WO2013095905A1 - Thyroid stimulating hormone compositions - Google Patents
Thyroid stimulating hormone compositions Download PDFInfo
- Publication number
- WO2013095905A1 WO2013095905A1 PCT/US2012/067705 US2012067705W WO2013095905A1 WO 2013095905 A1 WO2013095905 A1 WO 2013095905A1 US 2012067705 W US2012067705 W US 2012067705W WO 2013095905 A1 WO2013095905 A1 WO 2013095905A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- tsh
- composition
- peg
- rhtsh
- cysteine
- Prior art date
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/24—Follicle-stimulating hormone [FSH]; Chorionic gonadotropins, e.g. HCG; Luteinising hormone [LH]; Thyroid-stimulating hormone [TSH]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/34—Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyesters, polyamino acids, polysiloxanes, polyphosphazines, copolymers of polyalkylene glycol or poloxamers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- Thyroid cancer is a collection of diseases in which there is uncontrolled growth of cells derived from the thyroid.
- Thyroid cancer commonly has been classified as differentiated thyroid cancer, including papillary, follicular and Hurthle cell cancer, and other thyroid cancers, including medullary and anaplastic cancer. Over time, some differentiated thyroid cancers become less well differentiated, and may be classified as de-differentiated or poorly-differentiated cancer. Administration of Thyroid
- Stimulating Hormone to patients can play a role in the diagnostic or therapeutic approach for various thyroid diseases, including goiter and thyroid cancer.
- TSH Stimulating Hormone
- the pharmacokinetic profile of the administered TSH may be important for the optimal success of the diagnostic or therapeutic procedures.
- TSH Recombinant human TSH (rhTSH), marketed as THYROGEN® Thyroid Stimulating Hormone (Genzyme Corp., NDA 2-898), is dosed in multiple injections on consecutive days, followed by RAI dosing and blood draw for tumor diagnostics on day 3 and 5.
- This strict dosing regimen has been necessitated by the relatively short duration of action of TSH, which also results in reduced efficacy and side effects.
- a TSH composition with prolonged duration of action will likely improve treatment and detection of various thyroid diseases and reduce side effects.
- the present invention relates to compositions of Thyroid Stimulating Hormone (TSH) conjugated with a (one or more) polyalkylene glycol polymer, such as polyethylene glycol (PEG), that prolong the duration TSH action in vivo. Additionally, the invention relates to compositions of mutant TSH, wherein the TSH has been mutated to introduce additional sites that can be conjugated with a polyalkylene glycol polymer.
- TSH compositions of the present invention described herein are useful as preparing pharmaceutical compositions and can be used for treatment of patients in need thereof with thyroid conditions.
- the invention pertains to compositions comprising TSH, wherein at least one polyalkylene glycol polymer is attached to a carbohydrate site of the TSH.
- TSH of the compositions is isolated from a mammal, for example, a human, or the TSH is recombinant
- TSH mammalian TSH
- rhTSH recombinant human TSH
- the carbohydrate site of the TSH is a sialic acid on an amino acid, for example, asparagine residues ASN52 of the rhTSH a subunit, ASN78 of the rhTSH a subunit, or ASN23 of the rhTSH ⁇ subunit and combinations thereof.
- the carbohydrate site on TSH is galactose on an amino acid, for example, asparagine.
- the galactose group is located at a site on TSH, for example, amino acid ASN52 of the rhTSH a subunit, the amino acid ASN78 of the rhTSH a subunit, or the amino acid ASN23 of the rhTSH ⁇ subunit and combinations thereof.
- compositions of the invention exhibits an enhanced T4 response compared to a control.
- the polyalkylene glycol polymer attached to the carbohydrate site of TSH is polyethylene glycol (PEG).
- PEG polyethylene glycol
- the PEG has an average molecular weight of between about 3,000 and about 100,000 Daltons.
- one or more than one linear or branched PEG molecules is/are attached to TSH.
- a composition comprising a mutated Thyroid Stimulating Hormone (TSH) and at least one polyalkylene glycol polymer, wherein the mutated TSH comprises a TSH in which one or more amino acid residues has been substituted with a cysteine residue, wherein the polyalkylene glycol polymer is attached to the mutated TSH at the cysteine residues, and the mutated TSH is biologically active is described.
- TSH Thyroid Stimulating Hormone
- the amino acid residue that has been substituted with cysteine is located on the alpha subunit of TSH. In a particular embodiment, the amino acid residue that has been substituted with cysteine is located at an amino acid position of recombinant human TSH selected from the group consisting of ASN52, ASN78, MET71 , ASN66, THR69, and GLY22, and combinations thereof.
- the amino acid residue that has been substituted with cysteine is located on the beta subunit of TSH.
- the amino acid residue that has been substituted with cysteine is located at an amino acid position of recombinant human TSH selected from the group consisting of ASN23, VAL1 18, THR21 , GLU63, and ASP56, and combinations thereof.
- the mutated TSH with the cysteine modification has attached polyethylene glycol (PEG) as the polyalkylene glycol polymer.
- the PEG has an average molecular weight of between about 3,000 and about 100,000
- one or more than one linear or branched or combinations of PEG molecules is/are attached to TSH.
- compositions comprising an effective therapeutic amount of a composition of the invention along with a pharmaceutically acceptable carrier are described.
- compositions are used in methods of treating a thyroid condition in a patient in need thereof, by administering to the patient an effective amount of the pharmaceutical compositions of the invention.
- the thyroid condition is thyroid cancer.
- the composition is delivered by intramuscular injection.
- the invention also relates to methods of producing a PEGylated, biologically active thyroid stimulating hormone (TSH) comprising attaching at least one
- polyalkylene glycol polymer to a carbohydrate site of a TSH.
- the invention pertains to a method of producing a PEGylated, biologically active mutated thyroid stimulating hormone (TSH) comprising (a) introducing one or more additional cysteine residues into the amino acid sequence of TSH, thereby producing a mutated TSH; (b) attaching one or more polyalkylene glycol polymers to the one or more cysteine residues introduced in step (a), thereby producing a PEGylated, biologically active mutated TSH.
- the cysteine residue replaces an endogenous amino acid residue in TSH.
- the invention also relates to methods of treating a thyroid condition in a subject in need thereof, comprising administering an effective amount of a
- TSH thyroid stimulating hormone
- FIG. 1 A - FIG. 1 B are linear (FIG. 1 A) and three-dimensional (FIG. 1 B) schematics showing the structural modeling of the TSH subunits with PEGylation targets at N-termini, lysine amino acid residues and natural carbohydrate sites.
- FIG. 2A - FIG. 2D are Lysine- and N-terminal PEGylation reactions. SDS- PAGE analysis of PEGylation reaction mixture of Lysine PEGylation with different PEG:protein ratio are shown in FIG. 2A (Coomassie blue stain) and FIG. 2B (PEG stain). Reaction mixture with 1 :1 PEG:protein ratio is highlighted with boxes, which was further analyzed on a SEC-HPLC (FIG. 2C).
- FIG. 2D is a SEC-HPLC profile of an N-terminal PEGylation reaction at 2:1 PEG:protein ratio.
- FIG. 3 is a schematic showing three different carbohydrate PEGylation pathways.
- FIG. 4 is a structural model showing the beta-carbon positions of the selected mutants.
- FIG. 5 is a silver-stained non-reducing SDS-PAGE to assess expression level and oligomerization of the mutants.
- FIG. 6 is a gel showing the PEGylation of three cysteine site-directed mutants.
- FIG. 7 is a series of chromatograms of the SEC-HPLC profiles of several PEGylation reactions of mutant TSH.
- FIG. 8A - FIG. 8B are the optimization of aG22C TSH PEGylation conditions.
