WO2013144704A1 - Immunomodulating cyclic compounds from the bc loop of human pd1 - Google Patents

Immunomodulating cyclic compounds from the bc loop of human pd1 Download PDF

Info

Publication number
WO2013144704A1
WO2013144704A1 PCT/IB2013/000553 IB2013000553W WO2013144704A1 WO 2013144704 A1 WO2013144704 A1 WO 2013144704A1 IB 2013000553 W IB2013000553 W IB 2013000553W WO 2013144704 A1 WO2013144704 A1 WO 2013144704A1
Authority
WO
WIPO (PCT)
Prior art keywords
ser
cancer
compound according
phe
thr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2013/000553
Other languages
French (fr)
Inventor
Pottayil Govindan Nair Sasikumar
Muralidhara Ramachandra
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Aurigene Oncology Ltd
Original Assignee
Aurigene Discovery Technologies Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Aurigene Discovery Technologies Ltd filed Critical Aurigene Discovery Technologies Ltd
Priority to MX2014011353A priority Critical patent/MX2014011353A/en
Priority to CN201380018176.3A priority patent/CN104245726A/en
Priority to KR20147030294A priority patent/KR20140142736A/en
Priority to JP2015502472A priority patent/JP2015512910A/en
Priority to EP13720539.9A priority patent/EP2831108A1/en
Priority to US14/388,584 priority patent/US9422339B2/en
Priority to CA 2868408 priority patent/CA2868408A1/en
Priority to AU2013239366A priority patent/AU2013239366A1/en
Priority to RU2014143443A priority patent/RU2014143443A/en
Publication of WO2013144704A1 publication Critical patent/WO2013144704A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70521—CD28, CD152
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/64—Cyclic peptides containing only normal peptide links
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/12—Cyclic peptides, e.g. bacitracins; Polymyxins; Gramicidins S, C; Tyrocidins A, B or C
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/02—Antineoplastic agents specific for leukemia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4747—Apoptosis related proteins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)

Definitions

  • the present invention relates to novel cyclic compounds useful for treatment of disorders via immuno-potenttation comprising inhibition of immunosuppressive signal induced due to PD-1, PD-L1, or PD-L2 and therapies using them.
  • the invention also relates to pharmaceutical compositions comprising thereof.
  • Immune system possesses the ability to control the homeostasis between the activation and inactivation of lymphocytes through various regulatory mechanisms during and after an immune response. Among these mechanisms, there are mechanisms that specifically modulate the immune response as and when required. Mechanism via PD- 1 pathway relates to almost every aspect of immune responses including autoimmunity, tumour immunity, infectious immunity, transplantation immunity, allergy and immunological privilege.
  • PD-1 or Programmed Cell Death 1 or PDCD 1
  • PD-1 is a ⁇ 55kD type I membrane glycoprotein and is a receptor of the CD28 superfamily that negatively regulates T cell antigen receptor signalling by interacting with the specific ligands and is suggested to play a role in the maintenance of self tolerance.
  • the PD-1 protein's structure comprise of an extracellular IgV domain followed by a trans-membrane region and an intracellular tail.
  • the intracellular tail contains two phosphorylation sites located in an immunoreceptor tyrosine-based inhibitory motif and an immunoreceptor tyrosine-based switch motif, which suggests that PD-1 negatively regulates TCR signals.
  • PD-1 is expressed on the surface of activated T cells, B cells, and macrophages, (Y.
  • CTLA-4 (Cytotoxic T-Lymphocyte Antigen 4), also known as CD152 (Cluster of differentiation 152), a protein that also plays an important regulatory role in the immune system]
  • CD152 Cluster of differentiation 152
  • T cell exhaustion was initially described for CD8 T cells in mice chronically infected with lymphocytic choriomeningitis virus clone 13.
  • T cell antigen receptor drives the sustained expression of T cell inhibitory receptors, including programmed cell death-1 (PD-1 ) and lymphocyte activationgene-3 (LAG-3), on virus-specific CD8 T cells (Joseph Illingworth et al., Journal of Immunology (2013), 190(3), 1038- 1047).
  • PD-1 programmed cell death-1
  • LAG-3 lymphocyte activationgene-3
  • Blockade of PD- 1 an inhibitory receptor expressed by T cells, can overcome immune resistance.
  • PD- 1 is a key immune check point receptor expressed by activated T cells, and it mediates immune suppression.
  • PD- 1 functions primarily in peripheral tissues, where T cells may encounter the immune suppressive PD- 1 ligands; PD-L 1 (B7- Hl ) and PD-L2 (B7-DC), which are expressed by tumor cells, stromal cells, or both. Inhibition of the interaction between PD-1 and PD-L1 can enhance T-cell responses in vitro and mediate preclinical antitumor activity (Suzanne L. Topaiian et al., N Engl J Med. 2012, 366(26): 2443-2454).
  • PD- 1 plays critical roles in the regulation of the immune response to cancer, allergy, and chronic viral infection (Julie R. Brahmer et al., N Engl J Med. 2012, 366(26): 2455-2465).
  • Tumour cells and virus (including HCV and HIV) infected cells are known to exploit the PD- 1 signalling pathway (to create Immunosuppression) in order to escape immune surveillance by host T cells. It has been reported that the PD-1 gene is one of genes responsible for autoimmune diseases like systemic lup is erythematosus (Prokunina et al., Nature Genetics, 2002, Vol. 32, No. 4, 666-669.).
  • the present invention therefore provides novel therapeutically useful immunomodulatory compounds as cyclic peptide and its derivatives.
  • Figure 1 shows the in vivo efficacy of compound #2 on lung metastasis in B 16F 10 subcutaneous melanoma model.
  • SEQ ID NO: 1 shows amino acid sequence of extracellular domain of human PD-1.
  • SEQ ID NO: 2 shows amino acid sequence of BC Loop.
  • the present invention relates to novel cyclic peptide and its derivatives or a pharmaceutically acceptable salt thereof or a stereoisomer thereof, which are capable of modulating the PD1 signalling pathway.
  • the present invention provides a cyclic peptide compound of formula (I).
  • Ami represents 1 to 4 amino acid residues which may be same or different and each independently selected from Ser, Val, Glu, He, Asn and Thr; or may be absent;
  • X is selected from Lys, Glu or Ser
  • Y is Glu, Gin or Lys
  • represents -CO-(CH 2 ) n -NH-, -NH-(CH 2 ) n -CO- or an amide bond between X and Y;
  • 'n' is an integer selected from 1 to 5, both inclusive;
  • Am 2 represents 1 to 3 amino acid residues which may be same or different and each independently selected from Phe, Ser, Glu, He, Val, Gin, Tyr and Lys, or may be absent;
  • Z is Am3-L 2 ;
  • L 2 is -NH-(CH 2 ) n -CO- or is absent;
  • Ani3 represents 2 to 6 amino acid residues which may be same or different and each independently selected from Thr, Ser, Met, Glu, Asn, Phe and Lys;
  • R is an amidation of a C-terminal carboxylic acid moiety or is absent
  • 'peptide' is used herein to designate a sequence of natural or unnatural amino acids bonded in said sequence by peptide bonds.
  • peptide bond refers to the chemical bond between carbon and nitrogen in the bivalent group CONH that unites amino acid residues in a peptide.
  • Leu (or L) leucine He (or I)— isoleucine Orn -ornithine
  • Pro proline Phe (or F)— phenylalanine Trp (or W)— tryptophan Met (or M)— methionine Ser (or S)— serine Thr (or T)— threonine
  • Gin (or Q) glutamine Asp (or D)— aspartic acid
  • Glu (or E) glutamic acid
  • Modifications of the peptides discussed hereinafter and wherever relevant may include replacements of some of the L-amino acids by D-amino acids, bonding of amino acids at other than alpha amino groups, including at side chain amino or carboxylic groups, inclusion of non-peptide linkers between peptide sequences, lipidation, and
  • the present invention provides immunosuppression modulating peptides capable of modulating the PD1 signalling pathway.
  • the first embodiment of the present invention provides the structure of compounds as set forth in formula (I)
  • Ami represents 1 to 4 amino acid residues which may be same or different and each independently selected from Ser, Val, Glu, He, Asn and Thr; or may be absent;
  • X is selected from Lys, Glu or Ser
  • Y is Glu, Gin or Lys
  • L represents -CO-(CH 2 ) n -NH-, -NH-(CH 2 ) n -CO- or an amide bond between X and Y;
  • 'n' is an integer selected from 1 to 5, both inclusive;
  • Ami represents 1 to 3 amino acid residues which may be same or different and each independently selected from Phe, Ser, Glu, He, Val, Gin, Tyr and Lys, or may be absent;
  • Z is Am 3 -L 2 ;
  • L 2 is -NH-(CH 2 ) n -CO- or is absent;
  • Am 3 represents 2 to 6 amino acid residues which may be same or different and each independently selected from Thr, Ser, Met, Glu, Asn, Phe and Lys;
  • R is an amidation of a C-terminal carboxylic acid moiety or is absent
  • Y is Glu or Gin
  • is -CO-(CH2) n -NH- or an amide bond
  • 'n' is an integer selected from 2 to 5, both inclusive;
  • R is an amidation of a C-terminal carboxylic acid moiety or is absent
  • Ile, Val-Phe, Ser-Val, Ile-Phe, Ser.Tyr, Phe, Ser-DGIu or Ser-Phe-Lys and R is an amidation of a C-terminal carboxylic acid moiety or is absent.
  • Z is A1T13-L 2 wherein Am3 is Asn-Thr-Ser-Glu-Ser-Phe, Glu-Thr-Ser-Lys- Ser-Phe or Asn-Thr-Ser and L 2 is absent.
  • Y is Gin
  • Z is Am 3 -L 2 wherein A1TI3 is Asn-Thr-Ser-Glu-Ser-Phe or Glu- Thr-Ser-Lys-Ser-Phe and L 2 is -NH-(CH 2 )5-CO- or is absent; and R is absent.
  • Y is Glu
  • Z is Am 3 -L 2 wherein Am 3 is Asn-Thr-Ser-Glu-Ser-Phe or Glu- Thr-Ser-Lys-Ser-Phe and L 2 is absent
  • R is an amidation of a C-terminal carboxylic acid moiety.
  • R represents direct bond or 1 to 2 amino acid residues which may be same or different and each independently selected from Phe, Ser, Glu, He, Val, Gin and Tyr; Z is Am 3 -L 2 ; L 2 is -NH-(CH2) n -CO- or absent; Ani3 represents 2 to 6 amino acid residues which may be same or different and each independently selected from Thr, Ser, Met, Glu, Asn, Phe and Lys; R is free C-terminal, amidated C-terminal or amidated gamma C-terminal.
  • the present invention further provides modifications, derivatives of the peptides and pharmaceutical compositions comprising the peptides for treatment of cancer or infection via immunopotentiation caused by inhibition of immunosuppressive signal induced by PD-1 , PD-L1 , or PD-L2 and therapies using them, immunopotentiative substrates included as the active ingredients.
  • compounds capable of inhibiting ability to inhibit the programmed cell death 1 (PD1) signalling pathway and being capable of reducing PD-L1 or PD-L2 binding to PD- 1 and resulting immunosuppressive signalling by PD- 1 , wherein the compound comprises a peptide moiety or a modified peptide moiety derived from the peptide fragments of PD1 peptide itself.
  • PD1 programmed cell death 1
  • PD-1 possesses an ectodomain having multiple loop structures and strands between the loops.
  • the amino acid sequence of the extracellular domain of human PD- 1 is as set forth in SEQ ID NO: 1.
  • SEQ ID NO: 1 Extracellular domain of human PD-1
  • loop and strand assignments of amino acids are based on the 1.8-A- resolution structure of the murine PD- 1/PD-L2 complex reported in Lazar-Molnar et al, (PNAS, 2008, 105, 30, 10483-10488).
  • BC loop (i.e. 24 th to 30 th amino acid of SEQ ID NO: 1) was taken up for further modification.
  • the present invention provides compounds comprising of modified BC loop of extracellular domain of human PD- 1.
  • SEQ ID NO: 2 BC Loop comprise of amino acid sequences as
  • Compounds of the invention may comprise peptide moieties that are lipidated.
  • One or more of the amino acids of the peptide may be a D-amino acid with a view to provide improved stability in vivo.
  • the invention includes compounds as described above, formulated for pharmaceutical administration, typically by combination with a pharmaceutically acceptable carrier or diluent.
  • the invention includes compounds as described above for use in a method of medical treatment, e.g. in the treatment of cancer, treatment of bacterial and viral infections.
  • the invention further includes a method of screening compounds for ability to block interaction between PD- 1 and a PD-1 ligand, comprising contacting candidate compounds of the kind described above with PD-1 or a PD-1 ligand binding portion of PD- 1 and with a PD-1 ligand or a PD- 1 binding portion of a PD-1 ligand, and measuring the extent of PD-l PD-1 ligand binding.
  • compounds of the invention may be combined with carrier molecules such as dendrimers, e.g. PAMAM dendrimers, liposomes, micro-particles and nanoparticles such as polycyanoacrylate nanoparticles, and these also may be PEGylated.
  • carrier molecules such as dendrimers, e.g. PAMAM dendrimers, liposomes, micro-particles and nanoparticles such as polycyanoacrylate nanoparticles, and these also may be PEGylated.
  • PD1 programmed cell death 1
  • Further embodiment of the present invention relates to the compounds as disclosed in the present invention, wherein one or more of the amino acids of the peptide moiety the compounds is substituted with a D-amino acid.
  • the compounds as disclosed in the present invention are formulated for pharmaceutical administration.
  • Another embodiment of the present invention provided a pharmaceutical composition
  • a pharmaceutical composition comprising the compound as disclosed, and a pharmaceutically acceptable carrier or diluent.
  • Yet another embodiment of the present invention provides use of the compounds as disclosed in the present invention for the preparation of a medicament for the treatment of cancer.
  • Yet another embodiment of the present invention provides use of the compounds as disclosed in the present invention for the preparation of a medicament for the treatment of bacterial and viral infection.
  • Yet another embodiment of the present invention provides a method of treatment of cancer, wherein the method comprises administration of an effective amount of the compound and/or peptides of the present invention to the subject in need thereof.
  • Yet another embodiment of the present invention provides a method for inhibiting growth of tumour cells and/or metastasis by administering an effective amount of the compound of the present invention to the subject in need thereof.
  • tumour cells include cancer such as but not limited to melanoma, renal cancer, prostate cancer, breast cancer, colon cancer and lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, non-Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, chronic or acute leukemias including acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia
  • Still yet another embodiment of the present invention provides a method of treatment of infection via immunopotentiation caused by inhibition of immunosuppressive signal induced by PD- 1 , PD-L 1 , or PD-L2, wherein the method comprises administration of an effective amount of the compound and/or peptides of the present invention to the subject in need thereof.
  • the infectious disease includes but not limited to HIV, Influenza, Herpes, Giardia, Malaria, Leishmania, the pathogenic infection by the virus Hepatitis (A, B, & C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, cornovirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus and arboviral encephalitis virus, pathogenic infection by the bacteria chlamydia, rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningoco
  • coli legionella, diphtheria, salmonella, bacilli, cholera, tetanus, botulism, anthrax, plague, leptospirosis, and Lyme's disease bacteria, pathogenic infection by the fungi Candida (albicans, krusei, glabrata, tropicalis, etc.), Cryptococcus neoformans, Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor, absidia, rhizophus), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum, and pathogenic infection by the parasites Entamoeba histolytica, Balantidium coli, Naegleriafowleri, Acanthamoeba sp., Giardia lambia, Cryptosporidium sp., Pneum
  • the compounds of the present invention may be used as single drugs or as a pharmaceutical composition in which the compound is mixed with various pharmacologically acceptable materials.
  • the pharmaceutical composition is usually administered by a parenteral administration route, but can be administered by oral or inhalation routes.
