WO2013096567A2 - The hsf-like transcription factor, tbf1, is a major molecular switch for growth-to-defense transition in plants - Google Patents
The hsf-like transcription factor, tbf1, is a major molecular switch for growth-to-defense transition in plants Download PDFInfo
- Publication number
- WO2013096567A2 WO2013096567A2 PCT/US2012/070838 US2012070838W WO2013096567A2 WO 2013096567 A2 WO2013096567 A2 WO 2013096567A2 US 2012070838 W US2012070838 W US 2012070838W WO 2013096567 A2 WO2013096567 A2 WO 2013096567A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- promoter
- polypeptide
- plant
- functions
- tbf1
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8216—Methods for controlling, regulating or enhancing expression of transgenes in plant cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/62—Insulins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8274—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for herbicide resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
- C12N15/8281—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for bacterial resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
- C12N15/8282—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for fungal resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
- C12N15/8283—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for virus resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8279—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
- C12N15/8285—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for nematode resistance
Definitions
- Table SI which collectively refers to eight Supplemental Tables S1A-S1H, in the subsection labeled "Statistical Analysis” of the "Detailed Description of the Invention", provides a summary of the complete lists of TBFl-dependent SA- and elfl8-regulated genes set forth in tables formatted in Microsoft Word, extracted from eight worksheets of an Excel file.
- the present invention relates to new methods to study and control the expression of plant genes, particularly genes located downstream from regions comprising binding sites for transcription factors, such as the cis-element translocon 1 (TL1) comprising 6AAGAAGAA (SEQ ID NO: 99) and similar sequences.
- the invention relates to isolated nucleotide sequences comprising a regulatory region comprising a promoter operably-linked to one or more upstream open reading frames (uORFs) and one or more downstream open reading frames (dORFs) encoding one or more functional polypeptides, including transcription factors such as TBF1, reporter polypeptides, and polypeptides conferring resistance to drugs, resistance of plants viral, bacterial, or fungal pathogens, and polypeptides involved in the growth of plants.
- uORFs upstream open reading frames
- dORFs downstream open reading frames
- Another aspect of the invention relates to the use of a translational regulatory region wherein said uORFs encode polypeptides designated uORFl and uORF2 from Arabidopsis plants, natural and synthetic variants of these polypeptides, and their homologues and orthologues isolated from other plant species, including crop plants.
- This regulatory region allows translation of dORFs in response to pathogen challenge.
- the invention is also directed to vectors, cells, plant propagation material, transgenic plants, and seeds comprising nucleic acids comprising said regulatory region.
- Other aspects relate to methods of using these regulatory elements to generate and screen for transgenic plants having improved resistance to disease, particularly microbial and viral plant pathogens.
- the invention is also directed to plants comprising said ORFs to facilitate the controlled production of one or more recombinant proteins in plant-based expression systems. Measurement of the amount or activity of a recombinant protein in this system can reflect the actions of one or more factors involved in the transcriptional and/or translational control signals, including promoters and uORFS upstream from the coding sequence for a polypeptide.
- the invention is also directed to engineered cells and plants comprising these genetic elements to facilitate the production of proteins for use in structure/function studies, in industrial, agricultural, and medical applications, and particularly in the understanding and development of disease-resistant plants. BACKGROUND OF THE INVENTION
- NPR1 Non-expressor of PR genes
- Systemic acquired resistance is broad-spectrum and long lasting, compared to the signal-specific MA P- and effector-triggered immunity responses [4].
- SAR-associated transcriptional reprogramming re-directs cellular resources, normally dedicated to growth-related activities, towards de novo synthesis of anti-microbial proteins, such as the pathogenesis- related (PR) proteins.
- PR pathogenesis- related
- ER endoplasmic reticulum
- TBFl a membrane-bound receptor for the MAMP signal elfl8 (the N terminal 18 amino acids of the bacterial translation elongation factor Tu, EF-Tu), TBFl was found to regulate glycosylation pathway genes, including calreticulin 3 (CRT3), and UDP-glucose:glycoprotein glycosyltransferase, STT3A, involved in the ER quality control mechanism (ERQC) required for EFR function [6, 7].
- CRT3 calreticulin 3
- STT3A UDP-glucose:glycoprotein glycosyltransferase
- NPR1 a transcription cofactor.
- SA Upon induction by SA, NPR1 is translocated to the nucleus [8] inducing PR genes through its interaction with TGA transcription factors (TFs) at the promoters of PR genes [9, 10].
- TGA transcription factors TGA transcription factors
- TFs TGA transcription factors
- Significant enrichment of a novel cis- element TL1 (translocon 1; GAAGAAGAA) in the promoter regions of these NPRl-dependent ER-resident genes suggests the involvement of an unknown TF [3].
- Til-binding TF Point mutations in the Til elements in the BiP2 (Lumenal Binding Protein 2) promoter abolished the inducibility of this gene upon SA treatment, supporting this hypothesis [3]. Identification of the Til-binding TF is important to our understanding of the mechanism controlling the transition from growth- to defense-responses, as the secretory pathway is required for a wide variety of other cellular functions.
- the present invention relates to an isolated nucleic acid molecule comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and
- a vector, cell, or a transgenic plant comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii)a variant polypeptide thereof that contains one or more conservative substitutions in which uORF
- Still another aspect of the invention relates to a method of using a regulatory region to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to one or more upstream O Fs and one or more downstream ORFs encoding said one or more polypeptides, comprising the steps of: (a) introducing one or more nucleic acids comprising said regulatory region into a cell; (b) expressing one or more upstream ORFs and one or more downstream ORFs encoding one or more polypeptides for a period sufficient to modulate the amount or level of activity of at least one of the one or more polypeptides within the cell or in the cell culture medium obtained from said cell.
- Another aspect relates to a method, further comprising the step (c) of purifying at least one of said polypeptides from the cell comprising said regulatory region or from the cell culture medium obtained from said cell.
- FIG. 1 sets forth an illustration showing that H5F4 is the TLl-Binding TF, TBF1.
- Strain 1 carries the WT BiP2 promoter upstream of both the HIS3 and LacZ reporters and Strain 2 contains a mutant ⁇ 2 promoter in the TLl elements upstream of LacZ [3].
- Strain 1 and Strain 2 were both transformed with either pDEST-AD TBF1 encoding TBF1-AD, or the empty vector, pDEST-AD.
- Yeast growth assays for the HIS3 locus were performed on selective media (SD-His-Ura-Trp) supplemented with increasing concentrations of 3-AT, and photographed four days later (Panel 1A). (3-galactosidase reporter activity was measured using ONPG as the substrate (Panel IB). Error bars represent standard deviation from three different technical replications. The experiments were repeated three times with similar results.
- TBF1-GFP binding to the TL1 elements in the ⁇ 2 promoter was measured by ChIP analysis after treatment with H 2 0 or 1 mM SA.
- the PCR amplicons designated 1 to 6 (gray boxes in the upper panel) used in the ChIP analysis are shown, with TL1 elements highlighted in white.
- the arrow represents the translational start site of BiP2.
- the fold-enrichment for each amplicon was calculated from the real-time PCR results, which were normalized to input, and represented by the ratio between TBFlp:TBFl-GFP (in tbfl) and untransformed control plants (lower panel). Error bars represent the standard deviation from three different replicates. The experiment was repeated five times with similar results.
- FIG. SI related to FIGS. 1A and IB, sets forth
- Strain 1 contains the WT ⁇ 2 promoter fragment upstream of the HIS3 and the AacZ reporters.
- Strain 2 contains the WT ⁇ 2 promoter upstream of HIS3, but mTLl upstream of LacZ.
- FIG. S2 related to FIG. 1C, sets forth an illustration showing that TBF1 transcript levels in the tbfl T-DNA insertion mutant.
- FIG. S2B Expression of TBF1 in WT and the tbfl mutant. Relative TBF1 transcript levels were determined by quantitative RT-PCR using cDNA generated from leaves of 3-week-old WT and tbfl plants. The expression values were normalized using those of UBQ5 as internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
- FIG. S3, related to FIG. ID, sets forth an illustration
- TBFlp:TBFl-GFP can complement the tbfl mutation.
- FIG. 2 sets forth an illustration showing that
- TBF1 Plays a Major Role in Transcriptional Reprogramming during MTI and SAR.
- Venn diagram shows the numbers of TBFl-dependent SA down-regulated (SA down), SA up-regulated (SA up), elfl8 up-regulated (elfl8 up) and elfl8 down-regulated (elfl8 down) genes (p-value ⁇ 0.05).
- FIG. 54 sets forth an illustration showing that SA-induced accumulation ofER chaperones BiPl/2 is affected in the tbfl mutant.
- Total protein extract was obtained from six leaves derived from three plants per genotype 6 hours after treatment with 1 mM SA.
- An accumulation of highly sequence-similar BiPl/2 proteins was detected on Western blots with an antibody directed against BiP (oc-BiP). Ponceau S stain was used to verify equal loading amounts. The experiment was repeated three times with similar results.
- FIG. 55A related to FIG. 2D, sets forth an illustration showing validation of the microarray data using qRT-PCR analysis of selected genes. qRT-PCR analysis of selected TBFl-dependent SA-induced genes, identified in the microarray analysis.
- FIG. S5B sets forth an illustration showing validation of the microarray data using qRT-PCR analysis of selected genes.
- qRT-PCR analysis of selected TBFl-dependent SA-repressed genes identified in the microarray analysis. Leaves of 3-week-old Arabidopsis plants were sprayed with 1 mM SA or water (NT) and tissues collected 6 hrs later. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
- FIG. SSC sets forth an illustration showing validation of the microarray data using qRT-PCR analysis of selected genes.
- qRT-PCR analysis of selected TBFl-dependent elfl8-induced genes identified in the microarray analysis. Leaves of 3-week-old Arabidopsis plants were infiltrated with 10 ⁇ elfl8 or water (NT) and tissues collected 2 hrs later. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
- FIG. S5D sets forth an illustration showing validation of the microarray data using qRT-PCR analysis of selected genes.
- qRT-PCR analysis of selected TBFl-dependent elfl8-repressed genes identified in the microarray analysis. Leaves of 3-week-old Arabidopsis plants were infiltrated with 10 ⁇ elfl8 or water (NT) and tissues collected 2 hrs later. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
- FIG.3 sets forth an illustration showing that
- TBFl is a Major Molecular Switch for the Growth-to-Defense Transition
- Intracellular wash fluid (IWF) and total protein extracts from leaves of three-week-old WT, tbfl, tbfl transformed with the WT TBFl gene (TBFl comp.), nprl-1, and bip2 dad2 were collected 24 hrs after 1 m SA treatment and subsequently subjected to Western blotting using an antibody directed against PR1 (a-PRl).
- an antibody against tubulin (a-Tub) was used to probe the total protein blot.
- FIG. 57 related to FIG. 3, sets forth an illustration
- Relative BiP2 transcript levels were determined by quantitative RT-PCR using cDNA generated from leaf tissue of room temperature (RT)-incubated and heat-shocked (at 37°C for 2 hrs)) 3-week-old WT and tbfl plants.
- the expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. Experiment was repeated three times with similar results.
- FIG. 58 related to FIG. 3C, sets forth an illustration
- Relative PR1 transcript levels were determined by quantitative RT-PCR using cDNA generated from leaf tissue of 3-week-old WT, tbfl and nprl-1 plants. Samples were harvested at 0 and 16 hrs after 1 mM salicylic acid (SA) application. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
- FIG. 59 related to FIG. 3F, sets forth an illustration showing that the tbfl mutant has normal flg22-induced resistance to Psm ES4326.
- FIG. 4 sets forth an illustration showing that TBFl Expression is Regulated at both the Transcriptional and
- FIG. 510 related to FIG. SA, sets forth an illustration showing that the uORFl-uORF2-DHFR and DHFR recombinant proteins do not affect yeast growth in the absence of methotrexate.
- DHFR DHFR
- DHFR in the absence of methotrexate was measured over the course of ⁇ 47 hrs by optical density (ODeoonm)-
- the selective media SD -Leu -Phe
- Phe 15 15 mg/L
- Phe 75 75 mg/L
- Error bars represent the standard deviation from three technical replicates. This experiment was repeated three times with similar results.
- FIGS. SUA and SUB display the sequence and genetic elements of the TBFl region in compact form
- FIG. SUA continued as FIG. SUB, displaying the sequence and genetic elements of the TBFl region set forth in SEQ ID NO: 101 in compact form.
- FIG. 512 presents quantification oftranslational inhibitory effect
- FIG. S12 presents quantification of translational inhibitory effect exerted by uORFs in transgenic T 3 plants expressing uORFl-uORF2-GUS or uorfl-uorf2-GUS in Ler or gcn2 backgrounds (two independent lines per construct per genotype) at indicated time points after inoculation with Psm ES4326/avrRpt2. Error bars represent the standard deviation from three technical replicates.
- cell refers to one or more cells which can be in an isolated or cultured state, as in a cell line comprising a homogeneous or heterogeneous population of cells, or in a tissue sample, or as part of an organism, such as an unmodified or a transgenic plant or animal.
- aa or AA amino acid
- TBF1 TLl-binding factor
- TBF1 plant transcription factor
- the present invention relates to an isolated nucleic acid molecule comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and
- An aspect of the invention relates to an isolated nucleic acid, as described above, wherein said molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof.
- Another aspect relates to an isolated nucleic acid, further comprising one or more downstream ORFs (dORFs) encoding one or more polypeptides.
- dORFs downstream ORFs
- At least one dORF encodes a polypeptide selected from the group consisting of: (i) a polypeptide that is functionally-active as a transcription factor; (ii) a reporter polypeptide; (iii) a polypeptide that confers drug resistance; (iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and (v) a polypeptide involved in the growth of plants.
- polypeptides encoded by a downstream ORF are contemplated by the invention.
- the polypeptide is a transcription factor selected from the group consisting of: (i) a polypeptide represented by TBF1 (SEQ ID NO: 106); (ii) a variant polypeptide thereof, that contains one or more conservative substitutions in which TBF1 structure and one or more TBF1 functions are conserved; or (iii) a variant polypeptide thereof, that contains one or more substitutions, fusions, or truncations in which one or more TBF1 functions are conserved.
- the polypeptide is a reporter polypeptide selected from the group consisting of: (i) ⁇ -galactosidase ( ⁇ -gal), ⁇ -glucuronidase ( ⁇ -gluc), chloramphenicol acetyltransferase (CAT), ffen/V/a-luciferase (rue), Photinus luciferase (luc), secreted alkaline phosphatase (SAP), and green fluorescent protein (GFP); (ii) a variant of the reporter polypeptide specified in (i) that contains one or more conservative substitutions in which structure and one or more reporter functions are conserved; or (iii) a variant of the reporter polypeptide specified in (i) that contains one or more substitutions, fusions, or truncations in which one or more, reporter functions are conserved.
- ⁇ -gal ⁇ -galactosidase
- ⁇ -gluc ⁇ -glucuronidase
- CAT chloramphenicol acet
- the invention is not limited by the specific nature of the polypeptide encoded by the downstream ORF, provided it is functional in the cellular or organismal environment being evaluated. In some cases, it may be desirable to express a partially-functional or non-functional polypeptide, compared to a fully-functional polypeptide to study its properties with respect to its biological activity, including its binding affinity to, or influence on the properties of, other cellular molecules.
- polypeptides being studied including those encoded by upstream or downstream ORFS (uORFs and dORFs) may contain a variety of alterations, such as conservative substitutions, in which amino acids having similar structural or chemical properties (e.g., size, charge, or polarity) are substituted for amino acids in the unmodified polypeptide.
- polypeptides can tolerate insertions of other polypeptide segments, at the amino terminus, carboxy terminus, or at internal positions, permitting the evaluation of protein fusions, which may retain or interfere with the activity of the unmodified polypeptide.
- Many polypeptides can also tolerate internal deletions, or truncations of amino acids at the amino terminus or carboxy terminus, which may retain or interfere with the activity of the unmodified polypeptide.
- Polypeptides may also contain one or more alterations, such as substitutions, insertions/fusions, deletions/truncations, in a variety of combinations, which alter the structure, and in some cases function, of the polypeptide being studied.
- alterations may be tolerated in specific structural domains, if the system being evaluated is not sensitive to the function carried out by polypeptide domain.
- Reporter polypeptides may more easily tolerate alterations at either end of the polypeptide, permitting the construction of fused or truncated polypeptides, that retain the catalytic activity responsible for the reporter function (e.g., enzymatic activity, or fluorescence), than alterations located in the middle of the molecule.
- Transcriptional factors like TBFl, may tolerate alterations in regions that are not involved in the binding of the polypeptide to nucleic acids, other polypeptides, or other types of regulatory co- factors.
- the promoters used with the invention may comprise a variety of genetic elements that regulate their properties, including level of transcription at different times, generally in response to different concentrations of general or specific transcriptional components, including regulatory molecules, polymerase complexes, typically be small molecules, nucleic acids, peptides, or polypeptides, or conjugates between these and other cellular molecules or macromolecules.
- the promoter is constitutive, and in another aspect, the promoter is inducible.
- the promoter is active in plant cells.
- the promoter is selected from the group consisting of: (a) a plant promoter; (b) a plant virus promoter; (c) a promoter from a non-viral plant pathogen; (d) a mammalian cell promoter; and (e) a mammalian virus promoter.
- the promoter is a plant promoter.
- the plant promoter is selected from the group consisting of: (a) the TBFl promoter as set forth in SEQ ID NO: 113; (b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBFl promoter functions are preserved; or (c) a nucleotide sequence which is 50% or more identical to the TBFl promoter set forth in (a) in which one or more promoter functions are preserved.
- the plant promoter is selected from the group consisting of: (a) the BiP2 promoter as set forth in SEQ ID NO: 109; (b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBFl promoter functions are preserved.
- the plant promoter is a nucleotide sequence comprising a binding site for the TBFl polypeptide in which one or more promoter functions are preserved.
- the plant promoter is a nucleotide sequence comprising a functionally-active pathogen-inducible or constitutive promoter.
- the promoter is derived from an Arabidopsis locus selected from the group consisting of AT1G48850, AT1G62300, AT4G34230, AT4G34180, AT4G35110, AT2G30490, AT5G38900, AT5G24430, AT1G63720, AT4G39270.
- the promoter is a plant promoter which is inducible.
- the plant promoter is inducible upon challenge by a plant pathogen or a chemical inducer.
- the inducer is selected from the group consisting of salicylic acid, jasmonic acid, methyl jasmonic acid, abscisic acid, ethylene, AgN0 3 , cycloheximide, mannitol, NaCI, flg22, elfl8 and LPS. This non-limiting list of inducers have all been tested and shown to induce the TBFl promoter. Other stimuli, which trigger a similar induction response in TBFl-like genes could be used to test their ability to modulate expression mediated the regulatory region described above.
- aspects of the invention include cells and vectors comprising nucleic acids comprising the regulatory regions described above, and organisms, particularly plant propagation material, plants, and seeds derived from plants comprising said cells or vectors.
- One aspect for example, is a cell comprising a nucleic acid with a regulatory region comprising a promoter operable in said cell, and one or more upstream ORFs, optionally linked to one or more downstream ORFS, as described above.
- the cell is a plant cell and said promoter is active in plant cells.
- plant propagation material comprising said cell.
- Other aspects include a transgenic plant comprising said cell, and a seed derived from said transgenic plant.
- aspects include a vector comprising a nucleic acid with a regulatory region comprising a promoter operable in a cell, and one or more upstream ORFs, optionally linked to one or more downstream ORFS, as described above.
- Another aspect is a cell comprising a vector comprising the regulatory region as noted above, and a plant cell comprising the vector, wherein the promoter is active in plant cells.
- Other aspects include a transgenic plant comprising the vector, and the seed of a transgenic plant comprising the vector described above.
- vectors may carry genetic elements, such as those that confer resistance to drugs, that are not essential to the function of the nucleic acids of the invention that comprise the regulatory region (e.g., promoter, one or more uORFs, optionally one or more dORFs) described above.
- the vectors may be plasmids, propagated in bacteria or plants, or viruses. Plasmids are typically propagated as double- stranded DNA circles, while viruses may carry genetic information as single- or double-stranded RNA or DNA molecules.
- nucleic acids that comprise the regulatory region noted above may be introduced into cells as part of a larger molecule, such as a vector, or introduced directly into a cell not covalently linked to other nucleic acids, although other nucleic acids or vectors may be used to facilitate the introduction of genetic material, such as selectable or screenable genetic markers, into the cell.
- the nucleic acids of the invention therefore, may not be stably-propagated, after introduction into a cell, or may be stably-propagated, either by replication of a vector comprising the regulatory region noted above, or by stable integration of the nucleic acid at one or more regions within the genome of the cell.
- One aspect of the invention relates to a transgenic plant comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uO F) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii)a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or
- transgenic plant further comprising one or more downstream ORFs (dORFs) encoding one or more polypeptides.
- the invention also includes a transgenic plant, wherein at least one dORF encodes a polypeptide selected from the group consisting of: (i) a polypeptide that is functionally- active as a transcription factor; (ii) a reporter polypeptide; (iii) a polypeptide that confers drug resistance; (iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and (v) a polypeptide involved in the growth of plants.
- downstream ORFs encode specific polypeptides, such as TBF1, and natural or synthetic variants, homologues, and orthologs, or reporter polypeptides, such as ⁇ -glucuronidase, ⁇ -galactosidase, luciferase, and fluorescent proteins, as noted above.
- the invention also relates to a variety of methods of using the regulatory region described above to facilitate the expression (e.g., transcription of mRNA, and translation of the mRNA comprising one or more ORFs) of one or more peptides or polypeptides in a cell.
- a polypeptide may be also released from the cell into the extracellular environment, such as cell culture medium, after being processed for secretion, or by degradation of the cell membrane or cell wall, where it may be recovered and purified. It is not necessary for a polypeptide to be expressed at high levels to have an effect on other cellular functions.
- a transcriptional factor for example, may have pleiotropic effects by modulating its expression only slightly, compared to the amount or level of activity in a parent cell that does not contain a regulatory region described above.
- One aspect of the invention relates to a method of using a regulatory region to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to one or more upstream ORFs and one or more downstream ORFs encoding said one or more polypeptides, comprising the steps of: (a) introducing one or more nucleic acids comprising said regulatory region into a cell; (b) expressing one or more upstream ORFs and one or more downstream ORFs encoding one or more polypeptides for a period sufficient to modulate the amount or level of activity of at least one of the one or more polypeptides within the cell or in the cell culture medium obtained from said cell.
- Another aspect relates to a method, further comprising the step (c) of purifying at least one of said polypeptides from the cell comprising said regulatory region or from the cell culture medium obtained from said cell.
- the amount or level of activity at least one of said polypeptides may be enhanced above, or reduced below, the endogenous amount or level of activity in a parent cell lacking an introduced nucleic acid comprising said regulatory region.
- Another aspect relates to a method wherein said regulatory region contains a nucleic acid comprising at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations
- nucleic acid molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof, and also methods wherein said nucleic acid molecule further comprises one or more downstream ORFs (dORFs) encoding one or more polypeptides.
- dORFs downstream ORFs
- Another aspect includes a method wherein the regulatory region further comprises one or more downstream ORFs (dORFs) encoding one or more polypeptides.
- the invention also includes a method wherein at least one dORF encodes a polypeptide selected from the group consisting of: (i) a polypeptide that is functionally-active as a transcription factor; (ii) a reporter polypeptide; (iii) a polypeptide that confers drug resistance; (iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and (v) a polypeptide involved in the growth of plants.
- downstream ORFs encode specific polypeptides, such as TBF1, and natural or synthetic variants, homologues, and orthologs, or reporter polypeptides, such as ⁇ -glucuronidase, ⁇ -galactosidase, luciferase, and fluorescent proteins, as noted above.
- the regulatory region comprises a specific promoter, such as those described above, which may be constitutive or inducible, or derived from different sources, provided they are functionally active in the cell or organism being evaluated.
- the invention is also directed to any of the methods described above that include introducing the nucleic acid comprising the regulatory region comprising a promoter, one or more uO Fs, and one or more dORFs, into a cell, expressing a polypeptide under the control of the regulatory region, and purifying the polypeptide from a cell, tissue, or plants, or its extracellular environment.
- BiP2-ChlP-R2 CGGAAACTTTTGCGTACGAT 20 ssDNA 4
- HSP70-qPCR-F AATGGCTGGTAAAGGAGAAGG 21 ssDNA 49
- Ciathrin-qPCR-F CCTCGTGAAGTGCCAGTTATAG 22 ssDNA 59
- PAD4-qPCR-F AAGATCCATGACATCGCCG 19 ssDNA 61
- PAD4-qPCR-R AGGTAGAGGTTCATCGGAGG 20 ssDNA 62
- BiP2 - promoter - GW-F GGGGACAAGTTTGTACAAAAAAGCAGGCTTATTCCGG 1 ICI 1 1 1 55 ssDNA 85
- BiP2 - promoter - GW-R GGGGACCACHTTGTACAAGAAAGCTGGGTCATCGGAAACTTTT 53 ssDNA 86
- TL1 oligo TCCAGTGCTGAAGAAGAATTCTACG 25 ssDNA 95 mTLl oligo (EMSA) TCCAGTGTCATCACGTGTTTCTACG 25 ssDNA 96
- Genomic TBF1 region Genomic TBF1 region from Arabidopsis thaliana including 5085 DNA 101
- TBF1 promoter and regions encoding uORFl, uORFl, and
- TBF1 polypeptides (in exons 1 and 2, separated by TBF1
- TBF1 aa (l a Exon)
- MTAVTAAQRSVPAPFLS TYQLVDDHSTDDWSWNEEGTAFW 73 AA 104
- TBFl aa (l*' and 2'" , Exons) TAVTAAQRSVPAPFLSKTYQLVDDHSTDDWSWNEE6TAFWW T 284 AA 106
- TBF1 genomic region with The 4601-bp genomic DNA containing the TBF1 promoter 4601 DNA 107 STOP codon used for and the coding region (SEQ ID NO: 107) with the TBF1 intron
- TBF1 UTR through first exon
- the DNA fragment containing the S' untranslated region 670 DNA 108 ofTBFl ORF (UTR) and the first exon of TBF1 was amplified by
- PCR polymerase chain reaction
- BiP2 promoter fragment A 352-bp long fragment of the BiP2 promoter containing 352 DNA 109 four TL1 motifs was PCR-amplified using primers BiP2 - promoter - GW-F (SEQ ID NO: 85) and BiP2 - promoter - GW- R (SEQ ID NO: 86), cloned into the pDONR207 Gateway Entry
- Genomic TBF1 region The 4,598-bp genomic DNA containing the TBF1 promoter 4598 DNA 110 NON_STOP and the coding region (SEQ ID NO: 107) was amplified using
- UORF2 nucleotide seq ATGGAAGAAACCAAACGAAACTCCGATCTTCTCCGTTCTCG 111 112
- Strain 1 Strain 1 derived from YM4271 that This study has the WT BiP2 promoter driving
- GV3101 Agrobacterium Bacterial strain for floral-dip based [S13] tumefaciens plant transformation, rifampicin- resistant
- pTB3 Plasmid comprising S. cerevisiae DHFR ⁇ Chandra Tucker ⁇ promoter and reporter gene
- methotrexate [58].
- Cat pMDC123 Kan
- Gateway plant expression vector that Cat confers kanamycin and chloramphenicol Hph R resistance in E. coli and hygromycin
- Hygro Gateway cassette cloned upstream of the GFP reporter gene; vector confers kanamycin resistance in E. coli and hygromycin resistance in transgenic plants.
- pMDC107 Kan R The genomic TBF1 to GFP fusion was also TBFlp:TBFl- Hygro" generated by recombining pENTR207 GFP TBFlp:TBFl NON_STOP (amplified using primers TBFl-promoter-GW-F (SEQ ID NO: 84) and TBFl-cDNA-GW-R (NON_STOP) (SEQ ID NO: 83) into the destination vector pMDC107 [S6].
- the resulting destination clone pMDC107 TBFlp:TBFl-GFP was transformed into Agrobacterium tumefaciens strain GV3101 and introduced into tbfl mutant plants. A homozygous T3 line was selected for additional analysis.
- GV3101/ was transformed into Agrobacterium tumefaciens strain
- the genomic TBF1 to GFP fusion was generated by
- Arabidopsis plants Homozygous T 3 Arabidopsis line used for ChIP
- the DNA fragment containing the 5' untranslated region (UTR) and the first exon of TBFl was amplified by polymerase chain reaction (PCR) using primers TBFl 5'UTR- GW-F (SEQ ID NO: 87) and TBFl 5'UTR-GW-R (SEQ ID NO: 88), wherein the DNA fragment is represented by the nucleic acid set forth as SEQ ID NO: 108 and cloned into the Gateway vector pDONR207 (Invitrogen). Two A-to-C point mutations were introduced, either separately or together, into the start codons (ATG) of uORFl and uORF2.