- FIG. 9A - FIG. 9B are confirmation of subunit- and site-specific conjugation for G22C TSH
- FIG. 10A - FIG. 10D are SDS-PAGE analysis of carbohydrate PEGylation reaction mixtures and purified carbohydrate PEGylated rhTSH conjugates.
- GAM(+) and GAM(-) reaction mixtures with varied (PEGProtein) molar ratios are shown in FIG. 10A and FIG. 10B, respectively.
- Purified carbohydrate PEGylated rhTSH conjugates are shown in FIG. 10C (PEG staining) and FIG. 10D (Coomassie blue staining).
- FIG. 1 1A - FIG. 1 1 B are SEC-HPLC profiles of the 40kD SAM reaction mixture (FIG. 1 1 A) and purified carbohydrate PEGylated rhTSH conjugates (FIG. 1 1 B).
- FIG. 12 is a tryptic peptide map of purified monoPEGylated 40kD SAM conjugate and the N-terminal sequencing result of the collected PEGylated tryptic fragments as explained in Example 10.
- FIG. 13A - FIG. 13C are determination of the relative amount of PEGylation on each subunit of purified carbohydrate PEGylated rhTSH conjugates as explained in Example 1 1 .
- FIG. 14A - FIG. 14C are graphs showing the results of receptor binding assays of PEGylated SAM, GAM(+), GAM(-) with various sized PEG.
- FIG. 15 is a graph of pharmacodynamic data of various PEGylated TSH showing the effects on T4 levels (pg/dL) over time relative to rhTSH control as explained in Example 13.
- FIG. 16 is a graph showing the concentration of various PEGylated TSH in serum over time compared with control as explained in Example 13.
- FIG. 17 is a graph showing the concentration of various PEGylated TSH in serum over time compared with control as explained in Example 14.
- FIG. 18A - FIG.18D are graphs showing the concentration of T4 in serum for various PEGylated TSH over time compared with control as explained in Example 16.
- FIG. 19A- FIG. 19C are graphs showing the concentration of T4 in serum for different doses of 40kD SAM over time compared with control as explained in
- FIG. 20A - FIG. 20B are graphs showing the concentration of T4 in serum for various PEGylated TSH over time compared with control as explained in Example 18.
- FIG. 21 A - FIG. 21 F are graphs showing the concentration of T4 in serum for various PEGylated TSH over time compared with control as explained in Example 19.
- FIG. 22 is a graph showing the concentration of T4 in serum for various PEGylated TSH over time compared with control as explained in Example 19.
- FIG. 23 is a graph showing the concentration of T4 in serum for 10kD multiSAM and 40kD SAM over time as explained in Example 20.
- FIG. 24 is a graph showing the concentration of T4 in serum for 40kD SAM and 40kD G22C over time compared with control as explained in Example 21 .
- THYROGEN ® Thyroid Stimulating Hormone (Genzyme Corp., NDA 2-898) is recombinant human TSH (rhTSH) currently marketed for the diagnosis and/or treatment of thyroid cancer. It is sold as a lyophilized powder for reconstitution with water prior to intramuscular administration.
- TSH thyroid-stimulating hormone
- conjugating a polyalkylene glycol polymer e.g., polyethylene glycol to TSH, beneficially altered the pharmacokinetic profile and pharmacodynamic profile of TSH.
- a polyalkylene glycol polymer e.g., polyethylene glycol
- N-terminal PEGylation, lysine PEGylation and carbohydrate polymer attachment of TSH were studied. The expectation was that N-terminal PEGylation of TSH would result in a TSH with prolonged duration of action, whereas lysine PEGylation and carbohydrate
- the invention is directed to a composition comprising Thyroid Stimulating Hormone (TSH), wherein at least one polyalkylene glycol polymer is attached to a carbohydrate site of the TSH. Also shown herein is site-specific PEGylation of TSH which has been mutated to introduce cysteine residues targeted for PEGylation that results in a positive effect on the potency of TSH.
- TSH Thyroid Stimulating Hormone
- site-specific PEGylation of TSH which has been mutated to introduce cysteine residues targeted for PEGylation that results in a positive effect on the potency of TSH.
- the invention is directed to a composition
- a composition comprising a mutated Thyroid Stimulating Hormone (TSH) and at least one polyalkylene glycol polymer, wherein the mutated TSH comprises a TSH in which one or more amino acid residues has been substituted with a cysteine residue, wherein the polyalkylene glycol polymer is attached to the mutated TSH at the cysteine residues, and the mutated TSH is biologically active.
- TSH Thyroid Stimulating Hormone
- the PEGylated TSH compositions provided herein have one or more of the following improved therapeutic index effects relative to TSH that is not conjugated to a polyethylene glycol polymer: enhanced solubility, decreased proteolysis, decreased immunogenicity, reduced rate of kidney clearance, prolonged blood circulation lifetime, increased duration of action and altered distribution and absorption.
- TSH is a glycoprotein having two subunits, the alpha and the beta subunit.
- the a (alpha) subunit i.e., chorionic gonadotropin alpha
- the ⁇ (beta) subunit is unique to TSH, and determines its function.
- rhTSH refers to recombinantly synthesized TSH.
- the recombinant DNA methods described herein are generally those set forth in Sambrook et ai, Molecular Cloning: A Laboratory Manual (Cold String Harbor Laboratory Press, 1989, and /or Current Protocols in Molecular Biology (Ausubel et ai, eds., Green Publishers Inc., and Wiley and Sons 1994, with Supplements).
- recombinant refers to a polynucleotide synthesized or otherwise manipulated in vitro (e.g., "recombinant polynucleotide”), and to methods of using recombinant polynucleotides to produce gene products in cells or other biological systems, and to a polypeptide ("recombinant protein") encoded by a recombinant polynucleotide.
- TSH used in the methods and compositions described herein can be purified from naturally-occurring mammalian sources, such as bovine, porcine, primate, or human, or alternatively isolated in a recombinant form from non-naturally-occurring sources using methods known in the art, such as described in U.S. Patent Nos.
- polysaccharides polymers of sialic acid, hydroxyethyl starch and polyalkylene glycols (e.g., polypropylene glycol, polybutylene glycol, polyethylene glycol) and other like moieties) can be used for effectively altering the in vivo efficacy of drugs by changing the balance between their pharmacodynamic and pharmacokinetic properties.
- polyalkylene glycols e.g., polypropylene glycol, polybutylene glycol, polyethylene glycol
- PK pharmacokinetic
- PD pharmacodynamic
- PEG polyethylene glycol
- PEG Polyethylene glycol
- PEG has been shown to improve plasma half-life of the injected PEGylated protein but as stated above, potency can be lost due to steric hindrance by PEG (Fishburn, C.S., J Pharm Sci 97:4167 (2008)). To avoid potency problems and generate desirable PD and PK profiles, a detailed understanding of structure-function relationship of the target protein to be PEGylated is helpful for generating PEGylated products that retain maximum functional activity.
- the TSH receptor and FSH receptor are highly homologous.
- the FSH- FSH receptor complex may serve as an initial model for TSH interaction with its receptor.
- the N-termini appear to be most distant from the receptor interaction region, and thus are likely ideal sites for PEG attachment to minimize loss of receptor binding upon PEGylation (See FIG.1 B). Since there are many lysines in TSH, and some of them are near the receptor binding site, PEG attachment at lysines would be expected to interfere with receptor binding.
- TSH is a glycosylated protein.
- the carbohydrate chains constitute 15-25% of its weight and include three asparagine-linked carbohydrate chains. Two of these chains are found on the alpha subunit of TSH, linked to asparagine 52 (ASN 52) and asparagine 78 (ASN 78), respectively, and the third is on the beta subunit of TSH, linked to asparagine 23(ASN 23).
- Asparagine-linked carbohydrate chains are potential PEG conjugation sites, however, on the TSH protein their respective proximities to the receptor interaction region, in particular, ASN 52, suggests that PEG conjugation at such sites would likely have a negative effect on receptor binding. Thus, selecting potential sites for conjugation of polymers to TSH presented much uncertainty.