  • parenteral administration include administration by injection, and percutaneous, transmucosal, transnasal and trans pulmonary administrations.
  • the injectable materials include a solution, a suspension, and a solid injection that is dissolved or suspended in a solvent before use.
  • the injection is used after one or more active ingredients are dissolved, suspended or emulsified in a solvent.
  • the solvent include water-soluble solvents (e.g., distilled water, physiological saline and Ringer's solution), oil solvents (e.g., vegetable oils such as olive oil, sesame oil, cotton oil and corn oil, and alcohols such as propylene glycol, polyethylene glycol and ethanol), and combinations thereof.
  • the injection may contain a stabilizer (e.g., human serum albumin), solubilizing agent (e.g., polyethylene glycol, propylene glycol, D-mannitol, trehalose, benzyl benzoate, ethanol, trisaminomethane, cholesterol, triethanolamine, sodium carbonate, sodium citrate, sodium salicylate and sodium acetate), suspending agent (e.g., surfactants such as stearyl triethanolamine, sodium lauryl sulfate, lauryl aminopropionic acid, lecithin, benzalkonium chloride, benzethonium chloride and glyceryl monostearate; hydrophilic polymers such as polyvinyl alcohol, polyvinyl pyrrolidone, sodium carboxymethyl cellulose, methyl cellulose, hydroxymethyl cellulose, hydroxyethyl cellulose and hydroxypropyl cellulose; polysorbates; and polyoxyethylene hardened castor oil), emulsifier, soothing agent (e.
  • injections may be prepared by known methods in the formulation technology field, such as by a method described in various Pharmacopoeia. They are prepared, for example, through a sterilization process at the final stage, or by aseptic manipulation. It is also possible to use an aseptic solid fonnulation, such as a freeze dried product, wherein the aseptic solid fonnulation is prepared and dissolved in aseptic or sterilized distilled water for injection or other solvents before use.
  • aseptic solid fonnulation such as a freeze dried product, wherein the aseptic solid fonnulation is prepared and dissolved in aseptic or sterilized distilled water for injection or other solvents before use.
  • parenteral solutions may be supplied in a vessel with a standard capacity, such as a plastic or glass vial, ampoule, syringe and injector, or in a vessel with a large capacity, such as a bottle.
  • a standard capacity such as a plastic or glass vial, ampoule, syringe and injector
  • a vessel with a large capacity such as a bottle.
  • the dosage of the compounds of the present invention varies depending on age, weight, symptom, therapeutic efficacy, dosing regimen and/or treatment time. Generally, they may be administered by a parenteral route (preferably intravenous administration) in an amount of 1 mg to 100 mg per time, from once a couple of days, once 3 days, once 2 days, once a day to a couple of times a day, in the case of an adult, or continuously administered by intravenous administration from 1 to 24 hours a day. Since the dosage is affected by various conditions, an amount less than the above dosage may sometimes work well enough, or higher dosage may be required in some cases.
  • Parenteral administration by injection includes all forms of injections, and also includes intravenous fluids.
  • intramuscular injections includes intramuscular injections, subcutaneous injections, intradermal injections, intraarterial injections, intravenous injections, intraperitoneal injections, injections to spinal cavity, and intravenous drops.
  • the compounds of the present invention may be administered in combination with other drugs for (1) complementation and/or enhancement of prevention and/or therapeutic efficacy of the preventive and/or therapeutic drug of the present invention, (2) dynamics, absorption improvement, dosage reduction of the preventive and/or therapeutic drug of the present invention, and/or (3) reduction of the side effects of the preventive and/or therapeutic drug of the present invention.
  • a concomitant medicine comprising the peptide of the present invention and other drug may be administered as a combination preparation in which both components are contained in a single formulation, or administered as separate formulations.
  • the administration by separate formulations includes simultaneous administration and administration with some time intervals.
  • the compound of the present invention can be administered first, followed by another drug or another drug can be administered first, followed by the compound of the present invention.
  • the administration method of the respective drugs may be the same or different.
  • the dosage of the other drug can be properly selected, based on a dosage that has been clinically used.
  • the compounding ratio of the compound of the present invention and the other drug can be properly selected according to age and weight of a subject to be administered, administration method, administration time, disorder to be treated, symptom and combination thereof.
  • the other drug may be used in an amount of 0.01 to 100 parts by mass, based on 1 part by mass of the compound of the present invention.
  • the other drug may be a combination of two or more kind of arbitrary drugs in a proper proportion.
  • the other drug that complements and/or enhances the preventive and/or therapeutic efficacy of the compound of the present invention includes not only those that have already been discovered, but those that will be discovered in future, based on the above mechanism.
  • the concomitant medicine can be used for any diseases, as long as it complements and/or enhances the preventive and/or therapeutic efficacy of the compound of the present invention.
  • the concomitant use is able to reduce a dosage of chemotherapeutics commonly used or an irradiation dosage in radio therapy. This results in suppression of side effects that accompany with chemotherapy and radio therapy.
  • the compound of the present invention can be used with an existing chemotherapeutic concomitantly or in a mixture form.
  • the chemotherapeutic include an alkylation agent, nitrosourea agent, antimetabolite, anticancer antibiotics, vegetable-origin alkaloid, topoisomerase inhibitor, hormone drug, hormone antagonist, aromatase inhibitor-, P-glycoprotein inhibitor, platinum complex derivative, other immunotherapeutic drugs and other anticancer drugs.
  • a cancer treatment adjunct such as a leucopenia (neutrophenia) treatment drug, thrombocytopenia treatment drug, antiemetic and cancer pain intervention drug, concomitantly or in a mixture form.
  • the compound of the present invention can be used with other immunomodulators concomitantly or in a mixture form.
  • the immunomodulator include various cytokines.
  • the cytokines that stimulates immune responses include GM-CSF, M-CSF, G-CSF, interferon-a, ⁇ , or ⁇ , IL- 1, IL-2, IL-3 and IL-12.
  • the concomitant use of the compound of the present invention and a cancer antigen is able to give an additive or synergetic enhancement effect.
  • the cancer antigen include HLA-A l and HLA-A2 derived peptides derived from MAGE-1 or MAGE-3 of malignant melanoma, MART-1 and gpl OO, HER2/neu peptide of breast cancer and ovarian cancer, MUC-1 peptide of adenocarcinoma and NY-ESO-1 of metastatic cancer.
  • Different immunomodulatory compounds of the present invention were prepared via solid phase peptide synthesis, which was carried out manually using either a custom made glass reactor with a frit or polyethylene vessel equipped with a polypropylene filter.
  • the resin (1 g) was washed with a solution of 10% NMP in chloroform (6 X 15m L); 1% DIEPA in DMF (6 X 15 m L); DCM (6 X 15 m L); DMF (6 X 15m L); and finally with NMP (3 X 15ml each); The deprotection and resulting free amino group was confirmed by Kaiser test.
  • Lactam bridge/Cyclisation A solution of HOBT/DIC (5 equivalent each relative to resin loading) in NMP was added to the resin and coupling was carried out overnight. After 18 hr the resin was filtered and washed with DMF/DCM/DMF (6 X 10 m L). Kaiser test was carried out and in case of slight blue colouration, the peptidyl resin was capped with acetylating mixture (Pyridine DCM/acetic anhydride: 8:8: 1 ). After 30 min, the resin was filtered and washed with DMF/DCM/DMF (6 X 10 m L each)
  • the peptidyl Resin was washed with MeOH (6 X 15 ml) and solvent ether (3 X 15 ml) and dried under vacuum.
  • the cleavage of the peptides from the solid support is achieved by treating the peptide-resin with cleavage cocktail as specified for each peptide at room temperature for 2.5 h. Cleavage mixture was collected by filtration and the resin was washed with TFA and DCM. The excess TFA and DCM was concentrated to small volume under nitrogen and DCM was added to the residue and evaporated under nitrogen. The process was repeated 3-4 times to remove most of the volatile impurities. The residue was cooled to 0°C and anhydrous ether was added to precipitate the peptide.
  • the precipitated peptide was centrifuged and the supernatant ether was removed and fresh ether was added to the peptide and re-centrifuged. The residue was dissolved in Millipore water and lyophilized to obtain the crude peptide.
  • Cleavage cocktail A 80% TFA / 5% phenol / 5% thioanisole / 2.5% 1,2 ethanedithiol / 5% DCM/ 2.5 % DMS
  • Cleavage Cocktail B 90% TFA / 5% TIPS / 5% water
  • the Reverse phase analytical HPLC was performed using on Zorbax Eclipse XDB-C 18 silica column (4.6 mm X 250mm, 5 ⁇ ). The elution conditions used are
  • Method -1 Buffer A: 0.1% TF A/ Water, Buffer B: 0.1% TFA in 9: 1 acetonitrile /water.
  • LCMS was performed on AP I 2000 LC/MS/MS triple quad (Applied biosystems) with Agilent 1 100 series HPLC with G1315 B diode array detector (DAD) or using Agilent LC MSD VL single quad with Agilent 1 100 series HPLC with G 13 15 B DAD.
  • DAD diode array detector
  • Desiccated Rink Amide MBHA-Amide resin (100-200 mesh, 0.66 mmol/g, 2 g) was placed in a polyethylene vessel equipped with a polypropylene filter. Resin was swelled in DCM (25 m L) for 1 h and DMF (25 m L) for 1 h. The Fmoc group of the Rink Amide MBHA- Amide was deprotected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min (20 m L). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L).
  • the Fmoc group on the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine/DMF solution for 5 and 15 min (20 mL). The resin was washed with DMF (6 X 15 m L), DCM (6 X 1 5 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive.
  • the Fmoc group of the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine DMF solution for 5 and 15 min (20 mL). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive.
  • the Fmoc group of the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine/DMF solution for 5 and 15 min (20 mL). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive.
  • Bridge was carried out as mentioned in the general procedure using HOBT (0.7 g) DIC (0.8 m L) method.
  • the peptidyl resin was cleaved as mentioned in procedure for cleavage using cleavage cocktail B to yield (760 mg), 75 % yield.
  • the crude material was purified by preparative HPLC on water's X-bridge, C I 8, 19X 150mm,5um column with buffer A: 0.1 % TF A/Water, buffer B: 0.1%TFA/ CH 3 CN.
  • allyl protecting group from Glutamic acid was removed as mentioned in the general procedure using tetrakistriphenylphosphine palladium (0) (5 Equiv; 2 g) and Phenyl silane ( 10 eqv; 0.3 m L). This was followed by Fmoc removal of N-terminal Fmoc protecting group on Ahx using 20 % Pip/DMF. Cyclization was carried out as mentioned in the general procedure using HOBT/DIC (both 5 Equiv excess) method. The peptidyl resin was cleaved as mentioned in procedure for cleavage using cleavage cocktail A to yield (400 mg), 60 % yield.
  • Desiccated 2-chlorotrityl chloride resin (1 g; 1.12 m mol/g) was swelled in DCM for 1 h in a solid phase reaction vessel.
  • Fmoc-Phe-OH (0.53 g, 1.2 equivalents with respect to resin loading) was dissolved in dry DCM was added in to the reaction vessel followed by the addition of 3.8 eq. of DIPEA (0.73 ml).
  • the coupling was carried out at room temperature for 6 h.
  • the resin was filtered and washed with DCM (3 15 mL), DMF (3 x 15 mL) followed by 1% DIPEA in DMF (3 x 15 mL). Any unreacted chloride groups were capped using methanol. After 30 min the resin was filtered and washed with diethyl ether, desiccated under vacuum overnight.
  • the Phenylalanine first attached resin was used for further chain elongation and peptide synthesis was carried out as mentioned in example 1.
  • MDA-MB-231 cells were found to express PD-L l by RT-PCR and FACS assays and therefore used as a source of PD-L l in the assays.
  • Example: 8 The effect of PD1 derived peptides on mouse splenocyte proliferation inhibited by PDL1/PDL2 or tumor cells expressing PDL; analyzed by Fluorescence Activated Cell Shorting (FACS) method using CFSE labeling.
  • FACS Fluorescence Activated Cell Shorting
  • Working concentrations were titrated from 10 ⁇ to 1 ⁇ . (eBioscience-650850-85); 0.05% Trypsin and 0.02% EDTA (SIGMA 59417C); 96-vvell format EL1SA plates (Corning CLS3390); BD FACS caliber (E6016).
  • Splenocytes harvested in a 50ml falcon tube by mashing spleen in a 40 ⁇ ⁇ cell strainer were further treated with lml ACK lysis buffer for 5mins at room temperature. After washing with 9ml of RPMI complete media, cells were re-suspended in 3ml of l PBS in a 15ml tube. 3ml of histopaque was added very carefully to the bottom of the tube without disturbing overlaying splenocyte suspension. Spin the tube at 800xg for 20mins at room temperature. Opaque layer of lymphocytes was collected carefully without disturbing/mixing any of the layers. Cells were washed twice with cold lxPBS followed by total cell counting using trypan blue exclusion method and used further for cell based assays.
  • CFSE is the abbreviation of Carboxyfluorescein Diacetate Succinimidyl Ester, a dye that passively diffuses into cells and binds to intracellular proteins.
  • Tumor cells were cultured and maintained in high glucose complete DMEM media.
  • l xl O 5 tumor cells were plated in 96 well plates along with required cone, of PD 1 derived peptide and allowed to adhere at 37°C for 4 hrs.
  • lxl O 6 cells / ml of harvested splenocytes were treated with 5 ⁇ of CFSE in pre warmed lxPBS/0.1 %BSA solution for l Omins at 37°C. Excess CFSE was quenched using 5 volumes of ice-cold culture media to the cells and incubated on ice for 5mins.
  • CFSE labeled splenocytes were further given three washes with ice cold complete DMEM media.
  • CFSE labeled l x l O 5 splenocytes were added to above wells containing tumors cells and PD l peptides.
  • Splenocytes were stimulated with anti-CD3 and anti-CD28 antibody ( ⁇ g/ml each) and the co-culture was further incubated for 72hrs at 37°C with 5% CC .
  • Cells were harvested and washed thrice with ice cold FACS buffer and % proliferation was analyzed using a FACS caliber with 488nm excitation and 521nm emission filters. Each experimental condition was carried out in triplicates and each experiment at least carried out three times.
  • % splenocyte proliferation was analyzed using cell quest FACS program and fold induction was calculated by nonnalizing individual values to % background proliferation
  • Compound effect was examined by adding required cone, of compound to anti- CD3/CD28 stimulated splenocytes in presence of ligand (PDL- l/PDL-2) or tumor cells.
  • Table 4 The effect of compounds on mouse splenocyte proliferation inhibited by PD1 - PDL 1 interaction in MDAMB231 over expressing PDL 1
  • Example 9 In vivo efficacy of compound #2 on lung metastasis in B 16F10 subcutaneous melanoma model.
  • mice C57/Black6 female mice (Aurigene, Bangalore, India) aged 6 to 8 weeks were used for the experiment. Animals were acclimatized for a week in the experimental room before conducting the experiment. On day 0, B 16F 10 cells grown in DMEM containing 10% FBS at 70 to75% confluency were harvested and 0.1 X 10 6 cells per animal were injected to mice subcutaneously on the right flank region. On day 1 , peptide (Compound #2) at 5mg/kg dose dissolved in PBS, pH 7.4 was dosed subcutaneously at the rate of l Oml/kg volume for fourteen days once daily. Vehicle control group of mice received only saline. Taxol at 5MPK (i.p) with qd dosing was used as reference in this study.
  • 5MPK i.p

