEYNLALG

NO:36 A. marginale ACIS- subspecies 00403

Centrale

SEQ ID A. marginale & AM854 & RRANAVKEFILGCDRSLSPRISTQSRGKA

E NO:37 A. marginale ACIS- subspecies 00486

Centrale

SEQ ID A. marginale & AM854 & LVYS SDFKEAEKAH AQNRRVVLI

SEQ ID E. canis Ecaj 0563 LVYS SNPEEAEH AHAKNRRVVI

NO:50

SEQ ID E. ruminantium Erum5620 MRYQLIVANLILLCLTLNGCHFNSKHVP

LVNVHNLFSNIKAIDKVYFDLDKTVIKD NO:51

SDKVLLEKLVQKAQEDPTTDIIIVGHTDT

RGTDEYNLALGEQRANAVRDFIISCDKS

LEKRITVRSKGKSEPAILVYSNNPKEAED

AHAKNRRVVITLVNNSTSTDNKVPTTTT

PFNEEAHNTIS DQENNTQQQAKSDNIN

NINTQQKLEQDNNNTPEVN

SEQ ID E. ruminantium Erum5620 NSKHVPLVNVHNLFSNIKAIDKVYFDLD

KTVIKDSDKVLLE LVQKAQEDPTTDIII NO:52

V

SEQ ID E, ruminantium Erum5620 DSDKVLLEKLVQKAQEDPTTDIIIV NO:53

SEQ ID E. ruminantium Erum5620 GHTDTRGTDEYNLALGE

NO:54

SEQ ID E. ruminantium Erum5620 QRANAVRDFIISCDKSLEKRITVRSKGKS

EPAI NO:55

SEQ ID E. ruminantium Erum5620 LVYSNNPKEAED AHAKNRRVVI NO:56

In addition to sequences for OmpA and Asp 14 shown in Table 1 , and homologs shown in Tables 2-3, other surface proteins that Aph preferentially expresses in human versus tick cells may be used. Table 4 shows examples of proteins that can be included in the "cocktail" of peptides, polypeptides or protein sequences of the composition of the invention. Examples of these include APH_0915, APH J325 (Msp2), APHJ378, APHJ412, APH_0346, APH_0838, APH_0839, APH_0874, and APH_0906 because all are upregulated 3- to 60-fold during RC-DC transition, DC exit, and/or reinfection and our surface proteomic study indicates that they are surface proteins. The file names for each of the aforementioned proteins are from the A. phagocytophilum HZ annotated genome. A similar expression profile is exhibited by APH_1235, which is another late stage gene that is upregulated 70-fold, as taught by Mastronunzio and colleagues, who identified APH_1235 as an A. phagocytophilum surface protein. P44 is a 44 kilodalton surface protein and is the bacterium's major surface protein. Synonyms of P44 are Msp2 (major surface protein 2) and Msp2 (P44). All Anaplasma species encode P44 proteins and there are huge repertoires of P44 genes in these bacterial species' chromosomes. For instance, the annotated ,4p ¾ strain HZ genome encode 113 P44 proteins. These exist as complete genes or pseudogenes (incomplete genes). There is one expression site for p44 genes. Basically, different p44 genes get shuffled into the expression site by a process known as gene conversion with the end result being that Aph (and other Anaplasma species) can vary the P44 protein on their cell surfaces, a process called antigenic variation. This enables them to perpetually evade the humoral immune response.

Table 4. Anaplamatacaea Surface Proteins Sequence Listing and SEQ ID Numbers

In addition to polypeptides sequences from Aph surface proteins, other sequences may be included in the polypeptides of the invention. Such sequences include but are not limited to antigenic peptide sequences such as linker sequences which in and of themselves are antigenic. Examples of recombinant protein tags that may be useful in practicing the invention include but are not limited to glutathione-S-transferease (GST), poly-histidine, maltose binding protein (MBP), FLAG, V5, halo, myc, hemaglutinin (HA), S-tag, calmodulin, tag, streptavidin binding protein (SBP), Softagl™, Softag3™, Xpress tag, isopeptag, Spy Tag, biotin carboxyl carrier protein (BCCP), GFP, Nus-tag, strep-tag, thioredoxin tag, TC tag, and Ty tag. Examples of linker sequences include but are not limited to an amino acid spacer, an amino acid linker, a signal sequence, a stop transfer sequence, a transmembrane domain, and a protein purification ligand. It should also be recognized that a multitude of other such sequences are known to those of skill in the art, and inclusion of other antigenic, linker, or tag sequences is contemplated.

Those of skill in the art will recognize that, while in some embodiments of the invention, the amino acid sequences that are chosen for inclusion in the polypeptides of the invention correspond exactly to the primary amino acid sequence of the original or native sequences of an Asp 14 or OmpA protein, this need not always be the case. The amino acid sequence of an epitope that is included in the polypeptides of the invention may be altered somewhat and still be suitable for use in the present invention. For example, certain conservative amino acid substitutions may be made without having a deleterious effect on the ability of the polypeptides to elicit an immune response. Those of skill in the art will recognize the nature of such conservative substitutions, for example, substitution of a positively charged amino acid for another positively charged amino acid (e.g. for R or vice versa); substitution of a negatively charged amino acid for another negatively charged amino acid (e.g. D for E or vice versa); substitution of a hydrophobic amino acid for another hydrophobic amino acid (e.g. substitution of A, V, L, I, W, etc. for one another); etc. All such substitutions or alterations of the sequences of the polypeptides that are disclosed herein are intended to be encompassed by the present invention, so long as the resulting polypeptides still function to elicit a suitable immune response. In addition, the amino acid sequences that are included in the polypeptides or any chimeric proteins of the invention need not encompass a full length native

polypeptide. Those of skill in the art will recognize that truncated versions of amino acid sequences that are known to be or to contain antigenic polypeptides may, for a variety of reasons, be preferable for use in the practice of the invention, so long as the criteria set forth for an epitope is fulfilled by the sequence. Amino acid sequences that are so substituted or otherwise altered may be referred to herein as "based on" or "derived from" the original wild type or native sequence. In general, the Asp 14 or OmpA proteins or polypeptide fragments from which the linear epitopes are "derived" or on which the linear epitopes are "based" are the Asp 14 or OmpA proteins or peptide fragments as they occur in nature. These natural Aspl4/OmpA proteins may alternatively be referred to as native or wild type proteins.

Such changes to the primary sequence may be introduced for any of a variety of reasons, for example, to eliminate or introduce a protease cleavage site, to increase or decrease solubility, to promote or discourage intra- or inter-molecular interactions such as folding, ionic interactions, salt bridges, etc, which might otherwise interfere with the presentation and accessibility of the individual epitopes along the length of a peptide or polypeptide. All such changes are intended to be encompassed by the present invention, so long as the resulting amino acid sequence functions to elicit a protective antibody response in a host to whom it is administered. In general, such substituted sequences will be at least about 50% identical to the corresponding sequence in the native protein, preferably about 60 to 70, or even 70 to 80, or 80 to 90% identical to the wild type sequence, and preferably about 95, 96, 97, 98, 99, or even 100% identical to a native Asp 14 or OmpA sequence or peptide fragment. The reference native Asp 14 or OmpA sequence or peptide fragment may be from any suitable type of Anaplasmataceae, e.g. from any Anaplasmataceae which is known to infect mammals.

In some embodiments of the invention, individual linear epitopes in a chimeric vaccinogen are separated from one another by intervening sequences that are more or less neutral in character, i.e. they do not in and of themselves elicit an immune response to Anaplasmataceae. Such sequences may or may not be present between the epitopes of a chimera. If present, they may, for example, serve to separate the epitopes and contribute to the steric isolation of the epitopes from each other. Alternatively, such sequences may be simply artifacts of recombinant processing procedures, e.g. cloning procedures. Such sequences are typically known as linker or spacer peptides, many examples of which are known to those of skill in the art. See, for example, Crasto, C. J. and J. A. Feng. 2000.

In addition, other elements may be present in chimeric proteins, for example leader sequences or sequences that "tag" the protein to facilitate purification or detection of the protein, examples of which include but are not limited to tags that facilitate detection or purification (e.g. S-tag, or Flag-tag), other antigenic amino acid sequences such as known T-cell epitope containing sequences and protein stabilizing motifs, etc. In addition, the chimeric proteins may be chemically modified, e.g. by amidation, sulfonylation, lipidation, or other techniques that are known to those of skill in the art.

The invention further provides nucleic acid sequences that encode chimeric proteins of the invention. Such nucleic acids include DNA, RNA, and hybrids thereof, and the like. Further, the invention comprehends vectors which contain or house such coding sequences. Examples of suitable vectors include but are not limited to plasmids, cosmids, viral based vectors, expression vectors, etc. In a preferred embodiment, the vector will be a plasmid expression vector.

The chimeric proteins of the invention may be produced by any suitable method, many of which are known to those of skill in the art. For example, they may be chemically synthesized, or produced using recombinant DNA technology (e.g. in bacterial cells, in cell culture (mammalian, yeast or insect cells), in plants or plant cells, or by cell-free prokaryotic or eukaryotic-based expression systems, by other in vitro systems, etc.). In some embodiments, the polypeptides are produced using chemical synthesis methods.