- PCR polymerase chain reaction
- the WT and mutant uORFl-uORF2 sequences were inserted downstream of the constitutive 35S promoter and upstream of the coding region of the GUS reporter in pMDC140 through recombination [56].
- the resulting translational reporter plasmids (designated pMDClAO-uORFl-uORF2-GUS and its mutant variants pMDC14Q-uorfl-uORF2-GUS, pMDC140-uORFl-uorf2-GUS and pMDC 0-uorfl-uorf2-GUS (Table E3) were transformed into Col-0 WT plants or transiently-expressed in Nicotiana benthamiana using Agrobacterium tumefaciens [57].
- the DHFR reporter gene carried by plasmid pTB3 was engineered to make an unstable enzyme [37] and to contain the L22F/F31S mutations that confer resistance to methotrexate (MTX) [58].
- the uORFl-uORF2 of TBFl was translationally-fused to the coding region of the DHFR reporter and integrated into the genome of yeast strain BY4742 by homologous recombination. Equal amounts of yeast culture grown in liquid media (SD- Leu) were inoculated into SD-Leu-Phe double drop-out media supplemented with 15 mg/L or 75 mg/L phenylalanine.
- yeast cultures were also grown in Phe-rich, Asp-deficient media supplemented with 15 mM tobramycin (TOB) (Sigma, St. Louis, Ml, USA), a known inhibitor of yeast tRNA*" aspartylation.
- TOB tobramycin
- MTX was added to all cultures at the final concentration of 80 ⁇ to inhibit the endogenous DHFR activity.
- Yeast growth which was dependent on the expression of the recombinant DHFR reporter in the presence of MTX, was measured using optical density (OD 600 nm) over a 32-hour time course.
- the total weight of the hit was restricted to be more than 664.
- the exact (SEQ ID NO: 99) and degenerate TLl motifs (approximately represented by SEQ ID NO: 100) were searched for using the scan_for_matches software, available at ' (http://iubio.bio.indiana.edu/soft/molbio/pattern/ scan for matches.readme).
- Y1H assays were performed according to a previously-published protocol [S2].
- a 352-bp long fragment of the ⁇ 2 promoter (SEQ ID NO: 109) was cloned into the pDONR207 Gateway Entry vector, recombined into pMW2 and pMW3 vectors, and then integrated into the HIS3 and URA3 loci in yeast, respectively.
- Strain 1 has the WT ⁇ 2 promoter driving both HIS3 and URA3 genes
- Strain 2 has the WT ⁇ 2 promoter for HIS3 and the mutated BiP2 promoter [SI] for URA3 (Table E2, Figure SI).
- the assay was modified from protocols described in earlier studies [S3]. In brief, 0.1 ml of yeast transformant extract was added to 0.9 ml of Z buffer and warmed to 28°C. Reactions were initiated by addition of 0.2 ml of ONPG substrate (4 mg/ml) in Z buffer and terminated with 0.5 ml of 1 M Na 2 C0 3 . Reactions were terminated within the linear range of the assay (OD 42 onm ⁇ 1 0) ⁇ The ⁇ -galactosidase activity in yeast supernatants was normalized to their protein concentrations. The data represent the average from three dilutions of extracts.
- the assay was performed as described in earlier studies [SI]. Briefly, 3-week-old plants were treated with 1 mM SA for 4 hrs before leaf tissues were harvested. 40,000 cpm of labeled probe was added to 10 ⁇ g of protein, incubated in a buffer containing 12 mM HEPES pH 8.0, 60 mM KCI, 2 mM MgCI 2 , 0.1 mM EDTA, 12% glycerol, and 0.3 mM DTT for 20 min, and separated on a 5% polyacrylamide gel. DNA-protein interactions were detected using autoradiography.
- ChIP assays were performed as described in earlier studies [S4]. For each sample, 1 g of leaves from 3-week-old Arabidopsis plants was crosslinked with 1% formaldehyde under vacuum for 15 min, followed by addition of glycine to a final concentration of 0.1 M. The leaves were washed with water and then ground in liquid nitrogen. Arabidopsis nuclei were isolated and sonicated in Bioruptor* sonicator (Diagenode). The TBFl-GFP-tagged protein was immunoprecipitated using 1 ⁇ of an anti-GFP antibody ab-290 (Abeam) that was first coupled to the protein G Dynabeads (Invitrogen). The purified ChIP DNA samples were subject to real- time PC analysis. The amount of each amplicon was normalized to the input. The relative amount (fold- enrichment) of each signal was determined by the ratio of normalized ChIP signals between samples. The primer sequences used for ChIP analysis are listed in Table S3.
- Arabidopsis plants (Columbia-0 and tbfl mutant) were grown on soil (Metro Mix 360) at 22°C under a
- RNA extracted with TRIzol (Ambion) and labeled with MessageAmp Premier RNA Amplification Kit (Ambion), was hybridized with GeneChip Arabidopsis ATHlGenome Array (Affymetrix), and subsequently washed and scanned at the Duke Microarray Facility. Experiments were repeated three times using independently-grown and treated plants. The resulting data were normalized using Gene-Spring GX Software (RMA algorithm; Agilent).
- the 4,601-bp genomic DNA containing the TBF1 promoter and the coding region was amplified using primers TBFl-promoter-GW-F (SEQ ID NO: 84) and TBFl-cDNA-GW-R (SEQ ID NO: 82) (Table S3), cloned into the vector pDONR207 using the Gateway technology (Invitrogen), and inserted by recombination into the destination vector pMDC123 [6].
- the resulting destination clone pMDC123 TBFlp:TBFl was transformed into Agrobacterium tumefaciens strain GV3101.
- T 3 transgenic plants homozygous for the transgene were further analyzed.
- the genomic TBF1 to GFP fusion was also generated by recombining pENTR207 TBFlp:TBFl into the destination vector pMDC107 [S6].
- the resulting destination clone pMDC107 TBFlp:TBFl-GFP was transformed into Agrobacterium tumefaciens strain GV3101 and introduced into tbfl mutant plants.
- a homozygous T 3 line was selected for additional analysis.
- the anti-BiP Western blotting experiment was performed as described previously [SI], using leaf tissue sprayed with ImM SA 6 hrs prior to collection.
- the primary antibody was oc-BiP (Santa Cruz Biotechnology, aC-19, 1:4000 dilution, overnight at 4°C), followed by the secondary antibody (bovine anti- goat, Santa Cruz Biotechnology, 1:2000 dilution, 2 hrs, RT).
- the protein extraction was carried out in presence of a phosphatase inhibitor PhosSTOP (Roche), Protease Inhibitor Cocktail (Sigma Aldrich) and proteasome inhibitor G-115 (Sigma Aldrich).
- the primary antibody was a-p-elF2ct (pS51) (Epitomics, Burlingame, CA, 1090-1), (1:1000 dilution, overnight at 4°C), followed by the secondary antibody (goat anti-rabbit, Bio-Rad, 1:4000 dilution, 1 hr, RT).
- tRNA species were detected by hybridization using digoxigenin-labeled ONA probes (shown in Table S3 as tRNA phe represented by SEQ ID NO: 97, and tRNA* 5 " represented by SEQ ID NO: 98) according to the manufacturer's instructions (DIG High Prime DNA Labeling and Detection Starter Kit II, Roche Applied Science). The signal was visualized using a low-light CCD camera.
- a spike-in control was added into the pulverized leaf tissue at a concentration of 10 7 copies of Alien qRT-PCR Inhibitor Alert (Agilent Technologies, USA) per mg of fresh weight.
- Table SI summarizes the complete list of TBFl-dependent SA- and elfl8-regulated genes which are set forth supplementary data tables extracted from eight worksheets in an Excel file, herein specifically incorporated by reference, as noted above in the section entitled "Incorporation-By-Reference In International Application Under Rule 20.6 to Supplemental Tables of Information Included In An Earlier Priority Application”.
- TBF1 Is a TF that Binds to the TL1 cis-Element Enriched in Defense-Related Gene Promoters
- the TL1 cis-element (consensus sequence GAAGAAGAA) in the ER-resident genes is essential for their activation in response to SA induction [3].
- this cis element is important only for the ER- resident genes or also for induction of other defense-related functions.
- HSF4 also known as HsfBl; AT4G36990
- HsfBl Arabidopsis HSF4 and its tomato homolog do not functionally complement the yeast hsfl mutant strain [15] (Daniel Neef and Dennis Thiele, personal communication), and its overexpression has little effect on heat shock protein expression or thermotolerance [16, 17], we thought that HSF4 does not encode a typical heat shock factor. Its pathogen-inducible expression pattern suggests that it has a novel function related to plant immunity, and is a candidate for TBF1.
- HSF4 is the TLl c/s-element TBF1 involving a yeast one-hybrid (Y1H) vector system, in which the promoter fragment of ⁇ 2, containing multiple functional TLl c/s-elements, was used as bait [3].
- Y1H yeast one-hybrid
- Two yeast bait strains containing the WT and the mutant ⁇ mTLl) BiP2 promoters, respectively, were constructed ( Figure SI). Expression of TBF1-AD (containing the activation domain) in Strain 1, activated both HIS3 and LacZ reporters driven by the WT ⁇ 2 promoter ( Figures 1A and IB).
- TBF1 binding to the TLl c s-element was further demonstrated using electrophoretic mobility shift assays with protein extracts from both WT and an insertional knock-out TBF1 mutant, tbfl (Figure S2).
- WT displayed an up-shifted band, whose intensity was further enhanced in the extract made from plants treated with SA. This band was diminished in the tbfl mutant extract, indicating that TBF1 is required for the DNA-protein complex formation.
- TBF1 p TBF1 -GFP
- fusion protein was proven to be biologically-active through genetic complementation of the tbfl mutant phenotype ( Figure S3), we used it for chromatin immunoprecipitation (ChIP).
- TBF1 Is a Major Molecular Switch Involved in Transcriptional Preprogramming Induced by SA and elfl8.
- TBF1 down-regulates genes encoding chloroplast proteins (Figure 2D), an effect that is known to be associated with SA [23].
- Chloroplast function-related genes were even more profoundly repressed by elfl8 ( Figure 2E). These genes encode several structural and regulatory proteins of the chloroplast (e.g., PsbR subunit of photosystem II, chloroplast o-succinylbenzoyl-CoA ligase, plastid ribosomal protein, a subunit of the chloroplast NAD(P)H dehydrogenase complex and components involved in thylakoid membrane biogenesis) (Table SI).
- PsbR subunit of photosystem II e.g., chloroplast o-succinylbenzoyl-CoA ligase, plastid ribosomal protein, a subunit of the chloroplast NAD(P)H dehydrogenase complex and components involved in thylakoid
- Loss-of-f unction mutants involving these genes display a variety of developmental defects, such as decreased photosynthesis rate, reduced chloroplast number, pale pigmentation, dwarfism and lethality [24]. These metabolic and chloroplast-related genes are likely direct targets of TBFl, since their regulatory regions contain the TL1 element. Taken together, these results suggest that TBFl is used in plants to rapidly reprogram cellular transcription after an infection, diverting energy resources from growth and development functions to cope with pathogenic responses.
- TBFl is a major molecular switch involved in the transition from growth to defense functions.
- the tbfl mutant grew at a similar rate as the WT plant.
- the elfl8 or increasing concentrations of SA however, growth of the WT plants was significantly inhibited.
- the inhibitory effect was partially-alleviated in the tbfl mutant.
- another MAMP signal, flg22 exerted a similar growth-suppressing effect on WT and tbfl seedlings (Figure S6).
- the bip2 dadl double mutant which was previously shown to be defective in PR1 secretion [3], was used as a control.
- the defect in secretion of antimicrobial proteins in the tbfl mutant correlated with the 1 log higher growth of the bacterial pathogen, Psm ES4326, compared to WT and the complementation lines ( Figure 3D).
- Psm ES4326 the bacterial pathogen
- Figure 3E the complementation lines
- TBFl is a major molecular switch, that upon challenge by a pathogen, turns on multiple defense responses and inhibits primary growth and development ( Figures 2 and 3).
- Figures 2 and 3 we analyzed its expression patterns upon treatment with SA, detecting maximum levels of transcript at 4 hours ( Figure 4A).
- the SA-dependent induction was abolished in the nprl-1 mutant, demonstrating that NPR1 is required for SA-mediated TBFl transcription.
- TBFl also plays a role in regulating NPR1, as the NPR1 transcript levels were diminished in tbfl ( Figure 4B), suggesting that a feedback mechanism exists involving these two key immune system regulatory factors.
- uORF2 also known as conserved peptide upstream open reading frame 49, CPUORF49, Arabidopsis gene model AT4G36988
- SEQ ID NO: 103 is well-conserved among TBFl homologs in other plant species [32]. Translation in eukaryotes normally starts at the first 5' AUG codon.
- Both uORFs are enriched in aromatic amino acids, particularly in phenylalanine (Phe) (uORFl - 27%, and uORF2 - 19%), as compared to the average frequency of aromatic amino acids reported for species sequenced so far (7.63-7.86%) ([33]; ExPASy proteomics server http://expasy.org sprot/relnotes/relstat.html).
- the enrichment in Phe is evolutionarily-conserved for uORF2 among the TBFl homologs in other plant species [32]. This suggests that translation of the two uORFs and the downstream TBFl may be influenced by the cellular availability of Phe for translation, caused by the pathogen challenge.
- Amino acid starvation has previously been shown to de-repress uORF-mediated translation inhibition on the yeast General Control Nondepressible 4 (GCN4) and the mammalian Activating Transcription Factor 4 (ATF4) genes [34, 35].
- a yeast-based reporter system Since a Phe-def icient Arabidopsis mutant that has not been identified to date, a yeast chorismate mutase deletion strain, aro7, which is auxotrophic for Phe and tyrosine (Tyr) [36].
- a reporter vector was generated by fusing uORFl-uORF2- TBFl lst exon to the coding region of the mouse DHFR (dihydrofolate reductase), which has been engineered to be less stable [37] and resistant to methotrexate (MTX) [38].
- DHFR is an enzyme that regulates levels of tetrahydrofolate essential for growth.
- yeast growth becomes dependent on the recombinant DHFR reporter expression. Since both uORFl-uORF2-TBFl la emn -DHFR (abbreviated as uORFl-uORF2-DHFR), and the DHFR control, are driven by the endogenous yeast DHFR promoter, growth of these yeast strains reflect the translational rate of DHFR.
- uORFl-uORF2-DHFR uORFl-uORF2-DHFR
- the uORFs of TBFl appear to be specifically sensitive to Phe starvation, because aspartic acid starvation caused by addition of 15 mM tobramycin (TOB), a known inhibitor of yeast tRNA* 5 " aspartylation [39], did not eliminate the difference in the growth rate between the strain carrying uORFl-uORF2-DHFR, and the strain carrying DHFR.
- TOB tobramycin
- TBFl expression is tightly controlled in the plant cell at not only the transcriptional level by NPR1, but also at the translational level through uORFs.
- Pathogen challenges which cause a temporary increase in uncharged tRNA phe accumulation, trigger elF2ot phosphorylation, resulting in de-repression of the translation of TBFl.
- TLl in a wide array of defense-related gene promoters suggests that it plays a critical role as a transcription factor (TF) involved in immune responses in plants [3, 18, 19] ( Figures 2D and 2E).
- TF transcription factor
- Figures 2D and 2E we also demonstrated that the tbfl mutant plants are impaired in UPR, elfl8-induced MT1 and SA-mediated SAR, but not in the heat shock response ( Figure 3 and Figure S7).
- the evolution of transcriptional factors with novel functions may explain the greater expansion of HSF-like genes in plants compared to other organisms (one each in yeast and Drosophila, and three in vertebrates) [44].
- TBFl is a master molecular switch for this growth-to-defense reprogramming that involves activation and repression of nearly 3,000 genes during SAR and MTI. About 46% of these contain at least one copy of the TLl element in their promoters. TBFl is involved not only in the control of immune response genes, but also the control of genes relating to primary metabolism, growth, and photosynthesis.
- TBF1 may directly regulate NPR1 expression through the Til elements in the NPR1 promoter. Since the NPR1 promoter also contains W-boxes [50], TBF1 may regulate NPR1 indirectly through its transcriptional targets, WRKY TFs (Table SI). NPR1 may also regulate TBF1 expression through either TGA or WRKY TFs, as the TBF1 promoter contains five W-boxes and three TGA binding sites, also known as as-1 elements [51].
- TBF1 The two uORFs upstream of TBF1 ORF link translation of TBF1 with the availability of specific amino acids within the cell.
- TBF1 appears to be a key regulator, as transgenic lines overexpressing TBF1 cDNA under the constitutive 35S promoter were not viable (Pajerowska-Mukhtar and Dong, personal observation).
- Plant class B HSFs inhibit transcription and exhibit affinity for TFIIB and TBP. Plant Mol Biol 56, 57-75.
- Plants contain a novel multi-member class of heat shock factors without transcriptional activator potential. Plant Mol Biol 43, 459-471.
- Arabidopsis elF2alpha kinase GCN2 is essential for growth in stress conditions and is activated by wounding.
- Arabidopsis and the heat stress transcription factor world how many heat stress transcription factors do we need? Cell Stress Chaperones 6, 177-189. Heidel, A.J., Clarke, J.D., Antonovics, J., and Dong, X. (2004). Fitness Costs of Mutations Affecting the Systemic Acquired Resistance Pathway in Arabidopsis thaliana.
- the Xanthomonas type III effector protein AvrBs3 modulates plant gene expression and induces cell hypertrophy in the susceptible host.
- Floral dip a simplified method for
- Arabidopsis elF2alpha kinase GCN2 is essential for growth in stress conditions and is activated by wounding. BMC Plant Biol 8, 134.
- GUS fusion ⁇ -Glucuronidase as a sensitive and versatile gene fusion marker in higher plants. EMBOJ. 6, 3901-3907.
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Botany (AREA)
- Diabetes (AREA)
- Endocrinology (AREA)
- Toxicology (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
Abstract
The present invention relates to new methods to study and control the expression of plant genes, particularly nucleotide sequences located downstream from regions comprising binding sites for transcription factors, such as the cis-element translocon 1 (TL1) comprising GAAGAAGAA and similar sequences. The invention relates to isolated nucleotide sequences comprising a regulatory region comprising a promoter operably-linked to one or more upstream open reading frames (uORFs) and one or more downstream open reading frames (dORFs) encoding one or more functional polypeptides, including transcription factors such as TBF1, reporter polypeptides, and polypeptides conferring resistance to drugs, resistance of plants viral, bacterial, or fungal pathogens, and polypeptides involved in the growth of plants. Related aspects include the use of a region which encodes one or more polypeptides designated uORFl and uORF2 from Arabidopsis plants, natural and synthetic variants of these polypeptides, and their homologues and orthologues isolated from other plant species, including crop plants, plus vectors, cells, plant propagation material, transgenic plants, and seeds comprising nucleic acids comprising said all or portions of said regulatory region. Other aspects relate to methods of using these regulatory elements to generate and screen for transgenic plants having improved resistance microbial and viral plant pathogens, and engineered cells and plants comprising these one or more of these genetic elements to facilitate the production of proteins for use in structure/function studies, in industrial, medical, and agricultural applications, particularly in the discovery of metabolic pathways involved in the understanding and development of disease-resistant plants.
Description
t
-1-
THE HSF-LIKE TRANSCRIPTION FACTOR, TBF1, IS A MAJOR MOLECULAR
SWITCH FOR GROWTH-TO-DEFENSE TRANSITION IN PLANTS
CROSS REFERENCE TO RELATED APPLICATIONS
This application claims the benefit under 35 U.S.C. § 119(e) of the U.S. Provisional Application No.
61/578,632, filed 2011-12-21.
STATEMENT REGARDING FEDERALLY-SPONSORED RESEARCH OR DEVELOPMENT
This invention was made with U.S. Government Support under Federal Grant Numbers MCB-0519898 and IOS-0929226, both awarded by the National Science Foundation, to X. Dong. The U.S. Government has certain rights in the invention.
INCORPORATION-BY-REFERENCE OF A SEQUENCE LISTING
The sequence listing contained in the file "127183.0006_DULV_D946WO_ST25.txt", created on 2012- 12-17, modified on 2012-12-17, file size 54,281 bytes, is incorporated by reference in its entirety herein.
INCORPORATION-BY-REFERENCE IN INTERNATIONAL APPLICATION UNDER RULE 20.6 TO SUPPLEMENTAL
TABLES OF INFORMATION INCLUDED IN AN EARLIER PRIORITY APPLICATION
Table SI, which collectively refers to eight Supplemental Tables S1A-S1H, in the subsection labeled "Statistical Analysis" of the "Detailed Description of the Invention", provides a summary of the complete lists of TBFl-dependent SA- and elfl8-regulated genes set forth in tables formatted in Microsoft Word, extracted from eight worksheets of an Excel file.
The data in the eight Supplemental Tables S1A-S1H, which would occupy more than 580 pages if submitted on paper, are incorporated by reference in their entirety, herein, under Rule 20.6. The data in these Supplemental Tables are contained in the file "DULV_D946US_Table_SlA- SlH_Supplemental_Tables.pdf", modified on 2011-12-21, file size 3,473,862 bytes, which was incorporated by reference in U.S. Provisional Application No. 61/578,632, filed 2011-12-21, are also incorporated by reference in this international application, which claims the benefit of benefit of the provisional application under 35 U.S.C. § 119(e), as noted above in the section entitled "Cross Reference to Related Applications".
I
- 2-
FIELD OF THE INVENTION
The present invention relates to new methods to study and control the expression of plant genes, particularly genes located downstream from regions comprising binding sites for transcription factors, such as the cis-element translocon 1 (TL1) comprising 6AAGAAGAA (SEQ ID NO: 99) and similar sequences. The invention relates to isolated nucleotide sequences comprising a regulatory region comprising a promoter operably-linked to one or more upstream open reading frames (uORFs) and one or more downstream open reading frames (dORFs) encoding one or more functional polypeptides, including transcription factors such as TBF1, reporter polypeptides, and polypeptides conferring resistance to drugs, resistance of plants viral, bacterial, or fungal pathogens, and polypeptides involved in the growth of plants. Another aspect of the invention relates to the use of a translational regulatory region wherein said uORFs encode polypeptides designated uORFl and uORF2 from Arabidopsis plants, natural and synthetic variants of these polypeptides, and their homologues and orthologues isolated from other plant species, including crop plants. This regulatory region allows translation of dORFs in response to pathogen challenge. The invention is also directed to vectors, cells, plant propagation material, transgenic plants, and seeds comprising nucleic acids comprising said regulatory region. Other aspects relate to methods of using these regulatory elements to generate and screen for transgenic plants having improved resistance to disease, particularly microbial and viral plant pathogens. The invention is also directed to plants comprising said ORFs to facilitate the controlled production of one or more recombinant proteins in plant-based expression systems. Measurement of the amount or activity of a recombinant protein in this system can reflect the actions of one or more factors involved in the transcriptional and/or translational control signals, including promoters and uORFS upstream from the coding sequence for a polypeptide. The invention is also directed to engineered cells and plants comprising these genetic elements to facilitate the production of proteins for use in structure/function studies, in industrial, agricultural, and medical applications, and particularly in the understanding and development of disease-resistant plants. BACKGROUND OF THE INVENTION
The sessile nature of plants subjects them to a constant exposure of biotic and abiotic stresses. Although plants do not have specialized immune cells, they can mount local and systemic immune responses, which require extensive crosstalk between plant defense and other physiological processes [1]. Induction of local defense responses involves recognition of microbe-associated molecular patterns (MAMPs) by membrane-associated receptors, leading to MA P-triggered immunity (MTI), and recognition of pathogen-
delivered effectors by cytosolic receptors, resulting in effector-triggered immunity (ΕΤΊ) [2]. Salicylic acid (SA) that is produced during local infection events can lead to systemic acquired resistance (SAR). In Arabidopsis, SA signals through a key immune regulator, designated NPR1 (Non-expressor of PR genes), which is involved in regulating changes at the transcriptional level of as many as ~10% of all genes [3]. Systemic acquired resistance is broad-spectrum and long lasting, compared to the signal-specific MA P- and effector-triggered immunity responses [4].
SAR-associated transcriptional reprogramming re-directs cellular resources, normally dedicated to growth-related activities, towards de novo synthesis of anti-microbial proteins, such as the pathogenesis- related (PR) proteins. Before PR proteins can accumulate, endoplasmic reticulum (ER)-resident genes encoding the secretory pathway components are coordinately up-regulated to ensure efficient post- translational modification and secretion of the antimicrobial PR peptides [3, 5]. The enhancement of ER components is not restricted to SAR, however, as ER-resident genes have been shown to be involved in MTI. In studies directed to the biogenesis of EFR, a membrane-bound receptor for the MAMP signal elfl8 (the N terminal 18 amino acids of the bacterial translation elongation factor Tu, EF-Tu), TBFl was found to regulate glycosylation pathway genes, including calreticulin 3 (CRT3), and UDP-glucose:glycoprotein glycosyltransferase, STT3A, involved in the ER quality control mechanism (ERQC) required for EFR function [6, 7].
In earlier studies, we demonstrated that induction of both PR and ER-resident genes requires NPR1, a transcription cofactor. Upon induction by SA, NPR1 is translocated to the nucleus [8] inducing PR genes through its interaction with TGA transcription factors (TFs) at the promoters of PR genes [9, 10]. It is not known how NPR1 regulates the ER-resident genes. TGA TFs are not likely candidates, because expression of ER-resident genes is unaltered following induction in tga mutants [3]. Significant enrichment of a novel cis- element TL1 (translocon 1; GAAGAAGAA) in the promoter regions of these NPRl-dependent ER-resident genes suggests the involvement of an unknown TF [3]. Point mutations in the Til elements in the BiP2 (Lumenal Binding Protein 2) promoter abolished the inducibility of this gene upon SA treatment, supporting this hypothesis [3]. Identification of the Til-binding TF is important to our understanding of the mechanism controlling the transition from growth- to defense-responses, as the secretory pathway is required for a wide variety of other cellular functions.
In this study, we report the identification of a heat shock factor-like protein (HSF4/HsfBl) that binds to the Til os-element, which transcriptionally-regulates the expression of genes containing this motif in their promoter regions. We renamed it Til-Binding Transcription Factor 1, TBFl, since mutants of this transcription
factor have normal heat shock responses, but are compromised in the growth-to-defense transition upon challenge by pathogens. The translation of TBF1 is also tightly-regulated through two upstream open reading frames (uORFs) enriched in aromatic amino acids, which are precursors of a large array of plant secondary metabolites involved in defense. Taken together, these observations suggest that TBF1 plays a key role in the general control of events at the transcriptional level in plants.
BRIEF SUMMARY OF THE INVENTION
The present invention relates to an isolated nucleic acid molecule comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved.
Separate aspects of the invention relate to a vector, cell, or a transgenic plant comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii)a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved.
Still another aspect of the invention relates to a method of using a regulatory region to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter,
functional in said cell, operably-linked to one or more upstream O Fs and one or more downstream ORFs encoding said one or more polypeptides, comprising the steps of: (a) introducing one or more nucleic acids comprising said regulatory region into a cell; (b) expressing one or more upstream ORFs and one or more downstream ORFs encoding one or more polypeptides for a period sufficient to modulate the amount or level of activity of at least one of the one or more polypeptides within the cell or in the cell culture medium obtained from said cell. Another aspect relates to a method, further comprising the step (c) of purifying at least one of said polypeptides from the cell comprising said regulatory region or from the cell culture medium obtained from said cell.
A better understanding of the invention will be obtained from the following detailed descriptions and accompanying drawings, which set forth illustrative embodiments that are indicative of the various ways in which the principals of the invention may be employed.
BRIEF DESCRIPTION OF THE DRAWINGS
The foregoing aspects and many of the attendant advantages of this invention will become more readily appreciated as the same become better understood by reference to the following detailed description, when taken in conjunction with the accompanying drawings, wherein:
FIG. 1 sets forth an illustration showing that H5F4 is the TLl-Binding TF, TBF1.