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • Communicable Diseases (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Hydrogenated Pyridines (AREA)

Description

IMMUNOMODULA ING CYCLIC COMPOUNDS FROM THE BC LOOP OF HUMAN PD1
This application claims the benefit of Indian provisional application number 1213/CHE/2012, filed on March 29, 2012; which hereby incorporated by reference.
TECHNICAL FIELD
The present invention relates to novel cyclic compounds useful for treatment of disorders via immuno-potenttation comprising inhibition of immunosuppressive signal induced due to PD-1, PD-L1, or PD-L2 and therapies using them.
The invention also relates to pharmaceutical compositions comprising thereof.
BACKGROUND OF THE INVENTION
Immune system possesses the ability to control the homeostasis between the activation and inactivation of lymphocytes through various regulatory mechanisms during and after an immune response. Among these mechanisms, there are mechanisms that specifically modulate the immune response as and when required. Mechanism via PD- 1 pathway relates to almost every aspect of immune responses including autoimmunity, tumour immunity, infectious immunity, transplantation immunity, allergy and immunological privilege. PD-1 (or Programmed Cell Death 1 or PDCD 1) is a ~55kD type I membrane glycoprotein and is a receptor of the CD28 superfamily that negatively regulates T cell antigen receptor signalling by interacting with the specific ligands and is suggested to play a role in the maintenance of self tolerance.
The PD-1 protein's structure comprise of an extracellular IgV domain followed by a trans-membrane region and an intracellular tail. The intracellular tail contains two phosphorylation sites located in an immunoreceptor tyrosine-based inhibitory motif and an immunoreceptor tyrosine-based switch motif, which suggests that PD-1 negatively regulates TCR signals. Also, PD-1 is expressed on the surface of activated T cells, B cells, and macrophages, (Y. Agata et al., Int Immunol, May 1996, 8, 765) suggesting that compared to CTLA-4 [(Cytotoxic T-Lymphocyte Antigen 4), also known as CD152 (Cluster of differentiation 152), a protein that also plays an important regulatory role in the immune system], PD-1 more broadly negatively regulates immune responses.
Indeed, functional "exhaustion" (immune dysfunction) among T and B cell subsets is a well-described feature of chronic viral infections, such as hepatitis B and C and HIV viruses. T cell exhaustion was initially described for CD8 T cells in mice chronically infected with lymphocytic choriomeningitis virus clone 13. In the lymphocytic choriomeningitis virus mouse model, repeated antigen stimulation through the T cell antigen receptor drives the sustained expression of T cell inhibitory receptors, including programmed cell death-1 (PD-1 ) and lymphocyte activationgene-3 (LAG-3), on virus-specific CD8 T cells (Joseph Illingworth et al., Journal of Immunology (2013), 190(3), 1038- 1047).
Blockade of PD- 1 , an inhibitory receptor expressed by T cells, can overcome immune resistance. PD- 1 is a key immune check point receptor expressed by activated T cells, and it mediates immune suppression. PD- 1 functions primarily in peripheral tissues, where T cells may encounter the immune suppressive PD- 1 ligands; PD-L 1 (B7- Hl ) and PD-L2 (B7-DC), which are expressed by tumor cells, stromal cells, or both. Inhibition of the interaction between PD-1 and PD-L1 can enhance T-cell responses in vitro and mediate preclinical antitumor activity (Suzanne L. Topaiian et al., N Engl J Med. 2012, 366(26): 2443-2454).
PD- 1 plays critical roles in the regulation of the immune response to cancer, allergy, and chronic viral infection (Julie R. Brahmer et al., N Engl J Med. 2012, 366(26): 2455-2465).
Tumour cells and virus (including HCV and HIV) infected cells are known to exploit the PD- 1 signalling pathway (to create Immunosuppression) in order to escape immune surveillance by host T cells. It has been reported that the PD-1 gene is one of genes responsible for autoimmune diseases like systemic lup is erythematosus (Prokunina et al., Nature Genetics, 2002, Vol. 32, No. 4, 666-669.).
Several potential immunomodulators of PD-1 have been described. For example International application WO 01/14557, WO 2004/004771 , WO 2004/056875, WO 02/079499, WO 03/042402, and WO 2002/086083 report PD- 1 or PD-L1 inhibitory antibody or fusion protein.
United State patent application US201 1318373 reports peptide and their derivatives derived from PD1 ectodomain capable of inhibiting the programmed cell death 1 (PD 1 ) signalling pathway. In view of the current ongoing research and disclosures as discussed above, it would thus be desirable to explore further therapeutically usefulness of immunomodulatory compounds as peptides or modified peptides.
The present invention therefore provides novel therapeutically useful immunomodulatory compounds as cyclic peptide and its derivatives.
BRIEF DESCRIPTION OF ACCOMPANYING DRAWINGS
Figure 1 shows the in vivo efficacy of compound #2 on lung metastasis in B 16F 10 subcutaneous melanoma model.
AMINO ACID SEQUENCE INFORMATION
SEQ ID NO: 1 shows amino acid sequence of extracellular domain of human PD-1.
SEQ ID NO: 2 shows amino acid sequence of BC Loop.
SUMMARY OF INVENTION
The present invention relates to novel cyclic peptide and its derivatives or a pharmaceutically acceptable salt thereof or a stereoisomer thereof, which are capable of modulating the PD1 signalling pathway.
In one aspect, the present invention provides a cyclic peptide compound of formula (I).
Figure imgf000004_0001
(I)
wherein,
Ami represents 1 to 4 amino acid residues which may be same or different and each independently selected from Ser, Val, Glu, He, Asn and Thr; or may be absent;
X is selected from Lys, Glu or Ser;
Y is Glu, Gin or Lys;
L| represents -CO-(CH2)n-NH-, -NH-(CH2)n-CO- or an amide bond between X and Y;
'n' is an integer selected from 1 to 5, both inclusive; Am2 represents 1 to 3 amino acid residues which may be same or different and each independently selected from Phe, Ser, Glu, He, Val, Gin, Tyr and Lys, or may be absent;
Z is Am3-L2;
L2 is -NH-(CH2)n-CO- or is absent;
Ani3 represents 2 to 6 amino acid residues which may be same or different and each independently selected from Thr, Ser, Met, Glu, Asn, Phe and Lys;
R is an amidation of a C-terminal carboxylic acid moiety or is absent;
or a pharmaceutical salt of a peptide derivative of formula (I), or a stereoisomer of a peptide derivative of fonnula (I) or pharmaceutical salt thereof.
It should be understood that the formula (I) structurally encompasses all stereoisomers, enantiomers and diastereomers, and pharmaceutically acceptable salts that may be contemplated from the chemical structure of the genera described herein.
In another aspect of the present invention, it provides compound of Formula I therapeutically useful in the treatment or prevention of disease or disorder, where there is an advantage in modulation of the PD 1 signalling pathway.
DETAILED DESCRIPTION OF THE INVENTION
The term 'peptide' is used herein to designate a sequence of natural or unnatural amino acids bonded in said sequence by peptide bonds.
The term "peptide bond" as used herein refers to the chemical bond between carbon and nitrogen in the bivalent group CONH that unites amino acid residues in a peptide.
The term 'compound(s)' as used herein comprises peptides and modified peptides as disclosed in the present invention.
The following common abbreviations of the amino acids are used throughout this specification:
Gly (or G)— glycine Ala (or A)— alanine Val (or V)— valine
Leu (or L)— leucine He (or I)— isoleucine Orn -ornithine
Pro (or P)— proline Phe (or F)— phenylalanine Trp (or W)— tryptophan Met (or M)— methionine Ser (or S)— serine Thr (or T)— threonine
Cys (or C)— cysteine !Tyr (or Y)— tyrosine 1 Asn (or N)— asparagine
Gin (or Q)— glutamine Asp (or D)— aspartic acid Glu (or E)— glutamic acid
Lys (or K)— lysine Arg (or R)— arginine His (or H)— histidine
Modifications of the peptides discussed hereinafter and wherever relevant may include replacements of some of the L-amino acids by D-amino acids, bonding of amino acids at other than alpha amino groups, including at side chain amino or carboxylic groups, inclusion of non-peptide linkers between peptide sequences, lipidation, and
PEGylation.
The present invention provides immunosuppression modulating peptides capable of modulating the PD1 signalling pathway.
In our endeavour to provide novel immunomodulatory compounds, the first embodiment of the present invention provides the structure of compounds as set forth in formula (I)
Figure imgf000006_0001
wherein,
Ami represents 1 to 4 amino acid residues which may be same or different and each independently selected from Ser, Val, Glu, He, Asn and Thr; or may be absent;
X is selected from Lys, Glu or Ser;
Y is Glu, Gin or Lys;
L, represents -CO-(CH2)n-NH-, -NH-(CH2)n-CO- or an amide bond between X and Y;
'n' is an integer selected from 1 to 5, both inclusive;
Ami represents 1 to 3 amino acid residues which may be same or different and each independently selected from Phe, Ser, Glu, He, Val, Gin, Tyr and Lys, or may be absent; Z is Am3-L2;
L2 is -NH-(CH2)n-CO- or is absent;
Am3 represents 2 to 6 amino acid residues which may be same or different and each independently selected from Thr, Ser, Met, Glu, Asn, Phe and Lys;
R is an amidation of a C-terminal carboxylic acid moiety or is absent;
or a pharmaceutical salt of a peptide derivative of formula (I), or a stereoisomer of a peptide derivative of formula (I) or pharmaceutical salt thereof.
In another embodiment of the present invention, it provides the structure of compounds as set forth in formula (la)
Figure imgf000007_0001
(la)
wherein,
Ami, Am2, Am3 and R are same as defined in formula (I);
or a pharmaceutical salt of a peptide derivative of formula (la), or a stereoisomer of a peptide derivative of formula (la) or pharmaceutical salt thereof.
In yet another embodiment of the present invention, it provides the structure of compounds as set forth in formula (lb).
Figure imgf000008_0001
(lb)
wherein,
Ami, Am2, Am3 and R are same as defined in formula (I);
or a phannaceutical salt of a peptide derivative of formula (lb), or a stereoisomer of a peptide derivative of formula (lb) or pharmaceutical salt thereof.
In yet another embodiment of the present invention, it provides the structure of compounds as set forth in formula (Ic)
Figure imgf000008_0002
(Ic)
wherein,
Z is as defined in formula (I);
Y is Glu or Gin;
L| is -CO-(CH2)n-NH- or an amide bond;
'n' is an integer selected from 2 to 5, both inclusive;
R is an amidation of a C-terminal carboxylic acid moiety or is absent;
or a pharmaceutical salt of a peptide derivative of formula (Ic), or a stereoisomer of a peptide derivative of formula (Ic) or phannaceutical salt thereof.
The embodiment below are illustrative of the present invention and are not intended to limit the claims to the specific embodiments exemplified. In one embodiment, specifically provided are compounds of the formula (la) in which Ami is Ser, Ser-Asn, Ser-Asn-Thr or absent.
In another embodiment, specifically provided are compounds of the formula (la) in which Am2 is Ser-Phe, Phe or absent.
In yet another embodiment, specifically provided are compounds of the formula
(la) in which Am3 is Thr-Ser, Asn-Thr-Ser, Thr-Ser-Ser, Ser-Ser-Phe or Ser-Glu-Ser.
In yet another embodiment, specifically provided are compounds of the formula (la) in which Am i is Ser; Am3 is Thr-Ser or Thr-Ser-Ser; Am2 is Ser-Phe or Phe and R is an amidation of a C-terminal carboxylic acid moiety.
In yet another embodiment, specifically provided are compounds of the formula
(la) in which Ami is absent; Am3 is Asn-Thr-Ser; Am2 is Ser-Phe and R is an amidation of a C-terminal carboxylic acid moiety.
In yet another embodiment, specifically provided are compounds of the formula (lb) in which Ami is Ser, Ser-Asn-Thr-Ser, Glu, He, Val, Ser-Asn, Ser-Asn-Thr or absent.
In yet another embodiment, specifically provided are compounds of the formula (lb) in which Am2 is Ser-Phe, Ser-Ile, Val-Phe, Ser- Val, Ile-Phe, Ser-Gln, Val-Gln, Ser- Tyr, Phe, Ser-D-Glu, Val-Ile, Ser-Phe-Lys or absent.
In yet another embodiment, specifically provided are compounds of the formula (lb) in which Am3 is Thr-Ser, Ser-Glu-Ser, Met-Ser, Thr-Ser-Ser, Asn-Thr-Ser, Ser-Ser- Phe or Glu-Ser-Phe.
In yet another embodiment, specifically provided are compounds of the formula (lb) in which R is amidation of a C-terminal carboxylic acid moiety or is absent.
In yet another embodiment, specifically provided are compounds of the formula (lb) in which Ami is Ser; Am3 is Thr-Ser, Met-Ser or Thr-Ser-Ser; Am2 is Ser-Phe, Ser-
Ile, Val-Phe, Ser-Val, Ile-Phe, Ser.Tyr, Phe, Ser-DGIu or Ser-Phe-Lys and R is an amidation of a C-terminal carboxylic acid moiety or is absent.
In yet another embodiment, specifically provided are compounds of the formula (lb) in which Ami is Ser-Asn-Thr-Ser; Am3 is Ser-Glu-Ser; Am2 is a bond and R is an amidation of a C-terminal carboxylic acid moiety. In yet another embodiment, specifically provided are compounds of the formula (lb) in which Ami is Glu; Anri3 is Thr-Ser or Met-Ser; Am2 is Ser-Phe or Val-IIe and R is an amidation of a C-terminal carboxylic acid moiety.
In yet another embodiment, specifically provided are compounds of the formula (lb) in which Ami is He; Am3 is Thr-Ser or Met-Ser; Am2 is Ser-Phe, Ser-Gln or Val-Gln and R is absent.
In yet another embodiment, specifically provided are compounds of the formula (Ic) in which Z is A1T13-L2 wherein Am3 is Asn-Thr-Ser-Glu-Ser-Phe, Glu-Thr-Ser-Lys- Ser-Phe or Asn-Thr-Ser and L2 is absent.
In yet another embodiment, specifically provided are compounds of the formula
(Ic) in which Z is Ani3-L2 wherein Am3 is Asn-Thr-Ser-Glu-Ser-Phe and L2 is -NH- (CH2)5-CO-.
In yet another embodiment, specifically provided are compounds of the formula (Ic) in which Li is an amide bond.
In yet another embodiment, specifically provided are compounds of the formula
(Ic) in which L, is -CO-(CH2)5-NH-.
In yet another embodiment, specifically provided are compounds of the formula (Ic) in which R is an amidation of a C-terminal carboxylic acid moiety.
In yet another embodiment, specifically provided are compounds of the formula (Ic) in which R is absent.
In yet another embodiment, specifically provided are compounds of the formula (Ic) in which Y is Gin; Z is Am3-L2 wherein A1TI3 is Asn-Thr-Ser-Glu-Ser-Phe or Glu- Thr-Ser-Lys-Ser-Phe and L2 is -NH-(CH2)5-CO- or is absent; and R is absent.
In yet another embodiment, specifically provided are compounds of the formula (Ic) in which Y is Glu; Z is Am3-L2 wherein Am3 is Asn-Thr-Ser-Glu-Ser-Phe or Glu- Thr-Ser-Lys-Ser-Phe and L2 is absent; and R is an amidation of a C-terminal carboxylic acid moiety.
In yet another embodiment, specifically provided are compounds of the formula (I) in which Am i represents 1 to 4 amino acid residues which may be same or different and each independently selected from Ser, Val, Glu, He, Asn and Thr or absent; X is selected from Lys, Glu or Ser; with the proviso that when X is Ser then Ami is absent; Y is Glu or Lys; Li is -CO-(CH2)n-NH-, -NH-(CH2)n-CO- or an amide bond, which form a cyclic structure together with free carboxylic acid and amino group of X and Y; 'n' is an integer selected from 1 to 5, both inclusive; Am? represents direct bond or 1 to 2 amino acid residues which may be same or different and each independently selected from Phe, Ser, Glu, He, Val, Gin and Tyr; Z is Am3-L2; L2 is -NH-(CH2)n-CO- or absent; Ani3 represents 2 to 6 amino acid residues which may be same or different and each independently selected from Thr, Ser, Met, Glu, Asn, Phe and Lys; R is free C-terminal, amidated C-terminal or amidated gamma C-terminal.
In an embodiment, specific compounds of formula (I) without any limitation are enumerated in Table ( 1 ):
Table 1
Figure imgf000011_0001
Figure imgf000012_0001
Figure imgf000013_0001
Figure imgf000014_0001
Figure imgf000015_0001
SE*TSK*SE {C-terminus Glutamic acid is D- Glu} (SEQ ID NO: 27)
Figure imgf000017_0001
(SEQ ID NO: 36)
The present invention further provides modifications, derivatives of the peptides and pharmaceutical compositions comprising the peptides for treatment of cancer or infection via immunopotentiation caused by inhibition of immunosuppressive signal induced by PD-1 , PD-L1 , or PD-L2 and therapies using them, immunopotentiative substrates included as the active ingredients.
In accordance with the present invention, in one of the embodiment there are provided compounds capable of inhibiting ability to inhibit the programmed cell death 1 (PD1) signalling pathway and being capable of reducing PD-L1 or PD-L2 binding to PD- 1 and resulting immunosuppressive signalling by PD- 1 , wherein the compound comprises a peptide moiety or a modified peptide moiety derived from the peptide fragments of PD1 peptide itself.
The complete amino acid sequence of human PD-1 is disclosed in US5629204 (Honjo et. al.) and Finger et al., (Gene, 1997, 197, 177-187). Human and mouse PD-1 share around 60% amino acid identity, whereas the extracellular IgV domain shows only 21% and 16% sequence identity with CD28 and CTLA4, respectively.
PD-1 possesses an ectodomain having multiple loop structures and strands between the loops. The amino acid sequence of the extracellular domain of human PD- 1 is as set forth in SEQ ID NO: 1. SEQ ID NO: 1 Extracellular domain of human PD-1
PPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQ PGQDCRFRVTQLPNGRDFHMSVVRAPvRNDSGTYLCGAISLAPKAQIKESLRAEL RVTERRAEVPTAHPSPSPRSAGQFQTLV
These loop and strand assignments of amino acids are based on the 1.8-A- resolution structure of the murine PD- 1/PD-L2 complex reported in Lazar-Molnar et al, (PNAS, 2008, 105, 30, 10483-10488).
Out of the various loops and strands of the PD-1 ectodomain, BC loop (i.e. 24th to 30th amino acid of SEQ ID NO: 1) was taken up for further modification. The present invention provides compounds comprising of modified BC loop of extracellular domain of human PD- 1.
SEQ ID NO: 2 BC Loop comprise of amino acid sequences as
SNTSESF.
Compounds of the invention may comprise peptide moieties that are lipidated. One or more of the amino acids of the peptide may be a D-amino acid with a view to provide improved stability in vivo.
The invention includes compounds as described above, formulated for pharmaceutical administration, typically by combination with a pharmaceutically acceptable carrier or diluent.
The invention includes compounds as described above for use in a method of medical treatment, e.g. in the treatment of cancer, treatment of bacterial and viral infections.
The invention further includes a method of screening compounds for ability to block interaction between PD- 1 and a PD-1 ligand, comprising contacting candidate compounds of the kind described above with PD-1 or a PD-1 ligand binding portion of PD- 1 and with a PD-1 ligand or a PD- 1 binding portion of a PD-1 ligand, and measuring the extent of PD-l PD-1 ligand binding.