- the polymer is polyalkylene glycol.
- polyalkeylene glycol includes polyethylene glycol (PEG), polypropylene glycol (PPG), polybutylene glycol, and the like.
- PEG polyethylene glycol
- PPG polypropylene glycol
- PAG polybutylene glycol
- the polymers can be linear or branched.
- the PAG is attached covalently to a molecule.
- attachment refers to the coupling or conjugation of a site or moiety of the TSH protein and a polymer, such as a polyalkylene glycol, e.g., either directly covalently joined to one another, or else is indirectly covalently joined to one another through an intervening moiety or moieties, such as a bridge, spacer, or linkage moiety or moieties.
- a polymer such as a polyalkylene glycol
- Carbohydrate site refers to a carbohydrate side chain found on TSH.
- the site can be a naturally glycosylated site or a site that has been enzymatically provided.
- the carbohydrate site is specifically selected to meet desired criteria for optimal TSH interaction with the receptor or for other functional requirements such as folding or mobility of the protein.
- the carbohydrate site is available for attachment of a polymer moiety such as PEG. Typical
- carbohydrate sites on the protein are asparagine, serine or threonine.
- TSH has three asparagine-linked carbohydrate chains.
- a single polymer is attached to TSH.
- multiple polymers are attached the TSH.
- the multiple attached polymers can be of a single specie or multiple species.
- a single PEG molecule is attached to the protein the protein is referred to as "monoPEGylated” and in the case where more than one PEG molecule is attached the protein is referred to as "multiPEGylated”.
- an individual PEG attached to the protein vis a vis other attached PEGs
- the molecular weight range of the PEG molecule is 3,000-100,000
- the molecular weight of the PEG attached is 5kD, 10kD, 20kD, 30kD, 40kD, or 60kD or combinations thereof.
- sialic acid-mediated PEGylation referred to as "SAM”
- GAM(-) galactose- mediated PEGylation
- GAM(+) sialic acid removal coupled with galactose-mediated PEGylation
- Site-specific methods of PEGylation to TSH are also included in the present invention.
- One such method attaches PEG to cysteine residues using cysteine- reactive PEGs.
- cysteine-reactive PEGs with different reactive groups ⁇ e.g., maleimide, vinylsulfone) and different size PEGs (2-40 kDa) are commercially available.
- these PEG reagents selectively attach to "free" cysteine residues, i.e., cysteine residues not involved in disulfide bonds in the target protein.
- one of two cysteines involved in a native disulfide bond may be deleted or substituted with another amino acid, leaving a native cysteine (the cysteine residue in the protein that normally would form a disulfide bond with the deleted or substituted cysteine residue) free and available for chemical modification.
- the amino acid substituted for the cysteine would be a neutral amino acid such as serine or alanine.
- cysteine residues can be introduced at any useful position on the protein.
- the newly added "free” cysteines can then serve as sites for the specific attachment of a PEG molecule using cysteine-reactive PEGs.
- the added cysteine residue is a substitution for an existing amino acid in a protein.
- Cysteine residues can be added preceding the amino-terminus of the protein, after the carboxy- terminus of the protein, or inserted between two amino acids in the protein.
- mutant TSH refers to a TSH where one or more amino acids of the wild-type TSH have been substituted with another amino acid that permits the formation of one or more glycosylation sites on the TSH molecule.
- TSH amino acid substitution
- at least one polymer such as a polyalkylene glycol.
- site-specific coupling with PEG molecules to the mutant TSH allows the generation of a TSH that possesses the pharmacodynamic and
- amino acid substitution with cysteine can be at the positions shown for the mutants in Tables 1 and 2.
- the substitution does not substantially change the structural characteristic of native TSH.
- the amino acid residue that has been substituted with cysteine is located on the alpha subunit of TSH or the beta subunit.
- the amino acid residue that has been substituted with cysteine is located at an amino acid position on the alpha subunit of recombinant human TSH selected from the group consisting of ASN52, ASN78, MET71 , ASN66, THR69, and GLY22, and combinations thereof or is located at an amino acid position on the beta subunit of recombinant human TSH selected from the group consisting of ASN23, VAL1 18, THR21 , GLU63, and ASP56, and combinations thereof.
- TSH compositions described herein are biologically active.
- Biologically active means that the TSH compositions of the invention have one or more of the following effects: longer duration of action, prolonged half-life, increased duration of T4 release, higher AUEC, positive shift in Tmax, and a lower peak-to-trough exposure that can reduce side effects.
- the compositions are compared to a control and the effect is substantially similar, somewhat less or somewhat greater or substantially greater.
- the biological activity of TSH compositions produced according to the present invention can be assessed using a variety of techniques known to those of skill in the art.
- control refers to native (wild-type) TSH or rhTSH.
- compositions of this invention when administered to a patient in need thereof ⁇ e.g., a thyroid cancer patient who had near-total or total thyroidectomy), will provide a blood serum concentration of TSH that has been tailored for the indicated use.
- the duration of action for the compositions described herein is increased by at least 2-fold over rhTSH.
- the duration of action for the TSH compositions is increased by at least 3-fold over rhTSH.
- compositions provide longer half-life (t1/2), compared to rhTSH.
- t1/2 is up to 23-fold longer than rhTSH in rat.
- the T4 level is shown to have a greater sustained effect over rhTSH.
- T4 level in rhTSH group was back to vehicle level by 48 hours post-dose whereas in one embodiment T4 was sustained for 168 hours post- dose.
- an effective Tmax refers to a “Time of the Peak Height Concentration", which is characteristic of the composition in reference.
- An “effective Cmax” as used herein refers to a “Peak Height Concentration”, which is characteristic of the composition in reference.
- an effective Tmax and Cmax provide a blood (or serum or plasma) concentration time curve in which the
- concentration of a drug is in a therapeutic range.
- t1/2 refers to the duration of action of a drug is known and the period of time required for the concentration or amount of drug in the body to be reduced by one-half.
- the nucleic acid sequence of the alpha subunit of human TSH is: gctcctgatgtgcaggattgcccagaatgcacgctacaggaaacccattcttctcccagccgggtgcccca atacttcagtgcatgggctgctgcttctagagcatatcccactccactaaggtccaagaagacgatgttggt ccaaaagaacgtcacctcagagtccacttgctgtgtagctaaatcatataacagggtcacagtaatggggg gtttcaaagtggagaaccacacggcgtgccactgcagtgcagtacttgttattatcacaaatct (SEQ. ID NO:
- amino acid sequence of the alpha subunit of human TSH is: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQK
- the nucleic acid sequence of the beta subunit of human TSH is:
- the amino acid sequence of the beta subunit of human TSH is:
- amino acid residues corresponding to amino acid residues of the subunits of TSH is intended to indicate the amino acid residues corresponding to the sequence of wild-type TSH subunits (SEQ ID NOs: 2 and 4 ) when the sequences are aligned.
- Amino acid sequence homology/identity is conveniently determined from aligned sequences, using a suitable computer program for sequence alignment, such as, e.g., the ClustalW program, version 1 .8, 1999 (Thompson et ai, 1994, Nucleic Acid Research, 22: 4673-4680).
- Sodium periodate oxidation 25 mM sodium periodate (Sigma, 31 1448) in 100 mM sodium acetate, pH 5.6 was added to 4.5 mg/ml TSH in 100 mM sodium acetate, pH 5.6 to final concentrations ranging from 0.2 mM to 2mM, in a glass vial wrapped in aluminum foil. The mixture was gently shaken on ice in the dark for 30 minutes. After 30 minutes, 50% glycerol was added to 3% of the reaction volume and then shaken for 15 minutes. The mixture was then buffer exchanged to 100 mM sodium acetate, pH 5.6, and concentrated to a TSH concentration of at least 4.3 mg/ml in order to perform the PEGylation.
