WO2013081571A2 - Isolated lyssavirus nucleic acid and protein sequences - Google Patents
Isolated lyssavirus nucleic acid and protein sequences Download PDFInfo
- Publication number
- WO2013081571A2 WO2013081571A2 PCT/US2011/021309 US2011021309W WO2013081571A2 WO 2013081571 A2 WO2013081571 A2 WO 2013081571A2 US 2011021309 W US2011021309 W US 2011021309W WO 2013081571 A2 WO2013081571 A2 WO 2013081571A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- nucleic acid
- lyssavirus
- virus
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/70—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving virus or bacteriophage
- C12Q1/701—Specific hybridization probes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20111—Lyssavirus, e.g. rabies virus
- C12N2760/20121—Viruses as such, e.g. new isolates, mutants or their genomic sequences
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20111—Lyssavirus, e.g. rabies virus
- C12N2760/20122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20111—Lyssavirus, e.g. rabies virus
- C12N2760/20134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/145—Rhabdoviridae, e.g. rabies virus, Duvenhage virus, Mokola virus or vesicular stomatitis virus
Definitions
- the present invention relates to nucleic acid sequences of a virus. More particularly, the invention relates to a new representative species of the Lyssavirus genus. The invention relates to isolated nucleic acid sequences of a newly discovered Shimoni bat virus.
- Rabies is an ancient disease with the earliest reports possibly dated to the Old World before 2300 B.C. Rabies remains a world health threat due to remaining lack of effective control measures in animal reservoir populations and a widespread lack of human access to vaccination. Today, more than 50,000 people annually die of rabies, particularly in Asia and Africa.
- Lyssaviruses are RNA viruses with single-strand, negative-sense genomes responsible for rabies-like diseases in mammals.
- the Lyssavirus genus family Rhabdoviridae
- the type species Rabies virus (RABV) is distributed worldwide among mammalian reservoirs - carnivores and bats.
- Lagos bat virus (LBV) circulates among pteropid bats in sub-Saharan Africa, with infrequent spill-overs into other mammals.
- Mokola virus (MOKV) has been isolated in sub-Saharan Africa from shrews, domestic cats and dogs, a rodent and two humans. The reservoir hosts of MOKV have not yet been established.
- Duvenhage virus was isolated from insectivorous bats and humans that died after bat bites in sub-Saharan Africa.
- European bat lyssavirus, type 1 EBLV-1
- EBLV-1 European bat lyssavirus
- Serotine bat Eptesicus serotinus
- Human cases of EBLV-1 infection have been described as well.
- European bat lyssavirus, type 2 EBLV-2 was isolated primarily from insectivorous bats of the Myotis genus and from humans that died after bat bites in north-western Europe.
- Phylogroup I includes RABV, DUVV, EBLV-1, EBLV-2, ABLV, ARAV, KHUV and IRKV.
- Phylogroup II includes LBV and MOKV.
- the WCBV cannot be included in any of these phylogroups, and should be considered as a member of an independent phylogroup III.
- the operational term 'genotype' has been used for lyssavirus classification since the time when molecular techniques replaced serotyping for classification purposes.
- Demarcation of genotypes has been based largely on genetic distances (identity values) between members of the genus, and on the bootstrap support of phylogenetic constructions.
- identity values genetic distances between members of the genus
- LBV was suggested to be sub-divided into at least two separate genotypes.
- the ICTV does not operate with viral genotypes but recognizes only viral species. Definition of a viral species is complex, and cannot be based solely on genetic distances in the absence of other demarcation characteristics.
- the invention includes nucleic acid and protein sequences related to a newly discovered lyssavirus, the Shimoni bat virus (SHIBV).
- SHIBV Shimoni bat virus
- the cRNA sequence of the entire genome of SHIBV is presented herein as SEQ ID NO: 1.
- the invention includes an isolated nucleic acid molecule including the nucleotide sequence of SEQ ID NO: 1, or a complement thereof.
- the SHIBV sequence encodes five proteins.
- the invention also includes a portion of the nucleic acid molecule of SEQ ID NO: 1 corresponding to at least one of the lyssavirus structural genes N, P, M, G, or L.
- the proteins corresponding to the lyssavirus structural genes are also provided in isolated form as an isolated protein with the sequence of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, a fragment thereof, or derivative thereof.
- Also provided is a process for detecting the presence of a lyssavirus virus or a nucleic acid molecule derived from a lyssavirus in a biological sample including contacting a sample with an agent that selectively binds to the a nucleic acid molecule with a sequence including at least a portion of SEQ ID NO: 1; or a protein sequence encoded by at least a portion of SEQ ID NO: 1, and detecting whether the agent binds to the virus or the nucleic acid molecule derived therefrom in the sample.
- the agent is optionally an antibody.
- agent is a nucleic acid sequence, illustratively, a nucleic acid molecule including a nucleotide sequence having between 4 and 6600 contiguous nucleotides of the nucleotide sequence of SEQ ID NO: 1, or a complement thereof.
- a vaccine composition is also provided for inducing an immunological response against a lyssavirus in a subject, where the vaccine includes a pharmaceutically acceptable carrier admixed with: an isolated lyssavirus strain of SHIBV; an isolated protein sequence encoded by at least a portion of SEQ ID NO: 1, or derivative thereof; or an isolated nucleic acid sequence that has the sequence of least a portion of SEQ ID NO: 1, or derivative thereof.
- a vaccine is optionally formulated for parenteral or oral administration to a subject.
- a vaccine optionally includes an adjuvant.
- an isolated lyssavirus virus including a nucleic acid molecule having a nucleotide sequence of SEQ ID NO: 1 wherein each thymine is replaced with uracil.
- FIG. 1 are phylogenetic trees of concatenated N+P+M+G+L gene sequences of lyssaviruses, obtained by the NJ method (p-distances) for nucleotide (A) and amino acid (B) sequences, with midpoint rooting of the trees, and an unrooted ML tree for nucleotide sequences (C) where LBV lineages are indicated following Markotter et al. (2008) and Bootstrap values (1000 replicates for NJ and 100 replicates for ML) are shown for key nodes.
- the present invention includes an isolated new, previously unrecognized lyssavirus, which should be considered a new species of the Lyssavirus genus.
- Novel lyssavirus strains of the present invention are illustratively identified as Shimoni bat virus (SHIBV), fragments thereof, or derivatives thereof.
- SHIBV Shimoni bat virus
- the invention has utility for the development of new diagnostics, therapeutics and prophylactic therapies for viral infection.
- the invention also provides protein and polypeptide sequences as well as nucleic acid sequences suitable for use as a vaccine. As such, the invention also has utility as a vaccine for the prevention of Lyssavirus infection.
- Oral swabs were placed into tubes containing Minimum Essential Medium (MEM- 10, Invitrogen, Grand Island, NY). Sera were separated from blood clots by centrifugation. All samples were transported on dry ice and stored at -80°C until use.
- MEM- 10 Minimum Essential Medium
- Bat brains were subjected to the direct fluorescent antibody (DFA) test for detection of lyssavirus antigens (Dean et al., In: Meslin, F.-X., Kaplan, M.M., Koprowski, H. (Eds.). Laboratory techniques in rabies, 4th ed. WHO, Geneva, Switzerland, pp. 88-93) using monoclonal (Fujirebio Diagnostics Inc, Malvern, PA) and polyclonal (Chemicon Int., Temecula, CA) fluorescein isothiocyanate-labeled anti-rabies antibodies.
- DFA direct fluorescent antibody
- the determined genome sequence of the Shimoni bat virus and derivatives thereof are presented.
- the cRNA sequence is found illustrated as SEQ ID NO: 1 as follows.
- the negative- sense lyssavirus genome encodes five proteins: the nucleoprotein (N); phosphoprotein (P); matrix protein (M); glycoprotein (G); and RNA polymerase (L) that are present in the overall genome in the order 3'-N-P-M-G-L-5'. Tordo, N, et al., Proc Natl Acad Sci USA, 1986; 83:3914-3918.
- the invention also includes isolated nucleic acids encoding to the protein sequences of the five structural genes (N, P, M, G and L) of the SHIBV virus and derivatives thereof.
- the present invention also includes isolated protein sequences of the SHIBV virus corresponding to the five structural genes (N, P, M, G and L).
- a nucleic acid sequence encoding nucleoprotein includes nucleotides 71 to 1423 of SEQ ID NO: 1, or derivatives thereof.
- a nucleic acid sequence encoding the phosphoprotein (P gene) includes nucleotides 1522 to 2439 of SEQ ID NO: 1, and derivatives thereof.
- a nucleic acid sequence encoding the matrix protein (M gene) includes nucleotides 2516 to 3124 of SEQ ID NO: 1, and derivatives thereof.
- a nucleic acid sequence encoding the glycoprotein includes nucleotides 3330 to 4898 of SEQ ID NO: 1, and derivatives thereof.
- a nucleic acid sequence encoding the polymerase protein (L gene) includes nucleotides 5512 to 11895 of SEQ ID NO: 1, and derivatives thereof.
- a derivative of a nucleic acid is a sequence of nucleotides that is not found in nature.
- a derivative of a nucleic acid may include at least one substitution, deletion, or modification of at least one base.
- a derivative of a nucleic acid is optionally 50% or more identical to the wild-type sequence.
- a derivative is has identity relative to the wild- type sequence of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or any value or range of values therebetween.
- Base modifications are modifications known in the art that may alter the melting temperature, alter the annealing temperature, alter the translated amino acid sequence, shorten or lengthen an encoded amino acid sequence relative to wild-type, alter expression level of mRNA or protein, or other modification effect known in the art.
- nucleotide is intended to mean a base-sugar-phosphate combination either natural or synthetic, linear, circular and sequential arrays of nucleotides and nucleosides, e.g. cDNA, genomic DNA, mRNA, and RNA, oligonucleotides, oligonucleosides, and derivatives thereof. Included in this definition are modified nucleotides which include additions to the sugar-phosphate groups as well as to the bases.
- nucleic acid or “oligonucleotide” refers to multiple nucleotides attached in the form of a single or double stranded polynucleotide that can be natural, or derived synthetically, enzymatically, and by cloning methods.
- nucleic acid and oligonucleotide may be used interchangeably in this application.
- the nucleic acid sequence relates to the genome sequence of Shimoni bat virus as found in SEQ ID NO: 1, portions thereof, and derivatives thereof.
- the inventive nucleic acid sequence is optionally isolated from the cellular or viral materials with which it is naturally associated. Numerous methods are known in the art for the synthesis and production of nucleic acid sequences illustratively including cloning and expression in cells such as E. coli, insect cells such as Sf9 cells, yeast, and mammalian cell types such as Hela cells, Chinese hamster ovary cells, or other cells systems known in the art as amendable to transfection and nucleic acid and/or protein expression. Methods of nucleic acid isolation are similarly recognized in the art.
- plasmid DNA amplified in E. coli is cleaved by suitable restriction enzymes such as Ndel and Xhol to linearize glycoprotein DNA.
- suitable restriction enzymes such as Ndel and Xhol to linearize glycoprotein DNA.
- the glycoprotein DNA is subsequently isolated following gel electrophoresis illustratively using a S.N. A. P.TM UV-Free Gel Purification Kit (Invitrogen, Carlsbad, CA) as per the manufacturer's instructions.
- lipid agents illustratively including LIPOFECTIN recognized in the art as a is a 1:1 (w/w) liposome formulation of the cationic lipid N-[l-(2,3-dioleyloxy)propyl]-n,n,n-trimethylammonium chloride (DOTMA) and dioleoyl phophotidylethanolamine (DOPE) in membrane filtered water, baculo virus, naked plasmid or other DNA, or other systems known in the art.
- DOTMA l-(2,3-dioleyloxy)propyl]-n,n,n-trimethylammonium chloride
- DOPE dioleoyl phophotidylethanolamine
- nucleotide sequences of the invention may be isolated by conventional uses of polymerase chain reaction or cloning techniques such as those described in conventional texts.
- the nucleic acid sequences of this invention may be obtained via reverse transcription of viral RNA, and subsequent amplification and sequencing of the cDNA, using DNA primers and probes and PCR techniques. These sequences, fragments thereof, modifications thereto and the full-length sequences may be constructed recombinantly using conventional genetic engineering or chemical synthesis techniques or PCR, and the like.
- the present invention also encompasses isolated proteins derived from SHIBV genetic sequence or derivatives of proteins derived from SHIBV.
- a protein is a SHIBV nucleoprotein, phosphoprotein, matrix protein, glycoprotein, polymerase protein, or derivatives of any of these proteins.
- the protein is optionally recombinant.
- the protein is optionally isolated.
- naturally occurring structural protein is optionally isolated from at least a portion of sample material from which the wild- type sequence is normally found. Methods for purification of protein from organism derived samples are known and are within the level of skill in the art.
- An inventive protein illustratively has an amino acid sequence of nucleoprotein as represented by SEQ ID NO: 2, or derivatives thereof.
- An inventive protein illustratively has an amino acid sequence of phosphoprotein as represented by SEQ ID NO: 3, or derivatives thereof.
- An inventive protein illustratively has an amino acid sequence of matrix protein represented by SEQ ID NO: 4, or derivatives thereof.
- SEQ ID NO: 4 MNFLRRIVKNCKDEDAPKLGTPSAPPDDDDLWLPPPEYMPLAQIKGKESVR NFCINGEVKICSPNGYSFRIIRHILKSFDNVYSGNRRMIGLAKVVIGLALSGSPVPEGMNW VYKLRRTLIFQWAESQGPLEGEELEYSQEITWDDESEFVGLQIRISAKQCHIQGRLWCIN MNSRACQLWADMALKTQQSKDDENTSLLLE (SEQ ID NO: 4)
- An inventive protein illustratively has an amino acid sequence of glycoprotein represented by SEQ ID NO: 5, or derivatives thereof.