In addition, compounds of the invention may be combined with carrier molecules such as dendrimers, e.g. PAMAM dendrimers, liposomes, micro-particles and nanoparticles such as polycyanoacrylate nanoparticles, and these also may be PEGylated. In one of the embodiment of the present invention there is provided a compound having the ability to inhibit the programmed cell death 1 (PD1) signalling pathway and being capable of reducing PD-L 1 or PD-L2 binding to PD- 1 and resulting immunosuppressive signalling by PD-1.
Further embodiment of the present invention relates to the compounds as disclosed in the present invention, wherein one or more of the amino acids of the peptide moiety the compounds is substituted with a D-amino acid.
The compounds as disclosed in the present invention are formulated for pharmaceutical administration.
Another embodiment of the present invention provided a pharmaceutical composition comprising the compound as disclosed, and a pharmaceutically acceptable carrier or diluent.
Yet another embodiment of the present invention provides use of the compounds as disclosed in the present invention for the preparation of a medicament for the treatment of cancer.
Yet another embodiment of the present invention provides use of the compounds as disclosed in the present invention for the preparation of a medicament for the treatment of bacterial and viral infection.
Yet another embodiment of the present invention provides a method of treatment of cancer, wherein the method comprises administration of an effective amount of the compound and/or peptides of the present invention to the subject in need thereof.
Yet another embodiment of the present invention provides a method for inhibiting growth of tumour cells and/or metastasis by administering an effective amount of the compound of the present invention to the subject in need thereof.
The said tumour cells include cancer such as but not limited to melanoma, renal cancer, prostate cancer, breast cancer, colon cancer and lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, non-Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, chronic or acute leukemias including acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, solid tumours of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumour angiogenesis, spinal axis tumour, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, T-cell lymphoma, environmentally induced cancers including those induced by asbestos, and combinations of said cancers.
Still yet another embodiment of the present invention provides a method of treatment of infection via immunopotentiation caused by inhibition of immunosuppressive signal induced by PD- 1 , PD-L 1 , or PD-L2, wherein the method comprises administration of an effective amount of the compound and/or peptides of the present invention to the subject in need thereof.
The infectious disease includes but not limited to HIV, Influenza, Herpes, Giardia, Malaria, Leishmania, the pathogenic infection by the virus Hepatitis (A, B, & C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, cornovirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus and arboviral encephalitis virus, pathogenic infection by the bacteria chlamydia, rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and conococci, klebsiella, proteus, serratia, pseudomonas, E. coli, legionella, diphtheria, salmonella, bacilli, cholera, tetanus, botulism, anthrax, plague, leptospirosis, and Lyme's disease bacteria, pathogenic infection by the fungi Candida (albicans, krusei, glabrata, tropicalis, etc.), Cryptococcus neoformans, Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor, absidia, rhizophus), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum, and pathogenic infection by the parasites Entamoeba histolytica, Balantidium coli, Naegleriafowleri, Acanthamoeba sp., Giardia lambia, Cryptosporidium sp., Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondi, Nippostrongylus brasiliensis.
The compounds of the present invention may be used as single drugs or as a pharmaceutical composition in which the compound is mixed with various pharmacologically acceptable materials.
The pharmaceutical composition is usually administered by a parenteral administration route, but can be administered by oral or inhalation routes. Examples of the parenteral administration include administration by injection, and percutaneous, transmucosal, transnasal and trans pulmonary administrations.
The injectable materials include a solution, a suspension, and a solid injection that is dissolved or suspended in a solvent before use.
The injection is used after one or more active ingredients are dissolved, suspended or emulsified in a solvent. Examples of the solvent include water-soluble solvents (e.g., distilled water, physiological saline and Ringer's solution), oil solvents (e.g., vegetable oils such as olive oil, sesame oil, cotton oil and corn oil, and alcohols such as propylene glycol, polyethylene glycol and ethanol), and combinations thereof.
Further, the injection may contain a stabilizer (e.g., human serum albumin), solubilizing agent (e.g., polyethylene glycol, propylene glycol, D-mannitol, trehalose, benzyl benzoate, ethanol, trisaminomethane, cholesterol, triethanolamine, sodium carbonate, sodium citrate, sodium salicylate and sodium acetate), suspending agent (e.g., surfactants such as stearyl triethanolamine, sodium lauryl sulfate, lauryl aminopropionic acid, lecithin, benzalkonium chloride, benzethonium chloride and glyceryl monostearate; hydrophilic polymers such as polyvinyl alcohol, polyvinyl pyrrolidone, sodium carboxymethyl cellulose, methyl cellulose, hydroxymethyl cellulose, hydroxyethyl cellulose and hydroxypropyl cellulose; polysorbates; and polyoxyethylene hardened castor oil), emulsifier, soothing agent (e.g., benzyl alcohol), tonicity agent (e.g., sodium chloride, glycerin, D-mannitol, D-sorbitol and glucose), buffer, preservative (e.g., methylparaben, propylparaben, benzyl alcohol, chlorobutanol and phenol), antiseptic (e.g., paraoxybenzoic esters, chlorobutanol, benzyl alcohol, phenethyl alcohol, dehydroacetic acid and sorbic acid), antioxidant (e.g., sulfite and ascorbate) and dispersant (e.g., Polysorbate 80, Polyoxyethylene hardened castor oil 60, ethylene glycol, carboxymethyl cellulose and sodium alginate). These injections may be prepared by known methods in the formulation technology field, such as by a method described in various Pharmacopoeia. They are prepared, for example, through a sterilization process at the final stage, or by aseptic manipulation. It is also possible to use an aseptic solid fonnulation, such as a freeze dried product, wherein the aseptic solid fonnulation is prepared and dissolved in aseptic or sterilized distilled water for injection or other solvents before use.
These parenteral solutions may be supplied in a vessel with a standard capacity, such as a plastic or glass vial, ampoule, syringe and injector, or in a vessel with a large capacity, such as a bottle.
The dosage of the compounds of the present invention varies depending on age, weight, symptom, therapeutic efficacy, dosing regimen and/or treatment time. Generally, they may be administered by a parenteral route (preferably intravenous administration) in an amount of 1 mg to 100 mg per time, from once a couple of days, once 3 days, once 2 days, once a day to a couple of times a day, in the case of an adult, or continuously administered by intravenous administration from 1 to 24 hours a day. Since the dosage is affected by various conditions, an amount less than the above dosage may sometimes work well enough, or higher dosage may be required in some cases.
Parenteral administration by injection includes all forms of injections, and also includes intravenous fluids. For example, it includes intramuscular injections, subcutaneous injections, intradermal injections, intraarterial injections, intravenous injections, intraperitoneal injections, injections to spinal cavity, and intravenous drops.
The compounds of the present invention may be administered in combination with other drugs for (1) complementation and/or enhancement of prevention and/or therapeutic efficacy of the preventive and/or therapeutic drug of the present invention, (2) dynamics, absorption improvement, dosage reduction of the preventive and/or therapeutic drug of the present invention, and/or (3) reduction of the side effects of the preventive and/or therapeutic drug of the present invention.
A concomitant medicine comprising the peptide of the present invention and other drug may be administered as a combination preparation in which both components are contained in a single formulation, or administered as separate formulations. The administration by separate formulations includes simultaneous administration and administration with some time intervals. In the case of the administration with some time intervals, the compound of the present invention can be administered first, followed by another drug or another drug can be administered first, followed by the compound of the present invention. The administration method of the respective drugs may be the same or different.
The dosage of the other drug can be properly selected, based on a dosage that has been clinically used. The compounding ratio of the compound of the present invention and the other drug can be properly selected according to age and weight of a subject to be administered, administration method, administration time, disorder to be treated, symptom and combination thereof. For example, the other drug may be used in an amount of 0.01 to 100 parts by mass, based on 1 part by mass of the compound of the present invention. The other drug may be a combination of two or more kind of arbitrary drugs in a proper proportion. The other drug that complements and/or enhances the preventive and/or therapeutic efficacy of the compound of the present invention includes not only those that have already been discovered, but those that will be discovered in future, based on the above mechanism.
Diseases on which this concomitant use exerts a preventive and/or therapeutic effect are not particularly limited. The concomitant medicine can be used for any diseases, as long as it complements and/or enhances the preventive and/or therapeutic efficacy of the compound of the present invention.
Particularly, since the compound of the present invention exhibits an effect of stimulating or proliferating lymphoid cells, the concomitant use is able to reduce a dosage of chemotherapeutics commonly used or an irradiation dosage in radio therapy. This results in suppression of side effects that accompany with chemotherapy and radio therapy.
The compound of the present invention can be used with an existing chemotherapeutic concomitantly or in a mixture form. Examples of the chemotherapeutic include an alkylation agent, nitrosourea agent, antimetabolite, anticancer antibiotics, vegetable-origin alkaloid, topoisomerase inhibitor, hormone drug, hormone antagonist, aromatase inhibitor-, P-glycoprotein inhibitor, platinum complex derivative, other immunotherapeutic drugs and other anticancer drugs. Further, it can be used with a cancer treatment adjunct, such as a leucopenia (neutrophenia) treatment drug, thrombocytopenia treatment drug, antiemetic and cancer pain intervention drug, concomitantly or in a mixture form.
The compound of the present invention can be used with other immunomodulators concomitantly or in a mixture form. Examples of the immunomodulator include various cytokines. Examples of the cytokines that stimulates immune responses include GM-CSF, M-CSF, G-CSF, interferon-a, β, or γ, IL- 1, IL-2, IL-3 and IL-12.
The concomitant use of the compound of the present invention and a cancer antigen is able to give an additive or synergetic enhancement effect. Examples of the cancer antigen include HLA-A l and HLA-A2 derived peptides derived from MAGE-1 or MAGE-3 of malignant melanoma, MART-1 and gpl OO, HER2/neu peptide of breast cancer and ovarian cancer, MUC-1 peptide of adenocarcinoma and NY-ESO-1 of metastatic cancer.
EXPERIMENTAL
Different immunomodulatory compounds of the present invention were prepared via solid phase peptide synthesis, which was carried out manually using either a custom made glass reactor with a frit or polyethylene vessel equipped with a polypropylene filter.
All the compounds described herein, including compounds of general formula (I), (la) (lb) and (Ic), and specific examples are prepared using techniques known to one skilled in the art through the procedure depicted below or by other methods. Furthermore, in the following procedures, where specific acids, bases, reagents, coupling agents, solvents, etc. are mentioned, it is understood that other suitable acids, bases, reagents, coupling agents etc. may be used and are included within the scope of the present invention. The compounds obtained by using the below procedures may be of insufficient purity. These compounds can be purified by using any of the methods for purification of organic compounds known to persons skilled in the art, for -example, crystallization or silica gel or alumina column chromatography using different solvents in suitable ratios. All possible stereoisomers are envisioned within the scope of this invention.
Removal of Allyloxycarbonyl (Alloc) /OAII group of side chain of Lysine and Glutamic acid After the completion of the linear protected peptide sequence, the Alloc- protecting group from Lys (Alloc) and allyl protecting group from Glutamic acid was removed from the peptidyl resin by treating with tetrakistriphenylphosphine palladium (0) ( 10 Equiv) and Phenyl silane (20 eqv) in a solution of chloroform/N-methylpyrrolidine (95/5 v/v) for 6 h under argon. The resin (1 g) was washed with a solution of 10% NMP in chloroform (6 X 15m L); 1% DIEPA in DMF (6 X 15 m L); DCM (6 X 15 m L); DMF (6 X 15m L); and finally with NMP (3 X 15ml each); The deprotection and resulting free amino group was confirmed by Kaiser test.
Lactam bridge/Cyclisation: A solution of HOBT/DIC (5 equivalent each relative to resin loading) in NMP was added to the resin and coupling was carried out overnight. After 18 hr the resin was filtered and washed with DMF/DCM/DMF (6 X 10 m L). Kaiser test was carried out and in case of slight blue colouration, the peptidyl resin was capped with acetylating mixture (Pyridine DCM/acetic anhydride: 8:8: 1 ). After 30 min, the resin was filtered and washed with DMF/DCM/DMF (6 X 10 m L each)
Procedure for cleavage of peptidyl resin and global deprotection
The peptidyl Resin was washed with MeOH (6 X 15 ml) and solvent ether (3 X 15 ml) and dried under vacuum. The cleavage of the peptides from the solid support is achieved by treating the peptide-resin with cleavage cocktail as specified for each peptide at room temperature for 2.5 h. Cleavage mixture was collected by filtration and the resin was washed with TFA and DCM. The excess TFA and DCM was concentrated to small volume under nitrogen and DCM was added to the residue and evaporated under nitrogen. The process was repeated 3-4 times to remove most of the volatile impurities. The residue was cooled to 0°C and anhydrous ether was added to precipitate the peptide. The precipitated peptide was centrifuged and the supernatant ether was removed and fresh ether was added to the peptide and re-centrifuged. The residue was dissolved in Millipore water and lyophilized to obtain the crude peptide.
Cleavage cocktail A= 80% TFA / 5% phenol / 5% thioanisole / 2.5% 1,2 ethanedithiol / 5% DCM/ 2.5 % DMS
Cleavage Cocktail B= 90% TFA / 5% TIPS / 5% water
Purification and characterization of peptide
The Reverse phase analytical HPLC was performed using on Zorbax Eclipse XDB-C 18 silica column (4.6 mm X 250mm, 5μιη). The elution conditions used are
Method -1 : Buffer A: 0.1% TF A/ Water, Buffer B: 0.1% TFA in 9: 1 acetonitrile /water.
Equilibration of the column with 2 % buffer B and elution by a gradient of 2% to 70% buffer B during 15 min.
LCMS was performed on AP I 2000 LC/MS/MS triple quad (Applied biosystems) with Agilent 1 100 series HPLC with G1315 B diode array detector (DAD) or using Agilent LC MSD VL single quad with Agilent 1 100 series HPLC with G 13 15 B DAD.
For further illustration of methods of preparing the compounds of the present invention, the following examples are disclosed below.
Example: 1 Synthesis of compound 2
Figure imgf000027_0001
Desiccated Rink Amide MBHA-Amide resin (100-200 mesh, 0.66 mmol/g, 2 g) was placed in a polyethylene vessel equipped with a polypropylene filter. Resin was swelled in DCM (25 m L) for 1 h and DMF (25 m L) for 1 h. The Fmoc group of the Rink Amide MBHA- Amide was deprotected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min (20 m L). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deportation was positive. The C-terminal amino acid, Fmoc-Phe- OH (2.6 g; 5 equiv; 6.6 mmol) in dry DMF was added to the deprotected resin and coupling was initiated with DIC (1.1 m L; 5 equiv) and HOBT (0.84 g; 5 equiv) in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of coupling was negative. After the first amino acid attachment, the unreacted amino group, if any, in the resin is capped, used acetic anhydride/pyridine DCM (1 :8:8) for 20 minutes to avoid any deletion of the sequence. After capping, resin is washed with DCM (6 X 15 m L), DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). The Fmoc group on the C-terminal amino acid attached peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine/DMF solution for 5 and 15 min (20 m L). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive. Fmoc-Ser (tBu)-OH (2.5 g; 5 equiv; 6.6 mmol) in dry DMF was added to the deprotected resin and coupling was initiated with DIC ( 1.1 m L; 5 equiv) and HOBT (0.84 g; 5 equiv) in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of coupling was negative. The Fmoc group of the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine/DMF solution for 5 and 15 min (20 m L). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive. Next amino acid in the peptide sequence Fmoc-Lys(Alloc)-OH (2.9 g; 5 equiv; 6.6 mmol) in dry DMF was added to the deprotected resin and coupling was initiated with DIC ( 1.1 m L; 5 equiv) and HOBT (0.84 g; 5 equiv) in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of coupling was negative. On completion of threonine coupling Fmoc group on the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine/DMF solution for 5 and 15 min (20 m L). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deportation was positive. Next amino acid Fmoc-Ser (tBu)-OH (2.5 g; 5 equiv; 6.6 mmol) in dry DMF was added to the deprotected resin and coupling was initiated with DIC (1.1 m L; 5 equiv) and HOBT (0.84 g; 5 equiv) in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of coupling was negative. The Fmoc group on the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine/DMF solution for 5 and 15 min (20 mL). The resin was washed with DMF (6 X 15 m L), DCM (6 X 1 5 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive. Fmoc-Thr- (tBu)-OH (2.6 g; 5 equiv; 6.6 mmol) in Dry DMF was added to the deprotected resin and coupling was initiated with DIC (1.1 m L; 5 equiv) and HOBT (0.84 g; 5 equiv) in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of coupling was negative. The Fmoc group of the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine DMF solution for 5 and 15 min (20 mL). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive. Next amino acid Fmoc-Glu (OAIl)-OH (2.8 g; 5 equiv; 6.6 mmol) in dry DMF was added to the deprotected resin and coupling was initiated with DIC ( 1.1 m L; 5 equiv) and HOBT (0.84 g; 5 equiv) in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of coupling was negative. The Fmoc group of the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperdine/DMF solution for 5 and 15 min (20 mL). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive. Next amino acid Fmoc-Ser (tBu)-OH (2.5 g; 5 equiv; 6.6 mmol) in dry DMF was added to the deprotected resin and coupling was initiated with DIC ( 1 .1 m L; 5 equiv) and HOBT (0.84 g; 5 equiv) in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6