The present invention also provides compositions for use in eliciting an immune response. The compositions may be utilized as vaccines to prevent or treat anaplasmosis, particularly when manifested in humans as HGA. By eliciting an immune response, we mean that administration of the antigen causes the synthesis of specific antibodies (at a titer as described above) and/or cellular proliferation, as measured, e.g. by H thymidine incorporation, or by other known techniques. By "vaccine" we mean a linear polypeptide, a mixture of linear polypeptides or a chimeric or fusion polypeptide that elicits an immune response, which results in protection of an organism against challenge with an Anaplasmataceae species bacterium. The protective response either wholly or partially prevents or arrests the development of symptoms related to anaplasmosis or HGA infection (i.e. the symptoms of anaplasmosis), in comparison to a non-vaccinated (e.g. adjunct alone) control organisms, in which disease progression is not prevented. The compositions include one or more isolated and substantially purified polypeptides or chimeric peptides as described herein, and a pharmacologically suitable carrier. The polypeptides or chimeric peptides in the composition may be the same or different, i.e. the composition may be a "cocktail" of different polypeptides or chimeric peptides, or a composition containing only a single type of polypeptide or chimeric peptide. The preparation of such compositions for use as vaccines is well known to those of skill in the art. Typically, such compositions are prepared either as liquid solutions or suspensions, however solid forms such as tablets, pills, powders and the like are also contemplated. Solid forms suitable for solution in, or suspension in, liquids prior to administration may also be prepared. The preparation may also be emulsified. The active ingredients may be mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredients. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol and the like, or combinations thereof. In addition, the composition may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and the like. The vaccine preparations of the present invention may further comprise an adjuvant, suitable examples of which include but are not limited to Seppic, Quil A, Alhydrogel, etc. If it is desired to administer an oral form of the composition, various thickeners, flavorings, diluents, emulsifiers, dispersing aids or binders and the like may be added. The composition of the present invention may contain any such additional ingredients so as to provide the composition in a form suitable for administration. The final amount of polypeptides or chimeric peptides in the formulations may vary. However, in general, the amount in the formulations will be from about 0.01- 99%, weight/volume.

The methods involve administering a composition comprising recombinant polypeptides or chimeric peptides in a pharmacologically acceptable carrier to a mammal. The mammal may be a human, but this need not always be the case. Because

anaplasmosis is a zoonotic disease that causes anaplasmosis in all known mammalian hosts, veterinary applications of this technology are also contemplated. The vaccine preparations of the present invention may be administered by any of the many suitable means which are well known to those of skill in the art, including but not limited to by injection, inhalation, orally, intranasally, by ingestion of a food product containing the polypeptides or chimeric peptides, etc. In some embodiments, the mode of administration is subcutaneous or intramuscular. In addition, the compositions may be administered in conjunction with other treatment modalities such as substances that boost the immune system, various anti-bacterial chemotherapeutic agents, antibiotics, and the like. The present invention provides methods to elicit an immune response to

Anaplasmataceae and/or to vaccinate against Anaplasmataceae infection in mammals. In one embodiment, the mammal is a human. However, those of skill in the art will recognize that other mammals exist for which such vaccinations would also be desirable, e.g. the preparations may also be used for veterinary purposes. Examples include but are not limited to companion "pets" such as dogs, cats, etc.; food source, work and recreational animals such as cattle, horses, oxen, sheep, pigs, goats, and the like; or even wild animals that serve as a reservoir of Anaplasmataceae, particularly wild animals adapted to living in close proximity to urban areas (e.g. mice, deer, rats, raccoons, opossum, coyotes, etc).

The invention also provides a diagnostic and a method for using the diagnostic to identify individuals who have antibodies to the epitopes contained within the

polypeptides or chimeric proteins of the invention. A biological sample from an individual (e.g. a human, a deer, or other mammals susceptible to infection by

Anaplasmataceae) suspected of having been exposed to Anaplasmataceae, or at risk for being exposed to Anaplasmataceae, is contacted with the peptides, polypeptides, or chimeric proteins of the invention. Using known methodology, the presence or absence of a binding reaction between the polypeptides or chimeric proteins and antibodies in the biological sample is detected. A positive result (i.e. binding occurs, thus antibodies are present) indicates that the individual has been exposed to and/or is infected with

Anaplasmataceae. Further, the diagnostic aspects of the invention are not confined to clinical use or home use, but may also be valuable for use in the laboratory as a research tool, e.g. to identify Anaplasmataceae bacteria isolated from ticks, to investigate the geographical distribution of Anaplasmataceae species and strains, etc.

The present invention also encompasses antibodies to the epitopes and/or to the polypeptides or chimeric proteins disclosed herein. Such antibodies may be polyclonal, monoclonal or chimeric, and may be generated in any manner known to those of skill in the art. In a preferred embodiment of the invention, the antibodies are bactericidal, i.e. exposure of Anaplasmataceae bacteria to the antibodies causes death of the bacteria. Such antibodies may be used in a variety of ways, e.g. as detection reagents to diagnose prior exposure to Anaplasmataceae, as a reagent in a kit for the investigation of Anaplasmataceae, to treat Anaplasmataceae infections, etc.

Alternatively, appropriate antigen fragments or antigenic sequences or epitopes may be identified by their ability, when included in polypeptides or chimeric proteins, to elicit suitable antibody production to the epitope in a host to which the polypeptides or chimeric proteins are administered. Those of skill in the art will recognize that definitions of antibody titer may vary. Herein, "titer" is taken to be the inverse dilution of antiserum that will bind one half of the available binding sites on an ELISA well coated with 100 ng of test protein. In general, suitable antibody production is characterized by an antibody titer in the range of from about 100 to about 100,000, and preferably in the range of from about 10,000 to about 10,000,000. Alternatively, and particularly in diagnostic assays, the "titer" should be about three times the background level of binding. For example, to be considered "positive", reactivity in a test should be at least three times greater than reactivity detected in serum from uninfected individuals. Preferably, the antibody response is protective, i.e. prevents or lessens the development of symptoms of disease in a vaccinated host that is later exposed to Anaplasmataceae, compared to an unvaccinated host.

The following Examples are provided to illustrate various embodiments of the invention, however, as described in detail above, aspects of the invention can be practiced in a variety of ways different from those illustrated in the Examples.

EXAMPLES

The following experimental procedures were used in the examples of the invention:

Cell lines and cultivation of uninfected and Aph-infected HL-60 cells. PSGL-1 CHO cells and RF/6A cells were cultivated as described [21,77]. Uninfected HL-60 cells (American Type Culture Collection [ATCC]; Manassas, VA; ATCC code CCL-240) and HL-60 cells infected with the Aph NCH-1 strain or a transgenic HGE1 strain expressing GFP (a gift from Ulrike Munderloh of the University of Minnesota, Minneapolis, MN) were cultivated. Spectinomycin (Sigma-aldrich, St. Louis, MO) was added to HL-60 cultures harboring transgenic HGE1 bacteria at a final concentration of 100 μg/ml. Aph DC organism surface biotinylation and affinity purification. Aph DC organisms from 10⁹ infected (>90%) HL-60 cells were enriched for by soni cation followed by differential centrifugation as described [61]. To purify DC organisms away from the majority of contaminating host and RC organism cellular debris, the sonicate was fractionated using discontinuous Renografin (diatrizoate sodium, Bracco diagnostics, Princeton, NJ) density gradient centrifugation. Purified DC organisms were resuspended in 1 ml of phosphate-buffered saline (PBS) (pH 8.0) containing 1 mM MgCl₂ and 10 mM Sulfo-NHS-SS-Biotin (Pierce; Rockland, IL) and incubated for 30 min at room

temperature. Free biotin was quenched by washing the sample with 50 mM Tris (pH 8.0), followed by two washes with PBS. Biotinylated bacteria were solubilized in

radioimmunoprecipitation assay (RIP A) buffer (25 mM Tris-HCl [pH 7.6], 150 mM NaCl, 1% NP-40, 1 % sodium deoxycholate, 0.1 % sodium dodecyl sulfate [SDS], 1 mM sodium orthovanadate, 1 mM sodium fluoride, and Complete EDTA-free protease inhibitor set cocktail [Roche, Indianapolis, IN]) on ice for 1 h. Every 20 min during the 1- h incubation, the sample was subjected to eight 8-s bursts on ice interspersed with 8-s rest periods using a Misonix S4000 ultrasonic processor (Farmingdale, NY) on an amplitude setting of 30. Insoluble material was removed by spinning at 10,000 X g for 10 min at 4°C. To purify biotinylated proteins, the clarified lysate was mixed with High Capacity NeutrAvidin agarose beads (Pierce) by end-over-end rotation overnight at 4°C. The gel slurry was pelleted by centrifugation at 1 ,000 X g for 1 min. After removal of the supernatant, the beads were resuspended in eight ml PBS and parceled into ten 800 μΐ aliquots, each of which were added to spin columns optimized for affinity purification (Pierce). The columns were washed three times with PBS and centrifuged at 1 ,000 X g to remove any non-biotinylated proteins. The captured biotinylated proteins were eluted from the beads by end-over-end rotation with 150 mM DTT in 0.25% sodium

deoxycholate for 2 h at room temperature. The agarose beads were centrifuged at 1 ,000 X g for 2 min and the supernatant containing the biotinylated proteins was saved. The Bradford assay was used to determine the protein concentration of the eluate. The majority of the sample was stored at 4°C until analysis. To ensure that this procedure had enriched for DC bacterial surface proteins, an aliquot of the affinity-purified sample was resolved by SDS-PAGE alongside an Aph whole-cell lysate, neutravidin beads plus unlabeled DC whole cell lysate, and neutravidin beads alone followed by silver staining.

2D-LC/MS-MS proteome analysis. Unless otherwise stated, all buffers were made with LC/MS grade solvents (Fisher Chemical, Fairlawn, NJ). Samples were processed for proteomic analysis as described previously with the following methodological details. Following biotinylation enrichment of Aph surface proteins, 300 μg of protein mass in 400 μΐ of lysis buffer was concentrated and exchanged into 25 μΐ of ammonium bicarbonate buffer (ABC) (50 mM NH₄CO₃/0.05% C₂₄H₃₉0₄Na) using a Centriprep YM- 10 filter unit (Millipore, Billerica, MA). DTT was added to achieve a final concentration of 20 mM, and disulfide bonds were reduced at 90°C for 30 min. After cooling to room temperature, cysteine alkylation was performed on the sample with freshly prepared iodoacetamide (32 mM) for 30 min at room temperature in the dark. Trypsin Gold (100 ng/μΐ; Promega, Madison, WI) was added to a final 1 : 100 enzyme:protein ratio, and the sample was incubated at 37°C overnight. The digested sample was dried within a speed vacuum and stored dry at -20°C.