(Panels 1A and IB) TBF1 (HSF4) binding to the TLl c/s-elements in the ΒΊΡ2 promoter was detected in Y1H. Strain 1 carries the WT BiP2 promoter upstream of both the HIS3 and LacZ reporters and Strain 2 contains a mutant ΒΊΡ2 promoter in the TLl elements upstream of LacZ [3]. Strain 1 and Strain 2 were both transformed with either pDEST-AD TBF1 encoding TBF1-AD, or the empty vector, pDEST-AD. Yeast growth assays for the HIS3 locus were performed on selective media (SD-His-Ura-Trp) supplemented with increasing concentrations of 3-AT, and photographed four days later (Panel 1A). (3-galactosidase reporter activity was measured using ONPG as the substrate (Panel IB). Error bars represent standard deviation from three different technical replications. The experiments were repeated three times with similar results.
(Panel 1C) Electrophoretic mobility shift assays were performed using plant extracts from wild-type
(WT) and the tbfl mutant, with (+) and without (-) 6 hr-treatment with 1 mM SA. 40,000 cpm of the radioactive probe containing the TLl element was mixed with 10 μg of protein extract in the presence (+) or absence (-) of the unlabeled WT (cold) or the mutant TLl (mTLl) oligo (5 pmol/μΐ.). The autoradiograph was
developed 24 hrs after electrophoresis. The arrow marks the J F-TL1 complex. Asterisks indicate non-specific binding. The experiment was repeated three times with similar results.
(Panel ID) TBF1-GFP binding to the TL1 elements in the ΒΊΡ2 promoter was measured by ChIP analysis after treatment with H20 or 1 mM SA. The PCR amplicons designated 1 to 6 (gray boxes in the upper panel) used in the ChIP analysis are shown, with TL1 elements highlighted in white. The arrow represents the translational start site of BiP2. After ChIP analysis using an antibody directed against GFP, the fold-enrichment for each amplicon was calculated from the real-time PCR results, which were normalized to input, and represented by the ratio between TBFlp:TBFl-GFP (in tbfl) and untransformed control plants (lower panel). Error bars represent the standard deviation from three different replicates. The experiment was repeated five times with similar results.
FIG. SI, related to FIGS. 1A and IB, sets forth
an illustration showing the yeast strains used in the Y1H assay.
(Panel S1A) ΒΊΡ2 promoter containing multiple functional TL1 c/s-elements (top) (SEQ ID NO: 95) and mutated TL1 [mTLl; bottom) (SEQ ID NO: 96) are shown.
(Panel SIB) Strain 1 contains the WT ΒΊΡ2 promoter fragment upstream of the HIS3 and the AacZ reporters. Strain 2 contains the WT ΒΊΡ2 promoter upstream of HIS3, but mTLl upstream of LacZ.
FIG. S2, related to FIG. 1C, sets forth an illustration showing that TBF1 transcript levels in the tbfl T-DNA insertion mutant.
(Panel S2A) Schematic representation of the T-DNA insertion site in the tbfl mutant. The genomic organization of TBF1 encompassing exon 1, intron 1 and exon 2 is shown. The position and direction of the T- DNA insertion within TBF1 are indicated. Disruption of TBF1 leads to the loss-of -function mutant, designated as SALK_104713, also referred to as tbfl.
(Panel S2B) Expression of TBF1 in WT and the tbfl mutant. Relative TBF1 transcript levels were determined by quantitative RT-PCR using cDNA generated from leaves of 3-week-old WT and tbfl plants. The expression values were normalized using those of UBQ5 as internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
FIG. S3, related to FIG. ID, sets forth an illustration
showing that TBFlp:TBFl-GFP can complement the tbfl mutation.
Bacterial growth was quantified 3 days after infection with Psm ES4326 (OD6∞nm= 0.0001). Error bars represent the 95% confidence intervals determined from six replicates. The experiment was performed three times with similar results.
FIG. 2 sets forth an illustration showing that
TBF1 Plays a Major Role in Transcriptional Reprogramming during MTI and SAR.
(Panels 2A and 2B) Relative transcript levels of secretory pathway genes were determined by qRT-PCR using cDNA generated from WT, tbfl and nprl-1 plants treated with 1 mM SA. The expression levels of ΒΊΡ2 and CRT3 carrying TL1 in their promoters (2A) and BiP3 and CRT1 without TL1 in their promoters (2B) were normalized to the transcript levels of the constitutively-expressed UBQ5. Error bars represent the standard deviation from nine technical replicates derived from three independent experiments.
(Panel 2C) The Venn diagram shows the numbers of TBFl-dependent SA down-regulated (SA down), SA up-regulated (SA up), elfl8 up-regulated (elfl8 up) and elfl8 down-regulated (elfl8 down) genes (p-value < 0.05).
(Panels 2D and 2E) Heatmaps of TBFl-regulated genes in total numbers (top), degrees of TBF1 dependency (middle), and numbers of TL1 c/s-elements in the gene promoters (bottom), in response to SA (2D) and elfl8 (2E) treatments. Top-ranked functional groups were determined using DAVID Gene Ontology (GO) analysis for TBFl-dependent, SA-repressed or induced genes (2D), and elfl8-repressed or induced genes (2E). The scale indicates the log-transformed p-values of down- (blue) and up-(yellow) regulated genes (top). Yellow lines indicate TBFl-dependency (middle), and yellow lines correspond to the numbers of TL1 c/s- elements in the gene promoters (bottom).
FIG. 54, related to FIG. 2A, sets forth an illustration showing that SA-induced accumulation ofER chaperones BiPl/2 is affected in the tbfl mutant. Total protein extract was obtained from six leaves derived from three plants per genotype 6 hours after treatment with 1 mM SA. An accumulation of highly sequence-similar BiPl/2 proteins was detected on Western blots with an antibody directed against BiP (oc-BiP). Ponceau S stain was used to verify equal loading amounts. The experiment was repeated three times with similar results.
FIG. 55A, related to FIG. 2D, sets forth an illustration showing validation of the microarray data using qRT-PCR analysis of selected genes. qRT-PCR analysis of selected TBFl-dependent SA-induced genes, identified in the microarray analysis. Leaves of 3-week-old Arabidopsis plants were sprayed with 1 mM SA or water (NT) and tissues collected 6 hrs later. The expression values were normalized using those of UBQ5 as the internal standards. The error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
FIG. S5B, related to FIG. 2D, sets forth an illustration showing validation of the microarray data using qRT-PCR analysis of selected genes. qRT-PCR analysis of selected TBFl-dependent SA-repressed genes, identified in the microarray analysis. Leaves of 3-week-old Arabidopsis plants were sprayed with 1 mM SA or water (NT) and tissues collected 6 hrs later. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
FIG. SSC, related to FIG. 2E, sets forth an illustration showing validation of the microarray data using qRT-PCR analysis of selected genes. qRT-PCR analysis of selected TBFl-dependent elfl8-induced genes, identified in the microarray analysis. Leaves of 3-week-old Arabidopsis plants were infiltrated with 10 μΜ elfl8 or water (NT) and tissues collected 2 hrs later. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
FIG. S5D, related to FIG. 2E, sets forth an illustration showing validation of the microarray data using qRT-PCR analysis of selected genes. qRT-PCR analysis of selected TBFl-dependent elfl8-repressed genes, identified in the microarray analysis. Leaves of 3-week-old Arabidopsis plants were infiltrated with 10 μΜ elfl8 or water (NT) and tissues collected 2 hrs later. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
FIG.3 sets forth an illustration showing that
TBFl is a Major Molecular Switch for the Growth-to-Defense Transition
(Panel 3A) Fresh weight of ten seedlings grown for 10 days on plates with MS growth media (Ctrl), MS supplemented with increasing concentrations of SA or 10 μΜ elfl8. Error bars represent the standard deviation of three replicates. This experiment was repeated three times with similar results. Statistical analysis was performed using the Student's i-test, *, p-value < 0.05, **, p-value < 0.01, ***, p-value < 0.001.
(Panel 3B) Seedling recovery after a two-day treatment with the UPR inducer tunicamycin at 300
was measured 10 days later by counting the percentage of surviving seedlings (left), and by phenotype observations (right). Error bars represent standard deviation of three replicates. This experiment was repeated five times with similar results. Statistical analysis was performed using the Student's t-test, ***, p- value≤ 0.001
(Panel 3C) Intracellular wash fluid (IWF) and total protein extracts from leaves of three-week-old WT, tbfl, tbfl transformed with the WT TBFl gene (TBFl comp.), nprl-1, and bip2 dad2 were collected 24 hrs after 1 m SA treatment and subsequently subjected to Western blotting using an antibody directed against PR1 (a-PRl). For loading controls, an antibody against tubulin (a-Tub) was used to probe the total protein blot.
(Panel 3D) Enhanced disease susceptibility was measured in 3-week-old WT, tbfl, TBFl comp. and nprl-1 plants three days after infiltration with a bacterial suspension of Psm ES4326 (OD60onm = 0.0001). Error bars represent the 95% confidence intervals of twenty-four replicates derived from three independent experiments. This experiment was repeated at least five times with similar results. Statistical analysis was performed using the Bonferroni post-test, ***, p-value <0.0001.
(Panel 3E) SA-induced resistance was determined according to the schematic representation (upper panel) and the growth of Psm ES4326 was plotted as in (D) but with a higher initial inoculum (Οϋ∞οηηι = 0.001) (lower panel). Error bars represent 95% confidence intervals of twenty-four replicates derived from three independent experiments. Statistical analysis was performed using Bonferroni post-test, ***, p-value <0.0001.
(Panel 3F) elfl8-induced resistance was measured according to the schematic representation (upper panel) and with the initial Psm ES4326 inoculum of OD^o-m = 0.001 (lower panel). Error bars represent 95% confidence intervals of twenty-four replicates derived from three independent experiments. Statistical analysis was performed using Bonferroni post-test,***, p-value <0.0001.
FIG. 56, related to Figure 3 , sets forth an illustration showing that the tbfl mutant displays wild type levels of sensitivity to flg22.
Fresh weight of ten seedlings grown for 10 days on plates with regular MS growth media (-flg22) or MS supplemented with 10 μΜ flg22 (+flg22). Error bars represent standard deviation of three replicates. The experiment was repeated three times with similar results.
FIG. 57, related to FIG. 3, sets forth an illustration
showing that the tbfl mutant shows normal heat shock response.
Relative BiP2 transcript levels were determined by quantitative RT-PCR using cDNA generated from leaf tissue of room temperature (RT)-incubated and heat-shocked (at 37°C for 2 hrs)) 3-week-old WT and tbfl plants. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. Experiment was repeated three times with similar results.
FIG. 58, related to FIG. 3C, sets forth an illustration
showing that PR1 transcript levels are not altered in the tbfl mutant.
Relative PR1 transcript levels were determined by quantitative RT-PCR using cDNA generated from leaf tissue of 3-week-old WT, tbfl and nprl-1 plants. Samples were harvested at 0 and 16 hrs after 1 mM salicylic acid (SA) application. The expression values were normalized using those of UBQ5 as the internal standards. Error bars represent the standard deviation among three technical replications. The experiment was repeated three times with similar results.
FIG. 59, related to FIG. 3F, sets forth an illustration showing that the tbfl mutant has normal flg22-induced resistance to Psm ES4326.
(Panel S9A) Leaves were first injected with H20 or 10 μΜ flg22 4 hrs prior to bacterial infection. Disease symptoms upon infection with Psm ES4326 (ODajonm = 0.001) were observed at 3.5 days post inoculation.
(Panel S9B) Leaves were first treated with H20 or 10 μΜ flg22 for 4 hrs followed by infection with Psm ES4326 (OD60onm = 0.001). Bacterial growth was quantified at 3.5 days post inoculation. Error bars represent the 95% confidence interval of eight replicates. The experiment was performed three times with similar results.
FIG. 4 sets forth an illustration showing that TBFl Expression is Regulated at both the Transcriptional and
Translational Levels.
(Panels 4A and 4B) Relative transcript levels of TBFl (4A) and NPR1 (4B) genes in response to 1 mM SA treatment were determined by qRT-PCR using cDNA generated from WT, tbfl and nprl-1 plants. The expression values were normalized using the transcript levels of UBQ5. Error bars represent standard deviation from nine technical replicates derived from three independent experiments.
(Panel 4C) Schematic representation of uORFl and uORF2 and exon I of TBFl. The phenylalanines (F) in uORFl and uORF2 are highlighted in red and the stop codons are shown as asterisks. represents the translational start of TBFl and -451, -266, and -217 represent the upstream positions of the 5' end of the transcript, the start codon for uORFl and the start codon for uORF2, respectively.
(Panel 4D) The effects of uORFs on TBFl translation were determined by transiently expressing uORFl-uORF2-GUS (WT), uorfl-uORF2-GUS, uORFl-uorf2-GUS and uorfl-uorf2-GUS constructs under the control of the 35S promoter in Nicotiana benthamiana leaves, followed by GUS activity quantification 3 days later. GUS activities from mutant constructs were normalized to that of the WT construct. This experiment was repeated three times with similar results.
(Panel 4E) Quantification of translational inhibitory effect exerted by uORFs in transgenic T3 plants expressing uORFl-uORF2-GUS (two independent transformants 6-1 and 9-4) or uorfl-uorf2 GUS (two independent transformants 7-3 and 8-3) at various time points after inoculation with Psm ES4326/avrRpt2 (ODB0Onm = 0.02). Error bars represent the standard deviation from three different replicates. The experiment was repeated at least three times with similar results.
(Panel 4F) Polysome profiles (upper panel) and TBFl expression (lower panel) in samples obtained from WT plants at 0, 0.5 and 1 hr after inoculation with Psm ES4326/avrRpt2 (OD6∞nm = 0-02). The fractions containing monosome and polysome were identified based on the absorbance at 254 nm (A The TBFl transcript abundance normalized against Alien Alert* control transcript is expressed in arbitrary units (AU). Error bars represent standard error. This experiment was repeated using two biological replicates (each with three technical replicates) with similar results.
FIG.5 sets forth an illustration showing that TBF1 Translation is Regulated in Response to Pathogen-Induced Changes in Phenylalanine Metabolism.
(Panel 5A) The effects of phenylalanine and aspartate starvation on the translational inhibitory function of uORFs were measured by growth of the yeast strain aro7 (phe-, tyr-) transformed with the uORFl- uORF2-DHFR or DHFR reporter. 80 μΜ methotrexate was added to the media so that yeast growth became dependent on the DHFR reporter expression. Optical densities for cultures containing two different concentrations of phenylalanine (Phe; 15 and 75 mg/L) and for cultures lacking Asp, but supplemented with 15 mM tobramycin (TOB), an inhibitor of yeast tRNA** aspartylation, were recorded over the course of 32 hrs. Error bars represent the standard deviation from nine technical replicates derived from three independent experiments.
(Panel 5B) tRNA analysis of wild type plants 0, 0.5, 1, 2, 3, 4, and 8 hrs after inoculation with Psm ES4326/avrRpt2 (OD^nm = 0.02). tRNA was extracted from leaf samples, and a Northern blot experiment using DIG-labeled probes (Roche Applied Science) against tRNAPhe or tRNA*5" was performed to detect charged and uncharged tRNAphe or tRNA*51". This experiment was repeated using three biological replicates with similar results.
(Panel 5C) Total protein extracts from leaves of three-week-old WT plants were collected at various time points after inoculation with Psm ES4326/avrRpt2 (OD^,,--, = 0.02) and subsequently subjected to Western blotting analysis using an antibody directed against a phosphorylated form of elF2a (pelF2a, Epitomics). Ponceau S stain was used to determine the sample amounts needed for equal loading.
(Panel 5D) A model illustrating the molecular mechanism by which the translation initiation of TBF1 is regulated through rapid increases in uncharged and charged tRNAPhe, phosphorylation of elF2ct, and ribosomal read-through of uORFs.
FIG. 510, related to FIG. SA, sets forth an illustration showing that the uORFl-uORF2-DHFR and DHFR recombinant proteins do not affect yeast growth in the absence of methotrexate.
The growth of yeast aro7 strains (Phe, Tyr") carrying uORFl-uORF2-TBFllst exon-DHFR (uORFl-uORF2-
DHFR) or DHFR in the absence of methotrexate was measured over the course of ~47 hrs by optical density (ODeoonm)- The selective media (SD -Leu -Phe) was supplemented with 15 mg/L (Phe 15) and 75 mg/L (Phe 75) of phenylalanine, respectively. Error bars represent the standard deviation from three technical replicates. This experiment was repeated three times with similar results.
FIGS. SUA and SUB display the sequence and genetic elements of the TBFl region in compact form
FIG. SUA, continued as FIG. SUB, displaying the sequence and genetic elements of the TBFl region set forth in SEQ ID NO: 101 in compact form.
FIG. 512 presents quantification oftranslational inhibitory effect
exerted by uORFs in transgenic T3 plants
FIG. S12 presents quantification of translational inhibitory effect exerted by uORFs in transgenic T3 plants expressing uORFl-uORF2-GUS or uorfl-uorf2-GUS in Ler or gcn2 backgrounds (two independent lines per construct per genotype) at indicated time points after inoculation with Psm ES4326/avrRpt2. Error bars represent the standard deviation from three technical replicates.
TERMS AND ABBREVIATIONS
The following is a list of terms and their definitions used throughout the specification and the claims:
The terms "cell" and "cells", which are meant to be inclusive, refer to one or more cells which can be in an isolated or cultured state, as in a cell line comprising a homogeneous or heterogeneous population of cells, or in a tissue sample, or as part of an organism, such as an unmodified or a transgenic plant or animal.
General abbreviations and their corresponding meanings include: aa or AA = amino acid; mg = milligram(s); ml or mL = milliliter(s); mm = millimeter(s); mM = millimolar; nmol = nanomole(s); pmol = picomole(s); ppm = parts per million; RT = room temperature; U = units; ug, μg = micro gram(s); ul, μΙ = micro liter(s); uM, μΜ = micromolar; HPLC, high-performance liquid chromatography; ORF = open reading frame; PCR = polymerase chain reaction; SDS-PAGE = sodium dodecyl sulfate-polyacrylamide gel electrophoresis; RT = reverse transcriptase.
DETAILED DESCRIPTION OF THE INVENTION
Induction of plant immune responses involves significant reprogramming of transcription that prioritizes defense- over growth-related cellular functions. Despite intensive efforts involving forward genetic screens and genome-wide expression-profiling experiments, only a limited number of transcription factors have been found that are involved in regulating the growth-to-defense transition. Using endoplasmic reticulum (ER)-resident genes required for antimicrobial protein secretion as markers, we identified a heat shock factor-like transcription factor that specifically binds to the TLl (GAAGAAGAA) cis-element required for the induction of these genes. Plants lacking this TLl-binding factor (TBFl) respond normally to heat stress, but
were shown to be compromised in their immune responses induced by salicylic acid (SA), and by microbe- associated molecular pattern (MAMP), elfl8. Genome-wide expression profiling indicated that TBF1 plays a key role in the growth-to-defense transition. The expression of TBF1 itself was shown to be tightly regulated at both the transcriptional and translational levels. Two small upstream open reading frames (uORFs) encoding multiple aromatic amino acids were found 5' to the translation initiation codon of TBF1 and shown to affect its translation. Through this unique regulatory mechanism, TBF1 can sense metabolic changes upon invasion by pathogens, triggering specific transcriptional reprogramming by modifying the expression of its target genes. Key aspects of this study can be summarized as follows: (1) the plant transcription factor, TBF1, binds to the TL1 element in vitro and in vivo; (2) TBF1 controls the expression of nearly 3,000 genes involved in development and immunity; (3) TBF1 is required for effective SA- and MAMP-induced defense responses; and (4) translation of TBF1 is regulated by uORFs in 5' UTR and is sensitive to metabolic changes.
The present invention relates to an isolated nucleic acid molecule comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved.
An aspect of the invention relates to an isolated nucleic acid, as described above, wherein said molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof. Another aspect, relates to an isolated nucleic acid, further comprising one or more downstream ORFs (dORFs) encoding one or more polypeptides. In another aspect, at least one dORF encodes a polypeptide selected from the group consisting of: (i) a polypeptide that is functionally-active as a transcription factor; (ii) a reporter polypeptide; (iii) a polypeptide that confers drug resistance; (iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and (v) a polypeptide involved in the growth of plants.
A variety of polypeptides encoded by a downstream ORF are contemplated by the invention. In one aspect, the polypeptide is a transcription factor selected from the group consisting of: (i) a polypeptide
represented by TBF1 (SEQ ID NO: 106); (ii) a variant polypeptide thereof, that contains one or more conservative substitutions in which TBF1 structure and one or more TBF1 functions are conserved; or (iii) a variant polypeptide thereof, that contains one or more substitutions, fusions, or truncations in which one or more TBF1 functions are conserved. In another aspect, the polypeptide is a reporter polypeptide selected from the group consisting of: (i) β-galactosidase (β-gal), β-glucuronidase (β-gluc), chloramphenicol acetyltransferase (CAT), ffen/V/a-luciferase (rue), Photinus luciferase (luc), secreted alkaline phosphatase (SAP), and green fluorescent protein (GFP); (ii) a variant of the reporter polypeptide specified in (i) that contains one or more conservative substitutions in which structure and one or more reporter functions are conserved; or (iii) a variant of the reporter polypeptide specified in (i) that contains one or more substitutions, fusions, or truncations in which one or more, reporter functions are conserved.
The invention is not limited by the specific nature of the polypeptide encoded by the downstream ORF, provided it is functional in the cellular or organismal environment being evaluated. In some cases, it may be desirable to express a partially-functional or non-functional polypeptide, compared to a fully-functional polypeptide to study its properties with respect to its biological activity, including its binding affinity to, or influence on the properties of, other cellular molecules. In this respect, polypeptides being studied, including those encoded by upstream or downstream ORFS (uORFs and dORFs), may contain a variety of alterations, such as conservative substitutions, in which amino acids having similar structural or chemical properties (e.g., size, charge, or polarity) are substituted for amino acids in the unmodified polypeptide. A variety of polypeptides can tolerate insertions of other polypeptide segments, at the amino terminus, carboxy terminus, or at internal positions, permitting the evaluation of protein fusions, which may retain or interfere with the activity of the unmodified polypeptide. Many polypeptides can also tolerate internal deletions, or truncations of amino acids at the amino terminus or carboxy terminus, which may retain or interfere with the activity of the unmodified polypeptide. Polypeptides may also contain one or more alterations, such as substitutions, insertions/fusions, deletions/truncations, in a variety of combinations, which alter the structure, and in some cases function, of the polypeptide being studied.
The types of alterations that are tolerated depend on the nature of the polypeptide being studied. For example, for polypeptides having more than one function, alterations may be tolerated in specific structural domains, if the system being evaluated is not sensitive to the function carried out by polypeptide domain. Reporter polypeptides, for example, may more easily tolerate alterations at either end of the polypeptide, permitting the construction of fused or truncated polypeptides, that retain the catalytic activity responsible for the reporter function (e.g., enzymatic activity, or fluorescence), than alterations located in the
middle of the molecule. Transcriptional factors, like TBFl, may tolerate alterations in regions that are not involved in the binding of the polypeptide to nucleic acids, other polypeptides, or other types of regulatory co- factors.
The promoters used with the invention may comprise a variety of genetic elements that regulate their properties, including level of transcription at different times, generally in response to different concentrations of general or specific transcriptional components, including regulatory molecules, polymerase complexes, typically be small molecules, nucleic acids, peptides, or polypeptides, or conjugates between these and other cellular molecules or macromolecules. In one aspect of the invention, the promoter is constitutive, and in another aspect, the promoter is inducible.
In one aspect, the promoter is active in plant cells. In one aspect, the promoter is selected from the group consisting of: (a) a plant promoter; (b) a plant virus promoter; (c) a promoter from a non-viral plant pathogen; (d) a mammalian cell promoter; and (e) a mammalian virus promoter. In one aspect, the promoter is a plant promoter. In another aspect, the plant promoter is selected from the group consisting of: (a) the TBFl promoter as set forth in SEQ ID NO: 113; (b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBFl promoter functions are preserved; or (c) a nucleotide sequence which is 50% or more identical to the TBFl promoter set forth in (a) in which one or more promoter functions are preserved. In another aspect, the plant promoter is selected from the group consisting of: (a) the BiP2 promoter as set forth in SEQ ID NO: 109; (b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBFl promoter functions are preserved. In another aspect, the plant promoter is a nucleotide sequence comprising a binding site for the TBFl polypeptide in which one or more promoter functions are preserved. In a specific aspect, the plant promoter is a nucleotide sequence comprising a functionally-active pathogen-inducible or constitutive promoter. In more specific aspect, the promoter is derived from an Arabidopsis locus selected from the group consisting of AT1G48850, AT1G62300, AT4G34230, AT4G34180, AT4G35110, AT2G30490, AT5G38900, AT5G24430, AT1G63720, AT4G39270.
In one aspect, the promoter is a plant promoter which is inducible. In another aspect, the plant promoter is inducible upon challenge by a plant pathogen or a chemical inducer. In another aspect, the inducer is selected from the group consisting of salicylic acid, jasmonic acid, methyl jasmonic acid, abscisic acid, ethylene, AgN03, cycloheximide, mannitol, NaCI, flg22, elfl8 and LPS. This non-limiting list of inducers have all been tested and shown to induce the TBFl promoter. Other stimuli, which trigger a similar induction
response in TBFl-like genes could be used to test their ability to modulate expression mediated the regulatory region described above.
Other aspects of the invention include cells and vectors comprising nucleic acids comprising the regulatory regions described above, and organisms, particularly plant propagation material, plants, and seeds derived from plants comprising said cells or vectors. One aspect, for example, is a cell comprising a nucleic acid with a regulatory region comprising a promoter operable in said cell, and one or more upstream ORFs, optionally linked to one or more downstream ORFS, as described above. In another aspect, the cell is a plant cell and said promoter is active in plant cells. Another aspect is plant propagation material comprising said cell. Other aspects include a transgenic plant comprising said cell, and a seed derived from said transgenic plant.
Related aspects include a vector comprising a nucleic acid with a regulatory region comprising a promoter operable in a cell, and one or more upstream ORFs, optionally linked to one or more downstream ORFS, as described above. Another aspect is a cell comprising a vector comprising the regulatory region as noted above, and a plant cell comprising the vector, wherein the promoter is active in plant cells. Other aspects include a transgenic plant comprising the vector, and the seed of a transgenic plant comprising the vector described above.
It should be noted that vectors may carry genetic elements, such as those that confer resistance to drugs, that are not essential to the function of the nucleic acids of the invention that comprise the regulatory region (e.g., promoter, one or more uORFs, optionally one or more dORFs) described above. The vectors may be plasmids, propagated in bacteria or plants, or viruses. Plasmids are typically propagated as double- stranded DNA circles, while viruses may carry genetic information as single- or double-stranded RNA or DNA molecules. The nucleic acids that comprise the regulatory region noted above may be introduced into cells as part of a larger molecule, such as a vector, or introduced directly into a cell not covalently linked to other nucleic acids, although other nucleic acids or vectors may be used to facilitate the introduction of genetic material, such as selectable or screenable genetic markers, into the cell. The nucleic acids of the invention, therefore, may not be stably-propagated, after introduction into a cell, or may be stably-propagated, either by replication of a vector comprising the regulatory region noted above, or by stable integration of the nucleic acid at one or more regions within the genome of the cell.
One aspect of the invention relates to a transgenic plant comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a
promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uO F) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii)a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved. A related aspect includes a transgenic plant, wherein said molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof.
Another aspect includes a transgenic plant further comprising one or more downstream ORFs (dORFs) encoding one or more polypeptides. The invention also includes a transgenic plant, wherein at least one dORF encodes a polypeptide selected from the group consisting of: (i) a polypeptide that is functionally- active as a transcription factor; (ii) a reporter polypeptide; (iii) a polypeptide that confers drug resistance; (iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and (v) a polypeptide involved in the growth of plants.
Related aspects of the invention also include transgenic plants wherein downstream ORFs encode specific polypeptides, such as TBF1, and natural or synthetic variants, homologues, and orthologs, or reporter polypeptides, such as β-glucuronidase, β-galactosidase, luciferase, and fluorescent proteins, as noted above.
The invention also relates to a variety of methods of using the regulatory region described above to facilitate the expression (e.g., transcription of mRNA, and translation of the mRNA comprising one or more ORFs) of one or more peptides or polypeptides in a cell. A polypeptide may be also released from the cell into the extracellular environment, such as cell culture medium, after being processed for secretion, or by degradation of the cell membrane or cell wall, where it may be recovered and purified. It is not necessary for a polypeptide to be expressed at high levels to have an effect on other cellular functions. A transcriptional factor, for example, may have pleiotropic effects by modulating its expression only slightly, compared to the amount or level of activity in a parent cell that does not contain a regulatory region described above.