X 15 m L). Kaiser test on peptide resin aliquot upon completion of coupling was negative. After the completion of the linear protected peptide sequence, the Alloc- protecting group from Lys (Alloc) and Allyl protecting group from Glutamic acid was removed as mentioned in the general procedure using tetrakistriphenylphosphine palladium (0) ( 10 Equiv; 12.6 g) and Phenyl silane (20 eqv; 1.7 m L). The Lactam
Bridge was carried out as mentioned in the general procedure using HOBT (0.7 g) DIC (0.8 m L) method. The peptidyl resin was cleaved as mentioned in procedure for cleavage using cleavage cocktail B to yield (760 mg), 75 % yield. The crude material was purified by preparative HPLC on water's X-bridge, C I 8, 19X 150mm,5um column with buffer A: 0.1 % TF A/Water, buffer B: 0.1%TFA/ CH3CN. The peptide was eluted by gradient elution 0-4 min = 5-20 % buffer B, 4-6 min = 20-33 % buffer B with a flow rate of 15 m L/min. HPLC: RT -10.1 min (97.1%); LCMS Calculated Mass: 765.84, Observed Mass: 766.4 [M] +.
Example: 2 Synthesis of compound 1
Figure imgf000030_0001
Synthesis was carried out as explained in procedure for compound 2, using Rink Amide MBHA-Amide resin ( 100-200 mesh, 0.66 mmol/g, 1 g). The C-terminal amino acid was coupled as Fmoc-Phe-OH (1.3 g; 5 equiv) using DIC (0.55 m L; 5 equiv) and HOBT (0.42 g; 5 equiv) in DMF. The remaining amino acids; Fmoc-Ser (OtBu)-OH ( 1.3 g; 5 equiv), Fmoc-Glu (OAllyl)-OH (1.4 g; 5 equiv), Fmoc-Ser (OtBu)-OH (1.3 g; 5 equiv), Fmoc-Thr- (OtBu)-OH ( 1.3 g; 5 equiv), Fmoc-Lys(A!loc)-OH (1.5 g; 5 equiv) and Boc- Ser (OtBu)-OH (0.9 g; 5 equiv) were coupled sequentially by following analogous procedure as mentioned in example 1. After the completion of the linear protected peptide sequence, the Alloc- protecting group from Lysine and Allyl protecting group from Glutamic acid was removed as mentioned in the general procedure using tetrakistriphenylphosphine palladium (0) (5 Equiv; 2 g) and Phenyl silane (10 eqv; 0.3 m L). The lactam bridge was carried out as mentioned in the general procedure using HOBT (5 equiv excess)/DIC (5 equiv excess) method. The peptidyl resin was cleaved as mentioned in procedure for cleavage using cleavage cocktail A to yield (380 mg), 75 % yield. The crude material was purified by preparative HPLC on Water's X-bridge C I 8, ( 19X 150mm, 5um) with buffer A: 0.1 % TF A/Water, buffer B: 0.1%TFA/ CH3CN. The peptide was eluted by gradient elution 0-4 min = 5-20 % buffer B, 4- 10 min = 20-70 % buffer B with a flow rate of 15 mL/min. HPLC: RT - 10.3 min (96.5%); LCMS Calculated Mass: 765.84, Observed Mass: 766.3 [M]+.
Example: 3 Synthesis of compound 12
Figure imgf000031_0001
Synthesis was carried out as explained in procedure for compound 2, using Rink Amide MBHA-Amide resin ( 100-200 mesh, 0.66 mmol/g, 0. 5 g). The C-terminal amino acid was coupled as Fmoc-Glu-(OH)-OtBu where γ-carboxyl group of glutamic acid was used as point of attachment and its alpha carboxyl is protected as OtBu ester (0.68 g; 5 equiv; 1.65 mmol) to liberate the free peptide as Gin in the C-terminus. The remaining amino acids; Fmoc-Val (0.6 g), Fmoc-Lys(Alloc)-OH (0.72 g), Fmoc-Ser (tBu)-OH (0.62 g), Fmoc-Met-OH (0.6 g), Fmoc-Glu (OAll)-OH (0.7 g) and Boc-Ile-OH (0.42 g) were coupled sequentially as mentioned in example 1. After the completion of the linear protected peptide sequence, the Alloc- protecting group from Lys (Alloc) and Allyl protecting group from Glutamic acid was removed as mentioned in the general procedure using tetrakistriphenylphosphine palladium (0) (5 Equiv; 2 g) and Phenyl silane (10 eqv; 0.3 m L). The lactam bridge was carried out as mentioned in the general procedure using HOBT (0.18 g)/DIC (0.2 m L) method. The peptidyl resin was cleaved as mentioned in procedure for cleavage using cleavage cocktail A to yield (160 mg), 60 % yield. The crude material was purified by preparative HPLC on Phenomex. Luna C I 8, (10X250mm,5um) with buffer A: 0.1 % TF A/Water, buffer B: CH3CN. The peptide was eluted by gradient elution 0-5 min = 10- 15 % buffer B, 5-25 min = 15-25 % buffer B with a flow rate of 5 mL/min. HPLC: RT -10.3 min (96.5%); LCMS Calculated Mass: 816.01 , Observed Mass: 816.3 [M]+.
Example: 4 Synthesis of compound 14
Figure imgf000031_0002
Synthesis was carried out as explained in procedure for compound 2, using Rink Amide MBHA-Amide resin ( 100-200 mesh, 0.66 mmol/g, 1 g). The C-terminal amino acid was coupled as Fmoc-Glu-(OH)-OAllyl where γ-carboxyl group of Glutamic acid was used as point of attachment and its alpha carboxyl is protected as OAllyl ester (0.92 g; 5 equiv; 3.3 mmol). The remaining amino acids; Fmoc-Phe-OH (0.85 g), Fmoc-Ser (tBu)- OH (0.84 g), Fmoc-Glu(OtBu)-OH (0.94 g), Fmoc-Ser(tBu)-OH (0.84 g), Fmoc- Thr(tBu)-OH (0.87 g), Fmoc-Asn (Trt)-OH (1.3 g) and Fmoc-Ser(tBu)-OH (0.84 g) were coupled sequentially as mentioned in example 1. After the completion of the linear protected peptide sequence with Fmoc, allyl protecting group from the C-terminus was removed as mentioned in the general procedure using tetrakistriphenylphosphine palladium (0) (5 Equiv; 3.8 g) and Phenyl silane ( 10 eqv; 0.58 m L). The Fmoc group of the N-terminus of the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperidine DMF solution for 5 and 15 min (20 m L). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive. Cyclization was carried out as mentioned in the general procedure using HOBT (0.54 g)/DIC (0.82 m L) method. The peptidyl resin was cleaved using cleavage cocktail B to yield (380 mg), 65 % yield. The crude material was purified by preparative HPLC on Zorbax Eclipse XDB C I 8, (9.4X250mm, 5um) with buffer A: 0.1% TF A/Water, buffer B: CH3CN. The peptide was eluted by gradient elution 0-2 min = 5- 10 % buffer B, 2- 14 min = 10- 18 % buffer B with a flow rate of 7 m L/min. HPLC: RT - 10.168 min (96.5%); LCMS Calculated Mass: 880.8, Observed Mass: 881.7 [M+H] +.
Example: 5 Synthesis of compound 15
Figure imgf000032_0001
Synthesis was carried out as explained in procedure for compound 2, using Rink Amide MBHA-Amide resin ( 100-200 mesh, 0.66 mmol/g, 1 g). The C-terminal amino acid was coupled as Fmoc-Glu-(OH)-OAllyl where γ-carboxyl group of Glutamic acid was used as point of attachment and its alpha carboxyl is protected as OAllyl ester (0.92 g; 5 equiv; 3.3 mmol). The remaining amino acids; Fmoc-Ahx-OH(0.82g), Fmoc-Phe-OH (0.85 g), Fmoc-Ser (tBu)-OH (0.84 g), Fmoc-Glu(OtBu)-OH (0.94 g), Fmoc-Ser(OtBu)- OH (0.84 g), Fmoc-Thr(OtBut)-OH (0.87, g), Fmoc-Asn(Trt)-OH ( 1.3 g) and Fmoc- Ser(tBu)-OH (0.84 g) were coupled sequentially as mentioned in example 1. After the completion of the linear protected peptide sequence with Fmoc, allyl protecting group from the C-terminus was removed as mentioned in the general procedure using tetrakistriphenylphosphine palladium (0) (5 Equiv; 3.8 g) and Phenyl silane (10 eqv; 0.58 m L). The Fmoc group of the N-terminus of the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min (20 m L). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 1 5 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive. Cyclization was carried out as mentioned in the general procedure using HOBT (0.54 g) DlC (0.82 m L) method. The peptidyl resin was cleaved using cleavage cocktail B to yield (680 mg), 70 % yield. The crude material was purified by preparative HPLC on Zorbax Eclipse XDB C 18, (9.4 X 250 mm, 5 urn) with buffer A: 0.1% TF A/Water, buffer B: CH3CN. The peptide was eluted by gradient elution 0-3min = 10-10 % buffer B, 3-60 min = 10-50 % buffer B with a flow rate of 7 m L/min. HPLC: RT- 1 1.054 min (95.4%); LCMS Calculated Mass: 993.7, Observed Mass: 994.8 [M+H] +.
Example: 6 Synthesis of compound 17
Figure imgf000033_0001
Synthesis was carried out as explained in procedure for compound 2, using Rink Amide MBHA-Amide resin ( 100-200 mesh, 0.66 mmol/g, 1 g). The C-tenninal amino acid was coupled as Fmoc-Glu-(OH)-OAIlyl where γ-carboxyl group of gutamic acid was used as point of attachment and its alpha carboxyl is protected as OAllyl ester (0.92 g; 5 equiv; 3.3 mmol). The remaining amino acids; Fmoc-Phe-OH (0.85 g), Fmoc-Ser (tBu)-OH (0.84 g), Fmoc-Lys(Boc)-OH ( 1.01 g), Fmoc-Ser(tBu)-OH (0.87 g), Fmoc-Thr (tBu)-OH (0.93 g;) and Fmoc-Glu(OtBu)-OH (0.98 g) Fmoc-Ser (tBu)-OH (0.84 g), Fmoc-Ahx- OH (0.82 g), were coupled sequentially as mentioned in example 1. After the completion of the linear protected peptide sequence with Fmoc, allyl protecting group from the C- terminus was removed as mentioned in the general procedure using tetrakistriphenylphosphine palladium (0) (5 Equiv; 3.8 g) and Phenyl silane ( 10 eqv; 0.58 m L). The Fmoc group of the N-terminus of the peptidyl resin was deprotected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min (20 m L). The resin was washed with DMF (6 X 15 m L), DCM (6 X 15 m L) and DMF (6 X 15 m L). Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive. Cyclization was carried out as mentioned in the general procedure using HOBT (0.54 g) DIC (0.82 m L) method. The peptidyl resin was cleaved using cleavage cocktail B to yield (410 mg), 69 % yield. LCMS Calculated Mass: 1007.5, Observed Mass: 1008.6 [M+H] +.
Example: 7 Synthesis of compound 19
Figure imgf000034_0001
Synthesis was carried out as explained in procedure for compound 2, using Rink Amide MBHA-Amide resin ( 100-200 mesh, 0.66 mmol/g, 1 g). The C-terminal amino acid was coupled as Fmoc-Glu (OAllyl)-OH (1.3 g; 5 equiv) using DIC (0.52 m L; 5 equiv) and HOBT (0.45 g; 5 equiv) in DMF. The remaining amino acids; Fmoc-Phe-OH ( 1.25 g; 5 equiv), Fmoc-Ser (OtBu)-OH (1.3 g; 5 equiv), Fmoc-Glu-(OtBu)-OH ( 1.35 g; 5 equiv.), Fmoc-Ser(OtBu)-OH (1.3 g; 5 equiv), Fmoc-Thr (OtBu)-OH (1.3 g; 5 equiv), Fmoc- Asn(Trt)-OH (1.96 g; 5 equiv), Fmoc-Ser(OtBu)-OH ( 1.3 g; 5 equiv) and Fmoc-Ahx-OH (l -2g; 5 equiv) were coupled sequentially as mentioned in example 1. After the completion of the linear protected peptide sequence, allyl protecting group from Glutamic acid was removed as mentioned in the general procedure using tetrakistriphenylphosphine palladium (0) (5 Equiv; 2 g) and Phenyl silane ( 10 eqv; 0.3 m L). This was followed by Fmoc removal of N-terminal Fmoc protecting group on Ahx using 20 % Pip/DMF. Cyclization was carried out as mentioned in the general procedure using HOBT/DIC (both 5 Equiv excess) method. The peptidyl resin was cleaved as mentioned in procedure for cleavage using cleavage cocktail A to yield (400 mg), 60 % yield. The crude material was purified by preparative HPLC on Water's X-bridge C I 8, (9.4X250mm, 5um) with buffer A: 0.1 % TFA/Water, buffer B: 0.1%TFA/ CH3CN.; LCMS Calculated Mass: 994.0 Observed Mass: 994.8 [M+H]+.
Example: 8 Synthesis of compound 23
Figure imgf000035_0001
Desiccated 2-chlorotrityl chloride resin (1 g; 1.12 m mol/g) was swelled in DCM for 1 h in a solid phase reaction vessel. Fmoc-Phe-OH (0.53 g, 1.2 equivalents with respect to resin loading) was dissolved in dry DCM was added in to the reaction vessel followed by the addition of 3.8 eq. of DIPEA (0.73 ml). The coupling was carried out at room temperature for 6 h. The resin was filtered and washed with DCM (3 15 mL), DMF (3 x 15 mL) followed by 1% DIPEA in DMF (3 x 15 mL). Any unreacted chloride groups were capped using methanol. After 30 min the resin was filtered and washed with diethyl ether, desiccated under vacuum overnight. The Phenylalanine first attached resin was used for further chain elongation and peptide synthesis was carried out as mentioned in example 1.
The other compounds of the Table 1 were prepared by following similar procedure as described above with suitable modification known to the one ordinary skilled in the art. The identity of peptide was confirmed by LCMS (Table 2).
Table: 2 LCMS characterization
Comp No LCMS
Calculated mass Observed mass
1. 765.8 766.3 [M]+
2. 765.8 766.4[M]+
3. 751 .8 752.2 [Mf
4. 807.9 808.5[M]+
5. 731.8 732.3 [Mf
6. 791.9 792.3 [M]+
7. 777.9 778.8 [M+H]+
8. 717.8 718.4 [M+H]+
9. 791 .9 792.4 [M]+
10. 777.9 779.4 [M+H]+ 1 1 . 803.9 804.6 [M+H]+
12. 816.0 816.3 [M]+
13. 796.0 796.4 [Mf
14. 880.8 881 .7 [M+H]+
15. 994.0 994.8 [M+H]+
16. 894.9 895.5 [M+H]+
17. 1008.0 1008.6 [M+H]+
18. 994.0 995.0 [M+H]+
19. 994.0 994.8 [M+H]+
20. 894.9 895.5 [M+H]+
21 . 781.8 783.3 [M+H]+
22. 765.9 766.9 [M+H]+
23. 766.8 767.5 [M]+
24. 894.0 894.9 [M+H]+
Although the present application has been illustrated by certain of the preceding examples, it is not to be construed as being limited thereby; but rather, the present appl ication encompasses the generic area as hereinbefore disclosed. Various modifications and embodiments can be made without departing from the spirit and scope thereof. For example, the following compounds which can be prepared by following similar procedure as described above with suitable modification known to the one ordinary skilled in the art are also included in the scope of the present application:
Table 3:
Figure imgf000036_0001
Figure imgf000037_0001
(SEQ ID NO: 35)
(SEQ ID NO: 36)
Use of MDA-MB-231 cells as a source of PD-Ll :
MDA-MB-231 cells were found to express PD-L l by RT-PCR and FACS assays and therefore used as a source of PD-L l in the assays.
Example: 8 The effect of PD1 derived peptides on mouse splenocyte proliferation inhibited by PDL1/PDL2 or tumor cells expressing PDL; analyzed by Fluorescence Activated Cell Shorting (FACS) method using CFSE labeling.
Requirement:
Mouse splenocytes harvested from 6-8 weeks old C57 BL6 mice; RPMI 1640 (GIBCO, Cat # 1 1875); DMEM with high glucose (GIBCO, Cat # D6429); Fetal Bovine Serum [Hyclone, Cat # SH30071.03]; Pencilin ( 10000unit/ml)-Streptomycin( 10,000μg/ml) Liquid (GIBCO, Cat # 15140- 122); MEM Sodium Pyruvate solution l OOmM ( l OOx), Liquid (GIBCO, Cat # 1 1360); Nonessential amino acid (GIBCO, Cat # 1 1 140); L- Glutamine (GIBCO, Cat # 25030); Anti-CD3 antibody (eBiosciences - 16-0032); Anti- CD28 antibody (eBiosciences - 16-0281 ); ACK lysis buffer (l mL) (GIBCO, Cat # - A 10492); Histopaque (density- 1.083 gm/ml) (SIGMA 1083 1 ); Trypan blue solution (SIGMA-T8154); 2ml Norm Ject Luer Lock syringe- (Sigma 2014-12); 40μιη nylon cell strainer (BD FALCON 35230); Hemacytometer (Bright line-SIGMA Z359629); FACS Buffer (PBS/0.1 % BSA): Phosphate Buffered Saline (PBS) pH 7.2 (HiMedia TS 1006) with 0.1 % Bovine Serum Albumin (BSA) (SIGMA A7050) and sodium azide (SIGMA 08591 ); 5 mM stock solution of CFSE: CFSE stock solution was prepared by diluting lyophilized CFSE with 1 80μί of Di methyl Sulfoxide (DMSO C2H6SO, SIGMA-D- 5879) and aliquoted in to tubes for further use. Working concentrations were titrated from 10μΜ to 1 μΜ. (eBioscience-650850-85); 0.05% Trypsin and 0.02% EDTA (SIGMA 59417C); 96-vvell format EL1SA plates (Corning CLS3390); BD FACS caliber (E6016).
Protocol
Splenocyte preparation:
Splenocytes harvested in a 50ml falcon tube by mashing spleen in a 40μηη cell strainer were further treated with lml ACK lysis buffer for 5mins at room temperature. After washing with 9ml of RPMI complete media, cells were re-suspended in 3ml of l PBS in a 15ml tube. 3ml of histopaque was added very carefully to the bottom of the tube without disturbing overlaying splenocyte suspension. Spin the tube at 800xg for 20mins at room temperature. Opaque layer of lymphocytes was collected carefully without disturbing/mixing any of the layers. Cells were washed twice with cold lxPBS followed by total cell counting using trypan blue exclusion method and used further for cell based assays.
CFSE Proliferation assay:
CFSE is the abbreviation of Carboxyfluorescein Diacetate Succinimidyl Ester, a dye that passively diffuses into cells and binds to intracellular proteins.
Tumor cells were cultured and maintained in high glucose complete DMEM media. l xl O5 tumor cells were plated in 96 well plates along with required cone, of PD 1 derived peptide and allowed to adhere at 37°C for 4 hrs. lxl O6 cells / ml of harvested splenocytes were treated with 5μΜ of CFSE in pre wanned lxPBS/0.1 %BSA solution for l Omins at 37°C. Excess CFSE was quenched using 5 volumes of ice-cold culture media to the cells and incubated on ice for 5mins. CFSE labeled splenocytes were further given three washes with ice cold complete DMEM media. CFSE labeled l x l O5 splenocytes were added to above wells containing tumors cells and PD l peptides. Splenocytes were stimulated with anti-CD3 and anti-CD28 antibody ( ^g/ml each) and the co-culture was further incubated for 72hrs at 37°C with 5% CC . Cells were harvested and washed thrice with ice cold FACS buffer and % proliferation was analyzed using a FACS caliber with 488nm excitation and 521nm emission filters. Each experimental condition was carried out in triplicates and each experiment at least carried out three times. % splenocyte proliferation was analyzed using cell quest FACS program and fold induction was calculated by nonnalizing individual values to % background proliferation
Fold Induction = % splenocyte proliferation / % background proliferation Stimulated splenocytes: Splenocytes + anti-CD3/CD28 stimulation
Background proliferation: Splenocytes + anti-CD3/CD28 + PDL or Tumor
Compound effect was examined by adding required cone, of compound to anti- CD3/CD28 stimulated splenocytes in presence of ligand (PDL- l/PDL-2) or tumor cells.
Table 4: The effect of compounds on mouse splenocyte proliferation inhibited by PD1 - PDL 1 interaction in MDAMB231 over expressing PDL 1
Figure imgf000041_0001
Example 9: In vivo efficacy of compound #2 on lung metastasis in B 16F10 subcutaneous melanoma model.
C57/Black6 female mice (Aurigene, Bangalore, India) aged 6 to 8 weeks were used for the experiment. Animals were acclimatized for a week in the experimental room before conducting the experiment. On day 0, B 16F 10 cells grown in DMEM containing 10% FBS at 70 to75% confluency were harvested and 0.1 X 106 cells per animal were injected to mice subcutaneously on the right flank region. On day 1 , peptide (Compound #2) at 5mg/kg dose dissolved in PBS, pH 7.4 was dosed subcutaneously at the rate of l Oml/kg volume for fourteen days once daily. Vehicle control group of mice received only saline. Taxol at 5MPK (i.p) with qd dosing was used as reference in this study. Each group consisted of ten animals. Body weight and clinical signs were recorded daily. There was no body weight reduction during the period of dosing and no clinical signs observed. At the end of 14 days of dosing period lung was harvested and analysed for metastasis by counting the black nodules. It was observed that Compound 2 showed about 54 percent reduction in metastasis (Figure 1).