- An inventive protein illustratively has an amino acid sequence of polymerase protein represented by SEQ ID NO: 6, or derivatives thereof.
- glycoprotein (G) protein of Shimoni bat virus SHIBV
- G protein of Shimoni bat virus SHIBV
- SHIBV glycoprotein protein of Shimoni bat virus
- the use of glycoprotein is for exemplary purposes only and not meant to be a limitation on the isolated protein structures of the present invention, which are equally appreciated to include the isolated protein sequences encoded by the genes N, P, M, G, and L. All proteins encoded by the nucleotide sequence of Shimoni bat virus as in SEQ ID NO: 1, portions thereof, or derivatives thereof, are similarly included.
- polypeptide and “protein” are synonymous as used herein and are intended to mean a natural or synthetic compound containing two or more amino acids.
- Amino acids present in a protein include the common amino acids alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, methionine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan, and tyrosine as well as less common naturally occurring amino acids, modified amino acids or synthetic compounds, such as alpha-asparagine, 2-aminobutanoic acid or 2-aminobutyric acid, 4- aminobutyric acid, 2-aminocapric acid (2-aminodecanoic acid), 6-aminocaproic acid, alpha- glutamine, 2-aminoheptanoic acid, 6-aminohe
- a protein is obtained by any of various methods known in the art illustratively including isolation from a cell or organism, chemical synthesis, expression of a nucleic acid and partial hydrolysis of proteins.
- Chemical methods of peptide synthesis are known in the art and include solid phase peptide synthesis and solution phase peptide synthesis for instance, or by the method ofhackeng, TM, et al., Proc Natl Acad Sci U S A, 1997; 94(15):7845-50, the contents of which are incorporated herein by reference.
- a protein included in an inventive composition or method may be a naturally occurring or non-naturally occurring protein.
- naturally occurring refers to a protein endogenous to a cell, tissue or organism (in this case a lyssavirus) and includes allelic variations.
- a non-naturally occurring protein is synthetic or produced apart from its naturally associated organism or modified and is not found in an unmodified cell, tissue or organism.
- Modifications and changes can be made in the structure of the proteins that are the subject of the application and still obtain a molecule having similar characteristics as the wild- type protein.
- certain amino acids can be substituted for other amino acids in a sequence without appreciable loss of activity or ability to interact with other proteins, lipids, carbohydrates, cofactors, or other molecules.
- certain amino acid sequence substitutions can be made in a protein sequence and nevertheless obtain a protein with like properties.
- one or more amino acid substitutions, additions, or deletions can be made without altering the functional properties of SHIBV proteins. It is also appreciated that several mutations optionally increase, decrease, or do not change the immunogenicity of an inventive protein.
- Conservative amino acid substitutions can be made in SHBIV polypeptides to produce derivatives.
- Conservative amino acid substitutions are art recognized substitutions of one amino acid for another amino acid having similar characteristics.
- each amino acid may be described as having one or more of the following characteristics: electropositive, electronegative, aliphatic, aromatic, polar, hydrophobic and hydrophilic.
- a conservative substitution is a substitution of one amino acid having a specified structural or functional characteristic for another amino acid having the same characteristic.
- Acidic amino acids include aspartate, glutamate; basic amino acids include histidine, lysine, arginine; aliphatic amino acids include isoleucine, leucine and valine; aromatic amino acids include phenylalanine, glycine, tyrosine and tryptophan; polar amino acids include aspartate, glutamate, histidine, lysine, asparagine, glutamine, arginine, serine, threonine and tyrosine; and hydrophobic amino acids include alanine, cysteine, phenylalanine, glycine, isoleucine, leucine, methionine, proline, valine and tryptophan; and conservative substitutions include substitution among amino acids within each group. Amino acids may also be described in terms of relative size, alanine, cysteine, aspartate, glycine, asparagine, proline, threonine, serine, valine, all typically considered to be small.
- the hydropathic index of amino acids can be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a polypeptide is generally understood in the art. It is known that certain amino acids can be substituted for other amino acids having a similar hydropathic index or score and still result in a polypeptide with similar biological activity. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics.
- Those indices are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cysteine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (- 1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).
- the relative hydropathic character of the amino acid determines the secondary structure of the resultant polypeptide, which in turn defines the interaction of the polypeptide with other molecules, such as enzymes, substrates, receptors, antibodies, antigens, and the like. It is known in the art that an amino acid can be substituted by another amino acid having a similar hydropathic index and still obtain a functionally equivalent polypeptide. In such changes, the substitution of amino acids whose hydropathic indices are within + 2 is preferred, those within + 1 are particularly preferred, and those within + 0.5 are even more particularly preferred.
- Substitution of like amino acids can also be made on the basis of hydrophilicity, particularly, where the biological functional equivalent polypeptide or peptide thereby created is intended for use in immunological embodiments.
- the following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 + 1); glutamate (+3.0 + 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); proline (-0.5 + 1); threonine (-0.4); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4).
- amino acid can be substituted for another having a similar hydrophilicity value and still obtain a biologically equivalent, and in particular, an immunologically equivalent polypeptide.
- substitution of amino acids whose hydrophilicity values are within + 2 is preferred, those within + 1 are particularly preferred, and those within + 0.5 are even more particularly preferred.
- amino acid substitutions are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- substitutions that take various of the foregoing characteristics into consideration are well known to those of skill in the art and include (original residue: exemplary substitution): (Ala: Gly, Ser), (Arg: Lys), (Asn: Gin, His), (Asp: Glu, Cys, Ser), (Gin: Asn), (Glu: Asp), (Gly: Ala), (His: Asn, Gin), (He: Leu, Val), (Leu: lie, Val), (Lys: Arg), (Met: Leu, Tyr), (Ser: Thr), (Thr: Ser), (Tip: Tyr), (Tyr: Trp, Phe), and (Val: He, Leu).
- Embodiments of this disclosure thus contemplate functional or biological equivalents of a polypeptide as set forth above.
- embodiments of the polypeptides can include variants having about 50%, 60%, 70%, 80%, 90%, and 95% sequence identity to the polypeptide of interest.
- An inventive glycoprotein is illustratively recombinant.
- An inventive protein may be coexpressed with associated tags, modifications, other proteins such as in a fusion peptide, or other modifications or combinations recognized in the art.
- Illustrative tags include 6x His, FLAG, biotin, ubiquitin, SUMO, or other tag known in the art.
- a tag is illustratively cleavable such as by linking to glycoprotein or an associated protein via an enzyme cleavage sequence that is cleavable by an enzyme known in the art illustratively including Factor Xa, thrombin, SUMOstar protein as obtainable from Lifesensors, Inc., Malvern, PA, or trypsin. It is further appreciated that chemical cleavage is similarly operable with an appropriate cleavable linker.
- Protein expression is illustratively accomplished from transcription of nucleic acid sequence encoding glycoprotein or derivatives thereof, translation of RNA transcribed from glycoprotein nucleic acid sequence such as a cDNA sequence, modifications thereof, or fragments thereof. Protein expression is optionally performed in a cell based system such as in E. coli, Hela cells, or Chinese hamster ovary cells. It is appreciated that cell-free expression systems are similarly operable.
- lyssavirus proteins are within the scope of the present invention including amino acid substitutions, alterations, modifications, or other amino acid changes that increase, decrease, or do not alter the function of the protein sequence.
- a derivative of a protein sequence is a sequence of amino acids that is not found in nature.
- post-translational modifications are similarly envisioned as within the scope of the present invention illustratively including incorporation of a non-naturally occurring amino acid, phosphorylation, glycosylation, addition of pendent groups such as biotin, fluorophores, lumiphores, radioactive groups, antigens, or other molecules.
- the present invention also provides a vector with an inventive nucleic acid sequence therein wherein the nucleic acid sequence optionally encodes an inventive protein.
- inventive vectors include a plasmid, cosmid, cationic lipids, non-liposomal cationic vectors, cationic cyclodextrin, viruses with RNA or DNA genetic material, polyethylenimines, histidylated polylysine, or other vector system known in the art.
- a vector is optionally a plasmid.
- a suitable vector optionally possesses cell type specific expression or other regulatory sequences or sequences operable to stimulate or inhibit gene or protein expression.
- a vector illustratively contains a selection marker such as an antibiotic resistance gene.
- a host cell transformed with an appropriate vector or with the inventive nucleic acid sequence optionally that encodes an inventive protein or derivative.
- a host cell for expression of polypeptides and fragments thereof can be prokaryotic or eukaryotic, such as bacterial, plant, insect, fungus, yeast, and mammalian cells.
- Optional host cells include E. coli or Sf9 cells.
- An expression vector is introduced into a host cell using well-known techniques such as infection or transfection, including calcium phosphate transfection, liposome- mediated transfection, electroporation and sonoporation.
- a method for recombinantly expressing a inventive nucleic acid or protein sequence or fragments thereof wherein a cell is transformed with an inventive nucleic acid sequence and cultured under suitable conditions that permit expression of nucleic acid sequence or protein either within the cell or secreted from the cell.
- Cell culture conditions are particular to cell type and expression vector. Culture conditions for particular vectors and cell types are within the level of skill in the art to design and implement without undue experimentation. Techniques for the expression and purification of recombinant proteins are known in the art (see Sambrook Eds., Molecular Cloning: A Laboratory Manual 3 ed. (Cold Spring Harbor, N.Y. 2001).
- compositions containing nucleic acid that can be expressed as encoded polypeptides or proteins are compositions containing nucleic acid that can be expressed as encoded polypeptides or proteins.
- the engineering of DNA segment(s) for expression in a prokaryotic or eukaryotic system may be performed by techniques generally known to those of skill in recombinant expression. It is believed that virtually any expression system may be employed in the expression of the claimed nucleic and amino sequences.
- engineered and recombinant cells are synonymous with “host” cells and are intended to refer to a cell into which an exogenous DNA or RNA segment or gene, such as a cDNA or gene has been introduced. Therefore, engineered cells are distinguishable from naturally occurring cells which do not contain a recombinantly introduced exogenous DNA segment or gene.
- a host cell is optionally a naturally occurring cell that is transformed with an exogenous DNA segment or gene or a cell that is not modified.
- a recombinant encoded polypeptide in accordance with the present invention one optionally prepares an expression vector that includes a nucleic acid under the control of one or more promoters.
- an expression vector that includes a nucleic acid under the control of one or more promoters.
- To bring a coding sequence "under the control of a promoter one positions the 5' end of the translational initiation site of the reading frame generally between about 1 and 50 nucleotides "downstream" of (i.e., 3' of) the chosen promoter.
- the "upstream" promoter stimulates transcription of the inserted DNA and promotes expression of the encoded recombinant protein. This is the meaning of "recombinant expression" in the context used here.
- Cell types available for expression include, but are not limited to, bacteria, such as E. coli and B. subtilis transformed with recombinant phage DNA, plasmid DNA or cosmid DNA expression vectors.
- prokaryotic hosts are E. coli strain RR1, E. coli LE392, E. coli B, E. coli .chi. 1776 (ATCC No. 31537) as well as E. coli W3110 (F-, lambda-, prototrophic, ATCC No. 273325); bacilli such as Bacillus subtilis; and other enterobacteriaceae such as Salmonella typhimurium, Serratia marcescens, and various Pseudomonas species.
- plasmid vectors containing replicon and control sequences that are derived from species compatible with the host cell are used in connection with these hosts.
- the vector optionally carries a replication site, as well as marking sequences that are capable of providing phenotypic selection in transformed cells.
- E. coli is often transformed using pBR322, a plasmid derived from an E. coli species. Plasmid pBR322 contains genes for ampicillin and tetracycline resistance and thus provides easy means for identifying transformed cells.
- the pBR322 plasmid, or other microbial plasmid or phage may also contain, or be modified to contain, promoters that can be used by the microbial organism for expression of its own proteins.
- phage vectors containing replicon and control sequences that are compatible with the host cell can be used as transforming vectors in connection with these hosts.
- the phage lambda may be utilized in making a recombinant phage vector that can be used to transform host cells, such as E. coli LE392.
- Further useful vectors include pIN vectors and pGEX vectors, for use in generating glutathione S-transferase (GST) soluble fusion proteins for later purification and separation or cleavage.
- GST glutathione S-transferase
- Other suitable fusion proteins are those with ⁇ -galactosidase, ubiquitin, or the like.
- Promoters that are most commonly used in recombinant DNA construction include the ⁇ -lactamase (penicillinase), lactose and tryptophan (trp) promoter systems. While these are the most commonly used, other microbial promoters have been discovered and utilized, and details concerning their nucleotide sequences have been published, enabling those of skill in the art to ligate them functionally with plasmid vectors.
- ⁇ -lactamase penicillinase
- lactose lactose
- trp tryptophan
- the plasmid YRp7 for example, is commonly used.
- This plasmid contains the trpl gene, which provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example ATCC No. 44076 or PEP4-1.
- the presence of the trpl lesion as a characteristic of the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan.
- Suitable promoting sequences in yeast vectors include the promoters for 3- phosphoglycerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3- phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6- phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
- the termination sequences associated with these genes are also ligated into the expression vector 3' of the sequence desired to be expressed to provide polyadenylation of the mRNA and termination.
- cultures of cells derived from multicellular organisms may also be used as hosts.
- any such cell culture is operable, whether from vertebrate or invertebrate culture.
- mammalian cells these include insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus); and plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing one or more coding sequences.
- Autographica californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes.
- the virus grows in Spodoptera frugiperda cells.
- the isolated nucleic acid coding sequences are cloned into non-essential regions (for example the polyhedron gene) of the virus and placed under control of an AcNPV promoter (for example, the polyhedron promoter).
- Successful insertion of the coding sequences results in the inactivation of the polyhedron gene and production of non-occluded recombinant virus (i.e., virus lacking the proteinaceous coat coded for by the polyhedron gene).