One aspect of the invention relates to a method of using a regulatory region to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to one or more upstream ORFs and one or more downstream ORFs
encoding said one or more polypeptides, comprising the steps of: (a) introducing one or more nucleic acids comprising said regulatory region into a cell; (b) expressing one or more upstream ORFs and one or more downstream ORFs encoding one or more polypeptides for a period sufficient to modulate the amount or level of activity of at least one of the one or more polypeptides within the cell or in the cell culture medium obtained from said cell. Another aspect relates to a method, further comprising the step (c) of purifying at least one of said polypeptides from the cell comprising said regulatory region or from the cell culture medium obtained from said cell.
In any of these methods, the amount or level of activity at least one of said polypeptides may be enhanced above, or reduced below, the endogenous amount or level of activity in a parent cell lacking an introduced nucleic acid comprising said regulatory region.
Another aspect relates to a method wherein said regulatory region contains a nucleic acid comprising at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103); (ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved.
Related aspects include methods wherein said nucleic acid molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof, and also methods wherein said nucleic acid molecule further comprises one or more downstream ORFs (dORFs) encoding one or more polypeptides.
Another aspect includes a method wherein the regulatory region further comprises one or more downstream ORFs (dORFs) encoding one or more polypeptides. The invention also includes a method wherein at least one dORF encodes a polypeptide selected from the group consisting of: (i) a polypeptide that is functionally-active as a transcription factor; (ii) a reporter polypeptide; (iii) a polypeptide that confers drug resistance; (iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and (v) a polypeptide involved in the growth of plants. Related aspects include methods where the downstream ORFs encode specific polypeptides, such as TBF1, and natural or synthetic variants, homologues, and orthologs, or
reporter polypeptides, such as β-glucuronidase, β-galactosidase, luciferase, and fluorescent proteins, as noted above.
Other aspects also relate to methods wherein the regulatory region comprises a specific promoter, such as those described above, which may be constitutive or inducible, or derived from different sources, provided they are functionally active in the cell or organism being evaluated.
The invention is also directed to any of the methods described above that include introducing the nucleic acid comprising the regulatory region comprising a promoter, one or more uO Fs, and one or more dORFs, into a cell, expressing a polypeptide under the control of the regulatory region, and purifying the polypeptide from a cell, tissue, or plants, or its extracellular environment.
While specific aspects of the invention have been described in detail, it will be appreciated by those skilled in the art that various modifications and alternatives to those details could be developed in light of the overall teachings of the disclosure. Accordingly, the particular arrangements disclosed are meant to be illustrative only, and not limiting as to the scope of the invention, which is to be given the full breadth of the appended claims, and any equivalent, thereof.
EXAMPLES
The foregoing discussion may be better understood in connection with the following representative examples which are presented for purposes of illustrating the principle methods and compositions of the invention, and not by way of limitation. Various other examples will be apparent to the person skilled in the art after reading the present disclosure without departing from the spirit and scope of the invention. It is intended that all such other examples be included within the scope of the appended claims.
General Materials and Methods Sources of Materials
All parts are by weight (e.g., % w/w), and temperatures are in degrees centigrade (°C), unless otherwise indicated. Table S3 presents a summary of the PCR primers and nucleotide and amino acid sequences described in this application.
Table S3: PCR Primers, Nucleotide and Amino Acid Sequences and SEQ ID NOS Used In This Study
Name Description Length Type SEQ ID
NO:
A. Drimers used in
the ChIP experiment
BiP2-ChlP-Fl ATGGCTCGGCTCGCT 15 ssDNA 1
BiP2-ChlP- l GAGATCAAGCAACAATGCAGA 21 ssDNA 2
BiP2-ChlP-F2 TCGGGCACTGGACCTATTTA 20 ssDNA 3
BiP2-ChlP-R2 CGGAAACTTTTGCGTACGAT 20 ssDNA 4
BiP2-ChlP-F3 GGCCACGATTACTCCAACAC 20 ssDNA 5
BiP2-ChlP-R3 I CG I 1 1 1 lAI UGAAGACGAA 21 ssDNA 6
BiP2-ChlP-F4 GGTTCCGGTTCTTTTCCACT 20 ssDNA 7
BiP2-ChlP-R4 TGTGTTGGAGTAATCGTGGC 20 ssDNA 8
BiP2-ChlP-F5 GGT ACGCAGATCGGATTCGAGT AAAAC 27 ssDNA 9
BiP2-ChlP-R5 TTATAGCCAATTGATCCGAACCAAAACCG 29 ssDNA 10
BiP2-ChlP-F6 CATCCAAAAATATATTAGTACGAGCC 26 ssDNA 11
BiP2-ChlP-R6 CCATCACCGTTAACAAAGAAA 21 ssDNA 12
B. Primers used for
real-time PCR
UBQ5-qPCR-F GACGCTTCATCTCGTCC 17 ssDNA 13
UBQ5-qPCR-R GTAAACGTAGGTGAGTCCA 19 ssDNA 14
TBFl-qPCR-F GTTGGTTCGCCTTCTG 16 ssDNA 15
TBFl-qPCR-R CCACACCCCAAACAAT 16 ssDNA 16
BiP2-qPCR-F GACGCCAACGGTATTC 16 ssDNA 17
BiP2-qPCR-R TGTCTCCAGGGCATTC 16 SSDNA 18
CRT3-qPCR-F ATGACCCCAACGATGT 16 ssDNA 19
CRT3-qPCR-R CCTTGTAGTTCGGGTTCT 18 ssDNA 20
PRX-qPCR-F CTCATACACTCTGGTGGG 18 ssDNA 21
PRl-qPCR-R TTGGCACATCCGAGTC 16 SSDNA 22
BiP3-qPCR-F AGCACTCGAATCCCAA 16 ssDNA 23
BiP3-qPCR-R GCCTCCGACAGTTTCA 16 ssDNA 24
CRTl-qPCR-F CTGTGGTGGTGGCTAC 16 ssDNA 25
CRTl-qPCR-R GTCTCACATGGGACCT 16 ssDNA 26
NPRl-qPCR-F AAACATGTCTCGAATGT 17 ssDNA 27
NPRl-qPCR-R GATTCCTATGGTTGACA 17 ssDNA 28
CNXl-qPCR-F CCCATGTCTACACCGC 16 SSDNA 29
Name Description Length Type SEQ ID
NO:
CNXl-qPC - CACGGCATTTGGATCAG 17 ssDNA 30
MP ll-qPCR-F ACCCAAACAGACGCATTACAG 21 ssDNA 31
MPKll-qPCR-R CTCCTTGATGTTCTCTTCCGTC 22 ssDNA 32
GWD-qPCR-F ATCGCAGATTTGGAGAGTGAG 21 ssDNA 33
GWD-qPCR-R TGTAGCCATAAACCTCATCCAG 22 ssDNA 34
T6A3-qPCR-F TCTTGATGTCGGGAATGTGG 20 ssDNA 35
TGA3-qPCR-R AGTTGCTGATCGGTTAAGGG 20 ssDNA 36
SecY-qPCR-F TTCTACACCTCCAACATGCC 20 ssDNA 37
SecY-qPCR-R CTCTGATTCTTTCCACTGTCCC 22 ssDNA 38
PR-13-qPCR-F TGTGTATCCTCTGTTTGCGG 20 ssDNA 39
PR-13-qPCR-R TGCATTCATAGAGCCCTTGG 20 ssDNA 40
CRR23-qPCR-F ACAT CACACCAAACCCAAC 21 ssDNA 41
CRR23-qPCR-R TAAGGCTGGATGGTCAATCG 20 ssDNA 42
OB-fold-like-qPCR-F AACCTACCACGAACACCATC 20 ssDNA 43
OB-fold-like-qPCR-R ACTACATAAGCGGCCATCAG 20 ssDNA 44
ANNAT4-qPCR-F CAAACCAAGAGCCGGAAATC 20 ssDNA 45
ANNAT4-qPCR-R TCCCCAGTGTGCTTATCAATG 21 ssDNA 46
FLA8-qPCR-F TGCTCCACACTGACACTTG 19 ssDNA 47
FLA8-qPCR-R GCGAGGATTTGAGTGATGTTG 21 ssDNA 48
HSP70-qPCR-F AATGGCTGGTAAAGGAGAAGG 21 ssDNA 49
HSP70-qPCR-R CTATCAGTGAAGGCGACGTAAG 22 ssDNA 50
ATERF-7-qPCR-F AAATCTCGTGTCTGGCTCG 19 ssDNA 51
ATERF-7-qPCR-R AGGTGAGAGGTTGGAGAGG 19 ssDNA 52
DegP-qPCR-F AAGAGAACACTCCTTCCGTTG 21 ssDNA 53
DegP-qPCR-R TGACCTTGCTTATCCCACAC 20 ssDNA 54
Thylakoid P17-qPCR-F GAGATCCAGTTCCTTGTGAGAG 22 ssDNA 55
Thylakoid P17-qPCR-R ATTCCACCTTCATCTTCCCTTC 22 ssDNA 56
MP 3-qPCR-F CGAAAAGATACATCCGGCAAC 21 ssDNA 57
MPK3-qPCR-R GATTCAGAGCTTGTTCAACAGTG 23 ssDNA 58
Ciathrin-qPCR-F CCTCGTGAAGTGCCAGTTATAG 22 ssDNA 59
Clat rin-qPCR-R GGATTGTGCTTGAGTTTCGTG 21 ssDNA 60
PAD4-qPCR-F AAGATCCATGACATCGCCG 19 ssDNA 61
PAD4-qPCR-R AGGTAGAGGTTCATCGGAGG 20 ssDNA 62
PDIL-qPCR-F GTGGATGTTGACCGTACAGTAG 22 ssDNA 63
Name Description Length Type SEQ ID
NO:
PDIL-qPCR-R CTTGGAACTATCACCCTCGATC 22 ssDNA 64
PGL34-qPCR-F GCTTCTCATCCTCTGTATCACC 22 ssDNA 65
PGL34-qPCR-R AACCGAGTCTTGAACCATAGC 21 ssDNA 66
SAUR-like-qPCR-F TGGATTCGAGCAGAAAGGTAC 21 ssDNA 67
SAUR-like-qPCR-R TGGGTTAGGCCGTGTTTG 18 ssDNA 68
GA2ox-qPCR-F GAACCGATATCCACCTTGTCC 21 ssDNA 69
GA2ox-qPCR-R TGAGGAAATCACTGTCCGTG 20 ssDNA 70
EXLA2-qPCR-F TGACAAAGTACCCAACGGAG 20 ssDNA 71
EXLA2-qPCR-R ATGTCTGTGATCTGAACGCC 20 ssDNA 72
CESA6-qPCR-F TCCTTCrCGCCTCTATCCTTAC 22 ssDNA 73
CESA6-qPCR-R CAGTCCAAGCCACATATCTCG 21 ssDNA 74
WRKY75-qPCR-F GGAGGGATATGATAATGGGTCG 22 ssDNA 75
WRKY75-qPCR-R ACCTTCTGATCTAACCTTTGAGC 23 ssDNA 76
Ribosomal Protein-qPCR-F TTGCCrCTGAAATGAGTCCG 20 ssDNA 77
Ribosomal Protein-qPCR-R T6CTCTTCCCCTTTGTTCTC 20 ssDNA 78 DH-qPCR-F TTGCCTCTGAAATGAGTCCG 20 ssDNA 79
MDH-qPCR-R TGCTCTTCCCCTTTGTTCTC 20 ssDNA 80
C. Primers used for cloning
BiP2 promoter. TBFl
eenomic f raement and
5'UTR of TBra
TBFl-cDNA-GW-F GGGGACAAGTTTGTACAAAAAAGCAGGCTTAATGACGGCTGTG 57 ssDNA 81
ACGGCGGCGCAAAG
TBFl-cDNA-GW-R (STOP) GGGGACCA TTTGTACAAGAAAGCTGGGTCTTAGTTGCAGACTT 55 ssDNA 82
TGCTGCTTTTC
TBFl-cDNA-GW-R GGGGACCACTTTGTACAAGAAAGCTGGGTCGTTGCAGACTTTG 55 SSDNA 83 (NON_STOP) CTGU 1 1 I CCTC
TBFl-promoter-GW-F GGGGACAAGTTTGTACAAAAAAGCAGGCTTA 60 ssDNA 84
CGACGACTAGTTTACAGAGAATTTGGAC
BiP2 - promoter - GW-F GGGGACAAGTTTGTACAAAAAAGCAGGCTTATTCCGG 1 ICI 1 1 1 55 ssDNA 85
CCACTCCTAATG
BiP2 - promoter - GW-R GGGGACCACHTTGTACAAGAAAGCTGGGTCATCGGAAACTTTT 53 ssDNA 86
GCGTACGATC
TBFl S'UTR-GW-F GGGGACAAGTTTGTACAAAAAAGCAGGCTTAI 1 I LI lACAAAG 54 ssDNA 87
GTA6GACCAAC
TBFl S'UTR-GW-R GGGGACCACTTTGTACAAGAAAGCTGGGTCGTAAGTGTTGAGC 52 ssDNA 88
TGACGAATG
uORFl Phe->Leu-F GCTCCGGCGAAGTCTGGTCGTCGTCTTCATC 31 ssDNA 89 uORFl Phe->Leu-R GATGAAGACGACGACCAGACTTCGCCGGAGC 31 ssDNA 90 uORF2 Phe->Leu-F GATTTTTCCTTAACTGGAAGAAACCAAACG 30 ssDNA 91
UORF2 Phe->Leu-R CGTTTGG 1 1 ILI 1 CCAGTTAAGGAAAAATC 30 ssDNA 92
Name Description Length Type SEQID
NO: pTB3-dhAGT -TBF15'UTR-F GAGAAATTGAAGAGCGCAACGAACTACGAGCGGATCC 58 ssDNA 93
TTT TTACAAAGGTAGGACC
pTB3-dhAGT -TBF15'UTR-R GGACACGGCGACGATGCAGTTCAATGGTCGAACGTAAGTGTTG 55 ssDNA 94
AGCTGACGAATG
D. Olieos used for EMSA
TL1 oligo (EMSA) TCCAGTGCTGAAGAAGAATTCTACG 25 ssDNA 95 mTLl oligo (EMSA) TCCAGTGTCATCACGTGTTTCTACG 25 ssDNA 96
E. tRNA Probe Seauences
tRNA-Phe AGCGTGGATCGAACACGCGACCTTCAGATCTTCAGTCTGACGCT 59 SsDNA 97
CTCCCAACTGAGCTA
tRNA-Asp GCCGG6GATCGAACCCGGGTCACCCGCGTGACAGGCGGGAAT 59 ssDNA 98
ACTTACCACTATACTAC
F. TBF1 region
Exact TL1 motif GAAGAAGAA 9 DNA 99
Degenerate TL1 motif GXXXGXXXX, approximating degenerate motif, G-(A/G)- 9 Synthetic 100
(AGT)-G-(ACG)-(ACG)-(ACG)-(AC)-(ACGT) as noted in the
frequencies specified in the weight matrix of Table S2.
Genomic TBF1 region Genomic TBF1 region from Arabidopsis thaliana including 5085 DNA 101
TBF1 promoter, and regions encoding uORFl, uORFl, and
TBF1 polypeptides (in exons 1 and 2, separated by TBF1
intron)
See Figures S11A and SUB displaying the sequence and
genetic elements of the TBF1 region in compact form.
Beginning with
Aaaattttca .. .
Ending with
. . . acagaaacat tttct 5085
uO Fl aa WVFIFFLH HQIFP 15 AA 102
UORF2 aa EET RNSDLLRSRVFLSGFYCWDWEFLTALLLFSC 36 AA 103
TBF1 aa (la Exon) MTAVTAAQRSVPAPFLS TYQLVDDHSTDDWSWNEEGTAFW 73 AA 104
WKTAEFAKDLLPQYFKH
NNFSSFIRQL TY
TBF1 aa (2nd Exon) GFR TVPD WEFANDYFRRGGEDLLTDIRRRKSVIASTAG C WGS 211 AA 105
PSESNSGGGDDHGSSSTSSPGSSKNPGSVENMVADLSGENEKLKRENN
NLSSELAAA Q
RDELVTFLTGHLKVRPEQIDKMIKGG F PVESDEESECEGCDGGGGAE EGVGEGL LFG
VWLKGERKKRDRDEKNYWSGSRMTEIKNVDFHAPLWKSSKVCN
TBFl aa (l*' and 2'", Exons) TAVTAAQRSVPAPFLSKTYQLVDDHSTDDWSWNEE6TAFWW T 284 AA 106
AEFAKDLLPQYFKH
NNFSSFIRQLNTY
GFRKTVPDKWEFANDYFRRGGEDLLTDIRRRKSVIASTAGKCVWGS PSESNSGGGDDHGSSSTSSPGSS N PGSVEN MVADISGEN EKLKREN N NLSSELAAAKKQ
RDELVTFLTGHLKVRPEQIOKMIKGGKFKPVESDEESECEGCDGGGGAE EGVGEGLKLFG
Name Description Length Type SEQ ID
NO:
VWLKGER RDRDEKNYWSGSRMTEIKNVDFHAPLWKSS VCN
TBF1 genomic region with The 4601-bp genomic DNA containing the TBF1 promoter 4601 DNA 107 STOP codon used for and the coding region (SEQ ID NO: 107) with the TBF1 intron
complementation was amplified using primers TBFl-promoter-GW-F (SEQ ID
NO: 84) and TBFl-cDNA-GW-R (SEQ ID NO: 82)
Beginning with
cgacgactag . . .
Ending with
.. . tctgcaacta a 4601
TBF1 UTR through first exon The DNA fragment containing the S' untranslated region 670 DNA 108 ofTBFl ORF (UTR) and the first exon of TBF1 was amplified by
polymerase chain reaction (PCR) using primers TBF1 5'UTR- GW-F (SEQ ID NO: 87) and TBF1 5'UTR-GW-R (SEQ ID NO:
88). designated uORFl-uORF2-TBFl l" exon
tttcttacaa aggtaggacc aacatttgtg atctataaat cttcctacta
cgttatatag 60
agacccttcg acataacact taactcgttt atatatttgt tttacttgtt
ttgcacatac 120
acacaaaaat aaaaaagact ttatatttat ttacttttta atcacacgga
ttagctccgg 180
cgaagtatgg tcgtcgtctt catcttcttc ctccatcatc agatttttcc
ttaaatggaa 240
gaaaccaaac gaaactccga tcttctccgt tctcgtgttt tcctctctgg
cttttattgc 300
tgggattggg aatttctcac cgctctcttg ctttttagtt gctgattctt
tttccttcga 360
ctttctattt ccaatctttc ttcttctctt tgtgtattag attattttta
gttttatttt 420
tctgtggtaa aataaaaaaa gttcgccgga gatgacggct gtgacggcgg
cgcaaagatc 480
agttccggcg ccgtttttaa gcaaaacgta tcagctagtt gatgatcata
gcacagacga 540
cgtcgtttca tggaacgaag aaggaacagc ttttgtcgtg tggaaaacag
cagagtttgc 600
taaagatctt cttcctcaat acttcaagca taataatttc tcaagcttca
ttcgtcagct 660
caacacttac 670
BiP2 promoter fragment A 352-bp long fragment of the BiP2 promoter containing 352 DNA 109 four TL1 motifs was PCR-amplified using primers BiP2 - promoter - GW-F (SEQ ID NO: 85) and BiP2 - promoter - GW- R (SEQ ID NO: 86), cloned into the pDONR207 Gateway Entry
vector and subsequently recombined into yeast one hybrid
bait destination vectors pMW2 and pMW3.
Ttccggttcttttccactcctaatgatgtaatagaagaagactggcccaacaaaagctc
attgtctaattaagaagaagaaacgaagtaaccaacggccacgattactccaacacaa
gaccaaatctgattggttgacattatagatcgtcgtaagataattggtccacgtcatctcc
gatgacatagnaaatttcttcgtcttccataaaaagcgactacttcaccatcaccttcgg
gcactggacctatttaagcatcctaacttcttcttcaaagcttaaaaaccagaaaacaaa
aggaagctctctgttcaaatcaaaaagagagatcgtacgcaaaagtttccgat
Genomic TBF1 region The 4,598-bp genomic DNA containing the TBF1 promoter 4598 DNA 110 NON_STOP and the coding region (SEQ ID NO: 107) was amplified using
primers TBFl-promoter-GW-F (SEQ ID NO: 84) and TBF1- cDNA-GW-R (NON_STOP) (SEQ ID NO: 83). The resulting
Name Description Length Type SEQID
NO: fragment was cloned into pDONR207, subsequently
recombined into p DC107 and used to generate a genomic
TBF1-GFP fusion.