- PEGylation The appropriate size aminoxy PEG (100 mg/ml in dH 2 O) was added to the oxidized TSH to varying (PEGProtein) molar ratios. The reaction volume was adjusted with 100 mM sodium acetate, pH 5.6, to a final TSH
- Neuraminidase Treatment 20 mU neuraminidase (His6-Clostridium
- neuramindase (520 mU/ul) was added per mg TSH and incubated at 37°C for 6 hours.
- Catalase/Galactose Oxidase Treatment 2 U Catalase (Sigma 442 U/ ⁇ ) per mg TSH was added to the neuraminidase treated TSH. 4 g galactose oxidase (Worthington GAO, 1 .2 mg/ml) per mg TSH was added to the mixture and then incubated at 37°C for 16 hours. After incubation the mixture was buffer-exchanged and concentrated into 100 mM sodium acetate, pH 5.6, to a concentration of at least 5.5 mg/ml in order to perform the PEGylation.
- PEGylation The appropriate size aminoxy PEG (100 mg/ml in dH 2 O) was added to the oxidized and buffer-exchanged TSH to the (PEGProtein) molar ratio of 1 :1 .
- the reaction volume was adjusted with 100 mM sodium acetate, pH 5.6, so that the final TSH concentration in the reaction was 5 mg/ml.
- the mixture was then incubated at 25°C for 16 hours with gentle shaking.
- a 50 molar excess of 0.05M hydroxylamine (m.w. 69.49) was then added to the reaction mix and incubated at 25°C for 6 hours with gentle shaking.
- Catalase/Galactose Oxidase Treatment 2 U Catalase (Sigma 442 U/ ⁇ ) per mg and 4 g galactose oxidase (Worthington GAO, 1 .2 mg/ml) per mg were added to TSH. The mixture was then incubated at 37°C for 16 hours. After incubation the mixture was buffer-exchanged and concentrated into 100 mM sodium acetate, pH 5.6, to a final concentration of at least 5.5 mg/ml in order to perform the PEGylation.
- PEGylation The appropriate size aminoxy PEG (100 mg/ml in dH 2 O) was added to the oxidized and buffer-exchanged TSH to the (PEGProtein) molar ratio of 1 :2. The reaction volume was adjusted with 100 mM sodium acetate, pH 5.6, so that the final TSH concentration in the reaction was 5 mg/ml. The mixture was then incubated at 25°C for 16 hours with gentle shaking. A 50 molar excess of 0.05M hydroxylamine (m.w. 69.49) was then added to the reaction mix and incubated at 25°C for 6 hours with gentle shaking.
- Appropriate size aldehyde PEG (100 mg/ml in reaction buffer) was added to a final concentration of 5 mg/ml rhTSH at varying (PEGProtein) ratios in 100mM sodium acetate, pH 5 or pH 5.6, with 20mM sodium cyanoborohydride. Incubation was done at 25°C for 16 hours or 8°C for up to 2 days, before quenching the reaction with 0.1 volume of 1 M Tris, pH 7.5, for 3 hours at 25°C.
- N-terminal mono-PEGylation with 40kD PEG resulted in an 1 1 .1 -fold decrease of in vitro TSH receptor binding affinity, compared to the rhTSH control.
- PEGylation was done at 25°C or 37°C for 1 .5 hours or 19.5 hours. The short incubation time tested (1 .5 hour) showed the same results as long incubation time (19.5 hours). This was presumably due to a rapid hydrolysis of NHS PEG in aqueous solution. The extent of PEGylation depended on the (PEGProtein) molar ratios, with higher PEG molar excess producing more multi- PEGylated conjugates.
- TSH single mutants were designed and prepared to introduce cysteines for site-specific PEGylation. These mutants were designed to minimize its effect on protein folding, receptor binding and for their potentials to be effectively conjugated.
- the mutation site should not be located at or adjacent to a receptor binding site; 2) The mutation site should not be located at or adjacent to an alpha/beta subunit dimerization interface; 3) The mutation site should not be located at or adjacent to a disulfide bond; 4) Avoid sites that when mutated, result in dramatic loss in specific activity based on reported literature; 5) The mutation site should be solvent exposed for subsequent PEGylation; 6) Select sites that would evenly cover most of the TSH surface opposite of the receptor binding site to fully evaluate PEGylation feasibility at each region.
- the beta-carbon positions of the selected mutants were exposed to solvent in our structure model as shown in FIG. 4. This predicts that these positions are likely to be accessible for PEGylation reagents when mutated to cysteine.
- the first three sites selected in Table 1 were native glycosylation sites in TSH.
- DNAs encoding rhTSH genes were synthesized and cloned into a Gateway entry vector (for example, pDONOR221 ).
- Oligonucleotide-based site-directed mutagenesis was used to introduce Cys mutations at multiple sites on both TSH subunits.
- the resulting wild-type and mutant vectors were shuffled into expression vectors (for example, pCEP4.DEST) via
- Proteins were prepared from transiently transfected HEK293 cell media and characterized by biochemical and cell-based assays, e.g., gel
- Cys mutants were prepared from CHO pools. DNAs encoding the wild-type (WT) and mutant rhTSH genes were codon-optimized and synthesized. These genes were cloned into CHO expression vectors (for example, pGEN600, pGEN620) for transient transfection into CHO cells. Transfected CHO cells were amplified with methotrexate (MTX) selection. The resulting CHO pools were used for scale-up protein production.
- WT wild-type
- mutant rhTSH genes were codon-optimized and synthesized. These genes were cloned into CHO expression vectors (for example, pGEN600, pGEN620) for transient transfection into CHO cells. Transfected CHO cells were amplified with methotrexate (MTX) selection. The resulting CHO pools were used for scale-up protein production.
- MTX methotrexate
- the cysteine TSH mutants were found to be capped at the introduced cysteine after expression and purification, thus additional reducing methodology was needed to create PEGylated mutant TSH.
- the mutant TSH first needed to be reduced with a mild reductant to release the cap from the introduced cysteine without irreversibly breaking the native disulfide bonds that would inactivate the protein.
- cysteine reductant was removed together with the cap to allow the disulfides to reform.
- the "de-capped” introduced cysteine was then selectively conjugated to a cysteine-reactive PEG reagent.
- TSH has 1 1 % cysteine content (23/210 amino acids), which makes the introduction of a 24 th cysteine into TSH without scrambling the native disulfides (and thus dramatically lowering receptor binding affinity) particularly difficult. Consequently, we had to screen multiple positions for introducing the cysteine mutation, with only a few that could be successfully conjugated with a PEG.
- G22C rhTSH was produced from CHO cells for site-specific PEGylation. Cysteine was added to G22C rhTSH (1 -2mg/ml) to a final concentration of 2mM after optimization experiments shown in FIG. 8. The protein was incubated overnight at 4°C to remove the cap on Cys22. The mixture was dialfiltered into PEGylation buffer (10 mM sodium phosphate, 2mM EDTA, pH 7.0). PEG was added to the protein to get 5x molar excess and incubated at 25°C for 2 hours. The PEGylation was stopped with 2x cysteine and the yield was checked by SEC-HPLC. The pH of the action mixture was lowered to pH5.0 and then loaded onto a monoS column for purification.
- FIG.8 The SEC-HPLC profiles of several PEGylation reactions are shown in FIG.8. Approximately 75% mono-PEGylated G22C TSH was obtained, which is very effective conjugation. Confirmation of subunit- and site-specific conjugation of G22C is shown in FIG. 9A - FIG. 9B.
- Samples were purified over a monoS column (GE Healthcare) and eluted using a gradient with 10mM sodium acetate pH5 and 10mM sodium acetate, 1 M sodium chloride pH5 at a flow rate of 4ml/min.