The digest sample was reconstituted in 60 ih of 100 mM ammonium formate (pH 10) for multidimensional peptide separation and mass spectrometry analysis on a 2D- nanoAcquity chromatography system online with a Synapt quadrupole / time-of-flight tandem mass spectrometer (Waters) as previously reported. Two-replicate injections were analyzed for the sample. Resulting data were processed using PLGS software, v2.4 (Waters) as described elsewhere. Data were then search against an _^4/?A-specific FASTA database (RefSeq and Uniprot sources; downloaded Feb. 2010) and its reversed- sequences as a decoy database. Search parameters required a minimum precursor ion intensity of 500 counts, two or more peptide sequences per protein and a minimum of seven matching fragment ions. Trypsin selectivity was specified allowing for 1 missed cleavage event and variable methionine oxidation. Using a decoy-database method, a score threshold was calculated at the 5% false-discovery rate. Confidence in the protein identification is also increased for those that were identified against both RefSeq and Uniprot Aph databases.

Analyses of differential Aph gene expression over the course of infection.

Synchronous infections of HL-60 cells with Aph DC organisms were established. Indirect immunofluorescence microscopic examination of aliquots recovered at 24 h confirmed that > 60% of HL-60 cells contained morulae and that the mean number of morulae per cell was 2.8 + 0.6. The infection time course proceeded for 36 h at 37°C in a humidified atmosphere of 5% C0₂. At the appropriate time-point, aliquots were removed and processed for RNA isolation and RT-qPCR was performed using gene-specific primers. Relative transcript levels for each target were normalized to the transcript levels of the Aph 16S rRNA gene {Aph J 000) using the 2^"ΔΔ0 _Τ method.

Transmission feeding of Aph infected Ixodes, scapularis nymphs. Aph -infected I. scapularis nymphs were obtained from a tick colony maintained at Yale University (New Haven, CT). To propagate Aph-infected ticks, clean /. scapularis larvae were fed on ^ ?A-infected C3H/HeJ mice, and the larvae were allowed to molt to nymphs. Infection was confirmed by testing 10% of each tick batch by PCR of the Aph 16S rRNA gene. Ticks were incubated at 23°C with 85% relative humidity between feedings. To collect transmission-fed nymphs, groups of 20-25 infected tick nymphs were placed to feed on clean 5-6 week-old C3H/HeJ female mice and removed after 24, 48, or 72 hours of feeding. Salivary glands dissected from 2-3 ticks were pooled into a tube of RLT buffer and frozen at -80°C, prior to RNA extraction with the Qiagen RNEasy Kit (Qiagen, CA). Unfed ticks were dissected and RNA extracted from combined salivary glands and midguts. RT-qPCR was performed as described above.

Recombinant protein expression and purification and antisera production. Aph genes of interest were amplified using gene-specific primers and Platinum Pfx DNA polymerase (Invitrogen). Amplicons were cloned into pENTR/TEV/D-TOPO

(Invitrogen) as described [83] to yield pENTR-candidate gene entry plasmids containing the genes of interest. Plasmid inserts were verified and recombination of the candidate gene insert downstream of and in frame with the gene encoding GST was achieved using the pDest-15 vector (Invitrogen). In some cases plasmids encoding GST-OmpA or GST- Asp 14 were subjected to PCR mutagenesis using the Stratagene Quick Change kit according to the manufacturer's instructions for the purpose of inserting DNA segments encoding five-amino acid linkers or substituting the alanine codon for a specific OmpA or Asp 14 amino acid. Expression and purification of GST-OmpA, GST-Aspl4, and GST- Msp5 and generation of murine polyclonal antisera against each protein were performed as described. LH-conjugated peptides corresponding to OmpA amino acids 23-40, 41- 58, or 59-74 or Aspl4 amino acids 101-1 12 or 1 13-124 were synthesized by and used for raising rabbit polyclonal antiserum against each peptide by New England Peptides (Gardner, MA).

Antibodies, western blot analyses, and spinning disk confocal microscopy.

Antisera generated in this study and previous studies targeted OmpA, Aspl4, Msp5, APH_0032 [61], APHJ387 [83], Msp2 (P44), and Asp55 and Asp62. The latter two antibodies were gifts from Yasuko Rikihisa of The Ohio State University (Columbus, OH). Anti-Msp2 (P44) mAb 20B4 [84,85] was a gift from J. Stephen Dumler of The Johns Hopkins University (Baltimore, MD). Western blot analyses were performed. Aph infected HL-60 cells were processed and analyzed via indirect immunofluorescence using spinning disk confocal microscopy.

Surface trypsin digestion of intact Aph DC organisms. Intact DC bacteria were incubated at a 10:1 ratio of total protein to trypsin (Thermo Scientific, Waltham, MA) in IX PBS or vehicle alone at 37°C. After 30 min, phenylmethanesulfonyl fluoride (Sigma) was added to a final concentration of 2 mM. Bacteria were pelleted at 5,000 g for 10 min, after which pellets were resuspended in urea lysis buffer and processed. Lysates of trypsin- and vehicle-treated Aph organisms were fractionated by SDS-PAGE, Western- blotted, and screened with antibodies targeting OmpA, Aspl4, Asp55 [33], Msp5, Msp2 (P44), and APH_0032.

Flow cytometry. 1 x 10⁷ HL-60 cells infected with either transgenic HGE1 organisms expressing GFP or wild-type Aph bacteria were mechanically lysed followed by differential centrifugation to pellet host cellular debris. GFP -positive Aph organisms and remaining host cellular debris were pelleted, followed by resuspension in PBS containing equivalent amounts of a 1 :25 dilution of preimmune mouse serum, mouse anti-Aspl4 or anti-OmpA, or secondary antibody alone. Antibody incubations and wash steps were performed. For FACS analyses, samples were analyzed on a FACSCanto II Flow Cytometer (Becton Dickinson, Franklin Lakes, NJ). 1 10 events, which corresponded to individual Aph organisms and host cellular debris, were collected in the VCU Flow Cytometry and Imaging Shared Resource Facility. Post data-acquisition analyses were performed using the FCS Express 4 Flow Cytometry software package (De Novo Software, Los Angeles, CA).

In silico analyses. The MEMSAT-SVM algorithm (bioinf.cs.ucl.ac.uk/psipred) was used to predict the membrane topology of Aph OmpA. Predicted signal sequences for Anaplasma spp., Ehrlichia spp., and O. tsutsugamushi OmpA proteins were determined using TMPred (www.ch.embnet.org/software/TMPRED_form). Alignments of OmpA sequences (minus the predicted signal sequences) were generated using CLUSTAL W. The tertiary structure for Aph OmpA was predicted using the PHYRE² (Protein

Homology/analogy Recognition Engine, version 2.0) server (see the website at sbg.bio.ic.ac.uk/phyre2). To assess how OmpA potentially interacts with sLe^x, the OmpA tertiary structure predicted by PHYRE² was docked with the crystal structure for sLe^x using the autodock vina algorithm.

Assay for inhibition of Aph binding and infection. For antibody blocking studies, infection assays were performed as described, except that host cell-free Aph organisms were incubated with heat-killed mouse polyclonal antiserum targeting GST, GST-Aspl4, or GST-OmpA (10-200 ug/ml) or rabbit polyclonal anti-OmpA (targeting OmpA aa23- 40, aa43-58, or aa59-74) and/or anti-Aspl4 peptide serum (targeting Aspl4 aa98-l 12 or aa 113-124) for 30 min, after which the bacteria were added to HL-60 cells in the continued presence of antiserum for 1 h. Unbound bacteria were removed and aliquots of host cells were examined for bound Aph organisms using indirect immunofluorescence microscopy. The remainders of the samples were incubated for 48 h, after which host cells were examined for the presence of morulae using indirect immunofluorescence microscopy. For recombinant protein blocking studies, RF/6A or HL-60 cells were incubated with 4 μΜ GST; GST-Aspl4; GST-OmpAor GST ΑΡΗ_1387_Δ π at 37°C for 1 h. Host cells were washed with PBS to remove unbound proteins, fixed with

paraformaldehyde for 1 h, and permeabilzed with ice-cold methanol for 30 min. Protein binding to host cells was assessed by indirect immunofluorescence microscopy using rabbit anti-GST antibody (Invitrogen). For blocking studies, host cells were incubated with recombinant proteins for 1 h after which Aph organisms were added for an additional 24 h. Unbound bacteria were removed and the samples were incubated for 48 h followed by immunofluorescence microscopy analysis for the presence of morulae. Statistical analyses. The Student's t test (paired) performed using the Prism 4.0 software package (Graphpad; San Diego, CA) was used to assess statistical significance. Statistical significance was set at/? < 0.05.

Example 1. Neutravidin affinity purification of biotinylated Aph DC surface proteins and two-dimensional-liquid chromatography tandem mass spectrometry (2D-LC/MS-MS) proteome analysis identifies novel outer membrane protein candidates. DC bacteria were purified to remove the majority of contaminating host cellular debris. DC surface proteins labeled by Sulfo-NHS-SS-Biotin were recovered by neutravidin affinity chromatography (data not shown). Aliquots of input host cell-free DC lysate, affinity-captured DC surface proteins, neutravidin beads plus unlabeled DC whole cell lysate (lane 3), and neutravidin beads alone were resolved by SDS-PAGE followed by silver staining.

Because the Aph DC is the adherent and infectious form and the complement of DC surface proteins is unknown, we set out to identify DC surface proteins. Aph infected HL-60 cells were sonicated to liberate the bacteria from host cells and destroy fragile RC organisms. Electron microscopic examination of sonicated samples confirmed the presence of DC, but not RC bacteria, along with host cellular debris (data not shown). DC organisms were surface-labeled and biotinylated proteins were captured by

chromatography. Aliquots of affinity-captured DC proteins, input host cell-free DC lysate, neutravidin beads plus unlabeled DC whole cell lysate, and neutravidin beads alone were resolved by SDS-PAGE followed by silver staining (data not shown).

Comparison of the banding patterns of the input lysate and eluate revealed enrichment for many proteins. With the exception of proteins of 44 kDa and 70 kDa, both of which were recovered in low abundances, non-biotinylated DC whole cell lysate proteins did not bind to neutravidin beads.

Eluted proteins were subjected to 2D-LC/MS-MS proteomic analysis. Resulting data were searched against 2

FASTA databases (RefSeq and Uniprot sources) using Protein Lynx Global Surveyor (PLGS) software. Table 5 summarizes a total of 56 identified Aph proteins, 47 of which were identified in both the RefSeq and UnitProt sources.