- These recombinant viruses are then used to infect Spodoptera frugiperda cells in which the inserted gene is expressed (e.g., U.S. Patent No. 4,215,051).
- Examples of useful mammalian host cell lines are VERO and HeLa cells, Chinese hamster ovary (CHO) cell lines, W138, BHK, COS-7, 293, HepG2, NIH3T3, RIN and MDCK cell lines.
- a host cell may be chosen that modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the encoded protein.
- Expression vectors for use in mammalian cells optionally include an origin of replication (as necessary), a promoter located in front of the gene to be expressed, along with any necessary ribosome binding sites, RNA splice sites, polyadenylation site, and transcriptional terminator sequences.
- the origin of replication may be provided either by construction of the vector to include an exogenous origin, such as may be derived from SV40 or other viral (e.g., Polyoma, Adeno, VSV, BPV) source, or may be provided by the host cell chromosomal replication mechanism. If the vector is integrated into the host cell chromosome, the latter is often sufficient.
- an exogenous origin such as may be derived from SV40 or other viral (e.g., Polyoma, Adeno, VSV, BPV) source, or may be provided by the host cell chromosomal replication mechanism. If the vector is integrated into the host cell chromosome, the latter is often sufficient.
- the promoters may be derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the vaccinia virus 7.5K promoter). Further, it is also possible, and may be desirable, to utilize promoter or control sequences normally associated with the desired gene sequence, provided such control sequences are compatible with the host cell systems.
- a number of viral based expression systems may be utilized, for example, commonly used promoters are derived from polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40 (SV40).
- the early and late promoters of SV40 virus are useful because both are obtained easily from the virus as a fragment that also contains the SV40 viral origin of replication. Smaller or larger SV40 fragments may also be used, provided there is included the approximately 250 bp sequence extending from the HmdIII site toward the Bgll site located in the viral origin of replication.
- the coding sequences may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence.
- This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region El or E3) will result in a recombinant virus that is viable and capable of expressing proteins in infected hosts.
- Specific initiation signals may also be required for efficient translation of the claimed isolated nucleic acid coding sequences. These signals include the ATG initiation codon and adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may additionally need to be provided. One of ordinary skill in the art would readily be capable of determining this need and providing the necessary signals. It is well known that the initiation codon must be in-frame (or in-phase) with the reading frame of the desired coding sequence to ensure translation of the entire insert. These exogenous translational control signals and initiation codons can be of a variety of origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements or transcription terminators.
- polyadenylation site In eukaryotic expression, one will also typically desire to incorporate into the transcriptional unit an appropriate polyadenylation site if one was not contained within the original cloned segment.
- the poly A addition site is placed about 30 to 2000 nucleotides downstream of the termination site of the protein at a position prior to transcription termination.
- stable expression is optionally achieved.
- cell lines that stably express constructs encoding proteins may be engineered.
- host cells can be transformed with vectors controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
- appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
- engineered cells may be allowed to grow for 1-2 days in an enriched medium, and then are switched to a selective medium.
- the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci, which in turn can be cloned and expanded into cell lines.
- a number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes, in tk “ , hgprt " or aprt " cells, respectively.
- antimetabolite resistance can be used as the basis of selection for: dhfr, which confers resistance to methotrexate; gpt, which confers resistance to mycophenolic acid; neo, which confers resistance to the aminoglycoside G-418; and hygro, which confers resistance to hygromycin. It is appreciated that numerous other selection systems are known in the art that are similarly operable in the present invention.
- the isolated nucleic acids of the disclosure may be "overexpressed", i.e., expressed in increased levels relative to its natural expression in cells of its indigenous host, or even relative to the expression of other nucleic acids or proteins in a recombinant host cell. Overexpression may be assessed by a variety of methods, including radio-labeling and/or protein purification. However, simple and direct methods are may be used, for example, those involving SDS/PAGE and protein staining or immunoblotting, followed by quantitative analyses, such as densitometric scanning of the resultant gel or blot.
- a specific increase in the level of the recombinant nucleic acid or protein in comparison to the level in natural host cells is indicative of overexpression, as is a relative abundance of the specific protein in relation to the other proteins produced by the host cell and, e.g., visible on a gel.
- SHIBV viruses de novo from isolated genes such as by assembly of virus particles with captured genes illustratively by the techniques of or modifications of Gonzalez, SA, and Affranchino, JL, J. Gen. Virol., 1995; 76:2357-2360, the contents of which are incorporated herein by reference.
- purification and in particular embodiments, the substantial purification, of an encoded protein or peptide.
- isolated protein or peptide as used herein, is intended to refer to a composition, isolatable from other components, wherein the nucleic acid, protein or peptide is purified to any degree relative to its naturally-obtainable state, i.e., relative to its purity within a cell, relative to is purity within a virion, or relative to its purity within an infective organism.
- An isolated nucleic acid, protein, or peptide also refers to a nucleic acid, protein or peptide, free from the environment in which it may naturally occur.
- purified or “isolated” will refer to a nucleic acid, protein or peptide composition that has been subjected to fractionation to remove various other components, and which composition substantially retains its expressed biological activity, if any. Where the term “substantially” purified is used, this designation will refer to a composition in which the nucleic acid, protein or peptide forms the major component of the composition, such as constituting about 50% or more of the nucleic acids or proteins in the composition.
- Various methods for quantifying the degree of purification of the nucleic acid, protein or peptide will be known to those of skill in the art. These include, for example, determining the specific activity of an active fraction, or assessing the number of polypeptides within a fraction by SDS/PAGE analysis.
- An optional method for assessing the purity of a fraction is to calculate the specific activity of the fraction, to compare it to the specific activity of the initial extract, and to thus calculate the degree of purity, herein assessed by a "-fold purification number.”
- the actual units used to represent the amount of activity will, of course, be dependent upon the particular assay technique chosen to follow the purification and whether or not the expressed nucleic acid, protein or peptide exhibits a detectable activity.
- nucleic acid, protein or peptide there is no general requirement that the nucleic acid, protein or peptide always be provided in its most purified state. Indeed, it is contemplated that less substantially purified products will have utility in certain embodiments. Partial purification may be accomplished by using fewer purification steps in combination, or by utilizing different forms of the same general purification scheme. For example, it is appreciated that a cation-exchange column chromatography performed utilizing an HPLC apparatus will generally result in a greater -fold purification than the same technique utilizing a low pressure chromatography system. Methods exhibiting a lower degree of relative purification may have advantages in total recovery of product, or in maintaining the activity of an expressed protein.
- a protein or nucleic acid is optionally substantially purified to a purity of 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or any value or range therebetween.
- the inventive method also illustratively includes isolation of glycoprotein from a host cell or host cell medium.
- Methods of protein isolation illustratively include column chromatography, affinity chromatography, gel electrophoresis, filtration, or other methods known in the art.
- glycoprotein is expressed with a tag operable for affinity purification.
- a tag is optionally a 6x His tag.
- a 6x His tagged inventive protein is illustratively purified by Ni-NTA column chromatography or using an anti-6x His tag antibody fused to a solid support. (Geneway Biotech, San Diego, CA) Other tags and purification systems are similarly operable.
- an inventive protein is optionally not tagged.
- purification is optionally achieved by methods known in the art illustratively including ion-exchange chromatography, affinity chromatography using anti- glycoprotein antibodies, precipitation with salt such as ammonium sulfate, streptomycin sulfate, or protamine sulfate, reverse phase chromatography, size exclusion chromatography such as gel exclusion chromatography, HPLC, immobilized metal chelate chromatography, or other methods known in the art.
- ion-exchange chromatography affinity chromatography using anti- glycoprotein antibodies
- precipitation with salt such as ammonium sulfate, streptomycin sulfate, or protamine sulfate
- reverse phase chromatography size exclusion chromatography such as gel exclusion chromatography, HPLC, immobilized metal chelate chromatography, or other methods known in the art.
- size exclusion chromatography such as gel exclusion chromatography, HPLC, immobilized metal
- Inventive nucleic acids, proteins or fragments thereof are optionally chemically synthesized.
- Methods of protein chemical synthesis have produced proteins greater than 600 amino acids in length with or without the inclusion of modifications such as glycosylation and phosphorylation.
- Methods of chemical protein and peptide synthesis illustratively include solid phase protein chemical synthesis. Illustrative methods of chemical protein synthesis are reviewed by Miranda, LP, Peptide Science, 2000, 55:217-26 and Kochendoerfer GG, Curr Opin Drug Discov Devel. 2001; 4(2):205-14, the contents of which are incorporated herein by reference.
- Proteins of this invention are optionally be characterized by immunological measurements including, without limitation, western blot, macromolecular mass determinations by biophysical determinations, SDS-PAGE/staining, HPLC and the like, antibody recognition assays, cell viability assays, apoptosis assays, and assays to infer immune protection or immune pathology by adoptive transfer of cells, proteins or antibodies.
- Vaccines and methods for their use to induce active immunity and protection against lyssavirus induced illness in a subject are provided according to the present invention.
- the term "vaccine composition” is used herein to refers to a composition including a biological agent (e.g. protein or nucleic acid) capable of inducing an immune response in a subject inoculated with the vaccine composition.
- a biological agent e.g. protein or nucleic acid
- the biological agent is a live attenuated and/or inactive SHIBV.
- the biological agent is an antigenic portion of a SHIBV.
- a SHIBV included in a vaccine composition according to the present invention is a live attenuated SHIBV or an inactivated SHIBV.
- the choice of live attenuated SHIBV or inactivated SHIBV depends on factors such as route of vaccine composition administration.
- the isolated SHIBV is optionally treated to inactivate or attenuate the lyssavirus.
- a vaccine for lyssavirus includes a live attenuated SHBIV or an inactivated human SHBIV.
- live attenuated SHIBV refers to a SHIBV having the ability to infect an appropriate host or host cell and replicate and the term is used to distinguish an "inactivated” SHIBV.
- live attenuated SHIBV refers to a SHIBV characterized by substantially diminished virulence compared to wild type SHIBV.
- virulence is used to describe the degree of pathogenicity of a SHIBV to a host cell or a host organism. Virulence is determined using any of various assays recognized in the art.
- virulence may be assessed by exposing cultured host cells to an attenuated SHIBV and determining the number of cells which display a pathogenic response and/or the severity of pathogenic response elicited. Diminished virulence is present where an attenuated SHIBV has decreased capability to cause one or more pathogenic effects in a host cell and/or host organism.
- inactivated SHIBV is used herein to refer to SHIBV that has been killed and which is therefore capable of neither replication nor infection of a host cell or host organism.
- Inactivation is achieved by any of various techniques illustratively including inactivation using one or more chemical agents, thermal inactivation and/or UV light inactivation.
- Chemical agents used to inactivate a SHIBV include such agents as ethyleneimines such as binary ethyleneimine; cross-linking aldehydes such as formaldehyde and glutaraldehyde; proteases illustratively including pronase, trypsin and/or chymotrypsin; and detergents such as octylphenol ethoxylates and alkyl trimethylammonium salts.
- SHIBV may be inactivated by treatment with a base, for example by incubation of the lyssavirus at a pH above pH 10.0.
- Thermal inactivation may be achieved by heating at temperatures above 50° centigrade, for example.
- Inactivation is assessed by techniques standard in the art, illustratively including sampling virus at various times during an inactivation procedure and observing cytopathic effects or infectivity of a sample on suitable cells, such as mouse neuroblastoma (MNA) cells.
- suitable cells such as mouse neuroblastoma (MNA) cells.
- an antigenic portion of a SHIBV is optionally included in a vaccine composition of the present invention.
- a SHIBV-derived protein or peptide capable of inducing an immunological response in a subject is considered within the scope of the present invention.
- Vaccine compositions are provided according to embodiments of the present invention which include one or more SHIBV polypeptides and/or an immunogenic fragment of one or more SHIBV polypeptides.
- a SHIBV polypeptide, a derivative thereof, and/or an immunogenic fragment thereof is included.
- the present invention provides a virus including an nucleoprotein having SEQ ID NO: 2 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 2.
- the present invention provides a virus including an phosphoprotein having SEQ ID NO: 3 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 3.
- the present invention provides a virus including an matrix protein having SEQ ID NO: 4 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 4.
- the present invention provides a virus including an glycoprotein having SEQ ID NO: 5 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 5.
- the present invention provides a virus including an polymerase protein having SEQ ID NO: 6 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 6.
- a SHIBV for inclusion in a vaccine composition of the present invention is prepared by standard methods typically used for preparation of live or inactivated SHIBV.
- a compatible cell type is inoculated with a SHIBV and the cells are maintained under conditions which allow for viral replication and production of infectious particles.
- Inventive viral proteins of the present invention are optionally modified to increase their immunogenicity.
- the antigen may be coupled to chemical compounds or immunogenic carriers, provided that the coupling does not interfere with the desired biological activity of either the antigen or the carrier.
- Useful immunogenic carriers known in the art include, without limitation: keyhole limpet hemocyanin (KLH); bovine serum albumin (BSA); ovalbumin; PPD (purified protein derivative of tuberculin); red blood cells; tetanus toxoid; cholera toxoid; agarose beads; activated carbon; or bentonite.
- KLH keyhole limpet hemocyanin
- BSA bovine serum albumin
- PPD purified protein derivative of tuberculin
- red blood cells tetanus toxoid
- cholera toxoid agarose beads
- activated carbon or bentonite.
- Useful chemical compounds for coupling include, without limitation, dinitrophenol groups and arsonilic acid.
- SHIBV particles are harvested, typically from cell culture supernatant for inclusion in a vaccine composition.
- the SHIBV particles may be isolated from the cell culture supernatant, for example by filtration and/or centrifugation.
- the isolated SHIBV particles are optionally lyophilized, such as for later resuspension in a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier refers to a carrier which is substantially non-toxic to a subject and substantially inert to the lyssavirus included in a vaccine composition.