- the gradient started with 0% mobile phase B (10mM sodium acetate, 1 M sodium chloride pH5) then increased to 50% mobile phase B over 25 column volumes followed by 100% mobile phase B to wash the column.
- Pre-poured gradient gels (4-12% Bis Tris, Invitrogen) were loaded with 4-5 g TSH.
- MOPS (3-(N-morpholino)propanesulfonic acid ) running buffer (Invitrogen) was prepared.
- the electrophoresis apparatus was placed in an ice bucket with ice.
- the gel ran for approximately 50 minutes at 200V and was then rinsed three times, 5 minutes each with distilled water.
- 50 ml 5% barium chloride was added to the gel and then shaken for 10 minutes. The barium chloride was removed by rinsing the gel for 5 minutes with distilled water.
- the distilled water was then removed and the gel was first stained for PEG with 1 x potassium iodide/ iodine solution until the bands were visible.
- FIG. 12 shows the peptide map and N- terminal sequencing results of the 40 kD SAM conjugate. Only 3 tryptic
- glycopeptides (AT9, AT6, BT3) were detected, indicating the site specificity of carbohydrate PEGylation. Underlined N corresponds to N-linked glycosylation site.
- Subunit-specific PEGylation was calculated by measuring the relative amount of unPEGylated a and ⁇ subunits after isolating them from the PEGylated subunits, using two consecutive reversed-phase HPLC runs. This method of inference was used because chromatographic conditions that resolve PEGylated a and ⁇ subunits could not be identified. Samples (100 g) were concentrated to 20 ⁇ by centrifugal ultrafiltration and then denatured in 6 M guanidine hydrochloride, 10 mM sodium phosphate, 100 mM sodium chloride, pH 7.0.
- the samples were adjusted to 50 ⁇ with water and then reduced by addition of 4.7 ⁇ of 2 M dithiothreitol and 150 ⁇ of 6 M guanidine hydrochloride, 0.1 M Tris, pH 8.5, overlayed with nitrogen and incubated at 25°C overnight. Free thiols were then alkylated by adding 9.3 ⁇ of 2 M iodoacetamide, overlaying with nitrogen, and incubating for 2 hr at 25°C. The alkylation reaction was quenched by adding 150 ⁇ of 0.25% thfluoroacetic acid. Reduced and alkylated unPEGylated TSH subunits were profiled by the second reversed-phase HPLC run.
- the HPLC column setup was identical to that indicated above with the exception that solvent A consisted of 0.1 % trifluoroacetic acid in water and solvent B consisted of 0.08% trifluoroacetic acid in acetonitrile and the column was held at 50°C.
- the column was eluted with a linear gradient of 2-75%B in 15 min at 0.3 ml/min.
- the relative percentage of unPEGylated a vs. ⁇ subunits was determined by integration of the resulting A214 nm chromatograms (FIG. 13C) from triple injections per sample. The relative percentage of PEGylated a vs. ⁇ subunits was then taken as the inverse of these values.
- Purified PEGylated conjugates were analyzed by in vitro porcine TSH receptor binding assay using the TSH Receptor Autoantibody 2nd Generation ELISA kit from RSR Limited (Kronus, Star, ID). Instead of using the biotinylated human monoclonal autoantibody to the TSH receptor provided by the kit, we biotinylated Thyrogen ® (rhTSH) to use for competitive inhibition of binding to TSH receptor. Binding of biotinylated rhTSH to immobilized porcine TSH receptor was inhibited by either rhTSH control or PEGylated rhTSH conjugates and IC 5 o values were measured.
- Thyrogen ® was biotinylated with 1 .7 to 1 .8 biotins per protein using the
- ChromaLinkTM Biotin Labeling Reagent according to the manufacturer's protocol (QED Bioscience Inc., San Diego, CA) and buffer exchanged into 50mM sodium phosphate, 150mM sodium chloride pH 7.0 with a ZebaTM Desalt Spin Column (Thermo Scientific, Rockford, IL).
- In vitro measurement of receptor binding was performed by competition of biotinylated Thyrogen ® and PEG-rhTSH conjugate for binding to porcine TSH receptor immobilized onto 96-well plates supplied with the TSH Receptor Autoantibody 2 nd Generation ELISA kit from RSR Limited (Kronus, Star, ID).
- PEG-rhTSH conjugates were serially diluted 1 :5 from 16 ⁇ to 41 pM in assay buffer (100mM HEPES pH 7.5, 20mM EDTA, 1 % BSA, 0.5% Triton X-100) and mixed 1 :1 with biotinylated Thyrogen ® diluted 1000-fold in assay buffer. The mixture was added to each receptor-coated well and incubated at 25°C for 25 minutes.
- Unbound rhTSH was washed away and streptavidin peroxidase was added at 25°C for 20 minutes according to the RSR Limited ELISA protocol to determine the amount of biotinylated Thyrogen ® bound to the plate.
- the plate was then washed three times to remove excess unbound streptavidin peroxidase and then tetramethylbenzidine (TMB) was added to each well and incubated in the dark at 25°C for 30 minutes.
- TMB tetramethylbenzidine
- the data was fit using a sigmoidal dose response equation with GraphPad Prism software to generate IC 5 o values.
- N-terminus and lysine PEGylation yielded conjugates with lower TSH receptor affinity than carbohydrate conjugation.
- N-terminal mono-PEGylation with 40kD PEG resulted in 10.8-fold lower receptor binding affinity compared to the TSH control.
- Lysine-PEGylation with 40kD PEG resulted in 31 .2-fold lower receptor binding affinity compared to the TSH control.
- GAM+ mono-PEGylation resulted in 2.2- fold lower receptor binding affinity for 20kD PEG conjugation and 3.6-fold lower receptor binding affinity for 40kD PEG conjugation.
- SAM mono-PEGylation also resulted in moderate decrease in in vitro TSH receptor binding affinity compared to N- terminal PEGylation, ranging from 2.1 - to 5.3-fold decrease, depending on the size of PEG conjugated.
- GAM(-) mono-PEGylation caused the greatest loss among all the carbohydrate PEGylation strategies, with 20kD PEG conjugation causing 2.7-fold decrease and 40kD PEG conjugation, 8.0-fold decrease in in vitro TSH receptor binding affinity. (See Tables 3a and 3b and FIG. 14).
- rhTSH The pharmacokinetics of rhTSH and PEGylated rhTSH (20kD SAM, 20kD GAM(-), 20kD GAM(+), 40kD GAM(+)) was evaluated in male and female rats following a single intramuscular (IM) injection.
- rhTSH or PEGylated rhTSH (20kD SAM, 20kD GAM(-), 20kD GAM(+), 40kD GAM(+)) was administered IM to fasted male and female jugular vein cannulated rats at a dose of 0.5 mg/kg. Due to dose volume limitations, animals received test articles in the form of two or three intramuscular injections into quadriceps muscle. Legs were alternated for dosing. Blood samples were collected from the animals pre-dose and at the following post-dosage time points: 0.5, 1 , 2, 4, 8, 24, and 48 hours. Food was removed from the animal cages on the evening prior to test article administration. Animals had access to water during this time.
- the PK data showed that 20 kD SAM and 20 kD GAM(-) have >5-fold prolonged t1 /2, prolonged Tmax and increased exposure (area under the curve, AUC) compared to rhTSH control.
- the PK profile of 20 kD GAM(+) showed less improvement compared to 20kD SAM and 20kD GAM(-), and 40kD GAM(+) showed only a moderate improvement.
- Increased value of Vz apparent volume of distribution
- the serum T4 concentration was measured to collect the pharmacodynamic data (See FIG. 15), using ACE clinical chemistry system (Alfa Wassermann Diagnostic Technologies, LLC) according to
- PEGylated rhTSH (10kD multiSAM, 10kD SAM, 40kD SAM, 40kD GAM(-)) was evaluated in male and female rats following a single intramuscular (IM) injection.