APH 0346 Chaperone protem DnaK 69,676 4.9 381.2 25 34.4 177.7 380.1 24 36.4 177.7

APH_0248 Hypothetical protein (Asp 14) 13,824 4.9 359.0 10 58.1 0

APH 1049 Major surface protein 5 23,341 4.7 353.7 4 22.5 170.6 339.9 3 22.5 170.6

APH J334 F0F1 ATP synthase subunit 54,068 5.3 312.1 30 34.8 180.0 270.5 23 28.5 0 alpha

APH 0051 Iron binding protein 37,317 5.2 252.9 4 14.6 0 318.8 5 17.9 109.1

APH 0853 Hypothetical protein 10,833 9.3 249.9 4 62.9 0 162.7 1 15.5 0

APH_0625 Immunogenic protein; 34,653 5.9 229.0 6 28.6 0 207.9 5 28.6 0 membrane transporter

APHJ050 Putative phosphate ABC 37,567 5.6 221.0 3 16.5 0 192.1 1 2.7 0 transporter periplasmic

phosphate binding protein

APH 1246 Glutamine synthetase type I 52,383 6.0 216.0 9 10.2 0 228.0 10 10.2 0

APH 1232 Citrate synthase I 45,591 5.8 213.8 5 19.7 0 151.0 2 3.6 0

APH_0600 Thiamine biosynthesis protein 61 ,522 6.0 203.3 4 11.0 0 206.0 4 13.5 0

ThiC

APH_0059 Phenylalanyl tR A 39,277 6.5 197.0 7 14.0 0 180.0 8 1 1.4 0 synthetase alpha subunit

APH 0555 Cysteinyl tRNA synthetase 51 ,774 5.8 192.8 5 18.6 0 197.2 4 16.0 0

APH 0794 Hypothetical protein 27, 1 19 7.1 183.9 2 8.4 0 164.8 1 4.2 0

APH 0740 AnkA 131,081 6.1 182.8 1 1 7.2 0 189.2 13 8.2 0

APH J258 Fructose bisphosphate 32,685 6.7 182.0 5 9.2 0 193.7 4 9.2 0 aldolase

APH 1025 50S ribosomal protein L7 L12 14,122 4.8 181.5 2 23.9 0

APH 1292 Cell division protein FtsZ 41 ,975 5.0 181.3 3 13.3 0 205.0 3 10.5 0

APH_1210 OMP85 family outer 85,652 8.5 173.9 7 8.3 0 165.5 6 5.7 0

membrane protein

APH 0283 50S ribosomal protein L2 29,772 11.5 169.5 3 8.3 0 154.1 2 6.2 0

APH 0893 Heat shock protein 90 71 , 123 4.9 167.9 6 12.7 0 173.7 9 17.0 0

APH 0111 Uridylate kinase 26,347 6.9 164.4 2 13.1 0 176.4 3 18.0 0

APH_ 0608 PpiC parvulin rotamase 67,363 4.9 161.4 10 13.1 0 144.2 8 9.0 0

family protein

APH_1359 Major outer membrane 31,617 9.0 157.8 2 5.5 0 142.4 2 5.5 0

protein OMP-1A

APH_1084 Cytochrome c oxidase subunit 29,873 6.1 155.0 3 13.0 0

11

APH 0422 Acetylglutamate kinase 35,726 4.6 151.9 2 7.0 0

APH 0971 Putative trigger factor 49,358 4.8 140.8 3 13.0 0 138.3 2 10.0 0

APH 0038 CTP synthetase 59,416 5.5 139.6 2 5.9 0 136.9 2 5.9 0

APH_ _1355 P44 79 outer membrane 50,321 8.7 139.0 2 3.9 0 147.7 2 4.6 0 protein

APH _0669 Bifunctional proline 114,508 5.1 139.0 4 6.9 0 159.1 5 7.6 0 dehydrogenase pyrroline 5

carboxylate dehydrogenase

APH_ 0450 ATP dependent Clp protease 86,715 6.2 138.0 2 1.6 0

ATP binding subunit ClpA

APH 0231 Leucyl aminopeptidase 54,61 1 5.5 128.8 3 1 1.4 0

APH ^~0874 Hypothetical protein 1 15,420 6.6 123.2 5 2.9 0

APH~ _1017 Outer membrane protein 46,971 8.4 131.9 2 3.6 0

Msp2 family

APH 1339 Conserved domain protein 47,356 7.3 128.6 2 5.1 0

APH 0168 Heme exporter protein CcmC 26,310 9.5 126.7 4 6.9 0

APH ^~0502 tRNA pseudouridine synthase 28,012 8.8 131.9 2 3.6 0

A

"Refseq, A. phagocytophilum, Downloaded Feb. 2010

^UniProt, A. phagocytophilum, Downloaded Feb. 2010

cmW, molecular weight in Daltons

dpl, isoelectric point

efmol, femtomoles

^■^Proteins that have been previously confirmed to be on the A. phagocytophilum surface and/or were recovered by surface biotinylation and affinity

chromatography in the study by Ge and colleagues are denoted by bold text.

^Peptides that are considered in-source fragments are given a 0 fmol value as their quantification is confounded by signal lost within the mass spectrometer.

All proteins for which at least two peptides were identified from either RefSeq or UnitProt and scored above a 5% false-discovery cutoff are listed. Three protein identifications from each search result are likely false-positives, and are most probably among those found on one search result. Nine proteins had previously been delineated as being surface-localized, thereby validating the efficacy of our approach. Ten paralogs of the major surface protein 2 [Msp2 (P44)] family were identified, eight of which yielded the highest PLGS scores.

Example 2. Selection of Aph OMP candidates for further study. Figure 1A illustrates the experimental timeline relative to the the infection cycle and stages of Aph organisms during infection of a host. DC organisms were used to synchronously infect HL-60 cells and the infection proceeded for 36 h, a time period that allows for the bacteria to complete their biphasic developmental cycle and reinitiate infection. Total RNA was isolated from the DC inoculum and from infected host cells at several postinfection time points. RT-qPCR was performed using gene-specific primers. Relative transcript levels for each target were normalized to Aph 16S rRNA gene transcript levels using the 2^"AAC _T method. To determine the relative transcription of OMP candidate genes between RC and DC organisms, normalized transcript levels of each gene per time point (shown in Figure 1B-D) were calculated as the fold-change in expression relative to expression at 16 h (encircled in the experimental timeline in Figure 1A), a time point at which the Aph population consists exclusively of RC organisms. (Figure 1 A) Diagram of the experimental design highlighting the time points at which RNA was isolated, the Aph biphasic developmental and infection stages, and the expression categories into which each gene of interest was classified based on its expression profile. (Figures 1B-D) RT- qPCR results for each OMP candidate-encoding gene of interest are grouped as (IB) early stage, (1C) mid stage, and (ID) late stage depending on when during the course of infection they are most highly expressed. (Figure IE) RT-qPCR results for control genes. The data in Figures 1B-E are the means and standard deviations of results for triplicate samples and are representative of two independent experiments that yielded similar results. Several proteins were selected for differential gene expression analysis over the course of Aph infection. Aspl4, APH_0625, and APH_0874 were chosen because they were hitherto hypothetical proteins. For the remainder of this paper, we will refer to "hypothetical" proteins for which we have demonstrated expression as "uncharacterized" proteins. APHJ049 (Msp5), APHJ210 (Omp85), and APH 1359 (Omp-IA) were selected because, even though they are confirmed Anaplasma spp. proteins, their differential gene expression patterns have yet to be studied. APH_0240 (chaperonin GroEL), APH_0346 (Dna ), and APHJ032 (elongation factor Tu) were chosen because, even though these proteins play housekeeping roles, they have also been identified as surface proteins of Aph and other bacterial species and/or have been linked to bacterial adhesion.

A limitation of the surface biotinylation-affinity proteomics method is that it will not identify surface proteins that are inaccessible to the cross-linker, either due to a lack of free amine groups for cross-linking or due to excessive distance from the bacterial surface to which it extends relative to the length of the cross-linker. Also, detergents may not fully extract integral membrane proteins or protein complexes. Lastly, a surface protein that is in low abundance may not be in sufficient quantity to be detected even if biotinylated. We rationalized that Aph genes upregulated during colonization of mammalian versus tick cells are important for infection of mammalian cells. Therefore, as a complementary approach, we selected 9 candidate genes that are known to be preferentially expressed during infection of HL-60 cells and endothelial cells versus infection of ISE6 (immortalized I. scapularis embryonic) cells and are predicted by the CELLO subcellular prediction server to localize to the Aph outer membrane. These candidates, which were not detected by our or a previous surface proteomics study, are OmpA (homologous to peptidoglycan-associated lipoprotein [Pal]; conserved among most Gram-negative bacteria), APHJ220 (Omp-IN), APHJ325 (Msp2), APH_0838, APH_0839, APH_0906, APH_0915, APHJ378, and APHJ412. We also selected aph_0441 and aph _1170, because they encode previously detected, but uncharacterized Aph surface proteins. The SignalP 3.0 server predicts 9 of the 20 candidates - OmpA, Omp-la, Omp-IN, Omp85, Msp2, Msp5, APH_0441, APH_0915, and APHJ378 - to carry N-terminal signal peptide sequences. The TMPred algorithm (see the website at ch.embnet.org/software/TMPRED_form.html) predicts that all candidates except for Asp 14 and APH 1412 carry one or more transmembrane domains.

Example 3. Differential transcription profiling of omp candidate genes throughout the Aph infection cycle. To gain insight into the transcription of the 20 genes of interest during the Aph infection cycle, we synchronously infected HL-60 cells with DC organisms and allowed the infection to proceed in order for the bacteria to complete their biphasic developmental cycle and initiate a second round of infection. We isolated total RNA from DC organisms used as the inoculum and from bacteria recovered at several post-infection time points. RT-qPCR was performed on total RNA using gene-specific primers. Relative transcript levels for each target were normalized to Aph 16S rRNA gene (aph_1000) transcript levels using the 2^"AAC _T method. To facilitate identification of genes that are up-regulated in the infectious DC form compared to the non-infectious RC form, normalized transcript levels for each gene per time point were calculated as the fold- change in expression relative to expression at 16 h, a time point at which the Aph population consists exclusively of RC organisms.