Claims

Claims
1. A peptide derivative of formula (I)
Figure imgf000043_0001
(I)
wherein,
Ami represents 1 to 4 amino acid residues which may be same or different and each independently selected from Ser, Val, Glu, He, Asn and Thr; or may be absent;
X is selected from Lys, Glu or Ser;
Y is Glu, Gin or Lys;
Li represents -CO-(CH2)n-NH-, -NH-(CH2)n-CO- or an amide bond between X and Y;
'n' is an integer selected from 1 to 5, both inclusive;
Am2 represents 1 to 3 amino acid residues which may be same or different and each independently selected from Phe, Ser, Glu, He, Val, Gin, Tyr and Lys, or may be absent;
L2 is -NH-(CH2)n-CO- or is absent;
Ani3 represents 2 to 6 amino acid residues which may be same or different and each independently selected from Thr, Ser, Met, Glu, Asn, Phe and Lys;
R is an amidation of a C-termtnal carboxylic acid moiety or is absent;
or a pharmaceutical salt of a peptide derivative of formula 1, or a stereoisomer of a peptide derivative of formula 1 or pharmaceutical salt thereof.
2. The compound according to Claim- 1 , wherein one, more or all amino acids is/are in D-configuration.
3. The compound according to Claim- 1, wherein X is Lys.
4. The compound according to Claim- 1 , wherein X is Glu.
5. The compound according to Claim-1 , wherein X is Ser.
6. The compound according to Claim-1 , wherein Li is -CO-(CH2)5-NH-.
7. The compound according to Claim-1 , wherein L| is an amide bond between X and Y.
8. A peptide derivative of Claim 1 having the formula (la):
Figure imgf000044_0001
(la)
wherein,
Ami, Am2, Am3 and R are same as defined in Clam 1 ;
or a pharmaceutical salt of a peptide derivative of formula (la), or a stereoisomer of a peptide derivative of formula (la) or pharmaceutical salt thereof.
9. The compound according to Claim-8, wherein Ami is Ser; Am3 is Thr-Ser or Thr-Ser-Ser; Ani2 is Ser-Phe or Phe and R is an amidation of a C-terminal carboxylic acid moiety.
10. The compound according to Claim-8, wherein Ami is absent; Am3 is Asn- Thr-Ser; Ani2 is Ser-Phe and R is an amidation of a C-terminal carboxylic acid moiety.
1 1. The compound according to Claim-8, wherein Ami is Ser-Asn; Am3 is Ser-Ser-Phe; Am2 is absent and R is an amidation of a C-terminal carboxylic acid moiety.
12. The compound according to Claim-8, wherein Ami is Ser-Asn-Thr; Am3 is Ser-Glu-Ser; Am2 is absent and R is an amidation of a C-terminal carboxylic acid moiety.
13. A peptide derivative of claim 1 having the formula (lb):
Figure imgf000045_0001
(lb)
wherein,
Am I , Am2, Am3 and R are same as defined in Claim 1 ;
or a pharmaceutical salt of a peptide derivative of formula (lb), or a stereoisomer of a peptide derivative of formula (lb) or pharmaceutical salt thereof.
14. The compound according to Claim-13, wherein Ami is Ser; Am3 is Thr- Ser, Met-Ser or Thr-Ser-Ser; Am2 is Ser-Phe, Ser-Ile, Val-Phe, Ser-Val, Ile-Phe, Ser-Tyr, Phe, Ser-DGlu or Ser-Phe-Lys and R is an amidation of a C-terminal carboxylic acid moiety or is absent.
15. The compound according to Claim-13, wherein Ami is Ser-Asn-Thr-Ser; A1TI3 is Ser-Glu-Ser; Am2 is absent and R is an amidation of a C-terminal carboxylic acid moiety.
16. The compound according to Claim- 13, wherein Am i is Glu; Am3 is Thr- Ser or Met-Ser; Am2 is Ser-Phe or Val-Ile and R is an amidation of a C-terminal carboxylic acid moiety.
17. The compound according to Claim-13, wherein Ami is He; Α1Ή3 is Thr- Ser or Met-Ser; Am2 is Ser-Phe, Ser-Gln or Val-Gln and R is absent.
18. The compound according to Claim-13, wherein Ami is Val; Am3 is Thr- Ser; Am2 is Ser-Phe and R is an amidation of a C-terminal carboxylic acid moiety.
19. The compound according to Claim-13, wherein Ami is Ser-Asn; Am3 is Ser-Ser-Phe; Am2 is absent and R is an amidation of a C-terminal carboxylic acid moiety.
20. The compound according to Claim- 13, wherein Ami is Ser-Asn-Thr; Am3 is Glu-Ser-Phe; Am2 is absent and R is an amidation of a C-tenninal carboxylic acid moiety.
21. The compound according to Claim- 13, wherein Am i is absent; Am3 is Asn-Thr-Ser; Am2 is Ser-Phe and R is an amidation of a C-terminal carboxylic acid moiety.
22. A peptide derivative of Claim 1 having the formula (Ic):
Figure imgf000046_0001
(Ic)
wherein,
Z is as defined in formula I;
Y is Glu or Gin;
Li is -CO-(CH2)n-NH- or an amide bond;
'n' is an integer selected from 2 to 5, both inclusive;
R is an amidation of a C-terminal carboxylic acid moiety or is absent; or a phannaceutical salt of a peptide derivative of formula (Ic), or a stereoisomer of a peptide derivative of formula (Ic) or pharmaceutical salt thereof.
23. A compound selected from the group consisting of
Figure imgf000046_0002
Figure imgf000047_0001
Figure imgf000048_0001
(SEQ ID NO: 19)
Figure imgf000050_0001
Figure imgf000051_0001
(SEQ ID NO: 32)
Figure imgf000053_0001
or a pharmaceutical salt thereof or a stereoisomer thereof.
24. A pharmaceutical composition comprising at least one compound according to any one of Claims 1 to 23 and/or a phannaceutically acceptable salt or a stereoisomer thereof, and a pharmaceutically acceptable carrier or excipient.
25. The pharmaceutical composition of Claim 24 further comprising at least one additional pharmaceutical agent wherein the said additional pharmaceutical agent is an anticancer agent, chemotherapy agent, or antiproliferative compound.
26. A compound according to any one of the Claims 1 to 23 or a pharmaceutically acceptable salt or a stereoisomer thereof, for use as a medicament.
27. A compound according to any one of Claims 1 to 23 or a pharmaceutically acceptable salt or a stereoisomer thereof, for use as a medicament for the treatment of cancer or infectious disease.
28. A method of modulating an immune response mediated by PD-1 signaling pathway in a subject, comprising administering to the subject therapeutically effective amount of compound according to any one of the Claims from 1 to 23, such that the immune response in the subject is modulated.
29. A method of inhibiting growth of tumour cells and/or metastasis in a subject, comprising administering to the subject a therapeutically effective amount of compound according to any one of the Claims 1 to 23, capable of inhibiting the programmed cell death 1 (PD 1 ) signaling pathway.
30. The method of Claim 29, wherein the tumour cells are of a cancer selected from the group comprising of melanoma, renal cancer, prostate cancer, breast cancer, colon cancer and lung cancer.
31. The method of Claim 29, wherein the tumour cells are of a cancer selected from the list comprising of bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, non- Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, chronic or acute leukemias including acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, solid tumours of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumour angiogenesis, spinal axis tumour, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, T-cell lymphoma, environmentally induced cancers including those induced by asbestos, and combinations of said cancers.
32. A method of treating an infectious disease in a subject comprising administering to the subject a therapeutically effective amount of compound according to any one of the Claims 1 to 23, capable of inhibiting the programmed cell death 1 (PDl ) signaling pathway such that the subject is treated for the infectious disease.
33. A method of treating bacterial, viral and fungal infections in a subject comprising administering to the subject a therapeutically effective amount of compound according to any of Claims 1 to 23 capable of inhibiting the programmed cell death 1 (PDl ) signaling pathway such that the subject is treated for the bacterial, viral and fungal infections.
PCT/IB2013/000553 2012-03-29 2013-03-28 Immunomodulating cyclic compounds from the bc loop of human pd1 Ceased WO2013144704A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
MX2014011353A MX2014011353A (en) 2012-03-29 2013-03-28 Immunomodulating cyclic compounds from the bc loop of human pd1.
CN201380018176.3A CN104245726A (en) 2012-03-29 2013-03-28 Immunomodulating cyclic compounds from the bc loop of human PD1
KR20147030294A KR20140142736A (en) 2012-03-29 2013-03-28 Immunomodulating cyclic compounds from the bc loop of human pd1
JP2015502472A JP2015512910A (en) 2012-03-29 2013-03-28 Immunomodulatory cyclic compounds derived from the BC loop of human PD1
EP13720539.9A EP2831108A1 (en) 2012-03-29 2013-03-28 Immunomodulating cyclic compounds from the bc loop of human pd1
US14/388,584 US9422339B2 (en) 2012-03-29 2013-03-28 Immunomodulating cyclic compounds
CA 2868408 CA2868408A1 (en) 2012-03-29 2013-03-28 Immunomodulating cyclic compounds from the bc loop of human pd1
AU2013239366A AU2013239366A1 (en) 2012-03-29 2013-03-28 Immunomodulating cyclic compounds from the BC loop of human PD1
RU2014143443A RU2014143443A (en) 2012-03-29 2013-03-28 IMMUNOMODULATING CYCLE COMPOUNDS

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
IN1213CH2012 2012-03-29
IN1213/CHE/2012 2012-03-29

Publications (1)

Publication Number Publication Date
WO2013144704A1 true WO2013144704A1 (en) 2013-10-03

Family

ID=48289513

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2013/000553 Ceased WO2013144704A1 (en) 2012-03-29 2013-03-28 Immunomodulating cyclic compounds from the bc loop of human pd1

Country Status (10)

Country Link
US (1) US9422339B2 (en)
EP (1) EP2831108A1 (en)
JP (1) JP2015512910A (en)
KR (1) KR20140142736A (en)
CN (1) CN104245726A (en)
AU (1) AU2013239366A1 (en)
CA (1) CA2868408A1 (en)
MX (1) MX2014011353A (en)
RU (1) RU2014143443A (en)
WO (1) WO2013144704A1 (en)

Cited By (115)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015033299A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
WO2015033301A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators
WO2015033303A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited Cyclic peptidomimetic compounds as immunomodulators
WO2015044900A1 (en) * 2013-09-27 2015-04-02 Aurigene Discovery Technologies Limited Therapeutic immunomodulating compounds
US9308236B2 (en) 2013-03-15 2016-04-12 Bristol-Myers Squibb Company Macrocyclic inhibitors of the PD-1/PD-L1 and CD80(B7-1)/PD-L1 protein/protein interactions
EP3067062A1 (en) 2015-03-13 2016-09-14 Ipsen Pharma S.A.S. Combination of tasquinimod or a pharmaceutically acceptable salt thereof and a pd1 and/or pdl1 inhibitor, for use as a medicament
WO2016142833A1 (en) 2015-03-10 2016-09-15 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole and thiadiazole compounds as immunomodulators
US9732119B2 (en) 2014-10-10 2017-08-15 Bristol-Myers Squibb Company Immunomodulators
US9809625B2 (en) 2015-03-18 2017-11-07 Bristol-Myers Squibb Company Immunomodulators
JP2017536330A (en) * 2014-09-11 2017-12-07 ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company Macrocyclic inhibitors of PD-1 / PD-L1 and CD80 (B7-1) / PD-L1 protein / protein interaction
US9856292B2 (en) 2014-11-14 2018-01-02 Bristol-Myers Squibb Company Immunomodulators
US9861680B2 (en) 2014-12-18 2018-01-09 Bristol-Myers Squibb Company Immunomodulators
US9944678B2 (en) 2014-12-19 2018-04-17 Bristol-Myers Squibb Company Immunomodulators
US10098950B2 (en) 2016-09-15 2018-10-16 Leidos, Inc. PD-1 Peptide Inhibitors
US10143746B2 (en) 2016-03-04 2018-12-04 Bristol-Myers Squibb Company Immunomodulators
WO2019090263A1 (en) 2017-11-06 2019-05-09 Genentech, Inc. Diagnostic and therapeutic methods for cancer
WO2019087087A1 (en) 2017-11-03 2019-05-09 Aurigene Discovery Technologies Limited Dual inhibitors of tim-3 and pd-1 pathways
US10358463B2 (en) 2016-04-05 2019-07-23 Bristol-Myers Squibb Company Immunomodulators
WO2019165374A1 (en) 2018-02-26 2019-08-29 Gilead Sciences, Inc. Substituted pyrrolizine compounds as hbv replication inhibitors
WO2019195181A1 (en) 2018-04-05 2019-10-10 Gilead Sciences, Inc. Antibodies and fragments thereof that bind hepatitis b virus protein x
WO2019193543A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides
WO2019193542A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides
WO2019193533A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'2'-cyclic dinucleotides
WO2019200247A1 (en) 2018-04-12 2019-10-17 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
US10450347B2 (en) 2015-02-04 2019-10-22 Bristol-Myers Squibb Company Immunomodulators
WO2019211799A1 (en) 2018-05-03 2019-11-07 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide
WO2019246557A1 (en) 2018-06-23 2019-12-26 Genentech, Inc. Methods of treating lung cancer with a pd-1 axis binding antagonist, a platinum agent, and a topoisomerase ii inhibitor
WO2020018789A1 (en) 2018-07-18 2020-01-23 Genentech, Inc. Methods of treating lung cancer with a pd-1 axis binding antagonist, an antimetabolite, and a platinum agent
WO2020028097A1 (en) 2018-08-01 2020-02-06 Gilead Sciences, Inc. Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid
US10568870B2 (en) 2016-04-07 2020-02-25 Chemocentryx, Inc. Reducing tumor burden by administering CCR1 antagonists in combination with PD-1 inhibitors or PD-L1 inhibitors
WO2020051099A1 (en) 2018-09-03 2020-03-12 Genentech, Inc. Carboxamide and sulfonamide derivatives useful as tead modulators
WO2020092528A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity
WO2020092621A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds as hpk1 inhibitors
US10662416B2 (en) 2016-10-14 2020-05-26 Precision Biosciences, Inc. Engineered meganucleases specific for recognition sequences in the hepatitis B virus genome
WO2020132560A2 (en) 2018-12-21 2020-06-25 Aim Immunotech Inc. Compositions and methods for cancer therapy
WO2020150152A1 (en) 2019-01-14 2020-07-23 Genentech, Inc. Methods of treating cancer with a pd-1 axis binding antagonist and an rna vaccine
US10744118B2 (en) 2012-12-07 2020-08-18 Chemocentryx, Inc. Diazole lactams
WO2020178770A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides and prodrugs thereof
WO2020178768A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
WO2020178769A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides and prodrugs thereof
US10799555B2 (en) 2016-09-15 2020-10-13 Leidos, Inc. PD-1 peptide inhibitors
WO2020214995A1 (en) 2019-04-19 2020-10-22 Genentech, Inc. Anti-mertk antibodies and their methods of use
WO2020214652A1 (en) 2019-04-17 2020-10-22 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
WO2020214663A1 (en) 2019-04-17 2020-10-22 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
WO2020237025A1 (en) 2019-05-23 2020-11-26 Gilead Sciences, Inc. Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors
WO2021034804A1 (en) 2019-08-19 2021-02-25 Gilead Sciences, Inc. Pharmaceutical formulations of tenofovir alafenamide
US10966999B2 (en) 2017-12-20 2021-04-06 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
WO2021067181A1 (en) 2019-09-30 2021-04-08 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
US10988507B2 (en) 2016-11-07 2021-04-27 Bristol-Myers Squibb Company Immunomodulators
WO2021097110A1 (en) 2019-11-13 2021-05-20 Genentech, Inc. Therapeutic compounds and methods of use
WO2021113765A1 (en) 2019-12-06 2021-06-10 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
US11040948B2 (en) 2017-09-29 2021-06-22 Curis, Inc. Crystal forms of immunomodulators
WO2021136354A1 (en) 2020-01-03 2021-07-08 上海翰森生物医药科技有限公司 Biphenyl derivative inhibitor, preparation method therefor and use thereof
US11066445B2 (en) 2017-06-23 2021-07-20 Bristol-Myers Squibb Company Immunomodulators acting as antagonists of PD-1
WO2021155149A1 (en) 2020-01-31 2021-08-05 Genentech, Inc. Methods of inducing neoepitope-specific t cells with a pd-1 axis binding antagonist and an rna vaccine
US11103605B2 (en) 2016-05-19 2021-08-31 Bristol-Myers Squibb Company PET-imaging immunomodulators
WO2021188959A1 (en) 2020-03-20 2021-09-23 Gilead Sciences, Inc. Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same
US11130796B2 (en) 2017-01-05 2021-09-28 Kahr Medical Ltd. SIRPalpha-41BBL fusion protein and methods of use thereof
US11136300B2 (en) 2017-10-11 2021-10-05 Aurigene Discovery Technologies Limited Crystalline forms of 3-substituted 1,2,4-oxadiazole
US11203610B2 (en) 2017-12-20 2021-12-21 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
WO2022020716A1 (en) 2020-07-24 2022-01-27 Genentech, Inc. Heterocyclic inhibitors of tead for treating cancer
US11299530B2 (en) 2017-01-05 2022-04-12 Kahr Medical Ltd. SIRP alpha-CD70 fusion protein and methods of use thereof
WO2022093981A1 (en) 2020-10-28 2022-05-05 Genentech, Inc. Combination therapy comprising ptpn22 inhibitors and pd-l1 binding antagonists
US11338040B2 (en) 2020-06-04 2022-05-24 Leidos, Inc. Immunomodulatory compounds
WO2022119830A1 (en) 2020-12-02 2022-06-09 Genentech, Inc. Methods and compositions for neoadjuvant and adjuvant urothelial carcinoma therapy
WO2022232503A1 (en) 2021-04-30 2022-11-03 Genentech, Inc. Therapeutic and diagnostic methods and compositions for cancer
US11492375B2 (en) 2017-10-03 2022-11-08 Bristol-Myers Squibb Company Cyclic peptide immunomodulators
US11497735B2 (en) 2017-11-06 2022-11-15 Aurigene Discovery Technologies Limited Conjoint therapies for immunomodulation
WO2022241134A1 (en) 2021-05-13 2022-11-17 Gilead Sciences, Inc. COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS
WO2022261310A1 (en) 2021-06-11 2022-12-15 Gilead Sciences, Inc. Combination mcl-1 inhibitors with anti-body drug conjugates
WO2022261301A1 (en) 2021-06-11 2022-12-15 Gilead Sciences, Inc. Combination mcl-1 inhibitors with anti-cancer agents
WO2022271650A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271659A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271684A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271677A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2023279092A2 (en) 2021-07-02 2023-01-05 Genentech, Inc. Methods and compositions for treating cancer
US11566060B2 (en) 2017-01-05 2023-01-31 Kahr Medical Ltd. PD1-CD70 fusion protein and methods of use thereof
WO2023010094A2 (en) 2021-07-28 2023-02-02 Genentech, Inc. Methods and compositions for treating cancer
WO2023010095A1 (en) 2021-07-28 2023-02-02 F. Hoffmann-La Roche Ag Methods and compositions for treating cancer
WO2023051926A1 (en) 2021-09-30 2023-04-06 BioNTech SE Treatment involving non-immunogenic rna for antigen vaccination and pd-1 axis binding antagonists
WO2023056403A1 (en) 2021-09-30 2023-04-06 Genentech, Inc. Methods for treatment of hematologic cancers using anti-tigit antibodies, anti-cd38 antibodies, and pd-1 axis binding antagonists
WO2023080900A1 (en) 2021-11-05 2023-05-11 Genentech, Inc. Methods and compositions for classifying and treating kidney cancer
WO2023097194A2 (en) 2021-11-24 2023-06-01 Genentech, Inc. Therapeutic compounds and methods of use
WO2023097195A1 (en) 2021-11-24 2023-06-01 Genentech, Inc. Therapeutic indazole compounds and methods of use in the treatment of cancer
US11702458B2 (en) 2017-01-05 2023-07-18 Kahr Medical Ltd. PD1-41BBL fusion protein and methods of use thereof
WO2023191816A1 (en) 2022-04-01 2023-10-05 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2023219613A1 (en) 2022-05-11 2023-11-16 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2023240058A2 (en) 2022-06-07 2023-12-14 Genentech, Inc. Prognostic and therapeutic methods for cancer
WO2024015897A1 (en) 2022-07-13 2024-01-18 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2024020432A1 (en) 2022-07-19 2024-01-25 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2024049949A1 (en) 2022-09-01 2024-03-07 Genentech, Inc. Therapeutic and diagnostic methods for bladder cancer
WO2024077166A1 (en) 2022-10-05 2024-04-11 Genentech, Inc. Methods and compositions for classifying and treating lung cancer
WO2024077095A1 (en) 2022-10-05 2024-04-11 Genentech, Inc. Methods and compositions for classifying and treating bladder cancer
WO2024091991A1 (en) 2022-10-25 2024-05-02 Genentech, Inc. Therapeutic and diagnostic methods for multiple myeloma
US11987646B2 (en) 2020-10-12 2024-05-21 Leidos, Inc. Immunomodulatory peptides
WO2024137589A2 (en) 2022-12-20 2024-06-27 Genentech, Inc. Methods of treating pancreatic cancer with a pd-1 axis binding antagonist and an rna vaccine
US12134638B2 (en) 2018-07-11 2024-11-05 Kahr Medical Ltd. SIRPalpha-4-1BBL variant fusion protein and methods of use thereof
WO2024233341A1 (en) 2023-05-05 2024-11-14 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2024233646A1 (en) 2023-05-10 2024-11-14 Genentech, Inc. Methods and compositions for treating cancer
WO2024263904A1 (en) 2023-06-23 2024-12-26 Genentech, Inc. Methods for treatment of liver cancer
WO2024263195A1 (en) 2023-06-23 2024-12-26 Genentech, Inc. Methods for treatment of liver cancer
WO2025024257A1 (en) 2023-07-21 2025-01-30 Genentech, Inc. Diagnostic and therapeutic methods for cancer
WO2025049277A1 (en) 2023-08-25 2025-03-06 Genentech, Inc. Methods and compositions for treating non-small cell lung cancer comprising an anti-tigit antagonist antibody and a pd-1 axis binding antagonist
WO2025056778A1 (en) 2023-09-15 2025-03-20 BioNTech SE Methods of treatment using agents binding to epcam and cd137 in combination with pd-1 axis binding antagonists
WO2025085404A1 (en) 2023-10-16 2025-04-24 Genentech, Inc. Diagnostic and therapeutic methods for treating lung cancer
US12286466B2 (en) 2018-07-11 2025-04-29 Kahr Medical Ltd. PD1-4-1BBL variant fusion protein and methods of use thereof
WO2025155607A1 (en) 2024-01-16 2025-07-24 Genentech, Inc. Methods of treating urothelial carcinoma with a pd-1 axis binding antagonist and an rna vaccine
US12370258B2 (en) 2017-05-25 2025-07-29 Leidos, Inc. PD-1 and CTLA-4 dual inhibitor peptides
WO2025174933A1 (en) 2024-02-14 2025-08-21 Genentech, Inc. Methods for treatment of pancreatic cancer with anti-pd-l1 ab, anti-tigit ab, gemcitabine and nab-placlitaxel
US12403174B2 (en) 2020-01-06 2025-09-02 Bristol-Myers Squibb Company Immunomodulators
US12421278B2 (en) 2020-03-30 2025-09-23 Bristol-Myers Squibb Company Immunomodulators
WO2025240246A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin
WO2025240244A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection
WO2025240243A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus
WO2025240242A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin

Families Citing this family (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2980794T3 (en) 2015-09-15 2024-10-03 Acerta Pharma Bv Therapeutic combinations of a CD19 inhibitor and a BTK inhibitor
DK3402503T3 (en) 2016-01-13 2020-12-21 Acerta Pharma Bv THERAPEUTIC COMBINATIONS OF AN ANTIFOLATE AND A BTK INHIBITOR
CN107226842B (en) * 2016-03-24 2022-01-28 华东理工大学 PD-1 targeted polypeptide and application thereof
WO2018055080A1 (en) 2016-09-22 2018-03-29 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical compositions for reprograming immune environment in a subject in need thereof
TWI788307B (en) 2016-10-31 2023-01-01 美商艾歐凡斯生物治療公司 Engineered artificial antigen presenting cells for tumor infiltrating lymphocyte expansion
WO2018098352A2 (en) 2016-11-22 2018-05-31 Jun Oishi Targeting kras induced immune checkpoint expression
CN110121505B (en) 2016-12-28 2023-08-01 株式会社绿十字细胞治疗 Chimeric antigen receptors and natural killer cells expressing them
US11584733B2 (en) 2017-01-09 2023-02-21 Shuttle Pharmaceuticals, Inc. Selective histone deacetylase inhibitors for the treatment of human disease
EP3565549B1 (en) 2017-01-09 2022-03-09 Shuttle Pharmaceuticals, Inc. Selective histone deacetylase inhibitors for the treatment of human disease
WO2019020593A1 (en) 2017-07-25 2019-01-31 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical compositions for modulating monocytopoiesis
US20200353050A1 (en) 2017-11-10 2020-11-12 Armo Biosciences, Inc. Compositions and methods of use of interleukin-10 in combination with immune check-point pathway inhibitors
EP3712178A4 (en) 2017-11-14 2021-08-11 Green Cross Lab Cell Corporation ANTI-HER2 ANTIBODIES OR ANTIGEN BINDING FRAGMENT OF THE SAME, AND CHEMERICAL ANTIGENIC RECEPTOR INCLUDING IT
US11649294B2 (en) 2017-11-14 2023-05-16 GC Cell Corporation Anti-HER2 antibody or antigen-binding fragment thereof, and chimeric antigen receptor comprising same
EP3737376B1 (en) 2018-01-09 2024-04-17 Shuttle Pharmaceuticals, Inc. Selective histone deacetylase inhibitors for the treatment of human diseases
EP3810189A1 (en) 2018-06-19 2021-04-28 Armo Biosciences, Inc. Compositions and methods of use of il-10 agents in conjunction with chimeric antigen receptor cell therapy
TW202031273A (en) 2018-08-31 2020-09-01 美商艾歐凡斯生物治療公司 Treatment of nsclc patients refractory for anti-pd-1 antibody
EP3852524B1 (en) 2018-09-20 2023-06-28 Iovance Biotherapeutics, Inc. Expansion of tils from cryopreserved tumor samples
TW202039831A (en) 2018-11-05 2020-11-01 美商艾歐凡斯生物治療公司 Treatment of nsclc patients refractory for anti-pd-1 antibody
WO2020141199A1 (en) 2019-01-03 2020-07-09 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods and pharmaceutical compositions for enhancing cd8+ t cell-dependent immune responses in subjects suffering from cancer
CN114650820A (en) 2019-10-16 2022-06-21 科赛普特治疗学股份有限公司 Methods for normalizing neutrophil-to-lymphocyte ratios in cancer patients by selective glucocorticoid receptor antagonists
EP4090674A4 (en) 2020-01-14 2024-01-24 Synthekine, Inc. METHODS AND COMPOSITIONS OF BIASED IL2 MUTEINS
JP2023524639A (en) 2020-04-22 2023-06-13 アイオバンス バイオセラピューティクス,インコーポレイテッド Manufacturing adjustment system and adjustment method of cells for patient-specific immunotherapy
US12577621B2 (en) 2020-09-08 2026-03-17 Duke University LRRK2 mutations as biomarkers for the prediction of immune checkpoint response in cancer
EP4225330A1 (en) 2020-10-06 2023-08-16 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
IL302346A (en) 2020-10-28 2023-06-01 Ikena Oncology Inc Combination of an AHR inhibitor with a PDX inhibitor or doxorubicin
CA3204162A1 (en) 2021-01-11 2022-07-14 Robert Kastelein Compositions and methods related to receptor pairing
WO2022204564A2 (en) 2021-03-25 2022-09-29 Iovance Biotherapeutics, Inc. Methods and compositions for t-cell coculture potency assays and use with cell therapy products
CN113583089B (en) * 2021-07-09 2023-10-31 西南医科大学附属医院 PET imaging agent targeting tumor PD-L1, its labeled precursor, preparation method and application
EP4370139A4 (en) 2021-07-14 2025-10-15 Synthekine Inc Methods and compositions for use in cell therapy of neoplastic diseases
WO2023201369A1 (en) 2022-04-15 2023-10-19 Iovance Biotherapeutics, Inc. Til expansion processes using specific cytokine combinations and/or akti treatment
KR20250122544A (en) 2022-11-21 2025-08-13 이오반스 바이오테라퓨틱스, 인크. A two-dimensional process for the expansion of tumor-infiltrating lymphocytes and therapies using the same
WO2024151885A1 (en) 2023-01-13 2024-07-18 Iovance Biotherapeutics, Inc. Use of til as maintenance therapy for nsclc patients who achieved pr/cr after prior therapy
WO2026035866A1 (en) 2024-08-07 2026-02-12 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with a lag-3 inhibitor and a pd-1 inhibitor

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5629204A (en) 1994-03-01 1997-05-13 Ono Pharmaceutical Co., Ltd. Peptide related to human programmed cell death and DNA encoding it
WO2001014557A1 (en) 1999-08-23 2001-03-01 Dana-Farber Cancer Institute, Inc. Pd-1, a receptor for b7-4, and uses therefor
WO2002079499A1 (en) 2001-04-02 2002-10-10 Wyeth Pd-1, a receptor for b7-4, and uses therefor
WO2002086083A2 (en) 2001-04-20 2002-10-31 Mayo Foundation For Medical Education And Research Methods of enhancing cell responsiveness
WO2003042402A2 (en) 2001-11-13 2003-05-22 Dana-Farber Cancer Institute, Inc. Agents that modulate immune cell activation and methods of use thereof
WO2004004771A1 (en) 2002-07-03 2004-01-15 Ono Pharmaceutical Co., Ltd. Immunopotentiating compositions
WO2004056875A1 (en) 2002-12-23 2004-07-08 Wyeth Antibodies against pd-1 and uses therefor
WO2011161699A2 (en) * 2010-06-25 2011-12-29 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK1451224T3 (en) * 2001-12-04 2012-11-19 Theramab Llc Peptide or protein containing a C'-D loop from the CD28 receptor family
WO2007027906A2 (en) * 2005-08-31 2007-03-08 Cell Signaling Technology, Inc. Reagents for the detection of protein phosphorylation in leukemia signaling pathways

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5629204A (en) 1994-03-01 1997-05-13 Ono Pharmaceutical Co., Ltd. Peptide related to human programmed cell death and DNA encoding it
WO2001014557A1 (en) 1999-08-23 2001-03-01 Dana-Farber Cancer Institute, Inc. Pd-1, a receptor for b7-4, and uses therefor
WO2002079499A1 (en) 2001-04-02 2002-10-10 Wyeth Pd-1, a receptor for b7-4, and uses therefor
WO2002086083A2 (en) 2001-04-20 2002-10-31 Mayo Foundation For Medical Education And Research Methods of enhancing cell responsiveness
WO2003042402A2 (en) 2001-11-13 2003-05-22 Dana-Farber Cancer Institute, Inc. Agents that modulate immune cell activation and methods of use thereof
WO2004004771A1 (en) 2002-07-03 2004-01-15 Ono Pharmaceutical Co., Ltd. Immunopotentiating compositions
WO2004056875A1 (en) 2002-12-23 2004-07-08 Wyeth Antibodies against pd-1 and uses therefor
WO2011161699A2 (en) * 2010-06-25 2011-12-29 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds
US20110318373A1 (en) 2010-06-25 2011-12-29 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
FINGER ET AL., GENE, vol. 197, 1997, pages 177 - 187
JOSEPH ILLINGWORTH ET AL., JOURNAL OF IMMUNOLOGY, vol. 190, no. 3, 2013, pages 1038 - 1047
JULIE R. BRAHMER ET AL., N ENGL J MED., vol. 366, no. 26, 2012, pages 2455 - 2465
LAZAR-MOINTR ET AL., PNAS, vol. 105, no. 30, 2008, pages 10483 - 10488
PROKUNINA ET AL., NATURE GENETICS, vol. 32, no. 4, 2002, pages 666 - 669
SUZANNE L. TOPALIAN ET AL., N ENGL J MED., vol. 366, no. 26, 2012, pages 2443 - 2454
Y. AGATA ET AL., ITIT IMMUNOL, vol. 8, May 1996 (1996-05-01), pages 765