- rhTSH or PEGylated rhTSH (1 OkD multiSAM, 10kD SAM, 40kD SAM, 40kD GAM(-)) was administered IM to fasted male and female jugular vein cannulated rats at a dose of 0.5 mg/kg. Due to dose volume limitations, animals received test articles in the form of two or three intramuscular injections into quadriceps muscle. Legs were alternated for dosing. Blood samples were from the animals pre-dose and at the following post-dosage time points: 0.5, 1 , 3, 6, 24, 48, 72, and 96 hours. Food was removed from the animal cages on the evening prior to test article administration. Animals had access to water during this time. Food was added back to cages following pre-dose sample collections and test article
- Pre-dose 0.5, 1 , 3, 6, 24,
- Pre-dose 0.5, 1 , 3, 6, 24,
- the PK data showed that 10 kD multi-SAM, 40 kD SAM, and 40 kD GAM(-) have 14 ⁇ 23-fold prolonged t1 /2, prolonged Tmax and increased exposure (area under the curve, AUC) compared to rhTSH control. (See FIG. 17 and Table 7)
- the improvement observed in the PK profiles of 40 kD SAM and 40 kD GAM(-) is greater than that of 20 kD SAM and 20 kD GAM(-) in Example 13.
- Tmax PEG-size dependent delay in concentration peak time (Tmax) was also observed.
- 10kD, 20kD and 40kD SAM showed Tmax at 5.40 ⁇ 1 .34 hour, 16.0 ⁇ 8.76 hours and 30.0 ⁇ 12.0 hours, respectively, compared to rhTSH control at 2.00 ⁇ 0.00 hour or 1 .50 ⁇ 1 .18 hour. (See Table 5 and Table 7).
- Example 15 Pharmacokinetic Assay: rhTSH or PEGylated rhTSH ELISA
- High binding 96-well ELISA plates were coated with murine anti-hCG capture antibody at 1 .33pg/ml_ diluted in 0.1 M sodium bicarbonate buffer at pH 9.2, and added at 10 ⁇ _ per well.
- a standard rhTSH or PEGylated rhTSH curve was prepared from purified protein and diluted in sample dilution buffer (SDB) consisting of 1 .0% w/v BSA in 1 X plate wash.
- SDB sample dilution buffer
- the standard was diluted from 25-1 .463 ng/mL, 8.334- 0.488 ng/mL or 5.556 to 0.325 ng/mL using a 2:3 serial dilution scheme, depending on the qualified linear range of rhTSH or PEGylated rhTSH species per assay.
- Samples were diluted in SDB at no less than a 1 :10 dilution.
- 500 ng/mL, and 25 ng/mL rhTSH controls prepared in normal rat serum are diluted 1 :100 and 1 :10 respectively in SDB.
- a 0.5 ng/mL rhTSH control prepared in SDB was added undiluted.
- Coated plates were washed and 100 L of samples, standards and controls were added to the plates and incubated for 1 hour at 37°C.
- Biotinylated anti-rhTSH monoclonal detection antibody (clone TS8) was diluted in SDB according to the appropriate dilution specific to each lot. Plates were washed and 100 L of the diluted biotinylated detection antibody was added to the wells and incubated for 1 hour at 37°C.
- SA-HRP Streptavidin-horseradish peroxidase conjugate
- TMB tetramethyl benzidine
- TMB stop buffer 100 L was added to all wells, and the plate was read at 450nm.
- mice The pharmacodynamics of PEGylated rhTSH was evaluated in male mice following a single IP injection, three days post T3 pellet implantation.
- the endogenous mouse T4 was suppressed during the study period by implantation of slow-release T3 pellet three days prior to dosing (See vehicle group in FIG. 18A - FIG. 18D). Therefore, only the amount of T4 released by rhTSH control or PEGylated rhTSH conjugates was measured. Due to limited blood volume of mouse, four time points of 6, 24, 48 and 72 hours post-dose were collected.
- mice were anesthetized with isoflurane and a 0.1 mg T3 pellet (T-261 , Alternative Research of America) was implanted subcutaneously using a trochar. At three days post pellet implantation, a single dose of rhTSH (0.4 or 4.0 mg/kg) or PEGylated rhTSH (4 mg/kg) was administered IP to male mice (ICR strain, 6 weeks of age, Taconic Farms). Animals were anesthetized with isoflurane and blood samples were collected from the retro-orbital plexus. Group 1 blood samples were collected pre-dose (animals 1 -4), 6 (animals 5-8), 24, 48 and 72 hours following test article administration.
- Blood samples from all other groups were collected at 6, 24, 48, and 72 hours following test article administration. Approximately 60 ⁇ of whole blood was collected into micro-hematocrit capillary tubes and processed for serum. Following the last sample collection, animals were euthanized with CO 2 . All serum samples were stored at -80°C until they were analyzed for T4 concentrations by the ACE® clinical chemistry T4 assay. Serum T4 concentration was measured by ACE clinical chemistry system (Alfa Wassermann Diagnostic Technologies, LLC) according to manufacturer's protocol.
- 10 KD Multi SAM and 40 KD SAM appeared to be promising candidates based on the PK (Example 14) and PD (Example 16) data.
- 10 KD Multi-GAM(+) appeared promising as well, but did not have as much improved duration of action compared to the two more promising candidates.
- PEGylated rhTSH 40kD SAM was evaluated at three different dose levels in male mice following a single intraperitoneal (IP) injection, three days post T3 pellet implantation.
- Group 1 blood samples were collected 6 (animals 1 -4), 24, 48, 72 and 96 (animals 5-8) hours following test article administration. Blood samples from all other groups were collected at 6, 24, 48, and 72 hours following test article administration. Approximately 60 ⁇ of whole blood was collected into micro- hematocrit capillary tubes and processed for serum. Following the last sample collection, animals were euthanized with CO2. All serum samples were stored at - 80°C until they were analyzed for T4 concentrations by the ACE® clinical chemistry T4 assay. Serum T4 concentration was measured by ACE clinical chemistry system (Alfa Wassermann Diagnostic Technologies, LLC) according to manufacturer's protocol.
- Example 18 Pharmacodynamic Analysis of PEGylated rhTSH in Male and Female Sprague Dawley Rats Following a Single IM Injection, Three Days Post T3 Pellet Implantation
- the pharmacodynamics of PEGylated rhTSH was evaluated in male and female rats following a single intramuscular (IM) injection, three days post T3 pellet implantation.
- T3 pellet T-261 , Innovative Research of America
- rhTSH or PEGylated rhTSH was administered IM to male and female jugular vein cannulated rats at a dose of 0.0 mg/kg (vehicle), 0.04 mg/kg, 0.4 mg/kg, or 0.65 mg/kg.
- 0.65 mg/kg dose was determined based on the content of monoPEGylated species.
- mice received test articles in the form of two intramuscular injections into the quadriceps muscle. Legs were alternated for dosing. Blood samples were collected from the animals pre-dose and at the following post-dosage time points: 1 , 3, 6, 24, 48, 72, 96, 120, 144, and 168 hours. Blood was collected from the single port jugular cannula. Approximately 250 ⁇ of whole blood was collected into serum separator tubes and the blood was allowed to clot for a minimum of 30 minutes. Tubes were spun in a centrifuge at 10,000 rpm for 5 minutes and the serum was separated into two tubes (-50 ⁇ each).
- Tmax of rhTSH occurred at 6 hours post-dose and returned to baseline (i.e., vehicle group levels) by 72 hour post-dose.
- 10 KD multiSAM Tmax occurred at 24 hours post-dose and returned to baseline at 72 hours post-dose for 0.04 mg/kg dose and 96 hours post- dose for 0.4 mg/kg dose.