Genes of interest were classified as early (0-12 h), mid (12-24 h), or late stage (24-36 h) (Figure 1 A). The early stage correlates with DC adhesion and invasion, DC to RC differentiation, and initiation of RC replication. Early stage gene transcription increased at 4 h and peaked at 8 h or 12 h, except for asp 14 and aph_0346, both of which peaked at 4 h (Figure IB). Expression levels of all early stage genes began to increase again between 28 and 36 h, which correspond to the period during which Aph RC organisms differentiate to DC organisms and initiate the second round of infection. Mid stage gene expression, which coincides with a period of extensive Aph replication, peaked at 16 h (Figure 1C). Late stage genes were upregulated between 24 and 36 h (Figure ID), a period that correlates with the conversion of RC to DC organisms, DC exit, and initiation of the second round of infection. All target mRNAs were detected in host cell-free DC organisms (Figure 1). Transcript levels of asp!4, aph_0346, aph_0838, aph_0839, aph_0874, aph_0915, aph_1378, aph_1412, and msp2 were more abundant in DC bacteria used as the inoculum than in RC bacteria at 16 h. Because msp2 (P44), asp62, and asp55 encode confirmed Aph surface proteins and because the latter two constitute an operon, these genes were analyzed as controls. Coincident with the kinetics of the infection cycle, msp2 (p44) transcription steadily increased from 4 to 28 h, after which it pronouncedly declined by 32 h. The transcriptional profiles of asp55 and asp62 were highly similar, which reinforces the accuracy of the expression data obtained for all genes.

Example 4. Aph transcriptionally upregulates ompA and aspl4 during binding and invasion of myeloid but not endothelial cells. It takes up to four hours for the majority of bound Aph organisms to enter and reside within nascent host cell-derived vacuoles. Thus, genes that are upregulated between 0 and 4 h and in the initial hours following bacterial entry conceivably encode products that are important for invasion and/ or establishing infection. Of all genes examined, aspl4 is the most abundantly expressed at 4 h (Figure 1B-E), and aspl4 and ompA exhibit the most abundant non-DC to RC- normalized transcript levels (data not shown). Accordingly, we more closely examined the expression profiles of ompA and aspl4. Differential expression analyses of ompA and aspl4 during Aph invasion of HL-60 and RF/6A cells, during Aph binding to PSGL-1 CHO cells, and during transmission feeding of Aph infected I. scapularis ticks is shown in Figure 2A-C. Aph organisms were incubated with HL-60 (2A), RF/6A (2B), and PSGL-1 CHO cells (2C) for 4 h, a period that is required for bacterial adherence and for >90% of bound bacteria to invade host cells. Aph cannot invade PSGL-1 CHO cells. Total RNA was isolated from the DC inoculum and from host cells at 1, 2, 3, and 4 h post-bacterial addition. (2D) Aph infected I. scapularis nymphs were allowed to feed on mice for 72 h. Total RNA was isolated from the salivary glands of uninfected and transmission fed ticks that had been removed at 24, 48, and 72 h post-attachment. Total RNA was isolated from combined salivary glands and midguts from unfed ticks. (2A-2D) RT-qPCR was performed using gene-specific primers. Relative transcript levels for aspl4 and ompA were normalized to Aph 16S rRNA gene transcript levels. The normalized values in Figures 2A-C are presented relative to aspl4 or ompA transcript levels of the DC inoculum. Data are the means and standard deviations of results for triplicate samples and are representative of two independent experiments that yielded similar results. Aph DC bacteria were added to HL-60 and RF/6A cells, after which RT-qPCR was performed on total RNA isolated at 1 , 2, 3, and 4 h. RNA isolated from the DC bacterial inoculum served as a reference control. aspl4 was upregulated at all time points during adhesion and invasion of HL-60 cells and exhibited a maximal increase at 2 h, whereas ompA demonstrated a maximal increase at 4 h (Figure 2A). Neither ompA nor asp 14 was upregulated during binding and invasion of endothelial cells (Figure 2B).

Example 5. Aph engagement of PSGL-1 promotes upregulation of aspl4, but not ompA. We next examined whether Aph binding to PSGL-1 upregulates either aspl4 or ompA. Chinese hamster ovary cells transfected to express PSGL-1 (PSGL-1 CHO cells) are ideal models for studying Aph-?SGL-\ interactions because they support Aph binding, while untransfected CHO cells that lack PSGL-1 expression do not. Thus, Aph binding to PSGL-1 CHO cells occurs exclusively through bacterial engagement of PSGL- 1. DC bacterial binding to PSGL-1 CHO cells upregulated aspl4, but not ompA (Figure 2C).

Example 6. Aph upregulates ompA and aspl4 during /. scapularis transmission feeding. Aph genes that are induced during the bloodmeal of infected /. scapularis ticks are presumably important for establishing infection in mammals. We examined ompA and aspl4 expression in Aph infected I. scapularis nymphs during transmission feeding on naive mice. Transcripts for neither ompA nor asp 14 were detected in unfed Aph infected nymphs (Figure 2D). Both asp!4 and ompA were induced during transmission feeding, being first detected at 24 h and 48 h, respectively.

Example 7. Aph expresses OmpA and Aspl4 during infection of HL-60 cells and during murine and human infection. As illustrated in Figure 3 A and B, whole cell lysates of E. coli (U), E. coli induced (I) to express GST-OmpA (Figure 3 A) or GST- Aspl4 (Figure 3B), and GST-OmpA (3A) or GST-Aspl4 (3B) purified (P) by glutathione sepharose affinity chromatography were separated by SDS-PAGE and stained with Coomassie blue. (Figures 3C and D) Western blot analyses in which mouse anti-OmpA (aOmpA; raised against GST-OmpA) and aAspl4 (raised against GST-Aspl4) were used to screen whole cell lysates of uninfected HL-60 cells and Ap organisms. The blot in Figure 3D was stripped and rescreened with anti-Msp2 (P44) (aP44). The thin and thick arrows denote Aspl4 and Msp2 (P44), respectively. (Figure 3E) Western blotted MBP- P44, MBP, and whole cell lysates of uninfected HL-60 cells and Aph organisms were screened with aAspl4. The blot was stripped and rescreened with anti-MBP-P44. (Figure 3F) GST-Aspl4 was resolved by SDS-PAGE under non-reducing and reducing conditions, Western-blotted, and screened with aAspl4. (Figure 3G) Western-blotted GST-OmpA, GST-Aspl4, and GST were screened with sera from an HGA patient and an experimentally infected mouse.

The coding regions of ompA (excluding the signal sequence; 19.9 kDa) and aspl4 (13.8 kDa) were cloned and expressed in E. coli as N-terminal glutathione-S-transferase (GST)-tagged fusion proteins designated as GST-OmpA and GST-Aspl4, respectively (Figures 3A and B). After glutathione-Sepharose affinity chromatography, purified GST- OmpA and GST-Aspl4 appeared as 46.0- and 39.8-kDa bands, respectively, upon SDS- PAGE. Each fusion protein was used to immunize mice. Polyclonal anti-OmpA antisera recognized proteins of 22.1 kDa and 19.9 kDa, which correspond to OmpA preprotein and mature OmpA, respectively, in an Aph lysate but not an uninfected HL-60 cell lysate (Figure 3C). In addition to the anticipated 13.8 kDa band, anti-Aspl4 detected a band of approximately 42 kDa in a lysate of Aph, but not uninfected HL-60 cells (Figure 3E). Anti-Aspl4 occasionally detected another band of approximately 28 kDa on blots of Aph lysates (data not shown). Even though the 42-kDa band is close in size to that anticipated for Msp2 (P44), anti-Aspl4 failed to recognize Aph-denved maltose binding protein (MBP)-tagged Msp2 (P44) (Figures 3D and E). An amino acid sequence alignment of Asp 14 with Msp2 (P44)-23, the most abundantly expressed Msp2 (P44) paralog of the Aph NCH-1 strain [56,57], revealed no considerable stretches of homology (data not shown). GST-Aspl4 multimerizes when fractionated by non-denaturing SDS-PAGE (Figure 3F). Thus, the 28- and 42-kDa bands in the Aph lysate recognized by anti-Aspl4 are presumably multimeric complexes that consist exclusively of or contain Asp 14. HGA patient serum and Aph infected mouse serum recognize GST-OmpA and GST-Aspl4 (Figure 3G), signifying that Aph expresses OmpA and Asp 14 during human and murine infection. Example 8. OmpA is differentially expressed by Aph during infection of mammalian versus tick cells, while Asp 14 is expressed during infection of both mammalian and tick cells. Because Aph infects myeloid cells, endothelial cells, and I. scapularis cells in vivo and in vitro, we examined Asp 14 and OmpA expression during infection of HL-60 cells, RF/6A cells, and ISE6 cells, (data not shown). Aph infected HL-60, RF/6A, and ISE6 cells were fixed and viewed by confocal microscopy to determine immunoreactivity with antibodies against Msp2 (P44) (major surface protein; used to identify bacteria), OmpA, or Asp62 (confirmed surface protein). Both OmpA and Asp62 staining yield comparable ring-like bacterial surface staining patterns. Results described are the means and standard deviations of results of at least two separate experiments. At least 200 Msp2 (P44)-positive morulae were scored for Asp 14 and OmpA per condition. Confocal microscopic examination using anti-Aspl4 or anti-OmpA in conjunction with antiserum against constitutively expressed Msp2 (P44) revealed that 100.0% of morulae

(intravacuolar Aph colonies) in each of the three cell lines was Aspl4-positive. OmpA was detected in 100.0% and 48.6 + 15.9% of moruale in HL-60 and RF/6A cells, respectively, but was detected in only 7.0 + 3.5 % of morulae in ISE6 cells (results were statistically significant, p<0.001). Anti-OmpA binding to intracellular Aph organisms yielded a ring-like staining pattern on the periphery of each bacterium that overlapped with signal corresponding to the confirmed surface protein, Msp2 (P44)(data not shown). The anti-OmpA staining pattern was similar to that of another confirmed Aph surface protein, Asp62. Anti-Aspl4 staining was more uniformly distributed over the bacterial cells and exhibited partial overlap with Msp2 (P44) (data not shown).