- a pharmaceutically acceptable carrier is a solid, liquid or gel in form and is typically sterile and pyrogen free.
- a vaccine composition of the present invention may be in any form suitable for administration to a subject.
- a vaccine composition is administered by any suitable route of administration including oral and parenteral such as intravenous, intradermal, intramuscular, mucosal, nasal, or subcutaneous routes of administration.
- a vaccine composition for parenteral administration may be formulated as an injectable liquid including a SHIBV, SHBIV protein or nucleic acid, or fragment thereof, and a pharmaceutically acceptable carrier.
- suitable aqueous and nonaqueous carriers include water, ethanol, polyols such as propylene glycol, polyethylene glycol, glycerol, and the like, suitable mixtures thereof; vegetable oils such as olive oil; and injectable organic esters such as ethyloleate.
- Proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of a desirable particle size in the case of dispersions, and/or by the use of a surfactant, such as sodium lauryl sulfate.
- a stabilizer is optionally included such as, for example, sucrose, EDTA, EGTA, and an antioxidant.
- a solid dosage form for administration or for suspension in a liquid prior to administration illustratively includes capsules, tablets, powders, and granules.
- a SHIBV, SHBIV protein or nucleic acid, or fragment thereof is admixed with at least one carrier illustratively including a buffer such as, for example, sodium citrate or an alkali metal phosphate illustratively including sodium phosphates, potassium phosphates and calcium phosphates; a filler such as, for example, starch, lactose, sucrose, glucose, mannitol, and silicic acid; a binder such as, for example, carboxymethylcellulose, alignates, gelatin, polyvinylpyrrolidone, sucrose, and acacia; a humectant such as, for example, glycerol; a disintegrating agent such as, for example, agar-agar, calcium carbonate, plant starches such as potato or tapio
- a buffer such as,
- Solid dosage forms optionally include a coating such as an enteric coating.
- the enteric coating is typically a polymeric material.
- Enteric coating materials optionally have the characteristics of being bioerodible, gradually hydrolyzable and/or gradually water-soluble polymers.
- the amount of coating material applied to a solid dosage generally dictates the time interval between ingestion and drug release.
- a coating is applied having a thickness such that the entire coating does not dissolve in the gastrointestinal fluids at pH below 3 associated with stomach acids, yet dissolves above pH 3 in the small intestine environment. It is expected that any anionic polymer exhibiting a pH-dependent solubility profile is readily used as an enteric coating in the practice of the present invention to achieve delivery of the active agent to the lower gastrointestinal tract.
- the selection of the specific enteric coating material depends on properties such as resistance to disintegration in the stomach; impermeability to gastric fluids and active agent diffusion while in the stomach; ability to dissipate at the target intestine site; physical and chemical stability during storage; non-toxicity; and ease of application.
- Suitable enteric coating materials illustratively include cellulosic polymers such as hydroxypropyl cellulose, hydroxyethyl cellulose, hydroxypropyl methyl cellulose, methyl cellulose, ethyl cellulose, cellulose acetate, cellulose acetate phthalate, cellulose acetate trimellitate, hydroxypropylmethyl cellulose phthalate, hydroxypropylmethyl cellulose succinate and carboxymethylcellulose sodium; acrylic acid polymers and copolymers, preferably formed from acrylic acid, methacrylic acid, methyl acrylate, ammonium methylacrylate, ethyl acrylate, methyl methacrylate and/or ethyl; vinyl polymers and copolymers such as polyvinyl pyrrolidone, polyvinyl acetate, polyvinylacetate phthalate, vinylacetate crotonic acid copolymer, and ethylene- vinyl acetate copolymers; shellac; and combinations thereof.
- the enteric coating optionally contains a plasticizer to prevent the formation of pores and cracks that allow the penetration of the gastric fluids into the solid dosage form.
- Suitable plasticizers illustratively include, triethyl citrate (Citroflex 2), triacetin (glyceryl triacetate), acetyl triethyl citrate (Citroflec A2), Carbowax 400 (polyethylene glycol 400), diethyl phthalate, tributyl citrate, acetylated monoglycerides, glycerol, fatty acid esters, propylene glycol, and dibutyl phthalate.
- a coating composed of an anionic carboxylic acrylic polymer typically contains approximately 10% to 25% by weight of a plasticizer, particularly dibutyl phthalate, polyethylene glycol, triethyl citrate and triacetin.
- the coating can also contain other coating excipients such as detackifiers, antifoaming agents, lubricants (e.g., magnesium stearate), and stabilizers (e.g. hydroxypropylcellulose, acids or bases) to solubilize or disperse the coating material, and to improve coating performance and the coated product.
- Liquid dosage forms for oral administration include lyssavirus and a pharmaceutically acceptable carrier formulated as an emulsion, solution, suspension, syrup, or elixir.
- a liquid dosage form of a vaccine composition of the present invention may include a wetting agent, an emulsifying agent, a suspending agent, a sweetener, a flavoring, or a perfuming agent.
- Adjuvants are known in the art and illustratively include Freund's adjuvant, aluminum hydroxide, aluminum phosphate, aluminum oxide, saponin, dextrans such as DEAE-dextran, vegetable oils such as peanut oil, olive oil, and/or vitamin E acetate, mineral oil, bacterial lipopolysaccharides, peptidoglycans, and proteoglycans.
- subject is used herein to refer to a human, non-human animals, illustratively including other primates, cows, horses, sheep, goats, pigs, dogs, cats, birds, poultry, and rodents such as mice or rats.
- Viral proteins of the present invention may also be used in the form of pharmaceutically acceptable salts.
- Suitable acids and bases which are capable of forming salts with the proteins of the present invention are well known to those of skill in the art, and include inorganic and organic acids and bases.
- the proteins and nucleic acid sequences or anti-sense sequences of the invention may further be used in diagnostic methods, therapeutic compositions and in methods for treating humans and/or animals with disease or at risk of disease or infection.
- one such therapeutic composition may be formulated to contain a carrier or diluent and one or more Shimoni bat virus proteins or protein fragments of the invention.
- the original or synthesized G gene is optionally inserted into foreign vectors (for example, a pseudotype lentiviral vector), and further used for specific virus-neutralization diagnostic assays.
- Suitable pharmaceutically acceptable carriers facilitate administration of the proteins but are physiologically inert and/or nonharmful.
- the inventive composition may also contain conventional pharmaceutical ingredients, such as preservatives, or chemical stabilizers.
- suitable ingredients operable herein include, for example, casamino acids, sucrose, gelatin, phenol red, N-Z amine, monopotassium diphosphate, lactose, lactalbumin hydrolysate, and dried milk.
- a vaccine composition including a SHIBV, and/or SHIBV polypeptides and/or an immunogenic fragment of one or more SHIBV polypeptides, stimulates generation of neutralizing antibodies to a SHIBV or other immunological response in a subject.
- Methods of inducing an immunological response against a SHIBV-mediated disease in a subject are provided according to embodiments of the present invention which include administering a therapeutic amount of a vaccine composition including at least one SHIBV, SHIBV protein, or fragment thereof.
- terapéuticaally effective amount is used herein to refer to an amount effective to induce an immunological response sufficient to prevent or ameliorate signs or symptoms of a lyssavirus-mediated disease.
- Induction of an immunological response in a subject can be determined by any of various techniques known in the art, illustratively including detection of anti-lyssavirus antibodies, measurement of anti-lyssavirus antibody titer and/or lymphocyte proliferation assay. Illustrative methods for detection of anti-lyssavirus antibodies are illustrated by Hanlon, CA., et al., Virus Res., 2005; l l l(l):44-54, the contents of which are incorporated herein by reference.
- Signs and symptoms of lyssavirus-mediated disease may be monitored to detect induction of an immunological response to administration of a vaccine composition of the present invention in a subject.
- An immunological response is illustratively a reduction of clinical signs and symptoms of lyssavirus-mediated disease.
- An immunological response is illustratively, development of anti- lyssavirus antibodies, activation of T-cells, B- cells, or other immune cells following administration of an inventive composition, or other immune responses known in the art.
- a method of inducing an immunological response against a lyssavirus-mediated disease in a subject includes administering 10 4 to 108 ffu of live attenuated vaccine or 1 to 25 micrograms of inactivated virus in a typical vaccine composition.
- a method of inducing an immunological response against a lyssavirus-mediated disease in a subject includes administering a therapeutically effective amount of a vaccine composition including a SHIBV, polypeptide fragments thereof, derivatives thereof, or combinations thereof.
- Administration of a vaccine composition according to a method of the present invention includes administration of one or more doses of a vaccine composition to a subject at one time in particular embodiments. Alternatively, two or more doses of a vaccine composition are administered at time intervals of days, weeks, or years.
- a suitable schedule for administration of vaccine composition doses depends on several factors including age and health status of the subject, type of vaccine composition used and route of administration, for example.
- One of skill in the art is able to readily determine a dose and schedule of administration to be administered to a particular subject.
- a method for detecting the presence of a lyssavirus virus or a nucleic acid molecule derived from a lyssavirus in a biological sample including contacting a sample with an agent that selectively binds to the a nucleic acid molecule with a sequence that represents at least a portion of SEQ ID NO: 1; or a protein sequence encoded by at least a portion of SEQ ID NO: 1, and detecting whether the agent binds to the virus or the nucleic acid molecule derived therefrom in the sample.
- the agent has a nucleic acid sequence that hybridizes under stringent conditions with at least a portion of SEQ ID NO: 1, but optionally, has 100% sequence identity or less than 100% sequence identity.
- the agent is a nucleic acid molecule with a nucleotide sequence having between 4 and 6600 contiguous nucleotides of the nucleotide sequence of SEQ ID NO: 1, or a complement thereof.
- An agent optionally selectively binds a protein with a sequence of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or combinations thereof.
- the term "selectively binds" describes binding to a target nucleic acid sequence or amino acid sequence with less than 1% cross reactivity toward another nucleic acid sequence or amino acid sequence present in a sample.
- hybridizes under stringent conditions describes conditions for hybridization and washing under which nucleotide sequences having at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity to each other typically remain hybridized to each other.
- hybridization conditions are described in, for example but not limited to, Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1 6.3.6.; Basic Methods in Molecular Biology, Elsevier Science Publishing Co., Inc., N.Y. (1986), pp.75 78, and 84 87; and Molecular Cloning, Cold Spring Harbor Laboratory, N.Y.
- a non-limiting example of stringent hybridization conditions is hybridization in 6x sodium chloride/sodium citrate (SSC), 0.5% SDS at about 68°C followed by one or more washes in 2xSSC, 0.5% SDS at room temperature.
- Another non-limiting example of stringent hybridization conditions is hybridization in 6x SSC at about 45°C followed by one or more washes in 0.2x SSC, 0.1% SDS at 50to 65 °C.
- An agent is illustratively any molecule that will selectively bind at least a portion of a nucleic acid sequence with the sequence of SEQ ID NO: 1 or a protein encoded by at least a portion of SEQ ID NO: 1, or derivatives thereof.
- an agent include an antibody, other proteinaceous molecules, an aptamer, a nucleotide sequence, other molecules such as low molecular weight compositions with a molecular weight below 2000 Daltons, or other nucleic acid or protein binding compositions known in the art.
- An agent is illustratively an antibody.
- Such antibodies can be polyclonal or monoclonal.
- An intact antibody, a fragment thereof (e.g., Fab or F(ab') 2 ), or an engineered variant thereof (e.g., sFv) can also be used.
- Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass thereof.
- Methods of producing antibodies directed to specific sequences of protein or nucleic acid are known in the art.
- Optional methods of producing and screening for antibodies that will act as an agent are described by Birch, JR, and Racher, AJ, Advanced Drug Delivery Reviews, 2006; 58:671- 685.
- a biological sample is any sample derived from a biological source including an animal, plant, tissue, or cell.
- a biological sample is illustratively tissue derived from brain such as the brain stem or cerebellum, other neuronal tissue, kidney, heart, or other tissue.
- a biological sample is blood, plasma, serum, urine, feces, saliva, nasal secretions, lung aspirate, cerebrospinal fluid, or skin.
- a process of the invention illustratively includes detecting whether the agent binds to the virus or the nucleic acid molecule derived therefrom in the sample. Detection is by any method known in the art suitable for detecting the binding of an agent to a nucleic acid molecule or a protein. Illustrative examples include PCR related techniques such as PCR, RT-PCR, realtime PCR (qRT-PCR), hybridization of labeled agents where an agent is illustratively labeled with a radioactive or fluorescent molecule, mass spectrometry, electrophoresis or other technique known in the art. Illustrative examples of detecting the binding of an agent to a protein sequence include gel electrophoresis (e.g.
- the length of the complete SHIBV genome is 12045 nucleotides (GenBank Accession No. GU170201).
- the genome consists of 5 structural genes, common for all lyssaviruses, and non-coding regions that are most similar to those described in the phylogroup II lyssaviruses. Characteristics and alignments of particular genes of SHIBV are illustrated in Kuzmin, I, et al., Virus Res., 2010;149(2):197-210.
- Neighbor joining (NJ) phylogenetic analysis is performed in MEGA program (Kumar et al., 2001), using p-distances, Kimura-2 parameters and Maximum composite likelihood models, for 1000 bootstrap replicates.
- Bayesian analysis (BI) is performed using BEAST software (Drummond and Rambaut, 2007), with the general time-reversible model incorporating both invariant sites and a gamma distribution (GTR+I+G).
- ML Maximum likelihood analysis is performed using the PHYLIP package (Felsenstain, 1993) for 100 bootstrap replicates. Nucleotide substitution models used transition/transversion ratios varying from 2 to 4, with empirical base frequencies, and a gamma distribution of rate variations among sites. The gamma parameter for each alignment was determined using PAUP* (Swofford, 2003).