cgacgactagtttacagagaatttggaccgtccgatgtaaa
gcgaaaatagatctaggttttcoacgtgtcccctattttaa
tgaaaccttctgattcatgtagaagttttactcaatttaat
attttttagtatgtagttttgtgtgtgtgtgtgtgtgtgtt
tttatggctccacaccaacttttaaaatggtagaagcatgt
tgcatgtgatcgagtaaaaagccaataatgagattcagaaa
aataaaaattacttatatagttttttagagaaaaaattgta
ttttgtttaaagccttaatccggttgttgaaagagctgtgt
cacgagttaaaaatattttcttttcattttttaagtaatta
gtttataatgcaaaaatggtttttatttatttgtcttcgct
tatagaactgcaaattgagagagaaaaaaatgaattagtgg
tggtgaccaaacattcaggaagctgtgattgatcatttgtt
tttgaggtgagtgtagtggcaacgtatgacgttaacatatg
gcgtacataataattacatgaacttaatcataataatcata
ttgcatttaattcatatatcatatoccattagttggaccac
ttgatttgaggtcatgagaagaacatttatgttttttttag
tttgaatcggagtgatcactaaaaactagatactgaaaatt
ttcaaactaaaatcatattaatcttcaaaaaatgtgaaatc
taaaaaaaaaaaaaattttaacgcgttcattgtagccaagt
agccaagtattgttaaagtagtagtaaaagaagtttagctt
taagtgatataatttgacacaaatcctacttagatatggat
aataggatatagcttcatgtatatttttatcgttgcttctg
taaccccaaaatgtgttgatataagcatttgaatattcgta
tgtataatgttttcttttcaccgtaaaacatattacaatgt
tagtttatattggattttgaatgtgtttatgaacagttttt
gtcgactcaaaagttaagatgagaatatggaagaaagtaaa
gtttaaaagtcatgatgggaacaaggaatggaactcaaaca
ttctaatactcaacaaacgcaattatattattaccatgact
catctttcaagttccatcaaaaagattcgtggaaaataata
gacttacgtttcaaatccatgtttctttctttataacaaaa
aaaatggatgtttcttgacgcgtgtcgagagtactcaccat
tactctgacttcagtgagtttggtcaagtggtctttttttt
tctcatgtcaccaaaggtccaaaccctagaaattagttcga
actttccatagaagaactgaataaatggtccaaaattgttt
taaaaaggacctaagccattagttcattgaattcgagttaa
tgggtgaagatttttatgataacgaaagtcggagtaattat
gcttttggtccgatagttttctaatttgttttctttccatt
ttttttttttcaaatactacatactatataagatagtggtt
tgtgttaatgtcatcgatgtgttaccatccgcattatatta
attatttatcccaacataaagtcagaatctgtaatttcttt
gttataaaatacagtaaatggttccgtttaagctgttagat
gatttttgagtaaaaactaatgtaaaaaaaacaaaaaaaaa
acaatgtagttcataatacatgcatgttttaaagaagtttc
ttgtttactatcaacttgaatagtatttcacgaagtcaaaa
ttgttcattccgacttttctatgtggagaaaaaaaattcta
tcattgtgcacaatttaacagaatgtaatttcttgtaaaag
aagaggaaacaattcgctgttagtaaatgtgaagtatagaa
gtctaaaatgagatacctcaactagcttgaattaagaaaaa
aaacaaaaactctatcgacatgaaaaaggtcgcaaatattt
atcatttatcaatgccaaaggagtatttggttcacaaaata
ctgaatcatttatatagatatataattagctctaaattcta
ctataacttgcaaaataagtatactgactcaattatatagc
gtttaaaaatagacgatttgtatgatgaggtccatatatat
ggagatgtgcatgcaactatcgacattttcacacgttgata
tcgtctttctccaatggagacttgaatttgtgtaaactatg
aatactcgtctctctaagaccttttttcttcaaccatgcca
actatttaggtaagattttactgtctttgattgatattaaa
Name Description Length Type SEQID
NO: tacttagccgtggcgttatcaatgaatgataataaaaatgc
ggataaaagccaaaggtgttggaaataaatccaagaatgaa
gacgtagatgtcgatgggtattttaagaacttgaatttgtc
acgactcacacgttaaaatatattatccgaattgtttagtc
taaagacacacatatattgaaaaagaaaaggtaaatgaagc
tcattggtgcctaaatgtgaaatgaagccgaaatgtgttag
gtgaacacatttaaatatacaaaaagaaatataatagaaac
aaaactaattaacaaagtcgcaatttgtattgtataaaata
tctttccgtctcccgtcatatttgaaaaaaaaaaaattaca
aatctgttaattttaaaactttctagaaaaacacaagtata
taattttctcttttcgtgcgtgtttgttttaaaataacatt
gttttgattggcgactcaacatattttagcatttacatatt
tctgcatatattaaatgatttataaactcaactatagatta
aaatataatttgacatctaataattttaacaataatataaa
atatgagatttataaattacgaatataaatattcaagggag
agaaaaagtagaacataattcaaaagataagactttttaga
cttttttaacaatatttttgatggataaaaattattcaaaa
gagaagaaagtaagaagaaaagatgtttctgagaatttcta
gaaacagcatccgtttttataatttaattttcttacaaagg
taggaccaacatttgtgatctataaatcttcctactacgtt
atatagagacccttcgacataacacttaactcgtttatata
tttgttttacttgttttgcacatacacacaaaaataaaasa
gaotttatatttatttactttttaatcacacggattagctc
cggcgaagt
ATGGTCGTCGTCTTCATCTTCTTCCTCCATCATCAGATTTT TCCTTAA
ATGGAAGAAACCAAACGAAACTCCGATCTTCTCCGTTCTCG TGTTTTCCTCTCTGGCTTTTATTGCTGGGATTGGGAATTTC TCACCGCTCTCTTGCTTTTTAGTTGCTGA
ttctttttccttcgactttctatttccaatctttcttcttc
tctttgtgtattagattatttttagttttatttttctgtgg
taaaataaaaaaagttcgccggag
ATGACGGOTGTGAC;GCGGCGCALAAGATCAGTTCCGGCGCC
GTTTTTAJiGCA? ¾.CGTATCAGCTAGTTGATGftTCaTAGCA
CAGACGACGTCGTTTCATGGAACGAAGAAGGAACAGCTTTT GTCGTGTGGAA&ACAGCAGAGTTTGCTAAAGATCTTCTTCC
T AA ACTTCAAGCATAATAATTTCTCAAGCTTCATTCGTC GCTCAACACTTAC
gtgagtttcactctaacgaaaactcatttactctcaattta
atgcttcatttaattcgtttggtgaattgaatcattctttt
gtagttggttagccaatttcgtaattttctcataatttggg
ggttggtgagaaaaccttctagaagctgagaatgttcttgt
tctttttttttttttttttttggtttag
GGATTTCGTAAAACTGTACCGGATAAATGGGAATTTGCAAA CGATTM'TTCCGGAGAGGCGGGGAGGATCTGTTGACGGAOA
TftCGACGGCGTAftATCGGTGATTGCTTC¾¾CGGCGGGG ¾A
TGTGTTGTTGTTGGTTCGCCTTCTGKGTCTAATTCTGGTGG TGGTGaTGATCACGGTTCAAGCTCCaCGTCATCACCCGGTT
CGTCGAAGAATCCTGGTTCGGTGGAGAACATGGTTGCIGAX TTATOAGGAGAGAACGAGAAGCTT&AACGTGAAAACAATAA
C'CTGAGCTCGGAGCTCGCGGCGGCGAAGAAGCAGCGCGATG
AGCTAGTGACGTTCTTGACGGGTCATCTGAAAGTAAGACCG GAACAAATCGATAAAATGATCAAAGGAGGGAAJiTTTA/vACC
GGTGGAGTCTGACGAAGAGAGTGAGTGCGAAGGTTGCGACG
Name Description Length Type SEQ ID
NO:
GCGGCGGAGGAGCAGAGGAGGGGGTAGGTGA&GGATTGAAA
TTGTTTGGGGTGTGGTTGAA GGSGAGsGAAAAftAGAGGGa
CCGGGATGAAAAGaATTATGTGGTGAGTGGGTCCCGTRTGA
CGGAAATAAAGAACGTGGACTTTCACGCGCCGtTGTGGAAA
AGCAGCAAAGTCTGCAAC
uORFl nucleotide seq ATGGTCGTCGTCTTCATCTTCTTCCTCCaTCATCAGATTTT 48 111
TCCTTAA
UORF2 nucleotide seq ATGGAAGAAACCAAACGAAACTCCGATCTTCTCCGTTCTCG 111 112
TGTTTTCCTCTCTGGCTTTTATTGCTGGGATTGGGAATTTC TCACCGCTCTCTTGCTTTTTAGTTGCTGA
TBF1 promoter cgacgactaqtttacagagaatttggac 3354 113
cgtccgatgtaaagcgaaaatagatctaggttttccacgtg
tcccctattttaatgaaaccttctgattcatgtagaagttt
tactcaatttaatattttttagtatgtagttttgtgtgtgt
gtgtgtgtgtgtttttatggctccacaccaacttttaaaat
ggtagaagcatgttgcatgtgatcgagtaaaaagccaataa
tgagattcagaaaaataaaaattacttatatagttttttag
agaaaaaattgtattttgtttaaagccttaatccggttgtt
gaaagagctgtgtcacgagttaaaaatattttcttttcatt
ttttaagtaattagtttataatgcaaaaatggtttttattt
atttgtcttcgcttatagaactgcaaattgagagagaaaaa
aatgaattagtggtggtgaccaaacattcaggaagctgtga
ttgatcatttgtttttgaggtgagtgtagtggcaacgtatg
acgttaacatatggcgtacataataattacatgaacttaat
cataataatcatattgcatttaattcatatatcatatccca
ttagttggaccacttgatttgaggtcatgagaagaacattt
atgttttttttagtttgaatcggagtgatcactaaaaacta
gatactgaaaattttcaaactaaaatcatattaatcttcaa
aaaatgtgaaatctaaaaaaaaaaaaaattttaacgcgttc
attgtagccaagtagccaagtattgttaaagtagtagtaaa
agaagtttagctttaagtgatataatttgacacaaatccta
cttagatatggataataggatatagcttcatgtatattttt
atcgttgcttctgtaaccccaaaatgtgttgatataagcat
ttgaatattcgtatgtataatgttttcttttcaccgtaaaa
catattacaatgttagtttatattggattttgaatgtgttt
atgaacagtttttgtcgactcaaaagttaagatgagaatat
ggaagaaagtaaagtttaaaagtcatgatgggaacaaggaa
tggaactcaaacattctaatactcaacaaacgcaattatat
tattaccatgactcatctttcaagttccatcaaaaagattc
gtggaaaataatagacttacgtttcaaatccatgtttcttt
ctttataacaaaaaaaatggatgtttcttgacgcgtgtcga
gagtactcaccattactctgacttcagtgagtttggtcaag
tggtctttttttttctcatgtcaccaaaggtccaaacccta
gaaattagttcgaactttccatagaagaactgaataaatgg
tccaaaattgttttaaaaaggacctaagccattagttcatt
gaattcgagttaatgggtgaagatttttatgataacgaaag
tcggagtaattatgcttttggtccgatagttttctaatttg
ttttctttccattttttttttttcaaatactacatactata
taagatagtggtttgtgttaatgtcatcgatgtgttaccat
ccgcattatattaattatttatcccaacataaagtcagaat
ctgtaatttctttgttataaaatacagtaaatggttccgtt
taagctgttagatgatttttgagtaaaaactaatgtaaaaa
aaacaaaaaaaaaacaatgtagttcataatacatgcatgtt
ttaaagaagtttcttgtttactatcaacttgaatagtattt
cacgaagtcaaaattgttcattccgacttttctatgtggag
aaaaaaaattctatcattgtgcacaatttaacagaatgtaa
tttcttgtaaaagaagaggaaacaattcgctgttagtaaat
gtgaagtatagaagtctaaaatgagatacctcaactagctt
gaattaagaaaaaaaacaaaaactctatcgacatgaaaaag
gtcgcaaatatttatcatttatcaatgccaaaggagtattt
Name Description Length Type SEQ ID
NO: ggttcacaaaatactgaatcatttatatagatatataatta
gctctaaattctactataacttgcaaaataagtatactgac
tcaattatatagcgtttaaaaatagacgatttgtatgatga
ggtccatatatatggagatgtgcatgcaactatcgacattt
tcacacgttgatatcgtctttctccaatggagacttgaatt
tgtgtaaactatgaatactcgtctctctaagaccttttttc
ttcaaccatgccaactatttaggtaagattttactgtcttt
gattgatattaaatacttagccgtggcgttatcaatgaatg
ataataaaaatgcggataaaagccaaaggtgttggaaataa
atccaagaatgaagacgtagatgtcgatgggtattttaaga
acttgaatttgtcacgactcacacgttaaaatatattatcc
gaattgtttagtctaaagacacacatatattgaaaaagaaa
aggtaaatgaagctcattggtgcctaaatgtgaaatgaagc
cgaaatgtgttaggtgaacacatttaaatatacaaaaagaa
atataatagaaacaaaactaattaacaaagtcgcaatttgt
attgtataaaatatctttccgtctcccgtcatatttgaaaa
aaaaaaaattacaaatctgttaattttaaaactttctagaa
aaacacaagtatataattttctcttttcgtgcgtgtttgtt
ttaaaataacattgttttgattggcgactcaacatatttta
gcatttacatatttctgcatatattaaatgatttataaact
caactatagattaaaatataatttgacatctaataatttta
acaataatataaaatatgagatttataaattacgaatataa
atattcaagggagagaaaaagtagaacataattcaaaagat
aagactttttagacttttttaacaatatttttgatggataa
aaattattcaaaagagaagaaagtaagaagaaaagatgttt
ctgagaatt
tctagaaacagcatccgtttttataatttaattttcttaca
aaggtaggaccaacatttgtgatctataaatcttcctacta
cgttatatagagacccttcgacataacacttaactcgttta
tatatttgttttacttgttttgcacatacacacaaaaataa
aaaagactttatatttatttactttttaatcacacggatta
gctccggcgaagt
ATGGTCGTCGTCTTCATCTTCTTCCTCCATCAICftGAT TT
TCCTTAA
ATGGAAGAAACCAAACGAAACTCCGATCTTCTCCGTTCTCG TGTTTTCCTCTCTGGCTTTTATTGCTGGGATTGGGAATTTC
TCACCGCTCTCTTGCTTTTTAGTTGCTGA
ttctttttccttcgactttctatttccaatctttcttcttc
tctttgtgtattagattatttttagttttatttttctgtgg
TBF1 genomic seq ATGACGGCTGTGACGGCGGCGCftAAGATCRGTTCCGGCGCC 1047 114
GT 'tT AAGCAAftACGTATCAGC AG TGalGATCATAGCA
AGACGACGTCGTTTCATGGAACGA GAAGGAftCAGCTTTT
GTCGTGTGGAAAACAGCAGAGTTTGCTAaAGATCTTCTTCC
TCASTACTTCAAGCATAArAATTTCTC AGCTTCftTTCGTC
SGCTCAACACTTAC
gtgagtttcactctaacgaaaactcatttactctcaattta
atgcttcatttaattcgtttggtgaattgaatcattctttt
gtagttggttagccaatttcgtaattttctcataatttggg
ggttggtgagaaaaccttctagaagctgagaatgttcttgt
tctttttttttttttttttttggtttag
GGATTTCGTAAAACTGTACCGGATRAATGGGAATTTGCAAa
CGATTATTTCCGGaGAGGCGGGGAGGATCTGTTG¾CGGACS
TACGACGGCGTAAATCGGTGttTTGCTTCAACGGCGGGGA.5.A
TGTGTTGTTGTTGGTTCGCCTTCTGAG CTAATTCTGGTGG TGGTGaTGSTCACGGTTCAAGCTCCACGTCATCACCCGGTT
CGTCGAAGAATCCTGGTTCGGTGGAGAACATGGTTGCTGAT TTATCAGGAG?\i;AACi3AGAAGCTT¾AACGTGAARACAATA¾ CTTGAGCTCGGAGCTCGCGGCGGCGA.AGAAGCAGCGCG.ATG GC AGTGACG TCTTGACGGGTCATCTGAAAG AAG CCG GAACAAATGGATAAAATGATCA AGGAGGGAAA TAAACC GGTGGAGTeTGACGAAGAGAGTGAGTGCGAAGGTTGCGSeG GCGGCGGAGGAGCAGAGGAGGGGGTaGGTGAAGGATTGAAA
CCGGGATGAAAAGAATTATGTGGTGAGTGGGTCCCGTATGA CGGAAATAAAGAACGTGGACTTTCACGCGCCGTTGTGGAAA AGCAGCAAAGTCTGCAACTAA
Table E2: Host strains
Designation Organism Relevant Genotype Reference/
{Source}
Psm ES4326 Pseudomonas syringae ES4326 [S21] pv. maculicola [Psm)
Psm ES4326/avrRpt2 Pseudomonas syringae ES4326 avrRpt2 [S22] pv. maculicola [Psm)
carrying an avirulent
effector avrRpt2
YM4271 Saccharomyces Yeast strain used in yeast-one-hybrid [Sll] cerevisiae experiments, MATa, ura3-52, his3- {Clontech} 200, ade2-101, adeS, Iys2-801, leu2-3,
112, trpl-901, tyrl-501, gal4D, gal8D,
adeSr.hisG
BY4742 Saccharomyces yeast strain BY4742 MATa his3Al [S12] cerevisiae leu2A0 lys2A0 ura3A0 pep4A::KAN* {International
Yeast Deletion Consortium}
Strain 1 Strain 1 derived from YM4271 that This study has the WT BiP2 promoter driving
both HIS3 and URA3 genes.
Strain 2 Strain 2 derived from YM4271 that This study has the WT BiP2 promoter for HIS3
and the mutated BiP2 promoter [SI]
for URA3 (Figure SI).
GV3101 Agrobacterium Bacterial strain for floral-dip based [S13] tumefaciens plant transformation, rifampicin- resistant
Table E3: Plasmids
Reference/
Designation Markers Description
{Source} pMDC140 KanR, Gateway plant expression vector carrying a [56]
HygroR Gateway cassette cloned downstream of the
35S promoter and upstream of the GUS reporter gene; vector confers kanamycin resistance in E. coli and hygromycin
resistance in transgenic plants.
pMDC140- Kan", WT region
uORFl-uORF2 Hygro"
pMDC140- KanR, One A-to-C point mutation was introduced This study mORFl- Hygro" into the start codons (ATG) of uORFl. The
uORF2 mutant mORFl-uORF2 sequence was
inserted downstream of the constitutive 35S
promoter and upstream of the coding region of the GUS reporter in pMDC140 through recombination [56].
pMDC140- Kan", One A-to-C point mutation was introduced This study uORFl- Hygro" into the start codons (ATG) of uORF2. The
mORF2 mutant uORFl-mORF2 sequence was
inserted downstream of the constitutive 35S
promoter and upstream of the coding region of the GUS reporter In p DC140 through recombination [56].
pMDC140- anR, Two A-to-C point mutations were This study mORFl- Hygro" introduced into the start codons (ATG) of
mORF2 uORFl and uORF2. The mutant mORFl- mORF2 sequences were inserted
downstream of the constitutive 35S
promoter and upstream of the coding region of the GUS reporter in pMDC140 through recombination [56].
pTB3 Plasmid comprising S. cerevisiae DHFR {Chandra Tucker} promoter and reporter gene
pTB3-unstable TXR The DHFR reporter gene carried by plasmid This study DHFR&MTX pTB3 was engineered to make an unstable
resistance enzyme [37] and to contain the L22F/F31S
L22F/F31S mutations that confer resistance to
methotrexate (MTX) [58].
pDONR207 Gent", Gateway Entry vector {Invitrogen}
Cat"
pMDC123 Kan", Gateway plant expression vector that Cat", confers kanamycin and chloramphenicol HphR resistance in E. coli and hygromycin
resistance in transgenic plants.
pMW2 AmpR, Yeast one hybrid destination vector, HIS3
CatR, reporter
HIS3
pMW3 Amp", Yeast one hybrid destination vector, LacZ
CatR, reporter
U A3
pENTR207- Gent* A 352-bp long fragment of the BIP2
BiP2 promoter cloned into the pDONR207
Gateway Entry vector
pMW2- BiP2 AmpR, pMW2 plasmid containing a 352-bp long
HIS3 fragment of the ΒΊΡ2 promoter pMW3- BiP2 AmpR, pMW3 plasmid containing a 352-bp long
U A3 fragment of the ΒΊΡ2 promoter pMDC123 KanR, To perform genetic complementation of TBFlp:TBFl tbfl, the 4,601-bp genomic DNA containing the TBF1 promoter and the coding region (SEQ ID NO: 107) was amplified using primers TBFl-promoter-GW-F (SEQ ID NO: 84) and TBFl-cDNA-GW-R (SEQ ID NO: 82) cloned into the vector pDONR207 using the Gateway technology (Invitrogen), and inserted by recombination into the destination vector pMDC123 [6].
pMDC107 KanR, Gateway plant expression vector carrying a
Hygro" Gateway cassette cloned upstream of the GFP reporter gene; vector confers kanamycin resistance in E. coli and hygromycin resistance in transgenic plants. pMDC107 KanR, The genomic TBF1 to GFP fusion was also TBFlp:TBFl- Hygro" generated by recombining pENTR207 GFP TBFlp:TBFl NON_STOP (amplified using primers TBFl-promoter-GW-F (SEQ ID NO: 84) and TBFl-cDNA-GW-R (NON_STOP) (SEQ ID NO: 83) into the destination vector pMDC107 [S6]. The resulting destination clone pMDC107 TBFlp:TBFl-GFP, was transformed into Agrobacterium
tumefaciens strain GV3101 and introduced into tbfl mutant plants. A homozygous T3 line was selected for additional analysis.
Table E4: Description and sources of cloned genes
GenBank
Reference/
Designation Full Name Origin Accession
{Source} Number
4,601-bp genomic DNA
containing the TBF1 Arabidopsis At4g36990/ Arabidopsis genomic DNA
TBF1
promoter and the thaliana NM_119862 (gDNA), This study coding region
1809 bp long gene
[S15] [S16] [S17]
GUS (uidA) encoding beta- Escherichia coli NP_416134
glucuronidase {Invitrogen}
3072 bp long gene
LacZ encoding beta- Escherichia coli ABI99820 [S18] [S19] [S20] galactosidase {Invitrogen}
714 bp long gene encoding Aequorea [S21]
GFP AAA27722
green fluorescent protein victoria {Invitrogen}
BiP2 promoter Arabidopsis At4g42020/ Arabidopsis genomic DNA fragment thaliana N 123567 (gDNA), This study
Table E5: Features of Engineered Cell Lines or Plants
Reference/
Cell line Description
{Source}
Strain 1/
pMW2 BiP2 WT, pMW3 BiP2 WT, pDESTAD-TBFl This study pDESTAD-TBFl
Strain 1/
pMW2 BiP2 WT, pMW3 BiP2 WT, pDEST-AD This study pDEST-AD
Strain 2/
pMW2 BiP2 WT, pMW3 mBiP2, pDESTAD-TBFl This study pDESTAD-TBFl
Strain 2/
pMW2 BiP2 WT, pMW3 mBiP2, pDEST-AD This study pDESTAD-AD
The resulting destination clone pMDC123 TBFlp:TBFl,
GV3101/ was transformed into Agrobacterium tumefaciens strain
This study pMDC123 TBFlp:TBFl GV3101. Constructs were introduced into tbfl mutant
plants by the floral dipping method [S7].
The genomic TBF1 to GFP fusion was generated by
recombining pENTR207 TBFlp:TBFl into the destination
vector pMDC107 [S6]. The resulting destination clone
GV3101/
pMDC107 TBFlp:TBFl-GFP, was transformed into This study pMDC107 TBFlp:TBFl-GFP
Agrobacterium tumefaciens strain GV3101 and
introduced into tbfl mutant plants. A homozygous T3
line was selected for additional analysis.
GV3101/ Transiently expressed in Nicotiana benthamiana using
This study pMDC140-uORFl-uORF2 Agrobacterium tumefaciens
GV3101/ Transiently expressed in Nicotiana benthamiana using
This study pMDC140-uorfl-uORF2 Agrobacterium tumefaciens
GV3101/ Transiently expressed in Nicotiana benthamiana using
This study pMDC140-uORFl-uorf2 Agrobacterium tumefaciens
GV3101/ Transiently expressed in Nicotiana benthamiana using
This study pMDC140-uorfl-uorf2 Agrobacterium tumefaciens
Constructs were transformed into Arabidopsis wild-type
Col-0 plants. Two stable transgenic T3 lines homozygous
GV3101/
for each construct were chosen for quantitative GUS This study p DC140-uORFl-uORF2
assay [3] at 0, 0.5, 1, 2, 3, 4 and 8 hours after Psm
ES4326/avrRpt2 infiltration (OD = 0.02).
GV3101/ Same as above except that the mutant construct was
This study pMDC140-uorfl-uorf2 used here (wild-type construct above)
Arabidopsis plants
Control genotype ABRC* (Columbia-0)
Arabidopsis plants
SALKJ.04713 ABRC* (tbfl mutant)
Arabidopsis plants
Homozygous J3Arabidopsis line used for
(tbfl background) This study complementation assays
pMDC123 TBFlp:TBFl
Arabidopsis plants Homozygous T3Arabidopsis line used for ChIP
This study (tbfl background) experiments
PMDC107 TBFlp:TBFl-GFP
* Arabidopsis Biological Resource Center (ABRC), http://abrc.osu.edu.
EXPERIMENTAL PROCEDURES
Translational Analysis of uORFl-uORF2-GUS
The DNA fragment containing the 5' untranslated region (UTR) and the first exon of TBFl (designated uORFl- UORF2-TBF1 1st exon) was amplified by polymerase chain reaction (PCR) using primers TBFl 5'UTR- GW-F (SEQ ID NO: 87) and TBFl 5'UTR-GW-R (SEQ ID NO: 88), wherein the DNA fragment is represented by the nucleic acid set forth as SEQ ID NO: 108 and cloned into the Gateway vector pDONR207 (Invitrogen). Two A-to-C point mutations were introduced, either separately or together, into the start codons (ATG) of uORFl and uORF2. The WT and mutant uORFl-uORF2 sequences were inserted downstream of the constitutive 35S promoter and upstream of the coding region of the GUS reporter in pMDC140 through recombination [56]. The resulting translational reporter plasmids (designated pMDClAO-uORFl-uORF2-GUS and its mutant variants pMDC14Q-uorfl-uORF2-GUS, pMDC140-uORFl-uorf2-GUS and pMDC 0-uorfl-uorf2-GUS (Table E3) were transformed into Col-0 WT plants or transiently-expressed in Nicotiana benthamiana using Agrobacterium tumefaciens [57]. For Arabidopsis stable transgenic lines, two independent T3 lines homozygous for each construct (as set forth in Table E5) were chosen for quantitative GUS assay [3] at 0, 0.5, 1, 2, 3, 4 and 8 hours after Psm ES4326/avrRpt2 infiltration (ODeoo-m = 0.02).
Yeast Growth Assay Using the DHFR Reporter
The DHFR reporter gene carried by plasmid pTB3 was engineered to make an unstable enzyme [37] and to contain the L22F/F31S mutations that confer resistance to methotrexate (MTX) [58]. The uORFl-uORF2 of TBFl was translationally-fused to the coding region of the DHFR reporter and integrated into the genome of yeast strain BY4742 by homologous recombination. Equal amounts of yeast culture grown in liquid media (SD- Leu) were inoculated into SD-Leu-Phe double drop-out media supplemented with 15 mg/L or 75 mg/L phenylalanine. In other experiments, yeast cultures were also grown in Phe-rich, Asp-deficient media supplemented with 15 mM tobramycin (TOB) (Sigma, St. Louis, Ml, USA), a known inhibitor of yeast tRNA*" aspartylation. MTX was added to all cultures at the final concentration of 80 μΜ to inhibit the endogenous DHFR activity. Yeast growth, which was dependent on the expression of the recombinant DHFR reporter in the presence of MTX, was measured using optical density (OD600nm) over a 32-hour time course.
Genome-Wide Search of the TLl cis-Element
To perform a genome-wide search for the TLl c/s-element, 1000-bp upstream sequences with a cutoff at the adjacent gene were fetched from the Arabidopsis Information Resource website (http://www.arabidopsis.org) and analyzed using the Athena website software (http://www.bioinformatics2.wsu.edu/cgi-bin/Athena/cgi/home.pl). The sequence GAAGAAGAA (SEQ ID NO: 99) was considered as the exact TLl motif. Degeneracy of the TLl element was based on Wang et al. [SI] and shown in Table S2, below. To control the level of degeneracy, the total weight of the hit was restricted to be more than 664. The exact (SEQ ID NO: 99) and degenerate TLl motifs (approximately represented by SEQ ID NO: 100) were searched for using the scan_for_matches software, available at ' (http://iubio.bio.indiana.edu/soft/molbio/pattern/ scan for matches.readme).
Table S2. Weight matrix for degenerate TL1
element used in the genome-wide search for TLl
Yeast One Hybrid Assays
Y1H assays were performed according to a previously-published protocol [S2]. In brief, a 352-bp long fragment of the ΒΊΡ2 promoter (SEQ ID NO: 109) was cloned into the pDONR207 Gateway Entry vector, recombined into pMW2 and pMW3 vectors, and then integrated into the HIS3 and URA3 loci in yeast, respectively. Strain 1 has the WT ΒΊΡ2 promoter driving both HIS3 and URA3 genes, and Strain 2 has the WT ΒΊΡ2 promoter for HIS3 and the mutated BiP2 promoter [SI] for URA3 (Table E2, Figure SI). Both strains were transformed with the construct pDESTAD-TBFl or pDEST-AD, and the resulting yeast colonies were pooled and spotted on selection media (SD -Leu -Trp -Ura) (Clontech) supplemented with increasing concentrations of 3- AT (Sigma). Yeast growth was recorded 3 days later.
Quantitative β-Galactosidase Assay
The assay was modified from protocols described in earlier studies [S3]. In brief, 0.1 ml of yeast transformant extract was added to 0.9 ml of Z buffer and warmed to 28°C. Reactions were initiated by addition of 0.2 ml of ONPG substrate (4 mg/ml) in Z buffer and terminated with 0.5 ml of 1 M Na2C03. Reactions were terminated within the linear range of the assay (OD42onm < 1 0)· The β-galactosidase activity in yeast supernatants was normalized to their protein concentrations. The data represent the average from three dilutions of extracts.
Electrophoretic Mobility Shift Assay
The assay was performed as described in earlier studies [SI]. Briefly, 3-week-old plants were treated with 1 mM SA for 4 hrs before leaf tissues were harvested. 40,000 cpm of labeled probe was added to 10 μg of protein, incubated in a buffer containing 12 mM HEPES pH 8.0, 60 mM KCI, 2 mM MgCI2, 0.1 mM EDTA, 12%
glycerol, and 0.3 mM DTT for 20 min, and separated on a 5% polyacrylamide gel. DNA-protein interactions were detected using autoradiography.
Chromatin Immunoprecipitation (ChIP)
ChIP assays were performed as described in earlier studies [S4]. For each sample, 1 g of leaves from 3-week-old Arabidopsis plants was crosslinked with 1% formaldehyde under vacuum for 15 min, followed by addition of glycine to a final concentration of 0.1 M. The leaves were washed with water and then ground in liquid nitrogen. Arabidopsis nuclei were isolated and sonicated in Bioruptor* sonicator (Diagenode). The TBFl-GFP-tagged protein was immunoprecipitated using 1 μΙ of an anti-GFP antibody ab-290 (Abeam) that was first coupled to the protein G Dynabeads (Invitrogen). The purified ChIP DNA samples were subject to real- time PC analysis. The amount of each amplicon was normalized to the input. The relative amount (fold- enrichment) of each signal was determined by the ratio of normalized ChIP signals between samples. The primer sequences used for ChIP analysis are listed in Table S3.
qRT-PCR
Total RNA was extracted from 3-week-old plants with and without 1 mM SA treatment at different time points. RNA extractions were performed using TRIzol Reagent (Ambion). RNA samples were reverse- transcribed into cDNA using Superscript III Reverse Transcriptase (Invitrogen). The cDNA was quantified using gene specific primers (Table S3, above) and the POWER SYBR GREEN PCR Master Mix (Applied Biosystems) in a LightCycler (Roche) or RealPlex S (Eppendorf).
Microarray
Arabidopsis plants (Columbia-0 and tbfl mutant) were grown on soil (Metro Mix 360) at 22°C under a
16/8 hr light/dark cycle for 3 weeks and treated with 1 mM SA for 6 hrs (spray) or 10 μΜ elfl8 for 2 hrs (infiltration into leaves). Mock treatments with water were included for both spray and infiltration. The RNA, extracted with TRIzol (Ambion) and labeled with MessageAmp Premier RNA Amplification Kit (Ambion), was hybridized with GeneChip Arabidopsis ATHlGenome Array (Affymetrix), and subsequently washed and scanned at the Duke Microarray Facility. Experiments were repeated three times using independently-grown and treated plants. The resulting data were normalized using Gene-Spring GX Software (RMA algorithm; Agilent). Two-way ANOVA with the Benjamini-Hochberg multiple comparison correction was used to identify TBFl-dependent genes (i.e., with significant interaction between genotypes and treatments, p-value < 0.05). The SA- and elfl8-responsive genes (fold change > 2) were found through unpaired Student's t test with the Benjamini-Hochberg multiple comparison correction (p-value < 0.05). The Venn diagram was adapted from
Venny [5]. To generate the heatmaps of SA- or elfl8-upregulated and down-regulated genes, -loglOp-values of induced genes and loglOp-values of repressed genes from Student's r test were used. Higher positive values represent greater induction, and lower negative values indicate greater repression. For TBF1 dependence, -loglOp-values from two-way ANOVA tests were used. The gene ontology analysis was performed using the Database for Annotation, Visualization and Integrated Discovery (DAVID) (available at http://david.abcc.ncifcrf.gov/).
Tunicamycin Sensitivity Assay
This assay was performed as described in earlier studies [SI].
Genetic Complementation oftbfl
To perform genetic complementation of tbfl, the 4,601-bp genomic DNA containing the TBF1 promoter and the coding region (SEQ ID NO: 107) was amplified using primers TBFl-promoter-GW-F (SEQ ID NO: 84) and TBFl-cDNA-GW-R (SEQ ID NO: 82) (Table S3), cloned into the vector pDONR207 using the Gateway technology (Invitrogen), and inserted by recombination into the destination vector pMDC123 [6]. The resulting destination clone pMDC123 TBFlp:TBFl, was transformed into Agrobacterium tumefaciens strain GV3101. Constructs were introduced into tbfl mutant plants by the floral dipping method [S7]. T3 transgenic plants homozygous for the transgene were further analyzed. The genomic TBF1 to GFP fusion was also generated by recombining pENTR207 TBFlp:TBFl into the destination vector pMDC107 [S6]. The resulting destination clone pMDC107 TBFlp:TBFl-GFP, was transformed into Agrobacterium tumefaciens strain GV3101 and introduced into tbfl mutant plants. A homozygous T3 line was selected for additional analysis.
Bacterial Infection Assay
Infection of Arabidopsis plants with Pseudomonas syringae pv. maculicola (Psm) ES4326 was performed as described previously [S8]. To test for enhanced disease susceptibility, a bacterial suspension at ODeoonm = 0.0001 was infiltrated into 2-3 leaves per plant and 12 plants/genotype. Bacterial growth was quantified 3 days later. To test for SAR and MAMP-induced resistance, plants were pre-treated with relevant compounds (1 n M SA, spray 24 hrs prior to infection; 10 μΜ elfl8, infiltration 2 hrs prior to infection; 10 μΜ flg22, infiltration 2 hrs prior to infection), and subsequently inoculated with Psm ES4326 (OD60o„m = 0.001) into 2-3 leaves per plant and 12 plants/genotype/treatment. Sampling was performed 3 days post inoculation.
PR1 Protein Secretion
Three-week-old plants were treated with 1 mM SA for 24 hrs before infiltration under vacuum in a 20 mM phosphate buffer (KH2PO4 and K2HP0 , pH = 7.4). Intercellular wash fluid was collected from equal amounts of tissue by centrifuging the infiltrated leaf samples, which were packed in a syringe, for 5 min at 1500 g. As a control, total protein was also extracted from 50 mg of leaf tissue (from 3-4 independent plants) using a buffer described previously [SI]. Secreted and total protein were run on 15% SDS-PAGE gels, transferred to a nitrocellulose membrane, and probed with a polyclonal rabbit antibody raised against a synthetic peptide matching the carboxy terminus of the Arabidopsis PR1 protein (1:4000 dilution, 2 hrs) followed by a goat anti-rabbit secondary antibody (Santa Cruz Biotechnology) (1:2000 dilution, 1.5 hrs). To confirm equal loading of total protein, an anti-a-tubulin antibody (Sigma) was used subsequently to probe the total protein concentration on the blot.