Example 9. Surface localization of OmpA and Aspl4.

To assess surface presentation of OmpA and Asp 14, intact Aph DC organisms were incubated with trypsin followed by solubilization, western blotting, and screening with anti-OmpA or anti-Aspl4 to determine if immunoaccessible domains of either target protein are presented on the bacterial surface, shown in Figure 4 A and B. In Figure 4 A, Intact DC bacteria were incubated with trypsin or vehicle control, lysed in RIPA buffer, fractionated by SDS-PAGE, and immunoblotted. Western blots were screened with antisera targeting OmpA, Asp55, Msp5, Aspl4, Msp2 (P44), or APH_0032. Data are representative of two experiments with similar results. In Figure 4B, Transgenic Aph organisms expressing GFP were incubated with preimmune mouse serum, mouse anti- Aspl4 or anti-OmpA, or serum recovered from an Aph infected mouse. Primary antibodies were detected with anti-mouse IgG conjugated to Alexa fluor 647. Flow cytometry was used to determine the percentage of Alexa fluor 647- and GFP-positive DC organisms per sample. The fold-increases in the percentages of Alexa fluor 647- positive, GFP-positive DC organisms for each sample relative to preimmune serum are provided. Results presented are the means + SD of three experiments. Statistically significant (*,p< 0.05) values are indicated. Positive control antisera targeted Asp55, Msp2 (P44), and Msp5. Negative control antiserum was specific for APH_0032, which is an Aph effector and is not a surface protein. Anti-Asp55 is specific for a peptide epitope of a surface-exposed loop of the target protein. Considerably less detection of Asp55, OmpA, Asp 14, and Msp5 was observed for trypsin-treated than for vehicle control- treated bacteria, whereas Msp2 (P44) signal intensity was partially reduced and no loss in APH_0032 signal resulted (Figure 4A). As a complementary approach to verify surface presentation of OmpA and Asp 14, transgenic Aph DC organisms expressing GFP were recovered from sonicated HL-60 cells and screened with anti-OmpA, anti-Aspl4, or control antisera using flow cytometry. Serum from an Aph infected mouse recognized 1.9 + 0.8-fold more organisms than preimmune mouse serum (Figure 4B). Anti-OmpA and anti-Aspl4 recognized 5.0 + 2.9- and 4.9 + 2.7-fold more Aph organisms expressing GFP than preimmune mouse serum (Figure 4B).

Example 10. Pretreatment of Aph with anti-OmpA reduces infection of HL-60 cells.

Because OmpA is exposed on the Aph surface, we determined if treating DC organisms with heat-inactivated anti-OmpA serum prior to incubation with HL-60 cells alters bacterial adhesion to or infection of host cells. Anti-OmpA had no effect on bacterial adhesion, but significantly reduced infection (Figure 5A-D). Pretreatment of bacteria with mouse polyclonal anti-GST serum had no effect on binding or infection.

Example 11. In silico analyses of Aph OmpA and comparisons with homologs from other Anaplasmataceae pathogens. Since anti-OmpA inhibits Aph infection, we hypothesized that OmpA may contribute to infection of host cells. We performed in silico analyses to identify the predicted extracellular region of OmpA, which would putatively contain any receptor-binding domain, and to assess whether this and other regions of OmpA are conserved among its homologs from other Rickettsiales bacteria. The OmpA N-terminal region extending through to amino acid 86 is predicted to comprise the only extracellular domain, and amino acids 87-102 are predicted to form a transmembrane helix (Figure 6A). A multiple sequence alignment revealed that the Aph OmpA sequence has several shaded stretches that exhibit identity or similarity with its homologs from other Anaplasma spp. and Ehrlichia spp. (Figure 6A).

The PHYRE server (see the website at sbg.bio.ic.ac.uk/phyre2) predicts tertiary structures for protein sequences and threads the predicted structures on known crystal structures. The highest scoring model for Aph OmpA that exhibits the greatest amino acid sequence identity with the crystal structure on which it was threaded, Bacillus chorismate OmpA, is presented in Figure 6B. Amino acids 44-56 are predicted to form a surface- exposed helix and loop, as indicated by arrows. The peptide K[IV]YFDaxK (where "a" and "x" represent a non-polar and any amino acid, respectively), that corresponds to Aph OmpA residues 49-56 is conserved among Anaplasma spp. and Ehrlichia spp. OmpA proteins.

Example 12. Interactions of GST-OmpA with endothelial cells. We tested if we could detect GST-OmpA binding to RF/6A cells. Since OmpA proteins of Aph and O.

tsutsugamushi exhibit regions of identity, O. tsutsugamushi infects endothelial cells, and it is unknown whether O. tsutsugamushi OmpA interacts with endothelial cells, we also assessed whether GST-tagged O. tsutsugamushi OmpA (GST-OtOmpA) bound to RF/6A cells. Negative controls for cellular adhesion were GST alone and GST-tagged

APHJ 387 amino acids 1 12-579 (GST-APH_13871 12-579). APHJ387 is an Aph effector that associates with the bacterium's vacuolar membrane. APH__1387 amino acids 1 12- 579 lack the transmembrane domain that is required for interacting with eukaryotic cell membranes (unpublished observation). GST-OmpA but not GST bound to RF/6A cells (data not shown). Neither GST-APH_1387i 12-579 nor GST-OtOmpA bound the host cells. GST-tagged Aph OmpA binding to RF/6A cells is therefore specific because

recombinant form of neither an irrelevant Aph protein nor OmpA derived from another Rickettsiales bacterium binds to RF/6A cells. GST-OmpA binding to RF/6A cells does not involve PSGL-1 or sLe^x since antibodies targeting either receptor fail to bind RF/6A cells (data not shown) and a previous report demonstrated that endothelial cells do not express PSGL-1. We examined if preincubating RF/6A cells with GST-OmpA competitively inhibits Aph binding or infection. GST-OmpA but not GST significantly inhibited infection (data not shown). Neither recombinant protein inhibited Aph adhesion (data not shown).

Example 13. Sialidase and trypsin treatments markedly reduce GST-OmpA binding to host cells. Enzymatic removal of sialic acid residues from myeloid cell surfaces pronouncedly inhibits Aph binding and infection. Sialic acid residues are also important for Aph infection of RF/6A cells, as pretreatment of RF/6A cells with sialidases reduced Aph infection by 52.8 + 1.4% (data not shown). The MAL-II lectin recognizes sialic acids that are attached to galactose units via a2,3-linkages. The SNA lectin preferentially binds to sialic acid attached to galactose in an a2,6-linkage. Sialidase treatment abolished MAL-II binding and markedly reduced SNA binding, indicating that the sialidase cocktail completely removed a2,3-linked sialic acids and partially removed a2,6-linked sialic acids. GST-OmpA did not bind as well to RF/6A cells that had been incubated in the vehicle control buffer as compared to other buffers. Nonetheless, GST-OmpA binding to sialidase-treated cells was reduced. These results suggest that OmpA recognizes a2,3- linked sialic acids but is also capable of interacting with a2,6-linked sialic acids.

Pretreatment of RF/6A cells with trypsin, which would effectively digest protein and glycoprotein receptors, including terminally sialylated glycoproteins, nearly eliminated GST-OmpA binding.

Example 14. GST-OmpA competitively inhibits Aph infection of HL-60 cells. To define the relevance of OmpA to Ap ^infection of human myeloid cells and to delineate the OmpA region that is critical for cellular invasion, we examined if preincubating HL- 60 cells with GST-OmpA or fragments thereof inhibits infection by Aph DC organisms. GST-tagged full-length OmpA and OmpAi9_-74, which comprises the majority of the predicted extracellular domain, but not GST-OmpA_75-2o₅ or GST alone had no effect on adhesion (data not shown), but significantly inhibited infection (Figure 7A and B).

Example 15. GST-OmpA inhibits Aph binding to sLe^x-capped PSGL-1. Aph binding to the (x2, 3 -linked sialic acid determinant of sLe^x is necessary for the bacterium to optimally engage sLe^x-capped PSGL-1 and leads to infection of myeloid cells. Since GST-OmpA recognizes a2,3-sialic acid and competitively inhibits Aph infection of HL- 60 cells, we rationalized that GST-OmpA binds to a2,3-sialic acid of sLe^x. To test this, we incubated PSGL-1 CHO cells with GST-OmpA in an attempt to block Aph access to the a2,3-sialic acid determinant of sLe^x-capped PSGL-1 and thereby inhibit bacterial adherence to these cells. As a positive control for preventing bacterial access to the a2,3- linked sialic acid determinant of sLe^x, PSGL-1 CHO cells were incubated with CSLEXl . PSGL-1 CHO cells treated with GST or mouse IgM served as negative blocking controls. GST-OmpA reduced Aph binding to sLe^x-modified PSGL-1 by approximately 60% relative to GST alone, and this degree of inhibition was comparable to the blocking afforded by CSLEXl (data not shown).