- RV9 Bat Eptesicus Germany EF157976 serotinus
- NC_003243 Bat Saccolaimus Australia NC_003243
- N-MAbs anti-nucleocapsid monoclonal antibodies
- CDC Centers for Disease Control and Prevention
- N-MAb 422-5 of the Wistar Institute
- the CDC N-MAb panel was developed primarily for discrimination of RABV antigenic variants (Smith, 1989), such that phylogroup I lyssaviruses represent greater variety of antigenic patterns than phylogroup II lyssaviruses (Table 2).
- MOKV is distinguished from LBV in reaction with one N- MAb only. Patterns of SHIBV are different from those of LBV by two N-MAbs (C2 and C4), and from those of MOKV by one N-MAb (C4).
- C2 and C4 The positive reaction of SHIBV with the C2 MAb is similar to that of MOKV, WCBV, and many representatives of RABV (Smith, 1989).
- SHIBV reacts with the Wistar N-MAb 422-5, in contrast to all other lyssaviruses.
- Patents and publications mentioned in the specification are indicative of the levels of those skilled in the art to which the invention pertains. These patents and publications are incorporated herein by reference to the same extent as if each individual application or publication was specifically and individually incorporated herein by reference for the material for which it is cited as well as all other teaching contained therein.
- a single amino acid change in rabies virus glycoprotein increases virus spread and enhances virus pathogenicity. J. Virol. 79(22), 14141-14148.
- Familusi J.B., Moore, D.L., 1972. Isolation of a rabies related virus from the cerebrospinal fluid of a child with 'aseptic meningitis'. African J. Med. Sci. 3, 93-96. Familusi, J.B., Osunkoya, B.O., Moore, D.L., Kemp, G.E., Fabiyi, A., 1972. A fatal human infection with Mokola virus. Am. J. Trop. Med. Hyg. 21, 959-963.
- Kuzmin, I.V. Botvinkin, A.D., Poleschuk, E.M., Orciari, L.A., Smith, J.S. and Rupprecht, C.E. (2006). Bat rabies surveillance in the former Soviet Union. Dev. Biol. (Basel). 125, 273- 282.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Wood Science & Technology (AREA)
- Animal Behavior & Ethology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Biotechnology (AREA)
- Mycology (AREA)
- General Physics & Mathematics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Gastroenterology & Hepatology (AREA)
- Food Science & Technology (AREA)
- Epidemiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
Abstract
A new species of lyssavirus is presented including the whole genome sequence and the sequences of each of the structural genes. The Shimoni bat virus of the preset invention and structural proteins are used as vaccines or therapeutics for the prevention of amelioration of lyssavirus disease.
Description
ISOLATED LYSSAVIRUS NUCLEIC ACID AND PROTEIN SEQUENCES
GOVERNMENT SPONSORSHIP
[0001] This invention was made by the Centers for Disease Control and Prevention, an agency of the United States Government. CROSS REFERENCE TO RELATED APPLICATIONS
[0002] This application claims priority to U.S. Provisional Application No. 61/294,988 filed January 14, 2010, the entire contents of which are incorporated herein by reference.
FIELD OF THE INVENTION
[0003] The present invention relates to nucleic acid sequences of a virus. More particularly, the invention relates to a new representative species of the Lyssavirus genus. The invention relates to isolated nucleic acid sequences of a newly discovered Shimoni bat virus.
BACKGROUND OF THE INVENTION
[0004] Rabies is an ancient disease with the earliest reports possibly dated to the Old World before 2300 B.C. Rabies remains a world health threat due to remaining lack of effective control measures in animal reservoir populations and a widespread lack of human access to vaccination. Today, more than 50,000 people annually die of rabies, particularly in Asia and Africa.
[0005] Lyssaviruses are RNA viruses with single-strand, negative-sense genomes responsible for rabies-like diseases in mammals. The Lyssavirus genus (family Rhabdoviridae) includes eleven recognized species. The type species Rabies virus (RABV) is distributed worldwide among mammalian reservoirs - carnivores and bats. Lagos bat virus (LBV) circulates among pteropid bats in sub-Saharan Africa, with infrequent spill-overs into other mammals. Mokola virus (MOKV) has been isolated in sub-Saharan Africa from shrews, domestic cats and dogs, a rodent and two humans. The reservoir hosts of MOKV have not yet been established. Duvenhage virus (DUVV) was isolated from insectivorous bats and humans that died after bat bites in sub-Saharan Africa. European bat lyssavirus, type 1 (EBLV-1) has been isolated across Europe from insectivorous bats, and the primary host species of this virus appears to be the Serotine bat (Eptesicus serotinus). Human cases of EBLV-1 infection have been described as well. European bat lyssavirus, type 2 (EBLV-2) was isolated primarily from insectivorous bats of the Myotis genus and from humans that died after bat bites in north-western Europe. Australian bat lyssavirus (ABLV) circulates in Australia among insectivorous and pteropid bats,
and has caused at least two documented cases of human rabies. Recently, four other lyssavirus species were ratified by the International Committee on Virus Taxonomy (ICTV Official Taxonomy: Updates since the 8th Report): Aravan virus (ARAV) and Khujand virus (KHUV), isolated from insectivorous bats of the Myotis genus in the Central Asia; Irkut virus (IRKV), isolated from an insectivorous bat, Murina leucogaster in eastern Siberia; and West Caucasian bat virus (WCBV), isolated from an insectivorous bat, Miniopterus schreibersi in south-eastern Europe. Seroprevalence to WCBV was also detected in Miniopterus spp. bats from Kenya, suggesting a wider geographical range than was previously believed.
[0006] Based on genetic distances, serologic cross-reactivity, and peripheral pathogenicity in a mouse model, the Lyssavirus genus is subdivided into two phylogroups. Phylogroup I includes RABV, DUVV, EBLV-1, EBLV-2, ABLV, ARAV, KHUV and IRKV. Phylogroup II includes LBV and MOKV. The WCBV cannot be included in any of these phylogroups, and should be considered as a member of an independent phylogroup III.
[0007] The operational term 'genotype' has been used for lyssavirus classification since the time when molecular techniques replaced serotyping for classification purposes. Demarcation of genotypes has been based largely on genetic distances (identity values) between members of the genus, and on the bootstrap support of phylogenetic constructions. In addition, based on identity values LBV was suggested to be sub-divided into at least two separate genotypes. However, the ICTV does not operate with viral genotypes but recognizes only viral species. Definition of a viral species is complex, and cannot be based solely on genetic distances in the absence of other demarcation characteristics.
[0008] As lyssavirus surveillance in the developing countries of Africa and Asia is very limited, enhanced studies are needed to identify new lyssavirus species may be present there. This need is particularly significant because commercially available biologies do not protect against lyssaviruses that do not belong to the phylogroup I. Therefore, there is the need to develop better biologies for diagnostic, treatment and prophylaxis of the diseases, caused by these viruses.
SUMMARY OF THE INVENTION
[0009] The following summary of the invention is provided to facilitate an understanding of some of the innovative features unique to the present invention and is not intended to be a full description. A full appreciation of the various aspects of the invention can be gained by taking the entire specification, claims, drawings, and abstract as a whole.
[0010] The invention includes nucleic acid and protein sequences related to a newly discovered lyssavirus, the Shimoni bat virus (SHIBV). The cRNA sequence of the entire genome of SHIBV is presented herein as SEQ ID NO: 1. As such, the invention includes an isolated nucleic acid molecule including the nucleotide sequence of SEQ ID NO: 1, or a complement thereof.
[0011] The SHIBV sequence encodes five proteins. The invention also includes a portion of the nucleic acid molecule of SEQ ID NO: 1 corresponding to at least one of the lyssavirus structural genes N, P, M, G, or L. The proteins corresponding to the lyssavirus structural genes are also provided in isolated form as an isolated protein with the sequence of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, a fragment thereof, or derivative thereof.
[0012] Also provided is a process for detecting the presence of a lyssavirus virus or a nucleic acid molecule derived from a lyssavirus in a biological sample including contacting a sample with an agent that selectively binds to the a nucleic acid molecule with a sequence including at least a portion of SEQ ID NO: 1; or a protein sequence encoded by at least a portion of SEQ ID NO: 1, and detecting whether the agent binds to the virus or the nucleic acid molecule derived therefrom in the sample. The agent is optionally an antibody. In some embodiments, and agent is a nucleic acid sequence, illustratively, a nucleic acid molecule including a nucleotide sequence having between 4 and 6600 contiguous nucleotides of the nucleotide sequence of SEQ ID NO: 1, or a complement thereof.
[0013] A vaccine composition is also provided for inducing an immunological response against a lyssavirus in a subject, where the vaccine includes a pharmaceutically acceptable carrier admixed with: an isolated lyssavirus strain of SHIBV; an isolated protein sequence encoded by at least a portion of SEQ ID NO: 1, or derivative thereof; or an isolated nucleic acid sequence that has the sequence of least a portion of SEQ ID NO: 1, or derivative thereof. A vaccine is optionally formulated for parenteral or oral administration to a subject. A vaccine optionally includes an adjuvant.
[0014] Also provided is an isolated lyssavirus virus including a nucleic acid molecule having a nucleotide sequence of SEQ ID NO: 1 wherein each thymine is replaced with uracil.
BRIEF DESCRIPTION OF THE DRAWINGS
[0015] FIG. 1 are phylogenetic trees of concatenated N+P+M+G+L gene sequences of lyssaviruses, obtained by the NJ method (p-distances) for nucleotide (A) and amino acid (B)
sequences, with midpoint rooting of the trees, and an unrooted ML tree for nucleotide sequences (C) where LBV lineages are indicated following Markotter et al. (2008) and Bootstrap values (1000 replicates for NJ and 100 replicates for ML) are shown for key nodes.
DETAILED DESCRIPTION OF EMBODIMENTS OF THE INVENTION
[0016] The following description of particular embodiment(s) is merely exemplary in nature and is in no way intended to limit the scope of the invention, its application, or uses, which may vary. The invention is described with relation to the non-limiting definitions and terminology included herein. These definitions and terminology are not designed to function as a limitation on the scope or practice of the invention but are presented for illustrative and descriptive purposes only.
[0017] Scientific and technical terms used herein are intended to have the meanings commonly understood by those of ordinary skill in the art. Such terms are found defined and used in context in various standard references illustratively including J. Sambrook and D.W.
Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 3rd Ed., 2001; F.M. Ausubel, Ed., Short Protocols in Molecular Biology, Current Protocols; 5th Ed.,
2002; B. Alberts et al., Molecular Biology of the Cell, 4th Ed., Garland, 2002; D.L. Nelson and
M.M. Cox, Lehninger Principles of Biochemistry, 4th Ed., W.H. Freeman & Company, 2004;
Wild, D., The Immunoassay Handbook, 3rd Ed., Elsevier Science, 2005; Gosling, J. P.,
Immunoassays: A Practical Approach, Practical Approach Series, Oxford University Press, 2005;Antibody Engineering, Kontermann, R. and Dtibel, S. (Eds.), Springer, 2001; Harlow, E. and Lane, D., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1988;
Ausubel, F. et al., (Eds.), Short Protocols in Molecular Biology, Wiley, 2002; J. D. Pound (Ed.)
Immunochemical Protocols, Methods in Molecular Biology, Humana Press; 2nd ed., 1998;
B.K.C. Lo (Ed.), Antibody Engineering: Methods and Protocols, Methods in Molecular Biology, Humana Press, 2003; and Kohler, G. and Milstein, C, Nature, 256:495-497 (1975); the contents of each of which are incorporated herein by reference.
[0018] The present invention includes an isolated new, previously unrecognized lyssavirus, which should be considered a new species of the Lyssavirus genus. Novel lyssavirus strains of the present invention are illustratively identified as Shimoni bat virus (SHIBV), fragments thereof, or derivatives thereof.
[0019] The invention has utility for the development of new diagnostics, therapeutics and prophylactic therapies for viral infection. The invention also provides protein and polypeptide
sequences as well as nucleic acid sequences suitable for use as a vaccine. As such, the invention also has utility as a vaccine for the prevention of Lyssavirus infection.
[0020] The SHIBV was discovered in 2009 during a survey of bats in Kenya for the purpose of detecting new and potential human pathogens that could emerge from bat reservoirs within the region (Kuzmin, I.V., et al., Emerging Infect. Dis., 2008; 14(12):1887-1889; and Kuzmin, I.V., et al., J. Clin. Microbiol., 2008; 46(4):1451-1461). In total, 616 bats of 22 species were collected from 10 locations across Kenya including 40 sick and dead bats. The sampling and collection protocol were approved by the National Museums of Kenya and the Kenya Wildlife Service. The brain and pooled organs were collected into sterile plastic tubes. Oral swabs were placed into tubes containing Minimum Essential Medium (MEM- 10, Invitrogen, Grand Island, NY). Sera were separated from blood clots by centrifugation. All samples were transported on dry ice and stored at -80°C until use.
[0021] Bat brains were subjected to the direct fluorescent antibody (DFA) test for detection of lyssavirus antigens (Dean et al., In: Meslin, F.-X., Kaplan, M.M., Koprowski, H. (Eds.). Laboratory techniques in rabies, 4th ed. WHO, Geneva, Switzerland, pp. 88-93) using monoclonal (Fujirebio Diagnostics Inc, Malvern, PA) and polyclonal (Chemicon Int., Temecula, CA) fluorescein isothiocyanate-labeled anti-rabies antibodies. When a positive DFA result was documented, the brain specimen was homogenized into 10% suspension in MEM- 10, and inoculated intracranially into suckling mice (Koprowski, H., 1996. The mouse inoculation test. In: Meslin, F.-X., Kaplan, M.M., Koprowski, H. (Eds.). Laboratory techniques in rabies, 4th ed. WHO, Geneva, Switzerland, pp. 80-86) and mouse neuroblastoma (MNA) cell culture (Webster W.A., Casey, G.A., 1996. Virus isolation in neuroblastoma cell culture. In: Meslin, F.-X., Kaplan, M.M., Koprowski, H. (Eds.). Laboratory techniques in rabies, 4th ed. WHO, Geneva, Switzerland, pp. 96-104) for virus isolation. Virus sample is subjected to RT-PCR and directly sequenced.