- Low dose data showed decreased potency of 10 KD multiSAM relative to rhTSH in this model, which may reflect decreased TSH receptor binding affinity.
- High dose data confirmed enhanced pharmacodynamic effects with 10 KD multiSAM at 48 and 72 hours post-dose.
- All candidates including 40kD multiSAM and 50kD multiSAM showed enhanced T4 response compared to rhTSH at 0.4 mg/kg, which might have been in part mediated by shift in Tmax to 24 hours post- dose. Prolonged pharmacodynamic activity was observed through 96-120 hours post-dose. (For 40kD multiSAM and 50kD multiSAM, 0.65 mg/kg dose equaled to 0.4 mg/kg based on the percentage content of monoPEGylated species in these conjugates.) For all test articles, approximately 95% of the pharmacodynamic effects were observed within 96 hours post-dose following intramuscular administration. Higher AUECs observed with PEGylated conjugates is driven by higher T4 levels between 24-96 hours post-dose.
- Example 19 Pharmacodynamic Analysis of PEGylated rhTSH in Male and Female Sprague Dawley Rats Following a Single IM Injection, Three Days Post T3 Pellet Implantation
- the pharmacodynamics of PEGylated rhTSH was evaluated in male and female rats following a single intramuscular (IM) injection, three days post T3 pellet implantation.
- T3 pellet T-261 , Innovative Research of America
- rhTSH or PEGylated rhTSH were administered IM to male and female jugular vein cannulated rats at a dose of 0.0 mg/kg (vehicle), 0.4 mg/kg, or 0.65 mg/kg.
- 0.65 mg/kg dose was determined based on the content of monoPEGylated species. Due to dose volume limitations, animals received test articles in the form of two intramuscular injections into the quadriceps muscle.
- Example 20 Pharmacodynamic Assessment of PEGylated rhTSH (10KD MultiSAM and 40KD SAM) The pharmacodynamics of PEGylated rhTSH (10KD MultiSAM and 40KD SAM) was evaluated in male and female rats following a single intramuscular (IM) injection, three days post T3 pellet implantation.
- IM intramuscular
- T3 pellet T-261 , Innovative Research of America
- T-261 T3 pellet
- a single dose of vehicle or PEGylated rhTSH (10KD MultiSAM or 40KD SAM) was administered IM to male and female jugular vein cannulated rats at a dose of 0.0 mg/kg (vehicle), 0.1 , 0.2, 0.4, or 1 .0 mg/kg as specified in Table 15. Due to dose volume limitations, animals received test articles in the form of two intramuscular injections into the quadriceps muscle. Legs were alternated for dosing.
- Blood samples were collected from the animals pre-dose and at the following post-dosage time points: 6, 24, 48, 72, 96, and 168 hours. Blood was collected from the single port jugular cannula. Approximately 250 ⁇ of whole blood was collected into serum separator tubes and the blood was allowed to clot for a minimum of 30 minutes. Tubes were spun in a centrifuge at 10,000 rpm for 5 minutes and the serum was separated into two tubes (-50 ⁇ each). All samples were stored at -80°C until they were analyzed for T4 concentrations by the ACE clinical chemistry T4 assay. Following the last sample collection animals were euthanized with CO2. Serum T4 concentration was measured by ACE clinical chemistry system (Alfa Wassermann Diagnostic Technologies, LLC) according to manufacturer's protocol.
- Example 21 Pharmacodynamic (PD) Evaluation of PEGylated Cys-Mutant TSH (40KD G22C) Compared to Two Dose Levels of PEGylated rhTSH (40KD SAM) in Male and Female Sprague Dawley Rats Following a Single IM Injection, Three Days Post T3 Pellet Implantation
- T3 pellet T-261 , Innovative Research of America
- T-261 1 .5 mg T3 pellet
- T-261 1 .5 mg T3 pellet
- a single dose of vehicle, rhTSH, PEGylated rhTSH (40KD SAM), or PEGylated Cys-mutant TSH (40KD G22C) was administered IM to male and female jugular vein cannulated rats at a dose of 0.0 mg/kg (vehicle), 0.2 or 0.4 mg/kg. Due to dose volume limitations, animals received test articles in the form of two intramuscular injections into the quadriceps muscle. Legs were alternated for dosing.
- Blood samples were collected from the animals pre-dose and at the following post-dosage time points: 6, 24, 48, 72, 96, and 168 hours. Blood was collected from the single port jugular cannula. Approximately 250 ⁇ of whole blood was collected into serum separator tubes and the blood was allowed to clot for a minimum of 30 minutes. Tubes were spun in a centrifuge at 10,000 rpm for 5 minutes and the serum was separated into two tubes (-50 ⁇ each). All samples were stored at -80°C until they were analyzed for T4 concentrations by the ACE clinical chemistry T4 assay. Following the last sample collection animals were euthanized with CO2. Serum T4 concentration was measured by ACE clinical chemistry system (Alfa Wassermann Diagnostic Technologies, LLC) according to manufacturer's protocol.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Reproductive Health (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Inorganic Chemistry (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Priority Applications (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020147019638A KR102071731B1 (en) | 2011-12-19 | 2012-12-04 | Thyroid stimulating hormone compositions |
EP12812433.6A EP2793948B1 (en) | 2011-12-19 | 2012-12-04 | Thyroid stimulating hormone compositions |
JP2014547275A JP6255348B2 (en) | 2011-12-19 | 2012-12-04 | Thyroid-stimulating hormone composition |
CN201280069717.0A CN104220097B (en) | 2011-12-19 | 2012-12-04 | Thyrotropic hormone composition |
BR112014014868-6A BR112014014868B1 (en) | 2011-12-19 | 2012-12-04 | THYROID STIMULATING HORMONE COMPOSITIONS, METHODS OF PRODUCING THE SAME AND USE OF SUCH COMPOSITIONS |
US14/308,284 US20140357846A1 (en) | 2011-12-19 | 2014-06-18 | Thyroid stimulating hormone compositions |
HK14111926.0A HK1198424A1 (en) | 2011-12-19 | 2014-11-26 | Thyroid stimulating hormone compositions |
US15/096,879 US20170065725A1 (en) | 2011-12-19 | 2016-04-12 | Thyroid stimulating hormone compositions |
US17/751,433 US20230126645A1 (en) | 2011-12-19 | 2022-05-23 | Thyroid stimulating hormone compositions |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201161577412P | 2011-12-19 | 2011-12-19 | |
US61/577,412 | 2011-12-19 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/308,284 Continuation US20140357846A1 (en) | 2011-12-19 | 2014-06-18 | Thyroid stimulating hormone compositions |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2013095905A1 true WO2013095905A1 (en) | 2013-06-27 |
Family
ID=47520247
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2012/067705 WO2013095905A1 (en) | 2011-12-19 | 2012-12-04 | Thyroid stimulating hormone compositions |
Country Status (8)
Country | Link |
---|---|
US (4) | US20140357846A1 (en) |
EP (1) | EP2793948B1 (en) |
JP (1) | JP6255348B2 (en) |
KR (1) | KR102071731B1 (en) |
CN (1) | CN104220097B (en) |
BR (1) | BR112014014868B1 (en) |
HK (1) | HK1198424A1 (en) |