Western blotting
The anti-BiP Western blotting experiment was performed as described previously [SI], using leaf tissue sprayed with ImM SA 6 hrs prior to collection. The primary antibody was oc-BiP (Santa Cruz Biotechnology, aC-19, 1:4000 dilution, overnight at 4°C), followed by the secondary antibody (bovine anti- goat, Santa Cruz Biotechnology, 1:2000 dilution, 2 hrs, RT). The anti-phospho elF2a Western blotting experiment was performed as described previously [S9], using leaf tissue infected with Psm ES4326 expressing avrRpt2 (ODaxjnm = 0.02) over the indicated time periods. The protein extraction was carried out in presence of a phosphatase inhibitor PhosSTOP (Roche), Protease Inhibitor Cocktail (Sigma Aldrich) and proteasome inhibitor G-115 (Sigma Aldrich). The primary antibody was a-p-elF2ct (pS51) (Epitomics, Burlingame, CA, 1090-1), (1:1000 dilution, overnight at 4°C), followed by the secondary antibody (goat anti-rabbit, Bio-Rad, 1:4000 dilution, 1 hr, RT).
Rapid Amplification ofcDNA Ends (RACE)-PCR
RACE-PCR analyses were performed as described in manufacturer's protocol (SMART™ RACE cDNA Amplification Kit, Clontech, Mountain View, CA, USA).
tRNA Analysis
Total RNA was extracted using TRIzol reagent (Invitrogen) according to the instructions provided by the manufacturer. Total RNA was then dissolved in 0.1 M sodium acetate (pH 5.0). mRNA was precipitated using 2 M LiCI overnight. 2 volumes of isopropanol were added to the supernatant to precipitate the tRNA.
After washing with 100% ethanol, the t NA was dissolved in 0.1 M sodium acetate. 1μ§ tRNA was separated by acid urea PAGE, and transferred to NEF 976 GeneScreen Plus Hybridization Transfer Membrane (PerkinElmer) according to procedures established in earlier studies [SIO].
Specific tRNA species were detected by hybridization using digoxigenin-labeled ONA probes (shown in Table S3 as tRNAphe represented by SEQ ID NO: 97, and tRNA*5" represented by SEQ ID NO: 98) according to the manufacturer's instructions (DIG High Prime DNA Labeling and Detection Starter Kit II, Roche Applied Science). The signal was visualized using a low-light CCD camera.
Polysome profiling
Before extraction, a spike-in control was added into the pulverized leaf tissue at a concentration of 107 copies of Alien qRT-PCR Inhibitor Alert (Agilent Technologies, USA) per mg of fresh weight. 500 mg of pulverized leaf tissue was hydrated on ice for 10 min with occasional vortexing in 3 ml of extraction buffer, containing 0.2 M Tris (pH=9.0), 0.2 M KCI, 0.025 M EGTA, 0.035 M MgCI2, 1% (w/v) Brij-35, 1% (v/v) Triton X- 100, 1% (v/v) Igepal CA 630, 1% (v/v) Tween 20, 1% (w/v) sodium deoxycholate, 1% (v/v) polyoxyethylene 10 tridecyl ether, 5 mM dithiothreitol, ImM phenylmethylsulfonyl fluoride, 50 g/mL cycloheximide, 50 ug/mL chloramphenicol. The hydrated tissue was centrifuged at 16,000 g for 15 min. The supernatant was then separated in a 10 ml continuous (15-60% w/v) sucrose gradient containing 400 mM potassium acetate, 25 mM potassium HEPES (pH=7.2), 15 mM magnesium acetate, 200 μΜ cycloheximide by ultracentrifugation at 35,000 rpm using SW 41Ti rotor (Beckman Coulter, Germany) for 10 hrs at 4°C. The gradients were fractionated into 36 fractions of about 330 μί each using automated Density Gradient Fractionation System (Teledyne Isco Inc., USA) with a simultaneous A trace. Total RNA was extracted from the fractions containing ribosomes using TRIzol reagent (Invitrogen) according to instructions provided by the manufacturer. mRNA was further precipitated using 2 M LiCI overnight. cDNA was prepared and qRT-PCR analyses performed as described above.
Statistical Analyses
For gene expression data, expression values were used for linear models. Effects of genotype, treatment, time, biological replicate and interactions between genotype and time, and genotype and treatment were included in the linear model where appropriate. For bacterial infection data, logarithmic transformed colony forming units (cfu) were used for linear models. Effects of genotype, treatment, time, biological replicate and interactions between genotype and time, and genotype and treatment were included in the linear model where appropriate. Bonferroni post-tests were applied to address the significant
difference at individual time points between WT and mutant samples. All statistical analyses were performed using R software programs (CRAN).
Table SI summarizes the complete list of TBFl-dependent SA- and elfl8-regulated genes which are set forth supplementary data tables extracted from eight worksheets in an Excel file, herein specifically incorporated by reference, as noted above in the section entitled "Incorporation-By-Reference In International Application Under Rule 20.6 to Supplemental Tables of Information Included In An Earlier Priority Application".
Table SI - Tables S1A-S1H. incorporated by reference, listing TBFl-dependent SA- and elfl8-regulated genes
Excel
Table # Description SA elfl8 # Data Rows Sheet #
S1A 1 SA induced only + 528
SIB 2 SA repressed only - 534
SIC 3 elfl8 induced only + 477
SID 4 elf 18 repressed only - 1098
S1E 5 SA and elfl8 induced + + 37
S1F 6 SA and elf 18 repressed - - 110
S1G 7 SA induced elfl8 repressed + - 60
S1H 8 SA repressed elfl8 induced - + 22
EXAMPLE 1
RESULTS
TBF1 Is a TF that Binds to the TL1 cis-Element Enriched in Defense-Related Gene Promoters
The TL1 cis-element (consensus sequence GAAGAAGAA) in the ER-resident genes is essential for their activation in response to SA induction [3]. To determine whether this cis element is important only for the ER- resident genes or also for induction of other defense-related functions, we examined the promoter regions (1000 bp upstream of the ATG start codon) of genes regulated by the SA analog BTH (benzothiadiazole) (available at http://affv.arabidopsis.info/narravs/experimentbrowse.pl. experiment ID:NASCARRAYS-392) [11] and by the MAMP signals flg22 and elf26 (the first 26 amino acids of EF-Tu) ' (available at http://www.ebi.ac.uk/arrayexpress/. experiment ID: E-MEXP-547) [12] using the Athena program (http://www.bioinformatics2.wsu.edu/Athena). We found that the TL1 cis-element is enriched in the promoter regions of genes regulated by elf26 (p-value < 0.001) and flg22 (p-value < 0.01), indicating that this novel element may play a role in MTI. No significant enrichment of TL1 was detected when all of the BTH- affected promoters were analyzed, even though the element was first discovered in the SA-induced, NPR1- dependent ER-resident genes [3].
To search for the TF that regulates the TL1 cis-element (i.e., TBF1), we submitted the TL1 core sequence GAAGAAGAA to the TFSEARCH database (http://www.cbrc.jp/research/db/TFSEARCH.html) and found several HSFs of Saccharomyces cerevisiae and Drosophila melanogaster as potential candidates. The Arabidopsis genome contains 21 HSF-like genes. Several reports have indicated the involvement of the HSFs in immediate heat response, acquired thermotolerance, sensing of reactive oxygen species (ROS), and seed development [13, 14]. To identify a candidate gene for TBF1, we first examined the expression profiles of the Arabidopsis HSF family members using available microarray data in response to BTH induction (http://affy.arabidopsis.info/narrays/experimentbrowse.pl, experiment ID: NASCARRAYS-392) [11] and to the virulent and avirulent Pseudomonas syringae pv. maculicola (Psm) ES4326 bacteria (http://affy.arabidopsis.info/narrays/experimentbrowse.pl, experiment ID: NASCARRAYS-168). Only one gene family member, HSF4 (also known as HsfBl; AT4G36990), was strongly induced by these treatments. Because Arabidopsis HSF4 and its tomato homolog do not functionally complement the yeast hsfl mutant strain [15] (Daniel Neef and Dennis Thiele, personal communication), and its overexpression has little effect on heat shock protein expression or thermotolerance [16, 17], we thought that HSF4 does not encode a typical heat
shock factor. Its pathogen-inducible expression pattern suggests that it has a novel function related to plant immunity, and is a candidate for TBF1.
We carried out additional studies to demonstrate that HSF4 is the TLl c/s-element TBF1 involving a yeast one-hybrid (Y1H) vector system, in which the promoter fragment of ΒΊΡ2, containing multiple functional TLl c/s-elements, was used as bait [3]. Two yeast bait strains containing the WT and the mutant {mTLl) BiP2 promoters, respectively, were constructed (Figure SI). Expression of TBF1-AD (containing the activation domain) in Strain 1, activated both HIS3 and LacZ reporters driven by the WT ΒΊΡ2 promoter (Figures 1A and IB). The binding specificity of TBF1 to TLl was confirmed in Strain 2, where the two single-nucleotide substitutions in the mTLl core binding sequence blocked the induction of LacZ, while the control HIS3 reporter with the WT TLl was induced normally (Figure IB).
TBF1 binding to the TLl c s-element was further demonstrated using electrophoretic mobility shift assays with protein extracts from both WT and an insertional knock-out TBF1 mutant, tbfl (Figure S2). As shown in Figure 1C, WT displayed an up-shifted band, whose intensity was further enhanced in the extract made from plants treated with SA. This band was diminished in the tbfl mutant extract, indicating that TBF1 is required for the DNA-protein complex formation. Competition assays, using non-radioactive TLl and mutant mTLl probes, indicated that the observed TBF1 binding was specific to the TLl consensus sequence.
To test TBF1 DNA-binding activity in vivo, we generated transgenic tbfl plants expressing a translational fusion between TBF1 and GFP driven by the endogenous TBF1 promoter ( TBF1 p: TBF1 -GFP). Because the fusion protein was proven to be biologically-active through genetic complementation of the tbfl mutant phenotype (Figure S3), we used it for chromatin immunoprecipitation (ChIP). As shown in Figure ID, using six pairs of primers spanning different regions of the ΒΊΡ2 promoter (SEQ ID NOS: 1-12), we detected sequence enrichment corresponding to the TZJ-containing region 2 in both uninduced and SA-treated samples, region 3 in the SA-treated sample, and region 4 in the uninduced sample. No enrichment was found in regions 1, 5 and 6 that do not contain the TLl element.
TBF1 Is a Major Molecular Switch Involved in Transcriptional Preprogramming Induced by SA and elfl8.
In earlier studies, we showed that the TLl cis-element is present in many E -resident genes [3]. In this study, we tested if SA-mediated induction of these genes is dependent on TBFl. We found that the induction of ΒΊΡ2 and CRT3, containing multiple copies of TLl elements in their promoters, was compromised in the tbfl mutant and in nprl-1 (Figure 2A). BiP2 protein accumulation was not induced in the SA-treated tbfl mutant plants (Figure 54). In contrast to ΒΊΡ2 and CRT3, induction of two other ER-resident genes, BiP3
and CRT1, which do not have Til in their promoters, was not affected in tbfl (Figure 2B), confirming the specificity of TBF1 to 712.
Enrichment of the T l c/s-element in immune-induced ER-resident gene promoters, as well as promoters responsive to diverse immune signals [3, 18, 19], prompted us to perform a genome-wide transcriptional profiling experiment to determine the global effect of TBF1. WT and tbfl plants challenged with SA for 6 hours or elfl8 for 2 hours, were used to generate probes for the Affymetrix ATH1 GeneChip (Affymetrix, Santa Clara, CA). We noted that 1269 and 1792 TBFl-dependent genes were differentially- regulated by SA and elfl8, respectively (fold change > 2, p-values < 0.05), but only a small number of genes (~8%) were regulated by both signals (Figure 2C, Table SI), indicating that TBF1 controls distinct output genes in SAR and MTI. The total numbers of significantly-induced and repressed genes (the top heatmaps in Figures 2D and 2E), the degrees of TBF1 dependency (the middle heatmaps), and the numbers of TL1 c/s-elements present in the gene promoters (the bottom heatmaps) indicate that TBF1 plays a greater role in SA- and elfl8- mediated transcription repression, than in induction. These results are in agreement with earlier studies indicating that class B-Hsfs mainly act as repressors of target gene expression [20, 21].
To identify the biological functions induced and repressed by TBF1, we performed gene ontology (GO) analyses and selected functional categories that were significant at p≤ 0.001. We identified a significantly- enriched cluster of SA-induced secretory pathway genes (Figure 2D "membrane proteins". Table SI), which were in agreement with our earlier findings [3]. We also identified several major functional categories comprising genes known to encode defense-related proteins (Figures 2D and 2E), such as the master regulator of SA pathway NPR1, a TGA-class TF, several WRKY family members, EDS5, ADR1, metacaspase 2, membrane- associated proteins like SNAP33 and members of the MLO family, and several kinases including RLKs, MAPKKs and WAKs (Table SI) [22]. These genes appear to be directly controlled by TBF1, since their regulatory regions contain the 111 element (Table SI). A strong enrichment of ribosomal proteins was also noted among the elfl8-induced TBFl-dependent genes, suggesting that significant translation events occur after AMP induction.
Upon SA treatment, TBF1 down-regulates genes encoding chloroplast proteins (Figure 2D), an effect that is known to be associated with SA [23]. Chloroplast function-related genes were even more profoundly repressed by elfl8 (Figure 2E). These genes encode several structural and regulatory proteins of the chloroplast (e.g., PsbR subunit of photosystem II, chloroplast o-succinylbenzoyl-CoA ligase, plastid ribosomal protein, a subunit of the chloroplast NAD(P)H dehydrogenase complex and components involved in thylakoid membrane biogenesis) (Table SI). Loss-of-f unction mutants involving these genes display a variety of
developmental defects, such as decreased photosynthesis rate, reduced chloroplast number, pale pigmentation, dwarfism and lethality [24]. These metabolic and chloroplast-related genes are likely direct targets of TBFl, since their regulatory regions contain the TL1 element. Taken together, these results suggest that TBFl is used in plants to rapidly reprogram cellular transcription after an infection, diverting energy resources from growth and development functions to cope with pathogenic responses.
The GO analyses indicated that elfl8 treatment had a significant inhibitory effect on both abiotic stress and defense responses through TBFl, which was unexpected (Figure 2E). These repressed genes are involved in jasmonate (JA), ethylene and auxin biosynthesis or signaling pathways (e.g., lipoxygenases, JAZ2, WRKY33, CEVl, and SAUR and IAA families) (Table SI), which are known to be down-regulated during SA- mediated defense [25-27].
The expression changes observed in the microarray experiment were also confirmed through qRT- PCR experiments of independent biological samples on 26 selected genes representing several GO categories, which are illustrated in Figures 2D, 2E, and Figure S5.
TBFl Plays a Key Role in the Growth-to-Defense Transition
To determine if TBFl is a major molecular switch involved in the transition from growth to defense functions, we first measured the growth of both WT and the tbfl mutant plants. As shown in Figure 3A, in the absence of SA or elfl8, the tbfl mutant grew at a similar rate as the WT plant. In the presence of elfl8 or increasing concentrations of SA, however, growth of the WT plants was significantly inhibited. The inhibitory effect was partially-alleviated in the tbfl mutant. In contrast, another MAMP signal, flg22, exerted a similar growth-suppressing effect on WT and tbfl seedlings (Figure S6).
We also performed a series of tests to determine the stress responses mediated by TBFl. Although the tbfl mutant has been shown to have a normal heat-induced marker gene expression profile (Figure S7), and plays no detectable role in the heat shock response [28], its defect in the induction of multiple chaperone genes prompted us to examine the unfolded protein response (UPR). In mutant plants treated with the UPR inducer tunicamycin, seedling survival rate for tbfl was only ~ 20% compared to ~ 60% for WT (Figure 3B), indicating that TBFl plays a role in UPR. In earlier studies, SA-inducible ER-resident genes are required for efficient secretion of antimicrobial PR proteins [3]. Because TBFl was shown to control SA-mediated induction of these genes (Figures 2A and 2D, Table SI), we tested the secretion of PRl in the tbfl plants. While the PRl transcript induction and total PRl protein levels were unchanged in tbfl (Figure 3C and Figure S8), secreted PRl in the intercellular wash fluid was dramatically reduced in the tbfl mutant, compared to the WT sample.
This phenotype was complemented in the transgenic line carrying a genomic fragment comprising upstream regulatory sequences (3,554 bp) (SEQ ID NO: 113) and the coding region (1,047 bp) of TBF1 (TBF1 Compl.) (SEQ ID NO: 114). The bip2 dadl double mutant, which was previously shown to be defective in PR1 secretion [3], was used as a control. The defect in secretion of antimicrobial proteins in the tbfl mutant correlated with the 1 log higher growth of the bacterial pathogen, Psm ES4326, compared to WT and the complementation lines (Figure 3D). In response to induction by SA, less than 1 log reduction in Psm ES4326 growth was observed in the tbfl mutant, compared to the ~2 log reduction detected in WT plants (Figure 3E). SA- inducible defenses were restored in the TBF1 complementation line, while the nprl-1 line was completely deficient in establishing resistance.
We also examined elfl8-triggered immunity in the tbfl mutant, because expression profiling data demonstrated that TBF1 was responsible for significant genome-wide transcriptional changes induced by elfl8 (Figure 2C). Leaves were infiltrated with elfl8 or another MAMP signal, flg22, and infected with Psm ES43264 hours later. WT pre-treated with the MAMP signals showed a 1-log reduction in Psm ES4326 growth, compared to mock-treated samples (Figure 3F and Figure S9). The tbfl mutant, however, completely failed to establish the resistance induced by elfl8. This defect was specific to elfl8, as flg22-induced resistance was intact in the tbfl mutant, resembling the trend observed for the growth inhibition phenotype (Figure 3A and Figure S9). Since earlier studies demonstrated that flg22 and elfl8 induce largely overlapping sets of genes [12], different levels of responsiveness to elfl8 and flg22 in tbfl were unexpected. Our current results are consistent with the genetic data showing that the recognition of elfl8, but not flg22, specifically requires the ERQC mechanism [6, 7, 29, 30], and with observations demonstrating that TBF1 controls the induction of these ERQC genes (Figure 2A). The molecular mechanism underlying the TBFl-requirement has not been determined. TBF1 may affect the biogenesis of EFR, downstream signaling functions, or elfl8-triggered secretion of antimicrobial compounds.
A near normal response to elfl8 was also observed in the SA-insensitive nprl-1 mutant in the Psm ES4326 infection experiment (Figure 3F). Although there was an overall increase in Psm ES4326 growth in nprl-1, elf 18 could still induce a 1-log reduction in pathogen growth, which was similar to that observed in the WT sample. These results are in agreement with expression profiling data demonstrating that elfl8 and SA induce distinct sets of genes (Figure 2C). Recent studies have also demonstrated that MTI induced by flg22 and elfl8, is largely intact in a sid2 mutant, which is deficient in SA synthesis [31]. MTI and SAR, therefore, are two temporally and spatially separate immune responses. MTI occurs locally and immediately upon challenge by a pathogen, while SAR is a systemic response induced after the local response.
Translation of TBFl Is Controlled by uORFs Sensitive to Cellular Metabolic Changes
The genome-wide expression profiling data and the genetic data in the Examples set forth herein demonstrate that TBFl is a major molecular switch, that upon challenge by a pathogen, turns on multiple defense responses and inhibits primary growth and development (Figures 2 and 3). To understand how TBFl is regulated, we analyzed its expression patterns upon treatment with SA, detecting maximum levels of transcript at 4 hours (Figure 4A). The SA-dependent induction was abolished in the nprl-1 mutant, demonstrating that NPR1 is required for SA-mediated TBFl transcription. TBFl also plays a role in regulating NPR1, as the NPR1 transcript levels were diminished in tbfl (Figure 4B), suggesting that a feedback mechanism exists involving these two key immune system regulatory factors.
Analysis of the TBFl mRNA through the 5' and 3' rapid amplification of cDNA ends (RACE) experiments demonstrated that the transcript which encodes TBFl, also comprises two upstream open reading frames (uORFs) (SEQ ID NOS: 108 and 109) (Figure 4C). The second of these, uORF2 (also known as conserved peptide upstream open reading frame 49, CPUORF49, Arabidopsis gene model AT4G36988) (SEQ ID NO: 103) is well-conserved among TBFl homologs in other plant species [32]. Translation in eukaryotes normally starts at the first 5' AUG codon. The presence of two uORFs upstream from (5' to) the TBFl start codon, suggests that they may influence the initiation of translation of TBFl. To test this, we made a vector comprising a translational fusion between the 5' UTR of TBFl containing both uORFs, the first exon of TBFl, and the GUS reporter gene (abbreviated as uORFl-uORF2-GUS). We also constructed three other vectors which have the start codon mutated (from ATG to CTG) for uORFl (uorfl- uORF2-GUS), uORF2 (uORFl-uorf2- GUS), and both uORFs [uorfl-uorf2-GUS). To ensure equal levels of transcription in these vectors, we used the constitutive 35S promoter to drive the expression of these reporter genes. The vectors were used in transient-expression experiments carried out in Nicotiana benthamiana leaves, measuring the GUS activity in each sample (Figure 4D). Using activity of the WT construct as a control, we detected 1.5- and 3.5-fold increases in the GUS activities in uorfl-uORF2- GUS and uORFl-uorf2-GUS samples, respectively. Mutating both uORFs in uorfl-uorf2-GUS resulted in a 3.5-fold elevation in GUS activity over WT, which was similar to the result observed for the uorf2 mutant. These results suggest that both uORFs can function to inhibit TBFl translation, with uORF2 likely to play a more important role than uORFl in this matter.
To better understand the regulatory mechanisms involved in TBFl translation during plant defense events, we measured the GUS activities of the translational fusion vectors in stable transgenic Arabidopsis lines when challenged by Psm ES4326 carrying the avirulent effector, avrRpt2. We found that introduction and recognition of this avirulent bacterial strain, which can induce MTI, ETI, and SAR in plants, caused a rapid
increase in the activity of GUS translated from the TBFl start codon downstream of the uORFs (Figure 4E). This increase was not observed in the uorfl- uorf2-GUS transgenic lines. These results suggest that the Psm ES4326/avrRpt2 challenge could rapidly alleviate the inhibitory effect of the uORFs on translation of the downstream gene.
To determine whether the endogenous TBFl was translated in the plant cell upon pathogen challenge, we conducted a polysome profiling experiment shown in Figure 4F. There was a significant increase in TBFl transcript 30 minutes after Psm ES4326/avrRpt2 inoculation in the polysomal fractions of the gradient. This rapid association with polysome samples correlates well with the GUS reporter activities observed in the transgenic plants, noted above (Figure 4E). The association of TBFl within polysome samples appeared to be transient, as the TBFl transcript decreased at 1 hour post inoculation. This pathogen-induced derepression of TBFl translation occurs earlier than the transcription activation of the TBFl gene (Figure 4A).
Both uORFs are enriched in aromatic amino acids, particularly in phenylalanine (Phe) (uORFl - 27%, and uORF2 - 19%), as compared to the average frequency of aromatic amino acids reported for species sequenced so far (7.63-7.86%) ([33]; ExPASy proteomics server http://expasy.org sprot/relnotes/relstat.html). The enrichment in Phe is evolutionarily-conserved for uORF2 among the TBFl homologs in other plant species [32]. This suggests that translation of the two uORFs and the downstream TBFl may be influenced by the cellular availability of Phe for translation, caused by the pathogen challenge. Amino acid starvation has previously been shown to de-repress uORF-mediated translation inhibition on the yeast General Control Nondepressible 4 (GCN4) and the mammalian Activating Transcription Factor 4 (ATF4) genes [34, 35].
To determine if pathogenic infections can trigger changes in amino acid concentrations, we carried out the studies involving the measurement of amino acids in a large number of biological replicates. We could occasionally detect a rapid decrease in the level of Phe that occurred 15 to 45 minutes after Psm ES4326/avrRpt2 inoculation, followed by an increase in the level of Phe that was observed consistently (data not shown). These results suggest that Phe concentrations may change dramatically during early time points after infection, and that it is difficult to measure transient metabolic changes following pathogen challenge using methods that are currently available.
To improve our method of examining whether Phe levels affect the TBFl translation rate, we used a yeast-based reporter system. Since a Phe-def icient Arabidopsis mutant that has not been identified to date, a yeast chorismate mutase deletion strain, aro7, which is auxotrophic for Phe and tyrosine (Tyr) [36]. A reporter vector was generated by fusing uORFl-uORF2- TBFllst exon to the coding region of the mouse DHFR
(dihydrofolate reductase), which has been engineered to be less stable [37] and resistant to methotrexate (MTX) [38]. DHFR is an enzyme that regulates levels of tetrahydrofolate essential for growth. In the presence of 80 μΜ of MTX that abolishes the endogenous DHFR enzymatic activity, yeast growth becomes dependent on the recombinant DHFR reporter expression. Since both uORFl-uORF2-TBFlla emn-DHFR (abbreviated as uORFl-uORF2-DHFR), and the DHFR control, are driven by the endogenous yeast DHFR promoter, growth of these yeast strains reflect the translational rate of DHFR. We cultured the aro7 strain containing either uORFl-uORF2-DHFR or DHFR in presence of MTX. As shown in Figure 5A, under the Phe-rich conditions (75 mg/L; standard Phe concentration in synthetic yeast growth media), the yeast strain carrying the DHFR displayed a much higher growth rate than the strain carrying the uORFl-uORF2-DHFR, showing the inhibitory effects of the uORFs on DHFR translation. Both strains grew at similar rates under Phe-restricting conditions (15 mg/L), suggesting that low Phe level released the inhibitory effects of uORFs on DHFR translation (Figure 5A). To ensure that the TBFllst exon-DHFR fusion protein was not toxic to yeast cells, we grew the strains in the absence of MTX and observed no significant difference in their growth rates (Figure S10). The uORFs of TBFl appear to be specifically sensitive to Phe starvation, because aspartic acid starvation caused by addition of 15 mM tobramycin (TOB), a known inhibitor of yeast tRNA*5" aspartylation [39], did not eliminate the difference in the growth rate between the strain carrying uORFl-uORF2-DHFR, and the strain carrying DHFR.
To understand the molecular mechanism by which uORFs control TBFl translation, we carried out additional experiments. In yeast, amino acid starvation leads to accumulation of uncharged tRNAs, which in turn bind to the HisRS domain of the GCN2 serine/threonine protein kinase, activating it, and causing structural rearrangements within the GCN2 dimer [40, 41]. The activated GCN2 undergoes autophosphorylation, and activating its kinase function involved in phosphorylation of its sole target, eukaryotic initiation factor 2a (elF2a) [42]. The phosphorylated elF2ct allows initiation of translation, such as GCN4, downstream of uORFs [35]. To determine whether a similar mechanism controls the translation of TBFl after pathogen infection in plants, we first performed Northern blot analyses to measure the levels of charged and uncharged tRNA after inoculation with Psm ES4326/avrRpt2. As shown in Figure 5B, a dramatic increase in both charged and uncharged tRNAphe, was measured, appearing as early as 30 minutes after bacterial inoculation, and persisting for 8 hours, compared to only a moderate increase in the level of charged tRNA*315 level under the same conditions. No uncharged tRNA p was detected. These results are consistent with observations suggesting that pathogen challenges in plants can lead to dramatic changes in Phe metabolism.
We then investigated whether the pathogen-induced accumulation of uncharged tRNAPhe can lead to phosphorylation of elF2a, since a functional and stress-inducible GCN2-elF2a pathway has been found in Arabidopsis [43]. As shown in Figure 5C, in leaf samples infected with Psm ES4326/avrRpt2, a rapid accumulation of the phosphorylated elF2a was detected, supporting observations which suggest that it may facilitate re-attachment of the ribosome to the TBFl translation start codon downstream of uORFs to initiate TBFl translation.
Taken together, these observations strongly suggest that TBFl expression is tightly controlled in the plant cell at not only the transcriptional level by NPR1, but also at the translational level through uORFs. Pathogen challenges, which cause a temporary increase in uncharged tRNAphe accumulation, trigger elF2ot phosphorylation, resulting in de-repression of the translation of TBFl.