[0022] The determined genome sequence of the Shimoni bat virus and derivatives thereof are presented. The cRNA sequence is found illustrated as SEQ ID NO: 1 as follows.
[0023] ACGCTTAACAGCAAAGTCAGAGAAGAGATAAGCCTCTACAATGAGCGAA TCAAAATGTAACACCCCTACAATGGACTCTGAAAAGATTGTTTTCAAAGTTCGTAAC CAGGTGGTGTCTTTGAAGCCAGAAATAATCTCTGATCAGTATGAGTACAAATATCCT GCAATTCTGGATGGAAGAAAACCGGGGATCACTCTAGGGAGAGCTCCAGACTTAAA CACGGCTTACAAATCAATTTTGTCTGGTATGAATGCTGCCAAATTGGATCCAGATGA TGTGTGCTCCTATTTGGCTGCTGCGATGCAGCTGTTTGAAGGTGTTTGCCCAGAGGA
TTGGACTAGTTATGGTATTGTGATTGCAAAGAAGGGTGATAAGATCACTCCGGAAG ATTTGATAGATGTTACTAGGACAAATGTAGAGGGAAATTGGGCTCAAACAGGGGGA ACAGACATGACAAGAGATCCAACAAGTGCAGAACATGCATCTTTAGTGGGGTTGCT GTTGTGCTTATATCGTCTAAGCAAGATAGTCGGCCAGAATACTGCAAATTACAAGAC CAATGTGGCCGATAGAATGGAACAAATTTTTGAAACTGCACCTTTTGTGAAAATTGT TGAACATCATACTCTAATGACTACTCATAAAATGTGTGCTAATTGGAGTACAATTCC AAACTTTAGATTTCTTGCTGGAGCTTATGATATGTATTTTGCAAGAATAGAGCATCTT TACTCTGCTATAAGGGTTGGAACTGTAGTGACTGCTTACGAAGATTGTTCAGGATTG GTCTCCTTCACTGGATTTATAAAACAAATTAATTTATCTGCTAGAGATGCTTTGCTTT ATTTCTTTCACAAAAATTTTGAAGAAGAAATAAGAAGAATGTTCGAACCTGGTCAA GAAACTGCAATTCCTCATTCTTACTTCATACATTTTAGAGCTTTGGGATTAAGCGGC AAATCACCCTATTCATCAAATGCAGTAGGTCATACCTTCAACTTGATTCACTTTATA GGTTGTTATATGGGTCAGATAAGATCTCTAAATGCCACAGTTATTCAAGCTTGTGCA CCTCATGAGATGTCTGTCTTGGGAGGTTATCTAGGAGAGGAATTCTTTGGAAAAGGT ACTTTTGAAAG AAGGTTCTTCAGGGATGA AAAGGAGATGCAAG ACTATGC AGAATT GGAGGGAATTAAAATAGAGGCAGCATTGGCAGATGATGGAACAGTTGACTCTGATG ATGAGGATTTCTTTTCAGGAGAGACAAGAAGTCCAGAAGCAGTGTATAGTCGAATC ATGATGAACAACGGCAGATTGAAAAGGTCACACATAAGGCGGTACATATCAGTCAG CTCAAATCATCAGGCAAGGCCTAACTCATTTGCAGAGTTTTTAAACAAGGTGTACTC AGATGGGTCCTAATATTGATTTCAACAGAATGCATAGGAGACAGGAGAGTTTCCATT GTAAAAGGGGTACtGAAAAAAACTCAACACCCCTCTTCAATCCTTCcCTCCAAGATG AGCAAGGGGCTTATTCATCCGAGTTCCATTCGCTCCGGGCTTGTGGATTTGGAGATG GCGGAAGAAACTGTCGATCTAATTCACAAAAACTTGACAGACGGGCAGGCTCACTT ACAAGGTGAACCATTAGATGTCGATTCTCTTCCTGAAGATATGAGAAGAATGAGGC TGATTGACATGTCCAGACAAAAGGACATCAGGATCGGAGATGAAGGAGAGAGCAG CTCTGAGGACGAGTTTTACCTACCTAGTGGGAAAGATCCGATGGTTCCTCTTCAAGA TTTTCTTGATGAAATCGGAGCTCAAGTAGTGAAGAGGATGAAATCTGGAGATGGGT TCTTCAAAATCTGGTCTACTGTAACTGAAGATATAAAGGGATATATTTCTTCAAATT TCACTGCAGCAGAACCAAGATCCAGTGACAATAAATCAGTCCAAACAGAACCTGCT CAGATTCAAAAAGGGTTGCCAGAACCTCCATCCCATGAAGAGAAAGCAAAGGAAAC ACAAGAATCCTCTAAGAACAGGCAGGAGTCAAAGCCTGCTCCCTCTTCTGATTGGG ACAATAATCAAGAAGAAGTTGACGACATAGAGGGGGAAGTTGCTCATCAAGTTGCA GAGAGTTTCTCTAAAAAGTACAAGTTTCCATCTAGATCATCTGGAATCTTTTTATGG
AACTTTGAACAACTCAAGATGAATCTAGATGACATAGTGAAGGCTGCCTTGAACAT ACCAGGAATTGATAAAATTGCAGAGAAAGGAGGGAAGCTACCATTGAGATGTATCT TGGGATATGTTTCATTAAGTGCATCTAAGAGATTCTGCTTGCTTGCTGACAATGACA AAACTGCTAGGTTGATGCAAGATGACATCAACAATTATATTGCAAAAATTGAGGAA ATAGACAAAAGTTAAAACCCTACACAGATTCCATTGATCCACACTCAGCCTCATCAT ATTCTtGAAAAAAACATATAACACCCCTAAAAGAATGAATTTCCTGAGGAGAATTGt GAAAAACTGCAAAGACGAAGATGCCCCAAAACTGGGAACTCCCTCAGCTCCTCCGG ATGATGATGATTTGTGGCTACCTCCCCCTGAATACATGCCTTTAGCACAAATCAAAG GTAAAGAAAGTGTCAGAAACTTTTGCATAAACGGAGAGGTCAAAATCTGCAGTCCT AATGGATATTCATTCAGAATAATTAGACACATCTTAAAGTCTTTTGATAACGTGTAT TCTGGGAACAGAAGAATGATTGGACTAGCTAAAGTGGTAATCGGATTGGCACTGTC CGGCTCACCCGTTCCAGAAGGAATGAACTGGGTTTACAAGCTAAGGAGAACACTGA TTTTTCAATGGGCAGAATCTCAAGGCCCGTTAGAAGGGGAAGAGCTAGAATATTCC CAGGAGATAACCTGGGACGATGAATCGGAGTTTGTTGGTTTACAAATCAGAATCAG TGCCAAAC AATGTC ACATCC AGGGGAGATTGTGGTGTATCAAC ATGAACTCCAGAG CTTGCCAACTGTGGGCAGACATGGCCCTCAAGACCCAGCAGTCTAAAGATGATGAG AATACTTCGCTTCTGTTGGAATGAACTTACGCATGTTAGAACTGCTTGAAACTTTTAC CTCCATTTTGAGCCGATATTATCTGCGAGCAATAGAACAAACACAGTTATGGTGCCT GCTTTCAGCAAAATGGACACGACTTCCACCTTTATTAGTCTTTAGATTAAAACTTTG AGCAAGACGTGAAAAAAACATTCCCTAACGGGCTAACAGCCCTCCCCTTTTGTCATC ATGAGCAATTTATGCACCATTTTCATCCTGTGTGCAAGTATAATGGTTTCTTTAGGTG ATTTTCCACTGTACACAATTCCCGAGAAAATAGGACCATGGACGCCCATTGATTTGA CCCATCTGAGTTGTCCAAACAACCTGCTTTCAGAAGATGACGGATGCAGCTCTTCCT CAACTTTCAGTTATATAGAATTGAGAACTGGTTATCTCACCCATCAAAAAGTGTCTG GATTTACGTGTACTGGAGTCATCAACGAAGCAGTTACATACACCAATTTTGTAGGAT ATGTAACAACCACTTTTAAAAGAAAACATTTCAAACCAACTGCTTCTGCCTGTAGGG ATGCATATCATTGGAAAATTTCTGGAGATCCTCGTTATGAAGAATCACTACACACTC CTTACCCGGACAACAGTTGGTTGAGAACAGTCACTACAACCAAAGAATCACTTCTA ATCATCTCTCCAAGCATAGTGGAGATGGACATTTATAGTCGTTCTCTTCATTCACCA ATGTTTCCCACAGGGAGGTGTTATGACTTCTATAAATCTACCCCTTCTTGCTTGACCA ACCATGACTATACAATATGGCTTCCTGATGATGCAAATGTACGACTCACATGCGATA TCTTTGTAACGAGTACCGGAAAGAAATCAATGAATGGTTCAAAAATGTGTGGCTTTA CTGATGAAAGAGGACTTTATAGAACTCTGAAAGGGGCTTGTAAGTTGACATTATGTG
GAAAGCCAGGACTGAGATTGTTCGATGGCACCTGGATTTCTATCACAAGACCTGAG ATTGTTATGTGGTGTTCTCCTAATCAACTTGTGAATGTGCATAACAACAGAGTGGAT GAGATAGAACACTTAATTGTGGGTGACTTGATCCGTAGAAGAGAAGAGTGCCTGGA TACCTTAGAGACAGTTCTTATGTCAAAGTCAGTTAGTTTTAGACGACTGAGTCATTT CAGAAAGCTTGTCCCGGGTTTTGGAAAGGCATATACCATCGCCAATGGGAGCCTAA TGGAAACCAATGTACACTACAAAAGAGTAGATCGTTGGGAGGAAATATTACCCTCC AAAGGGTGCCTAAAACTGAATGACAAGTGTCTTAACCCTGAGAATGGGGTGTTTTTT AATGGGATCATTAAAGGCCCTGATGGACAGGTTTTAATTCCAGAAATGCAGTCAAG TTTATTGAAGCAACATATGGACTTGCTGAAAGCTTCTGTATTTCCTCTAAGACATCCT TTGATCGATCAAACATCTATCTTCAAAAAAGATGGAGAGGCAGATGACTTTGTTGAT GTTCACATGCCAGATCCGCATAAGTCAATATCCAATATAGATTTAGGTTTACCAGAC TGGGGTCTATATGCAATGATTGGGGGAACTGTAGTTGCATTTCTAATATTGGTGTGT CTCCTCTGTACTTGTTGTAAAAGAAGACGAAGGAGGAATTCCAGAAAGCCTAGCTC AGAACAAACCCCAAAAATTTCATCTACTCCTCCTTCTGGGACTAAAGTCATATCATC TTGGGAGTCTTATAA AGGCAC ATCTAGTGTGTAAACTAGATATTGTTTAAAAC AACT CTGAGTGCCATAAATACAGCTCAACAAACTGCCTCTTTATCATCATATCACTTTATTT TGTTTTACTCGATATAACGTTATATCTTACAGTGCATTCATCTCATATAACCTCTTAA AATGAGACAATCAATAAAGTATATCAATCTCATCTTTTTGTGGTACACACAACCGGG ACAGAGTACTCATGTTGCAAGGTTATATTGGACAGAAACACCGGCAATAGACTGTG ACATATTTCAATTGAGAACATTATAACAAGCAATCGATTACACCCTATCGTATGATA CAAAAGCCGCAACTGAGATTACTTATTTCACCTCGAGTGATTGTCTCAGTTCTTGAA CCTTTAGGGTGCATATACCTTAATCAAAGCAATCTTCCTGTACAATAACTCCTTCTGA TCTAATAATATTCAGGGATTCTGTAAATAACCTGCCTAAGAATGTAATGTAGTATAA GAGATGTTTGGTTTTTGTCATGTCAATTCATGTGCTAACTTTGCTCACACGTCACATT GTAAGGAACAtGAAAAAAACATCTTACACTCCCCAAGATTAAGCCTCAACAGCCcTC CTGGGTTTTGTTCCAACATGATTGAGTCCTCTGAGGTATATGATGATCCTCTTGATCC TGCAGAGCCTGAAAGTGAATGGAGTAATACCTCCATAATTCCAAACATACTGAGAA ATTCTGATTATAATCTGAATTCCCCTCTTTTAGAAGATCATGCTGATCTTATGTTGCA ATGGTTGTCCTCAGGAAATCGTCCTCTGAGAATGAGTACTACAGACAATATATCCAG ATCTTACAAAGTATTAAAATTGTCCTTTAAGAAAATAGATATAGCTTCAATAAAATT TGGAGGTCAGGGAGCTCAGGCAATGATGAATACTTGGGTTCTGTGTTCTCATGCAGA ATCCTCTAGAAGTAGGAAATGCTTGACAGACTTATCCATCTTTTACCAAAGATCTAT ACCTATAGAGTCTATTTTAAATTACACATTAAGTAATCGAGGACTACAAACACCGAA