WO (1) | WO2013095905A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20150051159A (en) | 2013-10-29 | 2015-05-11 | 한국 한의학 연구원 | Composition for preventing or treating thyroid disorders comprising phytolacca esculenta houttuyn extracts or fraction thereof |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR101794289B1 (en) * | 2015-11-05 | 2017-11-06 | 주식회사 프로젠 | Composition comprising recombinant human thyroid stimulating hormone and purification method for the recombinant human thyroid stimulating hormone |
MA45473A (en) * | 2016-04-04 | 2019-02-13 | Shire Human Genetic Therapies | CONJUGATE C1 ESTERASE INHIBITOR AND ITS USES |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4179337A (en) * | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
US5840566A (en) | 1985-12-11 | 1998-11-24 | Sloan-Kettering Institute For Cancer Research | Isolation of a gene encoding human thyrotropin beta subunit |
WO2004009672A1 (en) * | 2002-07-19 | 2004-01-29 | Nektar Therapeutics Uk Ltd | Polyalkylene glycols, derivatives and conjugates thereof in particulate form |
WO2005056046A2 (en) * | 2003-12-05 | 2005-06-23 | Zymogenetics, Inc. | Methods for treating inflammation using thyroid stimulating hormone |
WO2008036271A1 (en) * | 2006-09-19 | 2008-03-27 | Genzyme Corporation | Formulations for therapeutic administration of thyroid stimulating hormone (tsh) |
WO2012073125A1 (en) * | 2010-12-03 | 2012-06-07 | Universita' Degli Studi Magna Graecia Di Catanzaro | Tsh-conjugated nanocarrier for the treatment of thyroid cancer |
Family Cites Families (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2305804B1 (en) * | 1999-01-14 | 2015-05-06 | Bolder Biotechnology, Inc. | MonoPEGylated human growth hormone |
EP1539208A2 (en) * | 2002-06-28 | 2005-06-15 | Nastech Pharmaceutical Company Inc. | Compositions and methods for modulating physiology of epithelial junctional adhesion molecules for enhanced mucosal delivery of therapeutic compounds |
KR101145990B1 (en) * | 2002-12-19 | 2012-08-23 | 더 거번먼트 오브 더 유나이티드 스테이츠 오브 어메리카 애즈 레프리젠티드 바이 더 세크러터리 오브 더 디파트먼트 오브 헬쓰 앤드 휴먼 써비시즈 | Cyanovirin variant-polymer conjugates |
WO2006127896A2 (en) * | 2005-05-25 | 2006-11-30 | Neose Technologies, Inc. | Glycopegylated factor ix |
US20080171696A1 (en) * | 2005-10-21 | 2008-07-17 | Avigenics, Inc. | Pharmacodynamically enhanced therapeutic proteins |
WO2008019036A2 (en) * | 2006-08-04 | 2008-02-14 | Pharmathene Inc. | Long half-life recombinant butyrylcholinesterase |
US20100286067A1 (en) * | 2008-01-08 | 2010-11-11 | Biogenerix Ag | Glycoconjugation of polypeptides using oligosaccharyltransferases |
EP2569331A1 (en) * | 2010-05-10 | 2013-03-20 | Perseid Therapeutics LLC | Polypeptide inhibitors of vla4 |
-
2012
- 2012-12-04 EP EP12812433.6A patent/EP2793948B1/en active Active
- 2012-12-04 BR BR112014014868-6A patent/BR112014014868B1/en active IP Right Grant
- 2012-12-04 KR KR1020147019638A patent/KR102071731B1/en active IP Right Grant
- 2012-12-04 CN CN201280069717.0A patent/CN104220097B/en active Active
- 2012-12-04 WO PCT/US2012/067705 patent/WO2013095905A1/en active Application Filing
- 2012-12-04 JP JP2014547275A patent/JP6255348B2/en active Active
-
2014
- 2014-06-18 US US14/308,284 patent/US20140357846A1/en not_active Abandoned
- 2014-11-26 HK HK14111926.0A patent/HK1198424A1/en unknown
-
2016
- 2016-04-12 US US15/096,879 patent/US20170065725A1/en not_active Abandoned
-
2017
- 2017-12-22 US US15/852,581 patent/US20180326082A1/en not_active Abandoned
-
2022
- 2022-05-23 US US17/751,433 patent/US20230126645A1/en active Pending
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4179337A (en) * | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
US5840566A (en) | 1985-12-11 | 1998-11-24 | Sloan-Kettering Institute For Cancer Research | Isolation of a gene encoding human thyrotropin beta subunit |
US6365127B1 (en) | 1985-12-11 | 2002-04-02 | Sloan-Kettering Institute For Cancer Research | Isolation of a gene encoding human thyrotropin beta subunit |
WO2004009672A1 (en) * | 2002-07-19 | 2004-01-29 | Nektar Therapeutics Uk Ltd | Polyalkylene glycols, derivatives and conjugates thereof in particulate form |
WO2005056046A2 (en) * | 2003-12-05 | 2005-06-23 | Zymogenetics, Inc. | Methods for treating inflammation using thyroid stimulating hormone |
WO2008036271A1 (en) * | 2006-09-19 | 2008-03-27 | Genzyme Corporation | Formulations for therapeutic administration of thyroid stimulating hormone (tsh) |
WO2012073125A1 (en) * | 2010-12-03 | 2012-06-07 | Universita' Degli Studi Magna Graecia Di Catanzaro | Tsh-conjugated nanocarrier for the treatment of thyroid cancer |
Non-Patent Citations (10)
Title |
---|
"Current Protocols in Molecular Biology", 1994, GREEN PUBLISHERS INC., AND WILEY AND SONS |
CLUSTALW PROGRAM, 1999 |
FAN; HENDRICKSON, NATURE, vol. 433, 2004, pages 269 |
FISHBUM, C.S., J PHARM SCI, vol. 97, 2008, pages 4167 |
MEI ET AL., BLOOD, vol. 116, 2010, pages 270 - 9 |
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD STRING HARBOR LABORATORY PRESS |
SZKUDLINSKI ET AL., PHYSIOL REV., vol. 82, 2002, pages 473 |
THOMPSON ET AL., NUCLEIC ACID RESEARCH, vol. 22, 1994, pages 4673 - 4680 |
THOTAKURA, N.R.; SZKUDLINSKI, M.W.; WEINTRAUB, B.D., GLYCOBIOLOGY, vol. 4, 1994, pages 525 - 533 |
YANG ET AL., PROTEIN ENGINEERING, vol. 16, 2003, pages 761 - 770 |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20150051159A (en) | 2013-10-29 | 2015-05-11 | 한국 한의학 연구원 | Composition for preventing or treating thyroid disorders comprising phytolacca esculenta houttuyn extracts or fraction thereof |
Also Published As
Publication number | Publication date |
---|---|
KR20140103165A (en) | 2014-08-25 |
CN104220097B (en) | 2019-08-09 |
US20230126645A1 (en) | 2023-04-27 |
BR112014014868A2 (en) | 2020-10-27 |
HK1198424A1 (en) | 2015-04-24 |
CN104220097A (en) | 2014-12-17 |
US20170065725A1 (en) | 2017-03-09 |
EP2793948B1 (en) | 2022-03-23 |
JP2015502363A (en) | 2015-01-22 |
JP6255348B2 (en) | 2017-12-27 |
US20140357846A1 (en) | 2014-12-04 |
BR112014014868B1 (en) | 2022-12-27 |
KR102071731B1 (en) | 2020-01-30 |
EP2793948A1 (en) | 2014-10-29 |
US20180326082A1 (en) | 2018-11-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230126645A1 (en) | Thyroid stimulating hormone compositions | |
EP2371856B1 (en) | Site-directed modification of FVIII | |
WO2008017603A1 (en) | G-csf site-specific mono-conjugates | |
WO2012109975A1 (en) | Pegylated analogue protein of canine urate oxidase, preparation method and use thereof | |
TWI281864B (en) | N-terminally monopegylated human growth hormone conjugates and process for their preparation | |
ES2386575T3 (en) | Interferon alfa 2a modified by polyethylene glycol, its synthesis process and its application | |
AU2020256332A1 (en) | Site-directed modification of FVIII | |
KR20180087864A (en) | Novel exenatide variants-polymer complex |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12812433 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2014547275 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 20147019638 Country of ref document: KR Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2012812433 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112014014868 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 112014014868 Country of ref document: BR Kind code of ref document: A2 Effective date: 20140617 |