DISCUSSION
The presence of TLl in a wide array of defense-related gene promoters suggests that it plays a critical role as a transcription factor (TF) involved in immune responses in plants [3, 18, 19] (Figures 2D and 2E). In these studies, we also demonstrated that the tbfl mutant plants are impaired in UPR, elfl8-induced MT1 and SA-mediated SAR, but not in the heat shock response (Figure 3 and Figure S7). The evolution of transcriptional factors with novel functions may explain the greater expansion of HSF-like genes in plants compared to other organisms (one each in yeast and Drosophila, and three in vertebrates) [44].
Activation of the immune system consumes a significant amount of metabolic activity. Mutant plants with constitutively-activated defense responses often have stunted growth and retarded development [45]. Our studies demonstrate that TBFl is a master molecular switch for this growth-to-defense reprogramming that involves activation and repression of nearly 3,000 genes during SAR and MTI. About 46% of these contain at least one copy of the TLl element in their promoters. TBFl is involved not only in the control of immune response genes, but also the control of genes relating to primary metabolism, growth, and photosynthesis.
Our analysis revealed seven members of the alpha-expansin gene family in the SA-repressed, TBF1- dependent category. Expansins are cell wall-loosening proteins that mediate pH-dependent extensions of the plant cell wall and growth of the cell [46]. Cell hypertrophy (enlargement) is a common virulence strategy used by bacteria to promote pathogenicity [47-49]. A bacterial effector AvrBs3 from Xanthomonas spp. activates a plant bHLH TF gene, UPA20, which in turn induces multiple alpha-expansin genes [47]. Our study reveals that upon SA signal perception, TBFl down-regulates expansin that may inhibit this virulence strategy.
The presence of TL1 elements in alpha-expansin promoter regions, as shown in Table SI, suggests that they are direct transcriptional targets of TBF1.
The pivotal role that TBF1 plays in the growth-to-defense transition underscores the importance for the need to understand how it regulates other cellular functions and how its expression and activity are regulated. The expression of TBF1 is tightly controlled at both transcriptional and translational levels. Transcription of TBF1 and NPR1 appears to be interdependent, as mutations in either gene affect the transcription of the other gene (Figure 2A). TBF1 may directly regulate NPR1 expression through the Til elements in the NPR1 promoter. Since the NPR1 promoter also contains W-boxes [50], TBF1 may regulate NPR1 indirectly through its transcriptional targets, WRKY TFs (Table SI). NPR1 may also regulate TBF1 expression through either TGA or WRKY TFs, as the TBF1 promoter contains five W-boxes and three TGA binding sites, also known as as-1 elements [51].
The two uORFs upstream of TBF1 ORF link translation of TBF1 with the availability of specific amino acids within the cell. About 10% of all eukaryotic mRNAs contain uORFs, and a high percentage of them encode critical cellular regulators, such as protooncogenes, TFs, receptors, and other proteins involved in immune responses [52]. Expression of these genes is highly-regulated, as their protein products are essential for controlled cell growth and proliferation. TBF1 appears to be a key regulator, as transgenic lines overexpressing TBF1 cDNA under the constitutive 35S promoter were not viable (Pajerowska-Mukhtar and Dong, personal observation).
Pathogen challenges, resulting in increases in uncharged tRNAphe and the phosphorylation of elF2a, release the inhibitory effect of uORFs on the translation of TBF1 (Figure 5D). These results appear to be similar to the regulatory mechanisms described for the well-studied yeast GCN4 and mammalian ATF4 gene products (reviewed in [35]). The yeast GCN4 transcript contains four uORFs in its 5' regulatory region [53]. Under normal conditions, ribosomes bind to the 5' cap of GCN4 mRNA and initiate translation at the first uORF. They are unable to reinitiate translation at the start codon of GCN4. During amino-acid starvation, uncharged tRNAs induce phosphorylation of elF2a mediated by GCN2, which hinders reassembly of the 80S ribosome after translation of uORFl. This allows the 40S ribosomal subunit to continue scanning the mRNA and reinitiate translation at the start codon for GCN4 [53].
While derepression of GCN4 translation can be triggered by starvation of any amino acid, the uORF- mediated regulation of TBF1 in plants appears to be controlled by the metabolic levels of specific amino acids, such as Phe. It is note clear, yet, if an infection by a pathogen causes a transient reduction in the levels of Phe.
The rapid increase in the uncharged t NAphe after pathogen challenge coincided with the increase of the total tRNAphe (Figure 5B). These results suggest that infection by a pathogen affects the availability of Phe required for translation, as aromatic amino acids are known precursors for a large array of plant metabolites, including the growth hormone auxin, the SAR signal SA, cell wall components, and pigments such as anthocyanins [4, 54, 55]. In a manner similar to that observed for GCN4, the accumulation of uncharged tRNAphe triggers phosphorylation of elF2a, ribosomal movement through uORFs, and the translation of TBF1. The translational mechanisms involved in the regulation of TBF1 allow the cell to quickly detect pathogen-triggered metabolic changes, and produce sufficient amounts of TBF1 protein to activate cellular and systemic immune responses.
EXAMPLE 2
Recently, the Arabidopsis GCN2 (general control nonrepressed 2; a serine/threonine-protein kinase) protein was shown to directly phosphorylate elF2ct [59]. We previously noted a rapid accumulation of the phosphorylated elF2a in leaf samples infected with Psm ES4326/avrRpt2 (Fig. 5C) that temporally correlated with translational de-repression of the uORFl-uORF2-GUS reporter in planta (Fig. 4E). These results suggested that TBF1 might be controlled by a pathogen-mediated induction of the 6CN2-elF2a pathway. To test whether GCN2 controls TBF1 translation via uORFs, we transformed the uORFl-uORF2-GUS construct into the Arabidopsis gcn2 knock-out mutant and the corresponding Landsberg erecta (Ler) wild-type plants. We also created an additional set of transgenic lines in the Ler background that express a derivative construct in which the start codons for both uORFs {uorfl-uorf2-GUS) were mutated (from ATG to CTG). We quantified GUS activities of these translational fusions in T3 stable transgenic Arabidopsis lines in response to Psm ES4326/avrRpt2. We observed a rapid increase in the GUS activities only in the wild-type Ler plants expressing uORFl-uORF2-GUS (Fig. S12). This increase was not observed in the gcn2 mutant carrying uORFl-uORF2-GDS or wild-type expressing uorfl-uorf2-GUS. These data demonstrate that TBF1 translation is mediated by the GCN2/elF2a pathway upon pathogen infection. Since GCN2 kinase homologs have been found across kingdoms from yeast to animals to plants, the uORF-mediated translation regulatory mechanism discovered for the Arabidopsis TBF1 mRNA is likely to function in a heterologous genetic background.
While the preferred embodiments of the invention have been illustrated and described in detail, it will be appreciated by those skilled in the art that various changes can be made therein without departing from the spirit and scope of the invention. Accordingly, the particular arrangements disclosed are meant to be illustrative only and not limiting as to the scope of the invention, which is to be given the full breadth of the appended claims and any equivalent thereof.
EFERENCES
All references, patents, or applications cited herein are incorporated by reference in their entirety, as if written herein.
1. Nishimura, M.T., and Dangl, J.L (2010). Arabidopsis and the plant immune system. Plant J 61, 1053- 1066.
2. Jones, J.D., and Dangl, J.L (2006). The plant immune system. Nature 444, 323-329.
3. Wang, D., Weaver, N.D., Kesarwani, M., and Dong, X. (2005). Induction of protein secretory pathway is required for systemic acquired resistance. Science 308, 1036-1040.
4. Durrant, W.E., and Dong, X. (2004). Systemic acquired resistance. Annu Rev Phytopathol 42, 185-209.
5. Kwon, C, Bednarek, P., and Schulze-Lefert, P. (2008). Secretory pathways in plant immune responses.
Plant Physiol 147, 1575-1583.
6. Nekrasov, V., Li, J., Batoux, M., Roux, M., Chu, Z.H., Lacombe, S., Rougon, A., Bittel, P., Kiss-Papp, M., Chinchilla, D., et al. (2009). Control of the pattern-recognition receptor EFR by an ER protein complex in plant immunity. EMBOJ 28, 3428-3438.
7. Saijo, Y., Tintor, N., Lu, X., Rauf, P., Pajerowska-Mukhtar, K., Haweker, H., Dong, X., Robatzek, S., and Schulze-Lefert, P. (2009). Receptor quality control in the endoplasmic reticulum for plant innate immunity. EMBOJ 28, 3439-3449.
8. Kinkema, M., Fan, W., and Dong, X. (2000). Nuclear localization of NPRl is required for activation of PR gene expression. Plant Cell 12, 2339-2350. 9. Song, J., Durrant, W.E., Wang, S., Yan, S., Tan, E.H., and Dong, X. (2011). DNA Repair Proteins Are Directly Involved in Regulation of Gene Expression during Plant Immune Response. Cell Host Microbe 9, 115-124.
Zhang, Y., Fan, W., Kinkema, M., Li, X., and Dong, X. (1999). Interaction of NPR1 with basic leucine zipper protein transcription factors that bind sequences required for salicylic acid induction of the PR- 1 gene. Proc Natl Acad Sci USA 96, 6523-6528. Wang, D., Amornsiripanitch, N., and Dong, X. (2006). A genomic approach to identify regulatory nodes in the transcriptional network of systemic acquired resistance in plants. PLoS Pathog 2, el23. Zipfel, C, Kunze, G., Chinchilla, D., Caniard, A., Jones, J.D., Boiler, T., and Felix, G. (2006). Perception of the bacterial PAMP EF-Tu by the receptor EFR restricts ^grobarterium-mediated transformation. Cell 125, 749-760. Kotak, S., Larkindale, J., Lee, U., von oskull-Doring, P., Vierling, E., and Scharf, K.D. (2007). Complexity of the heat stress response in plants. Curr Opin Plant Biol 10, 310-316. Baniwal, S.K., Bharti, K., Chan, K.Y., Fauth, ., Ganguli, A., Kotak, S., Mishra, S.K., Nover, L, Port, M., Scharf, K.D., et al. (2004). Heat stress response in plants: a complex game with chaperones and more than twenty heat stress transcription factors. J Biosci 29, 471-487. Boscheinen, O., Lyck, R., Queitsch, C, Treuter, E., Zimarino, V., and Scharf, K.D. (1997). Heat stress transcription factors from tomato can functionally replace HSF1 in the yeast Saccharomyces cerevisiae. Mol Gen Genet 255, 322-331. Busch, W., Wunderlich, M., and SchoffI, F. (2005). Identification of novel heat shock factor-dependent genes and biochemical pathways in Arabidopsis thaliana. Plant J 41, 1-14. Prandl, R., Hinderhofer, K., Eggers-Schumacher, G., and SchoffI, F. (1998). HSF3, a new heat shock factor from Arabidopsis thaliana, derepresses the heat shock response and confers thermotolerance when overexpressed in transgenic plants. Mol Gen Genet 258, 269-278.
Fabro, G., Di Rienzo, J.A., Voigt, C.A., Savchenko, T., Dehesh, K.( Somerville, S., and Alvarez, M.E. (2008). Genome-wide expression profiling Arabidopsis at the stage of Golovinomyces cichoracearum haustorium formation. Plant Physiol 146, 1421-1439.
19. Humphry, M., Bednarek, P., Kemmerling, B., Koh, S., Stein, M., Gobel, U., Stuber, K.,Pislewska- Bednarek, M., Loraine, A., Schulze-Lefert, P., et al. (2010). A regulon conserved in monocot and dicot plants defines a functional module in antifungal plant immunity. Proc Natl Acad Sci U S A.
20. Czarnecka-Verner, E., Pan, S., Salem, T., and Gurley, W.B. (2004). Plant class B HSFs inhibit transcription and exhibit affinity for TFIIB and TBP. Plant Mol Biol 56, 57-75.
21. Czarnecka-Verner, E., Yuan, C.X., Scharf, K.D., Englich, G., and Gurley, W.B. (2000). Plants contain a novel multi-member class of heat shock factors without transcriptional activator potential. Plant Mol Biol 43, 459-471.
22. Panstruga, R., Parker, J.E., and Schulze-Lefert, P. (2009). Snapshot: Plant immune response pathways.
Cell 136, 978 e971-973.
23. Sugano, S., Jiang, C.J., Miyazawa, S., Masumoto, C, Yazawa, K., Hayashi, N., Shimono, M., Nakayama, A., Miyao, M., and Takatsuji, H. (2010). Role of OsNPRl in rice defense program as revealed by genome-wide expression analysis. Plant Mol Biol 74, 549-562.
24. Leister, D., and Schneider, A. (2003). From genes to photosynthesis in Arabidopsis thaliana. Int Rev Cytol 228, 31-83.
25. Wang, D., Pajerowska-Mukhtar, K., Culler, A.H., and Dong, X. (2007). Salicylic Acid Inhibits Pathogen Growth in Plants through Repression of the Auxin Signaling Pathway. Curr Biol 17, 1784-1790.
26. Gfeller, A., Liechti, R., and Farmer, E.E. (2010). Arabidopsis jasmonate signaling pathway. Sci Signal 3, cm4. 27. Zheng, Z., Qamar, S.A., Chen, Z., and Mengiste, T. (2006). Arabidopsis WRKY33 transcription factor is required for resistance to necrotrophic fungal pathogens. Plant J 48, 592-605.
28. Kumar, M., Busch, W., Birke, H., Kemmerling, B., Nurnberger, T., and SchoffI, F. (2009). Heat shock factors HsfBl and HsfB2b are involved in the regulation of Pdfl.2 expression and pathogen resistance in Arabidopsis. Mol Plant 2, 152-165.
29. Li, J., Zhao-Hui, C, Batoux, M., Nekrasov, V., Roux, M., Chinchilla, D., Zipfel, C, and Jones, J.D. (2009). Specific ER quality control components required for biogenesis of the plant innate immune receptor EFR. Proc Natl Acad Sci USA 106, 15973-15978.
30. Lu, X., Tintor, N., Mentzel, T., Kombrink, E., Boiler, T., Robatzek, S., Schulze-Lefert, P., and Saijo, Y.
(2009). Uncoupling of sustained MAMP receptor signaling from early outputs in an Arabidopsis endoplasmic reticulum glucosidase II allele. Proc Natl Acad Sci U S A 106, 22522-22527.
31. Tsuda, K., Sato, M., Stoddard, T., Glazebrook, J., and Katagiri, F. (2009). Network properties of robust immunity in plants. PLoS Genet 5, el000772.
32. Hayden, C.A., and Jorgensen, R.A. (2007). Identification of novel conserved peptide uORF homology groups in Arabidopsis and rice reveals ancient eukaryotic origin of select groups and preferential association with transcription factor-encoding genes. BMC Biol 5, 32.
33. Brooks, D.J., Fresco, J.R., Lesk, A.M., and Singh, M. (2002). Evolution of amino acid frequencies in proteins over deep time: inferred order of introduction of amino acids into the genetic code. Mol Biol Evol 19, 1645-1655. 34. Harding, H.P., Novoa, I., Zhang, Y.; Zeng, H., Wek, R., Schapira, M., and Ron, D. (2000). Regulated translation initiation controls stress-induced gene expression in mammalian cells. Mol Cell 6, 1099- 1108.
35. Hinnebusch, A.G. (2005). Translational regulation of GCN4 and the general amino acid control of yeast. Annu Rev Microbiol 59, 407-450. 36. Ball, S.G., Wickner, R.B., Cottarel, G., Schaus, M., and Tirtiaux, C. (1986). Molecular cloning and characterization of AR07-OSM2, a single yeast gene necessary for chorismate mutase activity and growth in hypertonic medium. Mol Gen Genet 205, 326-330.
37. Tucker, C.L, and Fields, S. (2001). A yeast sensor of ligand binding. Nat Biotechnol 19, 1042-1046.
38. Ercikan-Abali, E.A., Waltham, M.C., Dicker, A.P., Schweitzer, B.I., Gritsman, H., Banerjee, D., and Bertino, J.R. (1996). Variants of human dihydrofolate reductase with substitutions at leucine-22: effect on catalytic and inhibitor binding properties. Mol Pharmacol 49, 430-437.
Walter, F., Putz, J., Giege, ., and Westhof, E. (2002). Binding of tobramycin leads to conformational changes in yeast tRNA(Asp) and inhibition of aminoacylation. EMBO J 21, 760-768. Dey, M., Cao, C, Sicheri, F., and Dever, T.E. (2007). Conserved intermolecular salt bridge required for activation of protein kinases PKR, GCN2, and PERK. J Biol Chem 282, 6653-6660. Dong, J., Qju, H., Garcia-Barrio, M., Anderson, J., and Hinnebusch, A.G. (2000). Uncharged tRNA activates GCN2 by displacing the protein kinase moiety from a bipartite tRNA-binding domain. Mol Cell 6, 269-279. Padyana, A.K., Qju, H., Roll-Mecak, A., Hinnebusch, A.G., and Burley, S.K. (2005). Structural basis for autoinhibition and mutational activation of eukaryotic initiation factor 2alpha protein kinase GCN2. J Biol Chem 280, 29289-29299. Lageix, S., Lanet, E., Pouch-Pelissier, M.N., Espagnol, M.C., Robaglia, C, Deragon, J.M., and Pelissier, T. (2008). Arabidopsis elF2alpha kinase GCN2 is essential for growth in stress conditions and is activated by wounding. BMC Plant Biol 8, 134. Nover, L, Bharti, K., Doring, P., ishra, S.K., Ganguli, A., and Scharf, K.D. (2001). Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need? Cell Stress Chaperones 6, 177-189. Heidel, A.J., Clarke, J.D., Antonovics, J., and Dong, X. (2004). Fitness Costs of Mutations Affecting the Systemic Acquired Resistance Pathway in Arabidopsis thaliana. Genetics 168, 2197-2206. Li, Y., Darley, C ., Ongaro, V., Fleming, A., Schipper, O., Baldauf, S.L, and McQueen-Mason, S.J. (2002). Plant expansins are a complex multigene family with an ancient evolutionary origin. Plant Physiol 128, 854-864. Kay, S., Hahn, S., Marois, E., Hause, G., and Bonas, U. (2007). A bacterial effector acts as a plant transcription factor and induces a cell size regulator. Science 318, 648-651. Marois, E., Van den Ackerveken, G., and Bonas, U. (2002). The Xanthomonas type III effector protein AvrBs3 modulates plant gene expression and induces cell hypertrophy in the susceptible host. Mol Plant Microbe Interact 15, 637-646.
49. Wichmann, G., and Bergelson, J. (2004). Effector genes of Xanthomonas axonopodis pv. vesicatoria promote transmission and enhance other fitness traits in the field. Genetics 166, 693-706.
50. Eulgem, T., Rushton, P.J., Robatzek, S., and Somssich, I.E. (2000). The WRKY superfamily of plant transcription factors. Trends Plant Sci , 199-206. 51. Lebel, E., Heifetz, P., Thorne, L, Uknes, S., Ryals, J., and Ward, E. (1998). Functional analysis of regulatory sequences controlling PR-1 gene expression in Arabidopsis. Plant Journal 16, 223-233.
52. Kozak, M. (1991). An analysis of vertebrate mRNA sequences: intimations of translational control. J Cell Biol 115, 887-903.
53. Miller, P.F., and Hinnebusch, A.G. (1990). cis-acting sequences involved in the translational control of GCN4 expression. Biochim Biophys Acta 1050, 151-154.
54. Holton, T.A., and Cornish, E.C. (1995). Genetics and Biochemistry of Anthocyanin Biosynthesis. Plant Cell 7, 1071-1083.
55. Zhao, Y. (2010). Auxin biosynthesis and its role in plant development. Annu Rev Plant Biol 61, 49-64.
56. Curtis, M.D., and Grossniklaus, U. (2003). A gateway cloning vector set for high-throughput functional analysis of genes in planta. Plant Physio\ 133, 462-469.
57. Pajerowska-Mukhtar, K.M., Mukhtar, M.S., Guex, N., Halim, V.A., Rosahl, S., Somssich, I.E., and Gebhardt, C. (2008). Natural variation of potato allene oxide synthase 2 causes differential levels of jasmonates and pathogen resistance in Arabidopsis. Planta 228, 293-306.
58. Ercikan-Abali, E.A., Mineishi, S., Tong, Y., Nakahara, S., Waltham, M.C., Banerjee, D., Chen, W., Sadelain, M., and Bertino, J.R. (1996). Active site-directed double mutants of dihydrofolate reductase.
Cancer Res 56, 4142-4145. 9. Li, M.W., Auyeung, W. ., Lam, H.M. (2013, Jan) The GCN2 homologue in Arabidopsis thaliana interacts with uncharged tRNA and uses Arabidopsis elF2alpha molecules as direct substrates. Plant Biol (Stuttg) 15(l):13-8. doi: 10.1111/j.l438-8677.2012.00606.x. Epub 2012 Jun 5.
51. Wang, D., Weaver, N.D., Kesarwani, ., and Dong, X. (2005). Induction of protein secretory pathway is required for systemic acquired resistance. Science 308, 1036-1040.
52. Deplancke, B., Vermeirssen, V., Arda, H.E., Martinez, N.J., and Walhout, A.J.M. (2006). Gateway- compatible yeast one-hybrid screens. Cold Spring Harb Protoc, doi:10.1101/pdb.prot4590. S3. Zhang, X., and Bremer, H. (1996). Effects of Fis on ribosome synthesis and activity and on rRIMA promoter activities in Escherichia coli. J Mol Biol 259, 27-40.
S4. Song, J., Durrant, W.E., Wang, S., Yan, S., Tan, E.H., and Dong, X. (2011). DNA Repair Proteins Are Directly Involved in Regulation of Gene Expression during Plant Immune Response. Cell Host Microbe 9, 115-124. S5. Oliveros, J.C. (2007). VENNY. An interactive tool for comparing lists with Venn Diagrams.
http://bioinfogp.cnb.csic.es/tools/venny/index.html.
56. Curtis, M.D., and Grossniklaus, U. (2003). A gateway cloning vector set for high-throughput functional analysis of genes in planta. Plant Physiol 133, 462-469.
tra nsformation of Arabidopsis thaliana. Plant Journal 16, 735-743.
58. Durrant, W.E., Wang, S., and Dong, X.N. (2007). Arabidopsis SNI1 and RAD51D regulate both gene transcription and DNA recombination during the defense response. Proc Natl Acad Sci U S A 104, 4223-4227.
59. Lageix, S., Lanet, E., Pouch-Pelissier, M.N., Espagnol, M.C., Robaglia, C, Deragon, J.M., and Pelissier, T.
(2008). Arabidopsis elF2alpha kinase GCN2 is essential for growth in stress conditions and is activated by wounding. BMC Plant Biol 8, 134.
S10. Kohrer, C, and Rajbhandary, U.L. (2008). The many applications of acid urea polyacryiamide gel electrophoresis to studies of tRNAs and aminoacyl-tRNA synthetases. Methods 44, 129-138.
Sll. Deplancke, B., Dupuy, D ., Vidal, M., and Walhout, A.J.M. (2004) A Gateway-Compatible Yeast One- Hybrid System Genome Res. 14: 2093-2101.
Winzeler, E.A. et al. (1999) Functional characterization of the S. cerevisiae genome by gene deletion and parallel analysis. Science 285, 901-906.
Holsters, M., Silva, B., Van Vliet, F., Genetello, C, De Block, M., Dhaese, P., Depicker, A., Inze, D., Engler, G., Villarroel, R., Van Montagu, M. Schell, J. (1980) The functional organization of the nopaline A. tumefaciens plasmid pTiC58. Plasmid, 3, 212-230.
Deplancke, B., ukhopadhyay, A., Ao, W., Elewa, A.E., Grove, C.A., Martinez, N.J., Sequerra, R., Doucette-Stamm, L, Reece-Hoyes, J.S., Hope, I.A., Tissenbaum, H.A., Mango S.E., and Walhout, A.J. (2006). A gene-centered C. elegans protein-DNA interaction network. Cell, 125: 1192-1205
Riley, M., Abe, T., Arnaud, M.B., Berlyn, M.K.B., Blattner, F.R., Chaudhuri, R.R., Glasner, J.D., Horiuchi, T., Keseler, I.M., Kosuge, T., Mori, H., Perna, NT., Plunkett III, G., Rudd, K.E., Serresm, M.H., Thomas, G.H., Thomson, N.R., Wishart, D. and Wanner, B.L (2006) Escherichia coli K-12: a cooperatively developed annotation snapshot-2005 . Nucleic Acids Res. 34 (1), 1-9
Jefferson, R.A. (1987). Assaying chimeric genes in plants: The GUS gene fusion system. Plant Mol. Biol. Rep. 5, 387-405.
Jefferson, R.A., Kavanagh, T.A., and Bevan, M.W. (1987). GUS fusion: β-Glucuronidase as a sensitive and versatile gene fusion marker in higher plants. EMBOJ. 6, 3901-3907.
Miller, J.H. (1972) Experiments in molecular genetics. [Cold Spring Harbor, N.Y.] Cold Spring Harbor Laboratory.
Johnson, T.J., Kariyawasam, S., Wannemuehler, Y., Mangiamele, P.,Johnson, S.J., Doetkott, C, Skyberg, J.A., Lynne, A.M., Johnson, J.R., and Nolan, L.K. (2007) The genome sequence of avian pathogenic Escherichia coli strain 01:K1:H7 shares strong similarities with human extraintestinal pathogenic E. coli genomes. J. Bacteriol. 189 (8), 3228-3236.
Hall C.V., Jacob P.E., Ringold G.M., and Lee F.J. (1983) Expression and regulation of Escherichia coli lacZ gene fusions in mammalian cells. Mol Appl Genet. 2(1), 101-109.
S21. Prasher, D.C., Eckenrode, V.K., Ward, W.W., Prendergast, F.G., and Cormier, MJ. (1992) Primary structure of the Aequorea victoria green-fluorescent protein. Gene 111 (2), 229-233.
521. Dong, X., Mindrinos, M., Davis, K.R., and Ausubel, F.M. (1991) Induction of Arabidopsis Defense Genes by Virulent and Avirulent Pseudomonas syringae Strains and by a Cloned Avirulence Gene. The Plant Cell, 3(1), 61-72.
522. Whalen, M.C., Innes, R.W., Bent, A.F., and Staskawicz, BJ. (1991) Identification of Pseudomonas syringae Pathogens of Arabidopsis and a Bacterial Locus Determining Avirulence on Both Arabidopsis and Soybean. The Plant Cell, 3, 49-59.
Claims
What is claimed is:
1. An isolated nucleic acid molecule comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of:
(a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and
(b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or (iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved.
2. The isolated nucleic acid molecule of Claim 1, wherein said molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof.
3. The isolated nucleic acid of Claim 1, further comprising one or more downstream ORFs (dORFs) encoding one or more polypeptides.
4. The isolated nucleic acid molecule of Claim 3, wherein at least one dORF encodes a polypeptide selected from the group consisting of:
(i) a polypeptide that is functionally-active as a transcription factor;
(ii) a reporter polypeptide;
(iii) a polypeptide that confers drug resistance;
(iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and
(v) a polypeptide involved in the growth of plants.
The isolated nucleic acid of claim 4, wherein said polypeptide is a transcription factor selected from the group consisting of:
(i) a polypeptide represented by TBF1 (SEQ ID NO: 106);
(ii) a variant polypeptide thereof, that contains one or more conservative substitutions in which TBF1 structure and one or more TBF1 functions are conserved; or
(iii) a variant polypeptide thereof, that contains one or more substitutions, fusions, or truncations in which one or more TBF1 functions are conserved.
The isolated nucleic acid of claim 4, wherein said polypeptide is a reporter polypeptide selected from the group consisting of:
(i) β-galactosidase (β-gal), β-glucuronidase (β-gluc), chloramphenicol acetyltransferase (CAT), Renilla-luciferase (rue), Photinus luciferase (luc), secreted alkaline phosphatase (SAP), and green fluorescent protein (GFP);
(ii) a variant of the reporter polypeptide specified in (i) that contains one or more conservative substitutions in which structure and one or more reporter functions are conserved; or
(iii) a variant of the reporter polypeptide specified in (i) that contains one or more substitutions, fusions, or truncations in which one or more reporter functions are conserved.
The isolated nucleic acid of Claim 1, wherein said promoter is constitutive.
The isolated nucleic acid of Claim 1, wherein said promoter is inducible.
The isolated nucleic acid of Claim 1, wherein said promoter is active in plant cells.
The isolated nucleic acid of Claim 9, wherein said promoter is selected from the group consisting of:
(a) a plant promoter;
(b) a plant virus promoter;
(c) a promoter from a non-viral plant pathogen;
(d) a mammalian cell promoter; and
(e) a mammalian virus promoter.