Cited By (169)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10744118B2 (en) 2012-12-07 2020-08-18 Chemocentryx, Inc. Diazole lactams
US11759454B2 (en) 2012-12-07 2023-09-19 Chemocentryx, Inc. Diazole lactams
US9879046B2 (en) 2013-03-15 2018-01-30 Bristol-Myers Squibb Company Macrocyclic inhibitors of the PD-1/PD-L1 and CD80(B7-1)/PD-L1 protein/protein interactions
US9850283B2 (en) 2013-03-15 2017-12-26 Bristol-Myers Squibb Company Macrocyclic inhibitors of the PD-1/PD-L1 and CD80(B7-1)/PD-L1 protein/protein interactions
US9308236B2 (en) 2013-03-15 2016-04-12 Bristol-Myers Squibb Company Macrocyclic inhibitors of the PD-1/PD-L1 and CD80(B7-1)/PD-L1 protein/protein interactions
US10590093B2 (en) 2013-09-06 2020-03-17 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
WO2015033303A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited Cyclic peptidomimetic compounds as immunomodulators
US10160736B2 (en) 2013-09-06 2018-12-25 Aurigene Discovery Technologies Limited 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators
US9771338B2 (en) 2013-09-06 2017-09-26 Auirgene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
US9776978B2 (en) 2013-09-06 2017-10-03 Aurigene Discovery Technologies Limited 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators
US11512060B2 (en) 2013-09-06 2022-11-29 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
US12037321B2 (en) 2013-09-06 2024-07-16 Aurigene Oncology Limited 1,2,4-oxadiazole derivatives as immunomodulators
US10106581B2 (en) 2013-09-06 2018-10-23 Aurigene Discovery Technologies Limited Cyclic peptidomimetic compounds as immunomodulators
US10961205B2 (en) 2013-09-06 2021-03-30 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
US10173989B2 (en) 2013-09-06 2019-01-08 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
WO2015033301A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators
WO2015033299A1 (en) 2013-09-06 2015-03-12 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
EP3363790A1 (en) 2013-09-06 2018-08-22 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole derivatives as immunomodulators
EP3366289A1 (en) 2013-09-06 2018-08-29 Aurigene Discovery Technologies Limited Cyclic peptidomimetic compounds as immunomodulators
EP3385257A1 (en) 2013-09-06 2018-10-10 Aurigene Discovery Technologies Limited 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators
WO2015044900A1 (en) * 2013-09-27 2015-04-02 Aurigene Discovery Technologies Limited Therapeutic immunomodulating compounds
US10538555B2 (en) 2014-09-11 2020-01-21 Bristol-Myers Squibb Company Macrocyclic inhibitors of the PD-1/PD-L1 and CD80(B7-1)/PD-L1 protein/protein interactions
JP2017536330A (en) * 2014-09-11 2017-12-07 ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company Macrocyclic inhibitors of PD-1 / PD-L1 and CD80 (B7-1) / PD-L1 protein / protein interaction
US9732119B2 (en) 2014-10-10 2017-08-15 Bristol-Myers Squibb Company Immunomodulators
US11952434B2 (en) 2014-11-14 2024-04-09 Bristol-Myers Squibb Company Immunomodulators
US11358988B2 (en) 2014-11-14 2022-06-14 Bristol-Myers Squibb Company Immunomodulators
US10633419B2 (en) 2014-11-14 2020-04-28 Bristol-Myers Squibb Company Immunomodulators
US9856292B2 (en) 2014-11-14 2018-01-02 Bristol-Myers Squibb Company Immunomodulators
US9861680B2 (en) 2014-12-18 2018-01-09 Bristol-Myers Squibb Company Immunomodulators
US9944678B2 (en) 2014-12-19 2018-04-17 Bristol-Myers Squibb Company Immunomodulators
US10450347B2 (en) 2015-02-04 2019-10-22 Bristol-Myers Squibb Company Immunomodulators
US11465976B2 (en) 2015-03-10 2022-10-11 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole and thiadiazole compounds as immunomodulators
US10781189B2 (en) 2015-03-10 2020-09-22 Aurigene Discovery Technologies Limited 1,2,4-Oxadiazole and thiadiazole compounds as immunomodulators
EP4023645A1 (en) 2015-03-10 2022-07-06 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole and thiadiazole compounds as immunomodulators
WO2016142833A1 (en) 2015-03-10 2016-09-15 Aurigene Discovery Technologies Limited 1,2,4-oxadiazole and thiadiazole compounds as immunomodulators
EP3067062A1 (en) 2015-03-13 2016-09-14 Ipsen Pharma S.A.S. Combination of tasquinimod or a pharmaceutically acceptable salt thereof and a pd1 and/or pdl1 inhibitor, for use as a medicament
US9809625B2 (en) 2015-03-18 2017-11-07 Bristol-Myers Squibb Company Immunomodulators
US10143746B2 (en) 2016-03-04 2018-12-04 Bristol-Myers Squibb Company Immunomodulators
US10358463B2 (en) 2016-04-05 2019-07-23 Bristol-Myers Squibb Company Immunomodulators
US10568870B2 (en) 2016-04-07 2020-02-25 Chemocentryx, Inc. Reducing tumor burden by administering CCR1 antagonists in combination with PD-1 inhibitors or PD-L1 inhibitors
US11744822B2 (en) 2016-04-07 2023-09-05 Chemocentryx, Inc. Reducing tumor burden by administering CCR1 antagonists in combination with PD-1 inhibitors or PD-L1 inhibitors
US11103605B2 (en) 2016-05-19 2021-08-31 Bristol-Myers Squibb Company PET-imaging immunomodulators
US11793856B2 (en) 2016-09-15 2023-10-24 Leidos, Inc. PD-1 peptide inhibitors
US10799555B2 (en) 2016-09-15 2020-10-13 Leidos, Inc. PD-1 peptide inhibitors
US10799581B2 (en) 2016-09-15 2020-10-13 Leidos, Inc. PD-1 peptide inhibitors
US10098950B2 (en) 2016-09-15 2018-10-16 Leidos, Inc. PD-1 Peptide Inhibitors
US10662416B2 (en) 2016-10-14 2020-05-26 Precision Biosciences, Inc. Engineered meganucleases specific for recognition sequences in the hepatitis B virus genome
US11274285B2 (en) 2016-10-14 2022-03-15 Precision Biosciences, Inc. Engineered meganucleases specific for recognition sequences in the Hepatitis B virus genome
US10988507B2 (en) 2016-11-07 2021-04-27 Bristol-Myers Squibb Company Immunomodulators
US11566060B2 (en) 2017-01-05 2023-01-31 Kahr Medical Ltd. PD1-CD70 fusion protein and methods of use thereof
US11130796B2 (en) 2017-01-05 2021-09-28 Kahr Medical Ltd. SIRPalpha-41BBL fusion protein and methods of use thereof
US11299530B2 (en) 2017-01-05 2022-04-12 Kahr Medical Ltd. SIRP alpha-CD70 fusion protein and methods of use thereof
US12331098B2 (en) 2017-01-05 2025-06-17 Kahr Medical Ltd. SIRPalpha-41BBL fusion protein and methods of use thereof
US11702458B2 (en) 2017-01-05 2023-07-18 Kahr Medical Ltd. PD1-41BBL fusion protein and methods of use thereof
US11897937B2 (en) 2017-01-05 2024-02-13 Kahr Medical Ltd. SIRPalpha-41BBL fusion protein and methods of use thereof
US12370258B2 (en) 2017-05-25 2025-07-29 Leidos, Inc. PD-1 and CTLA-4 dual inhibitor peptides
US11066445B2 (en) 2017-06-23 2021-07-20 Bristol-Myers Squibb Company Immunomodulators acting as antagonists of PD-1
US11939306B2 (en) 2017-09-29 2024-03-26 Curis, Inc. Crystal forms of immunomodulators
US11643401B2 (en) 2017-09-29 2023-05-09 Curis, Inc. Crystal forms of immunomodulators
US11040948B2 (en) 2017-09-29 2021-06-22 Curis, Inc. Crystal forms of immunomodulators
US12252475B2 (en) 2017-09-29 2025-03-18 Curis, Inc. Crystal forms of immunomodulators
US11492375B2 (en) 2017-10-03 2022-11-08 Bristol-Myers Squibb Company Cyclic peptide immunomodulators
US12187689B2 (en) 2017-10-11 2025-01-07 Aurigene Oncology Limited Crystalline forms of 3-substituted 1,2,4-oxadiazole
US11680051B2 (en) 2017-10-11 2023-06-20 Aurigene Discovery Technologies Limited Crystalline forms of 3-substituted 1,2,4-oxadiazole
US11136300B2 (en) 2017-10-11 2021-10-05 Aurigene Discovery Technologies Limited Crystalline forms of 3-substituted 1,2,4-oxadiazole
US11497734B2 (en) 2017-11-03 2022-11-15 Aurigene Discovery Technologies Limited Dual inhibitors of TIM-3 and PD-1 pathways
US12226402B2 (en) 2017-11-03 2025-02-18 Aurigene Oncology Limited Dual inhibitors of TIM-3 and PD-1 pathways
WO2019087087A1 (en) 2017-11-03 2019-05-09 Aurigene Discovery Technologies Limited Dual inhibitors of tim-3 and pd-1 pathways
US12064418B2 (en) 2017-11-06 2024-08-20 Curis, Inc. Conjoint therapies for immunomodulation
WO2019090263A1 (en) 2017-11-06 2019-05-09 Genentech, Inc. Diagnostic and therapeutic methods for cancer
US11497735B2 (en) 2017-11-06 2022-11-15 Aurigene Discovery Technologies Limited Conjoint therapies for immunomodulation
US10966999B2 (en) 2017-12-20 2021-04-06 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
US11203610B2 (en) 2017-12-20 2021-12-21 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
WO2019165374A1 (en) 2018-02-26 2019-08-29 Gilead Sciences, Inc. Substituted pyrrolizine compounds as hbv replication inhibitors
WO2019195181A1 (en) 2018-04-05 2019-10-10 Gilead Sciences, Inc. Antibodies and fragments thereof that bind hepatitis b virus protein x
US11149052B2 (en) 2018-04-06 2021-10-19 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′-cyclic dinucleotides
WO2019193533A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'2'-cyclic dinucleotides
US11292812B2 (en) 2018-04-06 2022-04-05 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′-cyclic dinucleotides
WO2019193542A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides
WO2019193543A1 (en) 2018-04-06 2019-10-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides
US11142750B2 (en) 2018-04-12 2021-10-12 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome
US11788077B2 (en) 2018-04-12 2023-10-17 Precision Biosciences, Inc. Polynucleotides encoding optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome
WO2019200247A1 (en) 2018-04-12 2019-10-17 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
WO2019211799A1 (en) 2018-05-03 2019-11-07 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide
WO2019246557A1 (en) 2018-06-23 2019-12-26 Genentech, Inc. Methods of treating lung cancer with a pd-1 axis binding antagonist, a platinum agent, and a topoisomerase ii inhibitor
US12134638B2 (en) 2018-07-11 2024-11-05 Kahr Medical Ltd. SIRPalpha-4-1BBL variant fusion protein and methods of use thereof
US12286466B2 (en) 2018-07-11 2025-04-29 Kahr Medical Ltd. PD1-4-1BBL variant fusion protein and methods of use thereof
WO2020018789A1 (en) 2018-07-18 2020-01-23 Genentech, Inc. Methods of treating lung cancer with a pd-1 axis binding antagonist, an antimetabolite, and a platinum agent
WO2020028097A1 (en) 2018-08-01 2020-02-06 Gilead Sciences, Inc. Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid
WO2020051099A1 (en) 2018-09-03 2020-03-12 Genentech, Inc. Carboxamide and sulfonamide derivatives useful as tead modulators
WO2020092528A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity
EP4371987A1 (en) 2018-10-31 2024-05-22 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds as hpk1 inhibitors
EP4671244A1 (en) 2018-10-31 2025-12-31 Gilead Sciences, Inc. SUBSTITUTED 6-AZABENZIMIDAZOLE COMPOUNDS AS HPK1 HIBITORS
WO2020092621A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds as hpk1 inhibitors
WO2020132560A2 (en) 2018-12-21 2020-06-25 Aim Immunotech Inc. Compositions and methods for cancer therapy
WO2020150152A1 (en) 2019-01-14 2020-07-23 Genentech, Inc. Methods of treating cancer with a pd-1 axis binding antagonist and an rna vaccine
US12318403B2 (en) 2019-03-07 2025-06-03 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′-cyclic dinucleotides and prodrugs thereof
WO2020178770A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides and prodrugs thereof
WO2020178769A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides and prodrugs thereof
US11766447B2 (en) 2019-03-07 2023-09-26 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
WO2020178768A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
WO2020214652A1 (en) 2019-04-17 2020-10-22 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
EP4458416A2 (en) 2019-04-17 2024-11-06 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
WO2020214663A1 (en) 2019-04-17 2020-10-22 Gilead Sciences, Inc. Solid forms of a toll-like receptor modulator
WO2020214995A1 (en) 2019-04-19 2020-10-22 Genentech, Inc. Anti-mertk antibodies and their methods of use
WO2020237025A1 (en) 2019-05-23 2020-11-26 Gilead Sciences, Inc. Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors
WO2021034804A1 (en) 2019-08-19 2021-02-25 Gilead Sciences, Inc. Pharmaceutical formulations of tenofovir alafenamide
EP4458975A2 (en) 2019-09-30 2024-11-06 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
WO2021067181A1 (en) 2019-09-30 2021-04-08 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
WO2021097110A1 (en) 2019-11-13 2021-05-20 Genentech, Inc. Therapeutic compounds and methods of use
WO2021113765A1 (en) 2019-12-06 2021-06-10 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
US12410418B2 (en) 2019-12-06 2025-09-09 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the Hepatitis B virus genome
EP4567109A2 (en) 2019-12-06 2025-06-11 Precision Biosciences, Inc. Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
WO2021136354A1 (en) 2020-01-03 2021-07-08 上海翰森生物医药科技有限公司 Biphenyl derivative inhibitor, preparation method therefor and use thereof
US12403174B2 (en) 2020-01-06 2025-09-02 Bristol-Myers Squibb Company Immunomodulators
WO2021155149A1 (en) 2020-01-31 2021-08-05 Genentech, Inc. Methods of inducing neoepitope-specific t cells with a pd-1 axis binding antagonist and an rna vaccine
WO2021188959A1 (en) 2020-03-20 2021-09-23 Gilead Sciences, Inc. Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same
US12421278B2 (en) 2020-03-30 2025-09-23 Bristol-Myers Squibb Company Immunomodulators
US11338040B2 (en) 2020-06-04 2022-05-24 Leidos, Inc. Immunomodulatory compounds
WO2022020716A1 (en) 2020-07-24 2022-01-27 Genentech, Inc. Heterocyclic inhibitors of tead for treating cancer
US11987646B2 (en) 2020-10-12 2024-05-21 Leidos, Inc. Immunomodulatory peptides
WO2022093981A1 (en) 2020-10-28 2022-05-05 Genentech, Inc. Combination therapy comprising ptpn22 inhibitors and pd-l1 binding antagonists
WO2022119830A1 (en) 2020-12-02 2022-06-09 Genentech, Inc. Methods and compositions for neoadjuvant and adjuvant urothelial carcinoma therapy
WO2022232503A1 (en) 2021-04-30 2022-11-03 Genentech, Inc. Therapeutic and diagnostic methods and compositions for cancer
WO2022241134A1 (en) 2021-05-13 2022-11-17 Gilead Sciences, Inc. COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS
US11957693B2 (en) 2021-06-11 2024-04-16 Gilead Sciences, Inc. Combination MCL-1 inhibitors with anti-cancer agents
WO2022261310A1 (en) 2021-06-11 2022-12-15 Gilead Sciences, Inc. Combination mcl-1 inhibitors with anti-body drug conjugates
US11931424B2 (en) 2021-06-11 2024-03-19 Gilead Sciences, Inc. Combination MCL-1 inhibitors with anti-body drug conjugates
WO2022261301A1 (en) 2021-06-11 2022-12-15 Gilead Sciences, Inc. Combination mcl-1 inhibitors with anti-cancer agents
WO2022271684A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271677A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271659A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271650A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2023279092A2 (en) 2021-07-02 2023-01-05 Genentech, Inc. Methods and compositions for treating cancer
WO2023010094A2 (en) 2021-07-28 2023-02-02 Genentech, Inc. Methods and compositions for treating cancer
WO2023010095A1 (en) 2021-07-28 2023-02-02 F. Hoffmann-La Roche Ag Methods and compositions for treating cancer
WO2023051926A1 (en) 2021-09-30 2023-04-06 BioNTech SE Treatment involving non-immunogenic rna for antigen vaccination and pd-1 axis binding antagonists
WO2023052531A1 (en) 2021-09-30 2023-04-06 BioNTech SE Treatment involving non-immunogenic rna for antigen vaccination and pd-1 axis binding antagonists
WO2023056403A1 (en) 2021-09-30 2023-04-06 Genentech, Inc. Methods for treatment of hematologic cancers using anti-tigit antibodies, anti-cd38 antibodies, and pd-1 axis binding antagonists
WO2023080900A1 (en) 2021-11-05 2023-05-11 Genentech, Inc. Methods and compositions for classifying and treating kidney cancer
WO2023097194A2 (en) 2021-11-24 2023-06-01 Genentech, Inc. Therapeutic compounds and methods of use
US12275745B2 (en) 2021-11-24 2025-04-15 Genentech, Inc. Therapeutic compounds and methods of use
WO2023097195A1 (en) 2021-11-24 2023-06-01 Genentech, Inc. Therapeutic indazole compounds and methods of use in the treatment of cancer
US12110276B2 (en) 2021-11-24 2024-10-08 Genentech, Inc. Pyrazolo compounds and methods of use thereof
WO2023191816A1 (en) 2022-04-01 2023-10-05 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2023219613A1 (en) 2022-05-11 2023-11-16 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2023240058A2 (en) 2022-06-07 2023-12-14 Genentech, Inc. Prognostic and therapeutic methods for cancer
WO2024015897A1 (en) 2022-07-13 2024-01-18 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2024020432A1 (en) 2022-07-19 2024-01-25 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2024049949A1 (en) 2022-09-01 2024-03-07 Genentech, Inc. Therapeutic and diagnostic methods for bladder cancer
WO2024077166A1 (en) 2022-10-05 2024-04-11 Genentech, Inc. Methods and compositions for classifying and treating lung cancer
WO2024077095A1 (en) 2022-10-05 2024-04-11 Genentech, Inc. Methods and compositions for classifying and treating bladder cancer
WO2024091991A1 (en) 2022-10-25 2024-05-02 Genentech, Inc. Therapeutic and diagnostic methods for multiple myeloma
WO2024137589A2 (en) 2022-12-20 2024-06-27 Genentech, Inc. Methods of treating pancreatic cancer with a pd-1 axis binding antagonist and an rna vaccine
WO2024233341A1 (en) 2023-05-05 2024-11-14 Genentech, Inc. Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies
WO2024233646A1 (en) 2023-05-10 2024-11-14 Genentech, Inc. Methods and compositions for treating cancer
WO2024263904A1 (en) 2023-06-23 2024-12-26 Genentech, Inc. Methods for treatment of liver cancer
WO2024263195A1 (en) 2023-06-23 2024-12-26 Genentech, Inc. Methods for treatment of liver cancer
WO2025024257A1 (en) 2023-07-21 2025-01-30 Genentech, Inc. Diagnostic and therapeutic methods for cancer
WO2025049277A1 (en) 2023-08-25 2025-03-06 Genentech, Inc. Methods and compositions for treating non-small cell lung cancer comprising an anti-tigit antagonist antibody and a pd-1 axis binding antagonist
WO2025056180A1 (en) 2023-09-15 2025-03-20 BioNTech SE Methods of treatment using agents binding to epcam and cd137 in combination with pd-1 axis binding antagonists
WO2025056778A1 (en) 2023-09-15 2025-03-20 BioNTech SE Methods of treatment using agents binding to epcam and cd137 in combination with pd-1 axis binding antagonists
WO2025085404A1 (en) 2023-10-16 2025-04-24 Genentech, Inc. Diagnostic and therapeutic methods for treating lung cancer
WO2025155607A1 (en) 2024-01-16 2025-07-24 Genentech, Inc. Methods of treating urothelial carcinoma with a pd-1 axis binding antagonist and an rna vaccine
WO2025174933A1 (en) 2024-02-14 2025-08-21 Genentech, Inc. Methods for treatment of pancreatic cancer with anti-pd-l1 ab, anti-tigit ab, gemcitabine and nab-placlitaxel
WO2025240246A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin
WO2025240244A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection
WO2025240243A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus
WO2025240242A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin

Also Published As

Publication number Publication date
US20150125491A1 (en) 2015-05-07
KR20140142736A (en) 2014-12-12
MX2014011353A (en) 2014-12-05
JP2015512910A (en) 2015-04-30
AU2013239366A1 (en) 2014-10-16
CN104245726A (en) 2014-12-24
CA2868408A1 (en) 2013-10-03
RU2014143443A (en) 2016-05-20
US9422339B2 (en) 2016-08-23
EP2831108A1 (en) 2015-02-04

Similar Documents

Publication Publication Date Title
US9422339B2 (en) Immunomodulating cyclic compounds
US9096642B2 (en) Therapeutic compounds for immunomodulation
US8907053B2 (en) Immunosuppression modulating compounds
US9783578B2 (en) Immunosuppression modulating compounds
WO2015044900A1 (en) Therapeutic immunomodulating compounds
KR102409246B1 (en) immunomodulators
JP6474412B2 (en) Cyclic peptidomimetic compounds as immunomodulators
CN110267971B (en) Immunomodulators
US10160736B2 (en) 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives as immunomodulators
ES2998042T3 (en) Macrocyclic inhibitors of the pd-1/pd-l1 and cd80/pd-l1 protein/protein interactions
WO2015036927A1 (en) Immunomodulating peptidomimetic derivatives
US20130237580A1 (en) Peptidomimetic compounds as immunomodulators
CA2971189A1 (en) Immunomodulators
CN108164474A (en) 1,2,4-* oxadiazole derivatives as immunomodulator
EA033739B1 (en) Immunomodulators
US11021526B2 (en) DSG2-derived peptides
WO2025193571A1 (en) Macrocyclic peptides useful as immunomodulators

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13720539

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: MX/A/2014/011353

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2868408

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 14388584

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015502472

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2013239366

Country of ref document: AU

Date of ref document: 20130328

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2013720539

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2013720539

Country of ref document: EP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014023892

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20147030294

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014143443

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112014023892

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140925