Example 16. Model for ow Aph OmpA interacts with its receptor to promote infection of host cells (Figure 8A-D). Sialic acid has long been known to be a determinant that is important for Aph infection. This study demonstrates that OmpA targets sialylated glycoproteins to promote Aph infection. Our results fit the model that Aph employs multiple surface proteins to bind three determinants of sLe^x-capped PSGL-1 to infect myeloid cells (Figure 8A). When these data are examined in the context of results obtained from our own studies and others, the respective contributions of sialic acid, al ,3-fucose, and PSGL-1 N-terminal peptide to Aph binding and entry become clearer. Treating myeloid cells with CSLEXl to blocks, phagocytophilum binding to the sialic acid determinant of sLe^x markedly reduces infection (Figure 8C), a phenomenon that is analogous to the inhibitory action of GST-OmpA. Moreover, the inhibitory effects of CSLEXl and GST-OmpA on Aph binding to PSGL-1 CHO cells are nearly identical. Therefore, while OmpA is capable of binding sialic acid determinants of varied sialylated glycans, its specific interaction with the sialic acid residue of sLe^x is important for bacterial entry. GST-OmpA and GST-OmpAi_{9- 4} binding to host cells reduces Aph infection of HL-60 cells by approximately 52 and 57%, respectively, but has no inhibitory effect on bacterial adhesion. Thus, bacterial recognition of the PSGL-1 N- terminus, al,3-fucose of sLe^x, and perhaps sLe^x-/PSGL-l -independent interactions that still occur when the OmpA-sialic acid interaction is disrupted facilitate bacterial binding but lead to sub-optimal infection (Figure 8B). Antibodies that block access to the PSGL- 1 N-terminal peptide determinant prevent bacterial binding and infection. Therefore, the collective avidity mediated by OmpA interaction with sialic acid together with Aph recognition of al,3-fucose is insufficient to promote bacterial adhesion and,

consequently, entry in the absence of PSGL-1 recognition (Figure 8D).

Example 17. Pretreating Aph with anti-Aspl4 inhibits infection of HL-60 cells. Since Asp 14 is a surface protein, we examined if incubating Aph DC organisms with heat- inactivated Aspl4 antiserum prior to adding them to HL-60 cells inhibited bacterial binding or infection. Anti-Aspl4 had no effect on Aph adhesion, but reduced infection by approximately 33% and lowered the mean number of morulae per cell by approximately 54%), (Figures 9A-D). Inhibition was specific to Asp 14 antiserum, as GST antiserum did not alter bacterial binding or infection.

Example 18. The Aspl4 C-terminal region binds mammalian host cells. Since Aspl4 is an exposed outer membrane protein and anti-Aspl4 reduces Aph infection, we rationalized that Asp 14 may interact with mammalian host cell surfaces to promote infection. To test this possibility and to identify the Aspl4 region that is sufficient for optimal adherence, we examined if GST-tagged Asp 14 or portions thereof bind to RF/6A cells. GST alone and GST-tagged APH_1387 amino acids 112-579 (GST-APH_1387_n2- 5-79) were negative controls. APH_1387 is an Aph protein that localizes to the pathogen's vacuolar membrane and does not associate with the host cell surface. GST-Asp 14 but neither GST nor GST-APH_1387_u2-579 bound to RF/6A cells (Figure 9A-D). The binding domain is carried on the Aspl4 C-terminal half, as GST-Aspl4_65-i₂₄ but not GST-AspMi- ₆ exhibited binding. GST-AspHi-too and GST-Aspl4i.n₂ were unable to bind RF/6A cells (data not shown). Thus, Asp 14 residues 101-124 contain the minimal region that is sufficient to facilitate adhesion to mammalian cell surfaces.

Example 19. GST-Aspl4 requires Aspl4 residues 101-124 to competitively inhibit s. phagocytophilum infection of mammalian host cells. We next determined if GST- tagged Aspl4 or fragments thereof could inhibit A. phagocytophilum infection. GST- Aspl4 and GST-Aspl4_65-i2₄ each significantly reduced infection of HL-60 and RF/6A cells relative to GST alone (Figure 10A-D). GST-Aspl4i_-100 and GST-Aspl4i_-n2 had no effect on infection of HL-60 cells (Figures 10A and B). GST-AspMi-m did not lower the percentage of infected RF/6A cells, but reduced the mean number of morulae per RF/6A cell comparably to GST-Aspl4_65-i₂₄ (Figures IOC and D). Pretreating host cells with GST-Asp 14 fusion proteins prior to incubation with bacteria failed to inhibit A. phagocytophilum binding (data not shown). Thus, A. phagocytophilum binding to mammalian host cells is Aspl4-independent, but Asp 14 is important for bacterial invasion.

Example 20. The Aspl4 C-terminus is positively charged and residues 101-115 constitute a conserved domain among homologs from Anaplasma and Ehrlichia species. Based on our results, a domain that lies within Asp 14 amino acids 101-124 is involved in mediating interactions with host cells that promote A. phagocytophilum infection. To determine if this or any other Asp 14 region is conserved among Anaplasmataceae members, we aligned the primary amino acid sequences of Asp 14 with its homologs from two A. marginale strains and three monocyto tropic Ehrlichia species. Doing so identified two conserved regions, the first of which corresponds to Asp 14 amino acids 19-61 (Figure 11). The second conserved region aligns with Aspl4 residues 101-115. The consensus sequence for this region among the Anaplasma and Ehrlichia spp. Aspl4 homologs is L[RK] aI KR[IL] LRLERx V, where "a" and "x" represent a non- polar and any amino acid, respectively. Beginning at tyrosine 116, the Asp 14 C-terminus bears no sequence homology to its A. marginale and ehrlichiae counterparts. The Aspl4 C-terminus (amino acids 101-124) has a charge of +4.91 despite the entire protein sequence having a charge of -3.10. A similar trend is observed when the charges of the Asp 14 homologs' C-termini and entire protein sequences are examined.

Example 21. GST-Asp 14 and GST-OmpA together more pronouncedly inhibit A. phagocytophilum infection of HL-60 cells than either protein alone. We examined whether we could improve upon the protection against A. phagocytophilum infection afforded by GST-Aspl4 or GST-OmpA by pretreating HL-60 cells with both recombinant proteins. Consistent with previous results, 35.5 +7.4 % of GST-OmpA- treated and 53.2 + 11.8% of GST-Aspl4-treated HL-60 cells became infected (Figure 1 1 A). However, HL-60 cells that had been preincubated with both GST-Aspl4 and GST- OmpA were better protected against A. phagocytophilum infection, as only 9.9 + 9.4% of cells developed morulae. To prove that the synergistic reduction in infection was specific to the combinatorial effect of GST-Aspl4 and GST-OmpA and not simply due to the presence of excess recombinant protein, we treated HL-60 cells with GST-Aspl4 and GST-OmpA, GST-Aspl4i_ioo (does not block infection; data not shown) and GST- OmpA, or GST-Aspl4 and GST-OmpA _5-205 (does not block infection). HL-60 cells treated with GST- Asp 14 MOO and GST-OmpA or GST-Aspl4 and GST-OmpA_75-205 exhibited reductions in infection and bacterial load comparable to cells treated with GST- Aspl4 or GST-OmpA alone (Figures 12A and B). HL-60 cells treated with GST-Aspl4 and GST-OmpA exhibited an approximate 4.5-fold reduction in the percentage of infected cells relative to cells treated with either GST-Asp 14i_{- 10}o and GST-OmpA or GST-Aspl4 and GST-OmpA_75-205 (Figure 12 A).

Example 22. Peptide antisera blocking reveals that the OmpA invasin domain lies within amino acids 59-74. We had rabbit antiserum raised against peptides corresponding to OmpA amino acids 23-40, 41-58, and 59-74. We confirmed by ELISA that each serum is specific for recombinant OmpA and only the peptide against which it was raised (Figure 13 A). Pretreating A. phagocytophilum with serum specific for OmpA₅9_{- 4} but neither of the other two peptide sera significantly inhibited A. phagocytophilum infection of host cells in vitro (Figure 13B). Also, treatment of bacteria with OmpA₅9- 4 serum but not OmpA₂3_-40 serum or OmpA₄i_-58 serum prevents A. phagocytophilum binding to its known receptor, sialylated PSGL-1 (Figure 13C).

Please note that even thought amino acids 59-74 are most important for OmpA to promote infection that amino acids 23-58 are predicted to be presented on the A.

phagocytophilum surface and could therefore be a component of a protective vaccine.

Example 23. Linker insertions disrupt the ability of GST-OmpA to antagonize d. phagocytophilum infection of mammalian host cells and support that the invasin domain lies within amino acids 59-74. We also generated a series of glutathione-S- transferase (GST)-tagged OmpA proteins having an insertion of 5 amino acids (CLNHL) at defined locations. The purpose of the insertion of the amino acid "linker" was to disrupt any OmpA domain that facilitates binding of the protein to host cell surfaces. Individual plasmids encoding GST-OmpA proteins carrying linker insertions between aspartate 34 and leucine 35; isoleucine 54 and glycine 55; proline 62 and glycine 63; isoleucine 67 and leucine 68; glutamate 72 and glutamine 73; or aspartate 77 and aspartate 78 were generated by PCR mutagenesis of the plasmid encoding GST-OmpA (Figure 14). E. coli was transformed with each plasmid, induced to express the GST- OmpA proteins, and the proteins were purified by glutathione affinity chromatography. Adding recombinant wild-type OmpA and several OmpA insertion mutant proteins to host cells successfully inhibited A. phagocytophilum infection of host cells (Figure 15). These data indicate that the OmpA proteins were still able to bind to the OmpA receptor and competitively inhibit bacterial access to the receptor. However, only the GST-OmpA protein bearing a linker insertion between isoleucine 67 and leucine 68 lost the ability to competitively inhibit infection, which indicates that disruption of the region encompassed by amino acids 67 and 68 and its flanking amino acids abrogates the ability of OmpA to bind its receptor.

Example 24. Alanine substitution experiments identify that amino acids within OmpA aa59-74 are important for infection. To identify specific amino acids that are important for OmpA to bind to and mediate infection of host cells, we performed PCR mutagenesis to create plasmids encoding GST-OmpA bearing single or double alanine substitutions at D53, K64, E69, K60A, K65, E72A, KK6065AA, KK6064AA, KKK606465AAA, or K64 and K65. The proteins were purified and added to mammalian host cells. Next, A. phagocytophilum bacteria were incubated with the host cells. GST- OmpA, GST-OmpAD53 A, and GST-OmpA each significantly inhibited infection whereas GST alone did not (Figure 16). The abilities of GST-OmpAK64A and GST- OmpAKK6465AA to antagonize infection were significantly less than that of GST- OmpA, which indicates that OmpA amino acids 64 and 65 are important for OmpA to properly bind to host cells and for recombinant OmpA to serve as a competitive agonist against A. phagocytophilum infection]

Example 25. In silico modeling of OmpA interactions with its receptor. The tertiary structure for A. phagocytophilum OmpA was predicted using the PHYRE² (Protein Homology/analogy Recognition Engine, version 2.0) server (see the website at sbg.bio.ic.ac.uk/phyre2). The PHYRE server predicts tertiary structures for protein sequences and threads the predicted structures on known crystal structures. The highest scoring model predicts that amino acids 59-74 to be part of a surface-exposed helix that would be available to interact with other molecules (data not shown). Indeed, when the autodock vina algorithm (http://vina.scripps.edu) is used to assess whether OmpA binds to its known receptor, sialic acid of the sialyl Lewis x antigen, the lowest free energy models predict that Lysine 64 interacts with sialic acid (data not shown).