The isolated nucleic acid of Claim 10, wherein said promoter is a plant promoter.
The isolated nucleic acid of Claim 11, wherein said plant promoter is selected from the group consisting of:
(a) the TBF1 promoter as set forth in SEQ ID NO: 113;
(b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBF1 promoter functions are preserved; or
(c) a nucleotide sequence which is 50% or more identical to the TBF1 promoter set forth in (a) in which one or more promoter functions are preserved;
The isolated nucleic acid of Claim 11, wherein said plant promoter is selected from the group consisting of:
(a) the Bip2 promoter as set forth in SEQ ID NO: 109;
(b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBF1 promoter functions are preserved;
The isolated nucleic acid of Claim 11, wherein said plant promoter is a nucleotide sequence comprising a binding site for the TBF1 polypeptide in which one or more promoter functions are preserved.
15. The isolated nucleic acid of Claim 11, wherein said plant promoter is a nucleotide sequence comprising a functionally-active promoter derived from an Arabidopsis locus selected from the group consisting of AT1G48850, AT1G62300, AT4G34230, AT4G34180, AT4G35110, AT2G30490, AT5G38900, AT5G24430, AT1G63720, AT4G39270.
16. The isolated nucleic acid of Claim 11, wherein said plant promoter is inducible.
17. The isolated nucleic acid of Claim 16, wherein said plant promoter is inducible upon challenge by a plant pathogen or a chemical inducer.
18. The isolated nucleic acid of Claim 17, wherein said inducer is selected from the group consisting of salicylic acid, Jasmonic acid, methyl jasmonic acid, abscisic acid, ethylene, AgN03, cycloheximide, mannitol, NaCI, flg22, elfl8 and LPS.
19. A vector comprising the isolated nucleic acid of Claim 1.
20. A cell comprising isolated nucleic acid of Claim 1.
21. A vector comprising a nucleic acid comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uO F) that encodes a polypeptide selected from the group consisting of:
(a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102); a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or
(Hi) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and
(b) (0 a polypeptide represented by uORF2 (SEQ ID NO: 103);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or
(iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved.
22. The vector of Claim 21, wherein said molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof.
23. The vector of Claim 21, further comprising one or more downstream ORFs (dORFs) encoding one or more polypeptides.
24. The vector of Claim 23, wherein at least one dORF encodes a polypeptide selected from the group consisting of:
(i) a polypeptide that is functionally-active as a transcription factor;
(ii) a reporter polypeptide;
(iii) a polypeptide that confers drug resistance;
(iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and
(v) a polypeptide involved in the growth of plants.
25. The vector of claim 24, wherein said polypeptide is a transcription factor selected from the group consisting of:
(i) a polypeptide represented by TBF1 (SEQ ID NO: 106);
(ii) a variant polypeptide thereof, that contains one or more conservative substitutions in which TBF1 structure and one or more TBF1 functions are conserved; or
(iii) a variant polypeptide thereof, that contains one or more substitutions, fusions, or truncations in which one or more TBF1 functions are conserved.
26. The vector of claim 24, wherein said polypeptide is a reporter polypeptide selected from the group consisting of:
(i) β-galactosidase (β-gal), β-glucuronidase (β-gluc), chloramphenicol acetyltransferase (CAT), enilla-luciferase (rue), Photinus luciferase (luc), secreted alkaline phosphatase (SAP), and green fluorescent protein (GFP);
(ii) a variant of the reporter polypeptide specified in (i) that contains one or more conservative substitutions in which structure and one or more reporter functions are conserved; or
(iii) a variant of the reporter polypeptide specified in (i) that contains one or more substitutions, fusions, or truncations in which one or more reporter functions are conserved.
27. The vector of Claim 21, wherein said promoter is constitutive.
28. The vector of Claim 21, wherein said promoter is inducible. 29. The vector of Claim 21, wherein said promoter is active in plant cells.
30. The vector of Claim 29, wherein said promoter is selected from the group consisting of:
(a) a plant promoter;
(b) a plant virus promoter;
(c) a promoter from a non-viral plant pathogen; (d) a mammalian cell promoter; and
(e) a mammalian virus promoter.
31. The vector of Claim 30, wherein said promoter is a plant promoter.
32. The vector of Claim 31, wherein said plant promoter is selected from the group consisting of:
(a) the TBF1 promoter as set forth in SEQ ID NO: 113; (b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBF1 promoter functions are preserved; or
(c) a nucleotide sequence which is 50% or more identical to the TBF1 promoter set forth in (a) in which one or more promoter functions are preserved;
33. The vector of Claim 31, wherein said plant promoter is selected from the group consisting of:
(a) the Bip2 promoter as set forth in SEQ ID NO: 109;
(b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBF1 promoter functions are preserved;
34. The vector of Claim 31, wherein said plant promoter is a nucleotide sequence comprising a binding site for the TBF1 polypeptide in which one or more promoter functions are preserved.
35. The vector of Claim 31, wherein said plant promoter is a nucleotide sequence comprising a functionally-active promoter derived from an Arabidopsis locus selected from the group consisting of AT1G48850, AT1G62300, AT4G34230, AT4G34180, AT4G35110, AT2G30490, AT5G38900, AT5G24430, AT1G63720, AT4G39270.
36. The vector of Claim 31, wherein said plant promoter is inducible.
37. The vector of Claim 36, wherein said plant promoter is inducible upon challenge by a plant pathogen or a chemical inducer.
38. The vector of Claim 37, wherein said inducer is selected from the group consisting of salicylic acid, Jasmonic acid, methyl jasmonic acid, abscisic acid, ethylene, AgN03, cycloheximide, mannitol, NaCI, flg22, elf 18 and LPS.
39. A cell comprising the vector of Claim 21.
40. A plant comprising the vector of Claim 21.
41. A cell comprising a nucleic acid comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uO F) that encodes a polypeptide selected from the group consisting of:
(a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or
(iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and
(b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or
(iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved.
42. The cell of Claim 41, wherein said molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof.
43. The cell of Claim 41, further comprising one or more downstream ORFs (dORFs) encoding one or more polypeptides. 44. The cell of Claim 43, wherein at least one dORF encodes a polypeptide selected from the group consisting of:
(i) a polypeptide that is functionally-active as a transcription factor;
(ii) a reporter polypeptide;
(iii) a polypeptide that confers drug resistance; (iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and
(v) a polypeptide involved in the growth of plants.
45. The vector of claim 44, wherein said polypeptide is a transcription factor selected from the group consisting of:
(i) a polypeptide represented by TBF1 (SEQ ID NO: 106);
(ii) a variant polypeptide thereof, that contains one or more conservative substitutions in which TBF1 structure and one or more TBF1 functions are conserved; or
(iii) a variant polypeptide thereof, that contains one or more substitutions, fusions, or truncations in which one or more TBF1 functions are conserved.
46. The cell of claim 44, wherein said polypeptide is a reporter polypeptide selected from the group consisting of:
(i) β-galactosidase (β-gal), β-glucuronidase (β-gluc), chloramphenicol acetyltransferase (CAT), enilla-luciferase (rue), Photinus luciferase (luc), secreted alkaline phosphatase (SAP), and green fluorescent protein (GFP);
(ii) a variant of the reporter polypeptide specified in (i) that contains one or more conservative substitutions in which structure and one or more reporter functions are conserved; or
(iii) a variant of the reporter polypeptide specified in (i) that contains one or more substitutions, fusions, or truncations in which one or more reporter functions are conserved. 47. The cell of Claim 41, wherein said promoter is constitutive.
48. The cell of Claim 41, wherein said promoter is inducible.
49. The cell of Claim 41, wherein said promoter is active in plant cells.
50. The cell of Claim 49, wherein said promoter is selected from the group consisting of: (a) a plant promoter; (b) a plant virus promoter;
(c) a promoter from a non-viral plant pathogen;
(d) a mammalian cell promoter; and
(e) a mammalian virus promoter.
51. The cell of Claim 50, wherein said promoter is a plant promoter.
52. The cell of Claim 51, wherein said plant promoter is selected from the group consisting of:
(a) the TBF1 promoter as set forth in SEQ ID NO: 113; (b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBF1 promoter functions are preserved; or
(c) a nucleotide sequence which is 50% or more identical to the TBF1 promoter set forth in (a) in which one or more promoter functions are preserved;
53. The cell of Claim 51, wherein said plant promoter is selected from the group consisting of: (a) the Bip2 promoter as set forth in SEQ ID NO: 109;
(b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBF1 promoter functions are preserved;
54. The cell of Claim 51, wherein said plant promoter is a nucleotide sequence comprising a binding site for the TBF1 polypeptide in which one or more promoter functions are preserved. 55. The cell of Claim 51, wherein said plant promoter is a nucleotide sequence comprising a functionally- active promoter derived from an Arabidopsis locus selected from the group consisting of AT1G48850, AT1G62300, AT4G34230, AT4G34180, AT4G35110, AT2G30490, AT5G38900, AT5G24430, AT1G63720, AT4G39270.
56. The cell of Claim 51, wherein said plant promoter is inducible. 57. The cell of Claim 56, wherein said plant promoter is inducible upon challenge by a plant pathogen or a chemical inducer.
58. The cell of Claim 57, wherein said inducer is selected from the group consisting of salicylic acid, Jasmonic acid, methyl jasmonic acid, abscisic acid, ethylene, AgN03, cycloheximide, mannitol, NaCI, flg22, elfl8 and LPS.
59. A sample of plant propagation material, comprising the cell of claim 41. 60. A plant, comprising the cell of claim 41.
61. A transgenic plant comprising a regulatory region used to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of: (a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or
(iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved; and (b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or
(iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved. 62. The plant of Claim 61, wherein said molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof.
63. The plant of Claim 61, further comprising one or more downstream ORFs (dORFs) encoding one or more polypeptides.
64. The cell of Claim 63, wherein at least one dORF encodes a polypeptide selected from the group consisting of:
(i) a polypeptide that is functionally-active as a transcription factor;
(ii) a reporter polypeptide;
(iii) a polypeptide that confers drug resistance;
(iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and
(v) a polypeptide involved in the growth of plants.
65. The vector of claim 64, wherein said polypeptide is a transcription factor selected from the group consisting of:
(i) a polypeptide represented by TBF1 (SEQ ID NO: 106);
(ii) a variant polypeptide thereof, that contains one or more conservative substitutions in which TBF1 structure and one or more TBF1 functions are conserved; or
(iii) a variant polypeptide thereof, that contains one or more substitutions, fusions, or truncations in which one or more TBF1 functions are conserved.
The plant of claim 64, wherein said polypeptide is a reporter polypeptide selected from the group consisting of:
(i) β-galactosidase (β-gal), β-glucuronidase (β-gluc), chloramphenicol acetyltransferase (CAT), Renilla-luciferase (rue), Photinus luciferase (luc), secreted alkaline phosphatase (SAP), and green fluorescent protein (GFP);
(ii) a variant of the reporter polypeptide specified in (Ί) that contains one or more conservative substitutions in which structure and one or more reporter functions are conserved; or
(iii) a variant of the reporter polypeptide specified in (i) that contains one or more substitutions, fusions, or truncations in which one or more reporter functions are conserved.
The plant of Claim 61, wherein said promoter is constitutive.
The plant of Claim 61, wherein said promoter is inducible.
The plant of Claim 61, wherein said promoter is active in plant cells.
The plant of Claim 69, wherein said promoter is selected from the group consisting of:
(a) a plant promoter;
(b) a plant virus promoter;
(c) a promoter from a non-viral plant pathogen;
(d) a mammalian cell promoter; and
(e) a mammalian virus promoter.
The plant of Claim 70, wherein said promoter is a plant promoter.
The plant of Claim 71, wherein said plant promoter is selected from the group consisting of:
(a) the TBFl promoter as set forth in SEQ ID NO: 113;
(b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBFl promoter functions are preserved; or
(c) a nucleotide sequence which is 50% or more identical to the TBFl promoter set forth in (a) in which one or more promoter functions are preserved;
The plant of Claim 71, wherein said plant promoter is selected from the group consisting of:
(a) the Bip2 promoter as set forth in SEQ ID NO: 109;
(b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBFl promoter functions are preserved;
74. The plant of Claim 71, wherein said plant promoter is a nucleotide sequence comprising a binding site for the TBF1 polypeptide in which one or more promoter functions are preserved.
75. The plant of Claim 71, wherein said plant promoter is a nucleotide sequence comprising a functionally-active promoter derived from an Arabidopsis locus selected from the group consisting of AT1G48850, AT1G62300, AT4634230, AT4G34180, AT4G35110, AT2G3Q490, AT5G38900, AT5G24430, AT1G63720, AT4G39270.
76. The plant of Claim 71, wherein said plant promoter is inducible.
77. The plant of Claim 76, wherein said plant promoter is inducible upon challenge by a plant pathogen or a chemical inducer.
78. The plant of Claim 77, wherein said inducer is selected from the group consisting of salicylic acid, Jasmonic acid, methyl jasmonic acid, abscisic acid, ethylene, AgN03, cycloheximide, mannitol, NaCI, flg22, elfl8 and LPS.
80. A sample of plant propagation material, derived from the plant of Claim 61.
79. A seed, derived from the plant of Claim 61.
81. A method of using a regulatory region to modulate the expression of one or more polypeptides in a cell, wherein said regulatory region comprises a promoter, functional in said cell, operably-linked to one or more upstream ORFs and one or more downstream ORFs encoding said one or more polypeptides, comprising the steps of:
(a) introducing one or more nucleic acids comprising said regulatory region into a cell;
(b) expressing one or more upstream ORFs and one or more downstream ORFs encoding one or more polypeptides for a period sufficient to modulate the amount or level of activity of at least one of the one or more polypeptides within the cell or in the cell culture medium obtained from said cell.
82. The method of claim 81, further comprising the step of:
(c) purifying at least one of said polypeptides from the cell comprising said regulatory region or from the cell culture medium obtained from said cell.
The method of claim 81, wherein the amount or level of activity at least one of said polypeptides is enhanced above the endogenous amount or level of activity in a parent cell lacking an introduced nucleic acid comprising said regulatory region.
The method of claim 81, wherein the amount or level of activity at least one of said polypeptides is reduced below the endogenous amount or level of activity in a parent cell lacking an introduced nucleic acid comprising said regulatory region.
The method of claim 81, wherein said regulatory region contains a nucleic acid comprising at least one upstream open reading frame (uORF) that encodes a polypeptide selected from the group consisting of:
(a) (i) a polypeptide represented by uORFl (SEQ ID NO: 102);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORFl structure and one or more functions are conserved; or
(iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORFl functions are conserved;
(b) (i) a polypeptide represented by uORF2 (SEQ ID NO: 103);
(ii) a variant polypeptide thereof that contains one or more conservative substitutions in which uORF2 structure and one or more functions are conserved; or
(iii) a variant polypeptide thereof that contains one or more substitutions, fusions, or truncations in which one or more uORF2 functions are conserved.
86. The method of Claim 81, wherein said nucleic acid molecule comprises uORFl, or a functional variant thereof, and uORF2, or a functional variant thereof.
87. The method of Claim 81, wherein said nucleic acid molecule further comprises one or more downstream ORFs (dORFs) encoding one or more polypeptides.
The method of Claim 87, wherein at least one dORF encodes a polypeptide selected from the group consisting of:
(i) a polypeptide that is functionally-active as a transcription factor;
(ii) a reporter polypeptide;
(iii) a polypeptide that confers drug resistance;
(iv) a polypeptide involved in resistance of plants to viral, bacterial, or fungal pathogens; and
(v) a polypeptide involved in the growth of plants.
The isolated nucleic acid of claim 87, wherein said polypeptide is a transcription factor selected from the group consisting of:
(i) a polypeptide represented by TBF1 (SEQ ID NO: 106);
(ii) a variant polypeptide thereof, that contains one or more conservative substitutions in which TBF1 structure and one or more TBF1 functions are conserved; or
(iii) a variant polypeptide thereof, that contains one or more substitutions, fusions, or truncations in which one or more TBF1 functions are conserved.
The method of claim 87, wherein said polypeptide is a reporter polypeptide selected from the group consisting of:
(i) β-galactosidase (β-gal), β-glucuronidase (β-gluc), chloramphenicol acetyltransferase (CAT), Renilla-luciferase (rue), Photinus luciferase (luc), secreted alkaline phosphatase (SAP), and green fluorescent protein (GFP);
(ii) a variant of the reporter polypeptide specified in (i) that contains one or more conservative substitutions in which structure and one or more reporter functions are conserved; or
(iii) a variant of the reporter polypeptide specified in (i) that contains one or more substitutions, fusions, or truncations in which one or more reporter functions are conserved.
The method of Claim 81, wherein said promoter is constitutive.
The method of Claim 81, wherein said promoter is inducible.
The method of Claim 81, wherein said promoter is active in plant cells.
The method of Claim 92, wherein said promoter is selected from the group consisting of:
(a) a plant promoter;
(b) a plant virus promoter;
(c) a promoter from a non-viral plant pathogen;
(d) a mammalian cell promoter; and
(e) a mammalian virus promoter.
The method of Claim 93, wherein said promoter is a plant promoter.
The method of Claim 93, wherein said plant promoter is selected from the group consisting of:
(a) the TBFl promoter as set forth in SEQ ID NO: 113;
(b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBFl promoter functions are preserved; or
(c) a nucleotide sequence which is 50% or more identical to the TBFl promoter set forth in (a) in which one or more promoter functions are preserved;
The method of Claim 93, wherein said plant promoter is selected from the group consisting of:
(a) the Bip2 promoter as set forth in SEQ ID NO: 109;
(b) a variant sequence thereof, that contains one or more substitutions, insertions, or deletions, in which one or more TBFl promoter functions are preserved;
96. The method of Claim 93, wherein said plant promoter is a nucleotide sequence comprising a binding site for the TBF1 polypeptide in which one or more promoter functions are preserved.
97. The method of Claim 93, wherein said plant promoter is a nucleotide sequence comprising a functionally-active promoter derived from an Arabidopsis locus selected from the group consisting of AT1G48850, AT1G62300, AT4G34230, AT4G34180, AT4G35110, AT2G30490, AT5G38900,
AT5G24430, AT1G63720, AT4G39270.
98. The method of Claim 93, wherein said plant promoter is inducible.
99. The method of Claim 98, wherein said plant promoter is inducible upon challenge by a plant pathogen or a chemical inducer.
100. The method of Claim 99, wherein said inducer is selected from the group consisting of salicylic acid, Jasmonic acid, methyl jasmonic acid, abscisic acid, ethylene, AgN03, cycloheximide, mannitol, NaCI, flg22, elfl8 and LPS.
101. A purified recombinant protein produced by the method of Claim 82.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/576,304 US10017773B2 (en) | 2011-12-21 | 2014-12-19 | HSF-like transcription factor, TBF1, is a major molecular switch for growth-to-defense transition in plants |
| US16/003,289 US10584346B2 (en) | 2011-12-21 | 2018-06-08 | HSF-like transcription factor, TBF1, is a major molecular switch for growth-to-defense transition in plants |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161578632P | 2011-12-21 | 2011-12-21 | |
| US61/578,632 | 2011-12-21 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US201414310320A Continuation-In-Part | 2011-12-21 | 2014-06-20 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2013096567A2 true WO2013096567A2 (en) | 2013-06-27 |
| WO2013096567A3 WO2013096567A3 (en) | 2015-06-11 |
Family
ID=48669696
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/070838 Ceased WO2013096567A2 (en) | 2011-12-21 | 2012-12-20 | The hsf-like transcription factor, tbf1, is a major molecular switch for growth-to-defense transition in plants |
Country Status (2)
| Country | Link |
|---|---|
| US (2) | US10017773B2 (en) |
| WO (1) | WO2013096567A2 (en) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN106467909A (en) * | 2015-08-14 | 2017-03-01 | 中国科学院遗传与发育生物学研究所 | A kind of method that acquisition glyphosate-resistant rice is replaced by nucleotide fixed point |
| US10584346B2 (en) | 2011-12-21 | 2020-03-10 | Duke University | HSF-like transcription factor, TBF1, is a major molecular switch for growth-to-defense transition in plants |
| CN113430295A (en) * | 2013-10-31 | 2021-09-24 | 保尔·萨巴梯埃图卢兹第三大学 | Micropeptides and their use for modulating gene expression |
| US11421241B2 (en) | 2015-01-27 | 2022-08-23 | Institute Of Genetics And Developmental Biology, Chinese Academy Of Sciences | Method for conducting site-specific modification on entire plant via gene transient expression |
| US11492630B2 (en) | 2015-05-19 | 2022-11-08 | KWS SAAT SE & Co. KGaA | Methods and hybrids for targeted nucleic acid editing in plants using CRISPR/Cas systems |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110506118A (en) * | 2017-02-02 | 2019-11-26 | 杜克大学 | For controlling the composition and method of gene expression |
| CN111662923B (en) * | 2019-03-08 | 2023-04-18 | 中国科学院分子植物科学卓越创新中心 | Transcription factor for enhancing plant broad-spectrum disease resistance and application thereof |
| CN114316005B (en) * | 2021-11-23 | 2022-09-23 | 广东省科学院南繁种业研究所 | Upstream regulation factor IbWRKY1 and application thereof in regulation of IbMYB1 expression of purple sweet potato |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6031153A (en) * | 1995-01-23 | 2000-02-29 | Novartis Ag | Method for protecting plants |
| EP1033405A3 (en) * | 1999-02-25 | 2001-08-01 | Ceres Incorporated | Sequence-determined DNA fragments and corresponding polypeptides encoded thereby |
| US20040031072A1 (en) | 1999-05-06 | 2004-02-12 | La Rosa Thomas J. | Soy nucleic acid molecules and other molecules associated with transcription plants and uses thereof for plant improvement |
| US20110131679A2 (en) * | 2000-04-19 | 2011-06-02 | Thomas La Rosa | Rice Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement |
| AU2001280701A1 (en) * | 2000-07-20 | 2002-02-05 | Beth Blakeslee | Nucleic acids compositions conferring dwarfing phenotype |
| WO2003020936A1 (en) * | 2001-08-31 | 2003-03-13 | The Dow Chemical Company | Nucleic acid compositions conferring altered metabolic characteristics |
| US20060143729A1 (en) * | 2004-06-30 | 2006-06-29 | Ceres, Inc. | Nucleotide sequences and polypeptides encoded thereby useful for modifying plant characteristics |
| AR060563A1 (en) * | 2006-04-24 | 2008-06-25 | Mendel Biotechnology Inc | DISEASE PROMOTERS FOR DISEASE |
| GB0704984D0 (en) * | 2007-03-15 | 2007-04-25 | Wivenhoe Technology Ltd | Plant responses |
| US8362325B2 (en) * | 2007-10-03 | 2013-01-29 | Ceres, Inc. | Nucleotide sequences and corresponding polypeptides conferring modulated plant characteristics |
| WO2013096567A2 (en) | 2011-12-21 | 2013-06-27 | Duke University | The hsf-like transcription factor, tbf1, is a major molecular switch for growth-to-defense transition in plants |
-
2012
- 2012-12-20 WO PCT/US2012/070838 patent/WO2013096567A2/en not_active Ceased
-
2014
- 2014-12-19 US US14/576,304 patent/US10017773B2/en active Active
-
2018
- 2018-06-08 US US16/003,289 patent/US10584346B2/en active Active
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10584346B2 (en) | 2011-12-21 | 2020-03-10 | Duke University | HSF-like transcription factor, TBF1, is a major molecular switch for growth-to-defense transition in plants |
| CN113430295A (en) * | 2013-10-31 | 2021-09-24 | 保尔·萨巴梯埃图卢兹第三大学 | Micropeptides and their use for modulating gene expression |
| US11421241B2 (en) | 2015-01-27 | 2022-08-23 | Institute Of Genetics And Developmental Biology, Chinese Academy Of Sciences | Method for conducting site-specific modification on entire plant via gene transient expression |
| US11492630B2 (en) | 2015-05-19 | 2022-11-08 | KWS SAAT SE & Co. KGaA | Methods and hybrids for targeted nucleic acid editing in plants using CRISPR/Cas systems |
| CN106467909A (en) * | 2015-08-14 | 2017-03-01 | 中国科学院遗传与发育生物学研究所 | A kind of method that acquisition glyphosate-resistant rice is replaced by nucleotide fixed point |
| US11767536B2 (en) | 2015-08-14 | 2023-09-26 | Institute Of Genetics And Developmental Biology, Chinese Academy Of Sciences | Method for obtaining glyphosate-resistant rice by site-directed nucleotide substitution |
Also Published As
| Publication number | Publication date |
|---|---|
| US10017773B2 (en) | 2018-07-10 |
| US10584346B2 (en) | 2020-03-10 |
| WO2013096567A3 (en) | 2015-06-11 |
| US20150113685A1 (en) | 2015-04-23 |
| US20180273965A1 (en) | 2018-09-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10584346B2 (en) | HSF-like transcription factor, TBF1, is a major molecular switch for growth-to-defense transition in plants | |
| Wang et al. | Phosphorylation and ubiquitination of OsWRKY31 are integral to OsMKK10-2-mediated defense responses in rice | |
| Zhou et al. | Rice GLUTATHIONE PEROXIDASE1-mediated oxidation of bZIP68 positively regulates ABA-independent osmotic stress signaling | |
| Lu et al. | Nuclear factor Y subunit GmNFYA competes with GmHDA13 for interaction with GmFVE to positively regulate salt tolerance in soybean | |
| Peng et al. | CONSTITUTIVE EXPRESSER OF PATHOGENESIS-RELATED GENES 5 is an RNA-binding protein controlling plant immunity via an RNA processing complex | |
| Pajerowska-Mukhtar et al. | The HSF-like transcription factor TBF1 is a major molecular switch for plant growth-to-defense transition | |
| Cheng et al. | The bHLH transcription factor GmPIB1 facilitates resistance to Phytophthora sojae in Glycine max | |
| González-Lamothe et al. | The U-box protein CMPG1 is required for efficient activation of defense mechanisms triggered by multiple resistance genes in tobacco and tomato | |
| Ohama et al. | The transcriptional cascade in the heat stress response of Arabidopsis is strictly regulated at the level of transcription factor expression | |
| Yang et al. | The E3 ubiquitin ligase activity of Arabidopsis PLANT U-BOX17 and its functional tobacco homolog ACRE276 are required for cell death and defense | |
| Mbengue et al. | The Medicago truncatula E3 ubiquitin ligase PUB1 interacts with the LYK3 symbiotic receptor and negatively regulates infection and nodulation | |
| Shang et al. | The Mg-chelatase H subunit of Arabidopsis antagonizes a group of WRKY transcription repressors to relieve ABA-responsive genes of inhibition | |
| Leister et al. | Molecular genetic evidence for the role of SGT1 in the intramolecular complementation of Bs2 protein activity in Nicotiana benthamiana | |
| Noel et al. | Interaction between SGT1 and cytosolic/nuclear HSC70 chaperones regulates Arabidopsis immune responses | |
| Luo et al. | Overexpression of a new stress-repressive gene OsDSR2 encoding a protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice | |
| Reddy et al. | KIC, a novel Ca2+ binding protein with one EF-hand motif, interacts with a microtubule motor protein and regulates trichome morphogenesis | |
| Tong et al. | E3 ligase SAUL1 serves as a positive regulator of PAMP‐triggered immunity and its homeostasis is monitored by immune receptor SOC3 | |
| Huh et al. | Capsicum annuum WRKY transcription factor d (CaWRKYd) regulates hypersensitive response and defense response upon Tobacco mosaic virus infection | |
| Jiang et al. | The Arabidopsis RNA binding protein with K homology motifs, SHINY1, interacts with the C-terminal domain phosphatase-like 1 (CPL1) to repress stress-inducible gene expression | |
| Maldonado-Calderón et al. | Characterization of novel F-box proteins in plants induced by biotic and abiotic stress | |
| Cheong et al. | Xanthomonas oryzae pv. oryzae type III effector XopN targets OsVOZ2 and a putative thiamine synthase as a virulence factor in rice | |
| Toribio et al. | A novel eIF4E-interacting protein that forms non-canonical translation initiation complexes | |
| Tateda et al. | NtbZIP60, an endoplasmic reticulum-localized transcription factor, plays a role in the defense response against bacterial pathogens in Nicotiana tabacum | |
| US20190352664A1 (en) | Compositions and methods for controlling gene expression | |
| Kim et al. | Shade represses photosynthetic genes by disrupting the DNA binding of GOLDEN2-LIKE1 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12860248 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 12860248 Country of ref document: EP Kind code of ref document: A2 |