AGAAGGAGTATTATCATGTTTAGGTCGTATTAGTTATGATCAGTCCTTTGGTAGATA TTTAGGGAATCTATATTCATCTTATCTATTGTTTCATACTATGATCCTTTACATGAAT GCATTGGATTGGGAAGAAGAAAAGACGATTATAGCTTTGTGGAAAGAGATAACATC GATAGATGTCAAGAACGACAAGGTCACCTTCAGAGATCCCTTATGGGGAAAATTTTT AGTTACAAAAGAATTTGTTTACTCTTATACTAACTGCAGCTTATTTGATAGGAATTA CACATTAATGTTGAAAGATTTGTTTTTGTCTAGATTTAACTCCTTGTTAATTCTTATA TCACCTCCTGAACCTAGATACTCTGATGATTTAATTTCTAATCTCTGTCAATTATATA AATCTGGGGACAAAGTCATTTCAGAGTGTGGGAATTCCGGATACGATGTCATCAAA ATCTTAGAACCCTACGTTGTCAATCACCTAGTTCAAAAAGCTGAGACTTTCAGACCA TTGATTCACTCTTTAGGAGACTTTCCTGCTTTCATCAAAGATAAAACCACACAGTTG AGAGGGACTTTTGGGCCTTGTGCATCACAATTTTTCTCGGCTCTAGACCAATTTGAC AACATTCACGATTTGGTTTTTGTGTATGGATGTTATAGACATTGGGGCCATCCTTATA TTGACTATCGGAAAGGTCTAACCAAGTTGTTTGATCAAGTCCATATGAAAAAGACCA TTGACAAACATTATCAGGAATGCTTGGCTAGTGATTTAGCAAAGAAAATATTGAGAT GGGGATTTGATAA ATATTCAAGATGGTATTTAGACACCTCATTGTTACC AAAGAACC ACCCCTTGATTCCCTATATAACAACACAGACTTGGCCTCCTAGACATGTTGTAGATT TGTTGGGGGATTCATGGCATTCTCTCCCAATGACACAGATCTTTGAAATACCGGAAT CAATGGATCCTTCTGAAATATTAGATGACAAATCTCACTCATTCACAAGAACAAGAC TTGCATCCTGGCTATCTGAAAATAGAGGAGGTCCTGTCCCCAGTGAAAAAGTCATAA TCACTGCCTTATCTAAGGCTCCAGTTAATCCCAGAGAGTTCTTGAAGGCGGTTGATC TAAATGGGCTTGCTGAAGATGACTTGATCATAGGTTTGAAACCAAAGGAGAGGGAA CTCAAAATAGAAGGCAGGTTTTTTGCATTAATGTCATGGAATTTAAGACTTTACTTT GTTATCACGGAGAAACTTTTAGCAAACCATATTCTTCCTTTATTTGATGCTTTGACGA TGACAGACAACTTAAACAAAGTATTCAAGAAATTAATTGATAGGGTCACTGGTCAG GGACTTTGTGATTACTCGAGAGTCACATATGCTTTCCATCTTGATTATGAAAAATGG AACAATCACCAAAGACTAGAGTCTACCAAAGATGTCTTCTCTGTATTGGATAAGGCA TTCGGACTATCCCGTGTTTTTTCTAGAACTCATGAGTTTTTTCAGAAGTCCTGGGTTT ATTATTCAGACAGATCTGATTTAATCGGAATTTGGAATGATCAGATATATTGTCTTG ACATGGCCGATGGACCAACCTGCTGGAATGGTCAAGATGGTGGTCTTGAAGGTCTC AGGCAAAAGGGTTGGAGTTTAGTTAGTTTGCTTATGATAGACCGAGAATCTCAAAC AAGAAACACAAGAACCAAAATATTAGCACAGGGTGACAATCAAGTTTTGTGTCCCA CTTATATGTTGTCCTCTGGGTTAAATAATGAGGGCTTAATGTATGAATTAGAAAGCA TATCAAAAAATGCAATGTCAATTTATCGCGCCATtGAAGAGGGGGCTTCTAAGTTGG
GACTGATAATCAAAAAGGAGGAAACCATGTGTAGTTATGACTTTTTAATCTATGGCA AAACTCCACTGTTTAGAGGAAACATACTTGTTCCCGAGTCTAAGAGATGGGCTAGA GTGTCCTGCATATCAAATGATCAGATAGTAAACTTGGCAAATATCATGTCCACTGTA TCAACCAATGCGCTGACTGTAGCCCAGCATTCACAATCCCTAATCAAGCCTATGAGG GATTTTCTTCTAATGTCTGTTCAAGCTATTTATCATTACCTCTTATTTAGCCCCATCTT AAAAGATCGAGTATATAAAGTATTAAACTCAAAGGGGGATGACTTTCTCTTGACCAT GTCTAGGATAATATACTTAGACCCTTCATTGGGAGGAGTGTCAGGGATGTCTCTAGG TAGATTTCATATAAGACAATTCTCAGATCCTGTATCAGAGGGATTGACGTTCTGGAA AGAGATATGGCTAAGTTCTTCTGAATCTTGGATTCATCATCTTTGTCAAGAAGCAGG AAATCCTGATTTAGGAGATAGAAGTCTTGAGAGTTTTACCCGATTGCTGGAGGATCC CACAACTTTAAACATAAGAGGGGGTGCAAGCCCTACAATTTTGTTGAAAGAAGCTA TTAGAAAAGCCCTTTACGATGAGGTTGATAAAGTAGAAAATTCAGAATTCAGAGAG GCTATTATCTTATCCAAAACCCACAGGGACAACTTTATTCTATTTTTAAAATCAATTG AACCACTATTTCCCCGATTTTTAAGCGAATTGTTCAGTTCTTCATTCTTAGGGATACC AGAATCAATCATAGGTCTC ATTCAAAACTCC AGGACTGTTAGAAGAC AATTTAGAA AAAGCTTATCAAGAGCGTTAGAAGAATCCTTTTTTCACTCTGAAATTCATGGAATCA GTAGAATGACTCAATCTCCTCAAAGACTTGGGAGAGTCTGGTCATGTTCGGCAGAA AGAGCTGATCAGCTGCGCGAGATCTCTTGGGGAAGAAAAGTTGTAGGAACAACTGT CCCTCACCCATCGGAGATGCTAATGTTGGTCCCCAAATCTTCAGTCTCTTGTGGTTGT AGTATTAGGGAGCTGTACAACCCTAGAATCTCAGTTTCTGTTCTCCCTTCCTTTGACA ATTCTTTCTTCTCTAGAGGATCCCTCAGGGGGTATCTAGGGTCTTCTACATCCGTCTC AACTCAATTGTTCCATGCATGGGAGAAGGTGACCAATGTCCATGTTGTTAAAAGAGC TCTCTCTCTCAAGGAGTCAATCAACTGGTTTATTTCCCGAGACTCTAATTTGGCACAG ACTCTGATAAGAAACATACTGTCGTTAACAGGGCCTGAGTTTCCGATAGAAGAGGC TCCAGTGTTTAAAAGGACTGGGTCTGCCCTACATAGATTCAAATCTGCAAGGTACAG TGAAGGTGGTTATTCAGCTGTATGTCCGAATCTCTTGTCTCATATTTCTGTAAGCACT GATACGATGTCGGATCTCACTCAAGACGGAACTAATTTTGACTTTATGTTTCAACCC TTAATGTTGTATGCTCAGACATGGACATCGGAGCTTGTTCAGAAGGATTTAAGATTG AGAGACTCAACTTTTCATTGGCATCTGAGGTGTCAAAAATGTATAAGGCCTATTGAG GAGGTTAGTTTAGAAGCTCCACAAAGCTTTGCTTTTCCTGATATCTCCACTCGAATAT CCAGAATGGTGTCTGGGGCCGTACCTCAGTTTAGAAAACTTCCTACAATAGAACTTA AAGCGGGAGATCTTTCCAGTCTGACAAACAATGAGAGATCTTATCATGTAGGGACT GCCCAAGGTTTGCTATATTCTATCCTCGTAGCAATACATGATCCTGGATACAATGAC
AACTCTTTATTCCCAGTCAACATATATGGAAAGGTCTCTGCTAGAAGTTATTTGAGG GGCCTAGCAAGAGGTGTGTTTATTGGATCTTCCATATGTTTTCTAACCCGGATGACT AATATAAATATTAACAGACCTCTTGAGTTAATTTCTGGCGTGATCTCATACATTTTGC TCAGACTAGATAATCACCCTTCTCTTTATGTGATGTTAAAAGAACCTGAATTGAGGT CAGAGATCTTTTCAATTCCTCAGAAAATCCCAGCAGCTTACCCAACCACCATGAAGG AAGGTAACAGATCAGTTTTATGTTATCTTCAACAGGTACTAAGATATGAAAGAGAC AGTATGTCCTCATCTCCAGGTAACGATCTCCTGTGGATATTCTCAGACTTCAGAAGC ATCAAAATGACATATTTGACTTTAATAACTTTCCAGGCCCACCTTTGGTTACAACGG ATTGAGAGAAATTTGTCTAAACAAATGAGAGCAAAACTTCGTCAACTGAACTCATT AATGAGACAAGTTTTGGGCGGTCATGGAGAGGAAAATATCGAATCGGATGATGAAA TAAACTCTCTGCTCAAGGAAGCTCTTAGAAGAACTAGATGGGTAGATCAGGAGGTA CGTCATGCTGCTAAGACTATGAGACCTGACTTAAGTCCAGTTCCAAAGAACTCACGC AAAATTGGTTCTTCAGAATGGATTTGCTCTGCCCAACAAATAGCTTTCTCAACCTCTT TGAACCCTGCCCCAATGTCAGATATAGATTTGAGACTATTGTCTCGACAGTTTCAAA ACCCTCTTATGTC AGGTTTAAGAGTCGTCCAATGGGCTACAGGAGC ACATTATAAGT TAAAGCCAATCTTGGATGATTTAGAAGTCGGTCCAAGCTTGTCACTCGTAGTAGGAG
AtGGTTCAGGGGGAATTTCTAGGACTGTTCTGAACATGTTTCCAGACTCTAAGTTGGT TTTCAATAGCCTTCTAGAGGTAAATGATTTGATGGCTTCGGGAACACATCCTCTTCCT CCTTCCGCCTTGATGAGAGGAGGAGAAGATATAACATCAAGAGTGATAGACTTTGA ATCTATATGGGAAAAGCCTTCTGATTTAAGAAATTCTGTCACATGGAAATATTTTCA GTCTGTCCAAACAAGAGTGAAGGCTCATTTTGATCTAATCGTTTGTGATGCAGAGGT AACAGACATTGAATCTGTCAACAAGATCACTTTGCTTTTGTCTGATTTTGCAATGTCA ATAAGAGGACCCTTATGTCTGATCTTCAAGACATATGGAACTATGCTGATTAATCCT GATTACAAGGCCATCCATCACTTATCCAGAGCATTTCCTAACATGATTGGGTTTGTT ACTCAGATGACATCATCTTTCTCTTCTGAAGTTTATCTCAGATTTTCCAAAAAGGGTC ATTTTTTTAGAGAGCATGAGTCACTCACTGCCTCCACTATTAGAGAAATGAGCCTGG TTTTGTTCAATTGTAGCAATCCTAAAAGTGAAATGTTGAGGGCCAGATCGCTGAACT ATCAAGATTTGATCAGAGGATTCCCTGAAGAGATAATCTCCAATCCATATAACGAA ATGATAATAACTTTAATTGATAGTGAAGTCGAGTCATTTCTTGTCCATAAGTTGGTG GATGATCTAGAGTTAAAAAGAGGCTCCTCATCCAAGATGGCAATTATTGTTGCAATA ATTATACTGTTTTCTAACAGGGTCTTCAATGTGTCAAAGTCAATTAAAGATACAAAA TTCTTTCCTCCCTCAGATCCGAAAATTCTCCGACACTTTAACATATGTTTGAGCACGA TGTTGTTTTTGTCTACAACTATGGGGGACCTGTCAAACTTCACAAAAATTCATGAGT
TGTATAACTCTCCAGTCATATACTATTTTCGAAAACAGACTATCAAAGGCAAAAAGT TTCTCTCTTGGAGTTGGGCTGATCCCAGTAGCATATTCAAAAAGGTATCTTGTAACT CATCTCTTAGTTTATCAGCTCATTGGATTAGAATGATTTATAAAATTGTCAAAACTAC TAGGTTGAACTCAAATCCCCGAGAGTTGTTGAAAGAGGTAGAAATTTACCTTAAGG GATACAATCGATGGATTACAATGAGAGATGTTAGATCTAGAACCTCCTTGCTAGACT ATTGTTGTTTGTAATTTGAATCGTTGAGGATTCTCACCTAAAAGTTCAACTGACAGG TCACCTGGACTGAAGAAGATACAAAACTAGAAAAAAACATGTCTAAGACTCACAGC ATGTCACTGCTTGAGGACTCTTCTTTTTTATGTTGTTTTTTTGTTAAGCGT (SEQ ID NO: 1)
[0024] The negative- sense lyssavirus genome encodes five proteins: the nucleoprotein (N); phosphoprotein (P); matrix protein (M); glycoprotein (G); and RNA polymerase (L) that are present in the overall genome in the order 3'-N-P-M-G-L-5'. Tordo, N, et al., Proc Natl Acad Sci USA, 1986; 83:3914-3918. The invention also includes isolated nucleic acids encoding to the protein sequences of the five structural genes (N, P, M, G and L) of the SHIBV virus and derivatives thereof. The present invention also includes isolated protein sequences of the SHIBV virus corresponding to the five structural genes (N, P, M, G and L).
[0025] Also provided are isolated nucleic acids encoding the structural proteins of SHIBV. A nucleic acid sequence encoding nucleoprotein (N gene) includes nucleotides 71 to 1423 of SEQ ID NO: 1, or derivatives thereof. A nucleic acid sequence encoding the phosphoprotein (P gene) includes nucleotides 1522 to 2439 of SEQ ID NO: 1, and derivatives thereof. A nucleic acid sequence encoding the matrix protein (M gene) includes nucleotides 2516 to 3124 of SEQ ID NO: 1, and derivatives thereof. A nucleic acid sequence encoding the glycoprotein (G gene) includes nucleotides 3330 to 4898 of SEQ ID NO: 1, and derivatives thereof. A nucleic acid sequence encoding the polymerase protein (L gene) includes nucleotides 5512 to 11895 of SEQ ID NO: 1, and derivatives thereof.