Example 26. The Aspl4 invasin domain lies within amino acids 113-124. The structure of Asp 14 is not known and it cannot be predicted because it bears no semblance to any crystal structure. Next, we set out to identify the region of Asp 14 that is important for infection. We knew that the Asp 14 invasin domain lies within amino acids 101-124. We had rabbit antiserum raised against peptides corresponding to Asp 14 amino acids 101-112 and 113-124. We confirmed by ELISA that each serum is specific for recombinant Asp 14 and only the peptide against which it was raised (Figure 17A and B). Pretreating Aph with serum specific for Aspl4i i_3-i₂₄ but not Aspl4ioi- i i 2 significantly inhibited bacterial infection of host cells in vitro (Figure 18).

Example 27. Treating Aph with antibodies targeting OmpA aa59-74 and Aspl4 aal 13-124 together pronouncedly inhibits infection of mammalian host cells

Treating Aph organisms with anti-OmpA₅9_{- 4} or anti-Asp 14n₃.i₂₄ significantly inhibits infection of mammalian host cells in vitro (Figure 19). Treating the bacteria with both anti-OmpA₅9_{- 4} and Aspl4n_3-i₂₄ even more pronouncedly inhibits infection.

Example 28. Aph OmpA and A. marginale OmpA share B-cell epitopes. A. marginale infects bovine red blood cells and costs the cattle industry hundreds of millions of dollars annually. A. marginale OmpA and Aph OmpA, though not identical, are very similar, including the region corresponding to Aph OmpA aal 9-74 (SEQ ID NO: 05). Therefore, a vaccine preparation that includes SEQ ID NO: 05, alone or in combination with other sequences of the invention is also effective in providing protection against A. marginale infection. GST-tagged Aph OmpA, GST-tagged A. marginale OmpA (AM854), and GST alone were subjected to SDS-PAGE and transferred to nitrocellulose membrane. The blots were screened with serum from a cow that had been infected with A. marginale or with serum from a cow that had been immunized with purified A. marginale outer membrane proteins. Both sera recognized GST-tagged OmpA proteins not GST (data not shown), thereby demonstrating that OmpA proteins from Aph and A. marginale share B cell epitopes. Serum raised against Aph OmpA amino acids 41-58 or 59-74 recognize GST- A marginale OmpA (AM854) in both Western blot (Figure 20A) and ELISA (Figure 20B).

Example 28 Immunizing against OmpA and/or Aspl4 protects mice from tick- mediated Aph infection. C3H/HeJ mice (female, 4-6 weeks of age) are immunized with 10 ug of GST-OmpA (full length), GST-OmpAi_9-7₄, GST-Asp 14; 10 ug each of GST-OmpA and GST-Aspl4; or 10 ug each of GST-OmpAi_9-74 and GST-Aspl4 in Complete Freund's Adjuvant. At two and four weeks following the initial immunization, mice are boosted with the same amounts and combinations of each antigen in Incomplete Freund's Adjuvant.

Alternatively, C3H/HeJ mice are immunized with 50 ug of KLH-conjugated peptides corresponding to OmpA₂₃-₄o, OmpA₄i_-58, OmpA₅9_-74, Aspl4ioo-i i2, Aspl4n_3-i₂ and every possible combination thereof. The same adjuvants and immunization schedule as in the preceding paragraph may be followed.

Five days following the second boost, aliquots of serum from each mouse are tested via ELISA to confirm that a humoral immune response was mounted against OmpA, Asp 14, and the respective portions thereof. At one week following the second boost, three Aph infected Ixodes scapularis ticks are placed on each mouse and allowed to feed for 48 hours to allow for transmission of the bacteria into the mice. On days 3, 8, and 12 post tick feeding, peripheral blood is collected. DNA isolated from the blood is subjected to quantitative PCR using primers targeting the Aph 16S rDNA and murine Beta-actin to determine the pathogen load in the peripheral Wood (data not shown).

This protocol is also useful when adjuvants suitable for innocculating dogs, humans, or other mammals are used for respective species.

Example 29. Immunizing against OmpA and/or Aspl4 protects mice from syringe inoculation of Aph infection C3H/HeJ mice (female, 4-6 weeks of age) are immunized with 10 ug of GST-OmpA (full length), GST-OmpAi₉-₇₄, GST-Aspl4; 10 ug each of GST-OmpA and GST-Aspl4; or 10 ug each of GST-OmpAi₉-₇₄ and GST-Aspl4 in Complete Freund's Adjuvant. At two and four weeks following the initial immunization, mice are boosted with the same amounts and combinations of each antigen in Incomplete Freund's Adjuvant.

Alternatively, C3H/HeJ mice are immunized with 50 ug of LH-conjugated peptides corresponding to OmpA_23-40, OmpA^.sg, OmpA₅9-74, Aspl4ioo-ii₂, Aspl4i 13.124 and every possible combination thereof. The same adjuvants and immunization schedule as in the preceding paragraph may be followed.

Five days following the second boost, aliquots of serum from each mouse are tested via ELISA to confirm that a humoral immune response was mounted against OmpA, Asp 14, and the respective portions thereof. At one week following the second boost, each mouse is inoculated with either 100 ul of blood from an Aph infected SCID mouse that was confirmed to be infected or 100 ul of host cell free Aph bacteria recovered from tissue cell culture. On days 3, 8, and 12 post tick feeding, peripheral blood is collected. DNA isolated from the blood is subjected to quantitative PCR using primers targeting the Aph 16S rDNA and murine Beta-actin to determine the pathogen load in the peripheral blood (data not shown).

This protocol is also useful when adjuvants suitable for innocculating dogs, humans, or other mammals are used for respective species.

In summary, OmpA and Asp 14 are the first two Aph surface proteins found to be critical for infection of mammalian cells. Expression of these proteins is induced in Aph during the tick bloodmeal and during the period in which humoral immune responses are stimulated in humans and mice. Embodiments of the invention are compositions comprising OmpA and/or Asp 14 sequences and methods to prevent Aph infection of humans and animals by inducing an immune response that blocks one or more of the 3 critical stages of infection: (1) the initial colonization of neutrophils and/or endothelial cells that establishes infection; (2) the dissemination stage when infected peripherally circulating neutrophils are inhibited in their microbial killing capability; and (3) the infection of endothelial cells of heart and liver. A further embodiment provides compositions and methods for diagnosis of anaplasmosis and HGA.

Claims

What is claimed is:

1. An immunogenic composition including one or more isolated polypeptides in a vehicle or carrier suitable for administration to a subject, wherein at least one of said one or more polypeptides is or includes SEQ ID NO:03 or SEQ ID NO:06.

2. The immunogenic composition of claim 1, wherein said one or more polypeptides is linked to an amino acid spacer, an amino acid linker, a signal sequence, a stop transfer sequence, a transmembrane domain, a protein purification ligand, a heterologous protein, or one or more additional polypeptides comprising SEQ ID NO:01, 02, 03, 04, 05, 06, 07, 08, or 09, or a combination thereof.

3. The immunogenic composition of claim 2, wherein said one or more polypeptides is linked to said protein purification ligand and said protein purification ligand is selected from the group consisting of GST and His.

4. The immunogenic composition of claim 1 , wherein said at least one said one or more polypeptides is selected from the group consisting of SEQ ID NO:01 , SEQ ID NO:02, SEQ ID NO:03, SEQ ID NO:08, and SEQ ID NO:09.

5. The immunogenic composition of claim 1 , wherein said at least one said one or more polypeptides is selected from the group consisting of SEQ ID NO:04, SEQ ID NO:05, SEQ ID NO:06, and SEQ ID NO:07.

6. A method of protecting or treating a subject from a zoonotic disease by the step of administering to said subject an immunogenic composition including one or more isolated polypeptides, wherein at least one of said one or more polypeptides is or includes SEQ ID NO:03 or SEQ ID NO:06.

7. The method according to claim 6, wherein said one or more polypeptides is linked to an amino acid spacer, an amino acid linker, a signal sequence, a stop transfer sequence, a transmembrane domain, a protein purification ligand, a heterologous protein, or one or more additional polypeptides comprising SEQ ID NO:01, 02, 03, 04, 05, 06, 07, 08, or 09; or a combination thereof.

8. The method of claim 6, wherein said zoonotic disease is caused by an obligate intracellular Anaplasmataceae bacterium selected from the group consisting of

Anaplasma phagocytophilum, Anaplasma marginale, Anaplasma platys, Ehrlichia chaffeensis, Ehrlichia canis, and Ehrlicia ruminatium.

9. The method of claim 6, wherein said subject is a human, and said zoonotic disease is human granulocytic anaplasmosis (HGA).

10. The method of claim 6, wherein said subject is an animal and said zoonotic disease is anaplasmosis.

11. The method of claim 6, said immunogenic composition is a cocktail containing two or more peptides selected from the group consisting of SEQ ID NO:01-66.

12. A method of detecting antibodies that specifically bind an Anaplasmataceae polypeptide in a test sample, comprising the steps of contacting a test sample, under conditions that allow polypeptide-antibody complexes to form, with a composition that includes at least one or more polypeptides encoding all or a portion of SEQ ID NO:01 or SEQ ID NO: 04, and detecting one or more polypeptide-antibody complexes in said test samples, wherein the detection is an indication that antibodies specific for

Anaplasmataceae Asp 14 or OmpA are present in the test sample.

13. The method of claim 1 1, wherein said method is an assay selected from the group consisting of an immunoblot and an enzyme-linked immunosorbent assay (ELISA).