[0026] As used herein, a derivative of a nucleic acid is a sequence of nucleotides that is not found in nature. A derivative of a nucleic acid may include at least one substitution, deletion, or modification of at least one base. A derivative of a nucleic acid is optionally 50% or more identical to the wild-type sequence. Optionally a derivative is has identity relative to the wild- type sequence of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or any value or range of values therebetween. Base modifications are modifications known in the art that may alter the melting temperature, alter the annealing temperature, alter the translated amino acid sequence, shorten or lengthen an
encoded amino acid sequence relative to wild-type, alter expression level of mRNA or protein, or other modification effect known in the art.
[0027] The term "nucleotide" is intended to mean a base-sugar-phosphate combination either natural or synthetic, linear, circular and sequential arrays of nucleotides and nucleosides, e.g. cDNA, genomic DNA, mRNA, and RNA, oligonucleotides, oligonucleosides, and derivatives thereof. Included in this definition are modified nucleotides which include additions to the sugar-phosphate groups as well as to the bases.
[0028] The term "nucleic acid" or "oligonucleotide" refers to multiple nucleotides attached in the form of a single or double stranded polynucleotide that can be natural, or derived synthetically, enzymatically, and by cloning methods. The terms "nucleic acid" and "oligonucleotide" may be used interchangeably in this application.
[0029] An inventive nucleic acid sequence is provided. The nucleic acid sequence relates to the genome sequence of Shimoni bat virus as found in SEQ ID NO: 1, portions thereof, and derivatives thereof. The inventive nucleic acid sequence is optionally isolated from the cellular or viral materials with which it is naturally associated. Numerous methods are known in the art for the synthesis and production of nucleic acid sequences illustratively including cloning and expression in cells such as E. coli, insect cells such as Sf9 cells, yeast, and mammalian cell types such as Hela cells, Chinese hamster ovary cells, or other cells systems known in the art as amendable to transfection and nucleic acid and/or protein expression. Methods of nucleic acid isolation are similarly recognized in the art. Illustratively, plasmid DNA amplified in E. coli is cleaved by suitable restriction enzymes such as Ndel and Xhol to linearize glycoprotein DNA. The glycoprotein DNA is subsequently isolated following gel electrophoresis illustratively using a S.N. A. P.™ UV-Free Gel Purification Kit (Invitrogen, Carlsbad, CA) as per the manufacturer's instructions.
[0030] Numerous agents are commercially available to facilitate cell transfection illustratively including synthetic or natural transfection agents such as lipid agents illustratively including LIPOFECTIN recognized in the art as a is a 1:1 (w/w) liposome formulation of the cationic lipid N-[l-(2,3-dioleyloxy)propyl]-n,n,n-trimethylammonium chloride (DOTMA) and dioleoyl phophotidylethanolamine (DOPE) in membrane filtered water, baculo virus, naked plasmid or other DNA, or other systems known in the art.
[0031] The nucleotide sequences of the invention may be isolated by conventional uses of polymerase chain reaction or cloning techniques such as those described in conventional texts. For example, the nucleic acid sequences of this invention may be obtained via reverse
transcription of viral RNA, and subsequent amplification and sequencing of the cDNA, using DNA primers and probes and PCR techniques. These sequences, fragments thereof, modifications thereto and the full-length sequences may be constructed recombinantly using conventional genetic engineering or chemical synthesis techniques or PCR, and the like.
[0032] The present invention also encompasses isolated proteins derived from SHIBV genetic sequence or derivatives of proteins derived from SHIBV. In some embodiments, a protein is a SHIBV nucleoprotein, phosphoprotein, matrix protein, glycoprotein, polymerase protein, or derivatives of any of these proteins. The protein is optionally recombinant. The protein is optionally isolated. However, it is also envisioned that naturally occurring structural protein is optionally isolated from at least a portion of sample material from which the wild- type sequence is normally found. Methods for purification of protein from organism derived samples are known and are within the level of skill in the art.
[0033] An inventive protein illustratively has an amino acid sequence of nucleoprotein as represented by SEQ ID NO: 2, or derivatives thereof.
[0034] MDSEKIVFKVRNQVVSLKPEIISDQYEYKYPAILDGRKPGITLGRAPDLNTAY KSILSGMNAAKLDPDDVCSYLAAAMQLFEGVCPEDWTSYGIVIAKKGDKITPEDLIDVT RTNVEGNWAQTGGTDMTRDPTSAEHASLVGLLLCLYRLSKIVGQNTANYKTNVADRM EQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGAYDMYFARIEHLYSAIRVGTV VTAYEDCSGLVSFTGFIKQINLSARDALLYFFHKNFEEEIRRMFEPGQETAIPHSYFIHFRA LGLSGKSPYSSNAVGHTFNLIHFIGCYMGQIRSLNATVIQACAPHEMSVLGGYLGEEFFG KGTFERRFFRDEKEMQDYAELEGIKIEAALADDGTVDSDDEDFFSGETRSPEAVYSRIM MNNGRLKRSHIRRYISVSSNHQARPNSFAEFLNKVYSDGS (SEQ ID NO: 2)
[0035] An inventive protein illustratively has an amino acid sequence of phosphoprotein as represented by SEQ ID NO: 3, or derivatives thereof.
[0036] MSKGLIHPSSIRSGLVDLEMAEETVDLIHKNLTDGQAHLQGEPLDVDSLPED MRRMRLIDMSRQKDIRIGDEGESSSEDEFYLPSGKDPMVPLQDFLDEIGAQVVKRMKSG DGFFKIWSTVTEDIKGYISSNFTAAEPRSSDNKSVQTEPAQIQKGLPEPPSHEEKAKETQE S S KNRQES KP APS SDWDNNQEE VDDIEGE V AHQ V AESFS KKYKFPSRS S GIFLWNFEQL KMNLDDIVKAALNIPGIDKIAEKGGKLPLRCILGYVSLSASKRFCLLADNDKTARLMQD DINNYIAKIEEIDKS (SEQ ID NO: 3)
[0037] An inventive protein illustratively has an amino acid sequence of matrix protein represented by SEQ ID NO: 4, or derivatives thereof.
[0038] MNFLRRIVKNCKDEDAPKLGTPSAPPDDDDLWLPPPEYMPLAQIKGKESVR NFCINGEVKICSPNGYSFRIIRHILKSFDNVYSGNRRMIGLAKVVIGLALSGSPVPEGMNW VYKLRRTLIFQWAESQGPLEGEELEYSQEITWDDESEFVGLQIRISAKQCHIQGRLWCIN MNSRACQLWADMALKTQQSKDDENTSLLLE (SEQ ID NO: 4)
[0039] An inventive protein illustratively has an amino acid sequence of glycoprotein represented by SEQ ID NO: 5, or derivatives thereof.
[0040] MSNLCTIFILCASIMVSLGDFPLYTIPEKIGPWTPIDLTHLSCPNNLLSEDDGCS SSSTFSYIELRTGYLTHQKVSGFTCTGVINEAVTYTNFVGYVTTTFKRKHFKPTASACRD AYHWKISGDPRYEESLHTPYPDNSWLRTVTTTKESLLIISPSIVEMDIYSRSLHSPMFPTG RCYDFYKSTPSCLTNHDYTIWLPDDANVRLTCDIFVTSTGKKSMNGSKMCGFTDERGL YRTLKGACKLTLCGKPGLRLFDGTWISITRPEIVMWCSPNQLVNVHNNRVDEIEHLIVG DLIRRREECLDTLETVLMSKSVSFRRLSHFRKLVPGFGKAYTIANGSLMETNVHYKRVD RWEEILPSKGCLKLNDKCLNPENGVFFNGIIKGPDGQVLIPEMQSSLLKQHMDLLKASVF PLRHPLIDQTSIFKKDGEADDFVDVHMPDPHKSISNIDLGLPDWGLYAMIGGTVVAFLIL VCLLCTCCKRRRRRNSRKPSSEQTPKISSTPPSGTKVISSWESYKGTSSV (SEQ ID NO: 5)
[0041] An inventive protein illustratively has an amino acid sequence of polymerase protein represented by SEQ ID NO: 6, or derivatives thereof.
[0042] MIESSEVYDDPLDPAEPESEWSNTSIIPNILRNSDYNLNSPLLEDHADLMLQW LSSGNRPLRMSTTDNISRSYKVLKLSFKKIDIASIKFGGQGAQAMMNTWVLCSHAESSRS RKCLTDLSIFYQRSIPIESILNYTLSNRGLQTPKEGVLSCLGRISYDQSFGRYLGNLYSSYL LFHTMILYMNALDWEEEKTIIALWKEITSIDVKNDKVTFRDPLWGKFLVTKEFVYSYTN CSLFDRNYTLMLKDLFLSRFNSLLILISPPEPRYSDDLISNLCQLYKSGDKVISECGNSGY DVIKILEPYVVNHLVQKAETFRPLIHSLGDFPAFIKDKTTQLRGTFGPCASQFFSALDQFD NIHDLVFVYGCYRHWGHPYIDYRKGLTKLFDQVHMKKTIDKHYQECLASDLAKKILR WGFDKYSRWYLDTSLLPKNHPLIPYITTQTWPPRHVVDLLGDSWHSLPMTQIFEIPESM DPSEILDDKSHSFTRTRLASWLSENRGGPVPSEKVIITALSKAPVNPREFLKAVDLNGLAE DDLIIGLKPKERELKIEGRFFALMSWNLRLYFVITEKLLANHILPLFDALTMTDNLNKVF KKLIDRVTGQGLCDYSRVTYAFHLDYEKWNNHQRLESTKDVFSVLDKAFGLSRVFSRT HEFFQKSWVYYSDRSDLIGIWNDQIYCLDMADGPTCWNGQDGGLEGLRQKGWSLVSL LMIDRES QTRNTRTKILAQGDNQ VLCPT YMLS S GLNNEGLM YELES IS KN AMSIYR AIEE GASKLGLIIKKEETMCSYDFLIYGKTPLFRGNILVPESKRWARVSCISNDQIVNLANIMST VSTNALTVAQHSQSLIKPMRDFLLMSVQAIYHYLLFSPILKDRVYKVLNSKGDDFLLTM SRIIYLDPSLGGVSGMSLGRFHIRQFSDPVSEGLTFWKEIWLSSSESWIHHLCQEAGNPDL
GDRSLESFTRLLEDPTTLNIRGGASPTILLKEAIRKALYDEVDKVENSEFREAIILSKTHRD NFILFLKSIEPLFPRFLSELFSSSFLGIPESIIGLIQNSRTVRRQFRKSLSRALEESFFHSEIHGI SRMTQSPQRLGRVWSCSAERADQLREISWGRKVVGTTVPHPSEMLMLVPKSSVSCGCSI RELYNPRISVSVLPSFDNSFFSRGSLRGYLGSSTSVSTQLFHAWEKVTNVHVVKRALSLK ESINWFISRDSNLAQTLIRNILSLTGPEFPIEEAPVFKRTGSALHRFKSARYSEGGYSAVCP NLLSHISVSTDTMSDLTQDGTNFDFMFQPLMLYAQTWTSELVQKDLRLRDSTFHWHLR CQKCIRPIEEVSLEAPQSFAFPDISTRISRMVSGAVPQFRKLPTIELKAGDLSSLTNNERSY HVGTAQGLLYSILVAIHDPGYNDNSLFPVNIYGKVSARSYLRGLARGVFIGSSICFLTRM TNININRPLELIS G VIS YILLRLDNHPS LY VMLKEPELRSEIFS IPQKIP A A YPTTMKEGNRS VLCYLQQVLRYERDSMSSSPGNDLLWIFSDFRSIKMTYLTLITFQAHLWLQRIERNLSKQ MRAKLRQLNSLMRQVLGGHGEENIESDDEINSLLKEALRRTRWVDQEVRHAAKTMRP DLSPVPKNSRKIGSSEWICSAQQIAFSTSLNPAPMSDIDLRLLSRQFQNPLMSGLRVVQW ATGAHYKLKPILDDLEVGPSLSLVVGDGSGGISRTVLNMFPDSKLVFNSLLEVNDLMAS GTHPLPPSALMRGGEDITSRVIDFESIWEKPSDLRNSVTWKYFQSVQTRVKAHFDLIVCD AEVTDIESVNKITLLLSDFAMSIRGPLCLIFKTYGTMLINPDYKAIHHLSRAFPNMIGFVT QMTSSFSSEVYLRFSKKGHFFREHESLTASTIREMSLVLFNCSNPKSEMLRARSLNYQDLI RGFPEEIISNPYNEMIITLIDSEVESFLVHKLVDDLELKRGSSSKMAIIVAIIILFSNRVFNVS KSIKDTKFFPPSDPKILRHFNICLSTMLFLSTTMGDLSNFTKIHELYNSPVIYYFRKQTIKG KKFLSWSWADPSSIFKKVSCNSSLSLSAHWIRMIYKIVKTTRLNSNPRELLKEVEIYLKG YNRWITMRDVRSRTSLLDYCCL (SEQ ID NO: 6)
[0043] Illustrative nucleic acid and protein sequences of the present invention can be found at GenBank Accession No: GU170201, the entire contents of which are incorporated herein by reference.
[0044] The description is directed primarily to the glycoprotein (G) protein of Shimoni bat virus (SHIBV) as an illustrative example of a protein sequence that is the target of antibodies and useful for development of a vaccine to SHIBV. It is to be appreciated that the use of glycoprotein is for exemplary purposes only and not meant to be a limitation on the isolated protein structures of the present invention, which are equally appreciated to include the isolated protein sequences encoded by the genes N, P, M, G, and L. All proteins encoded by the nucleotide sequence of Shimoni bat virus as in SEQ ID NO: 1, portions thereof, or derivatives thereof, are similarly included.
[0045] The terms "polypeptide," "peptide," and "protein" are synonymous as used herein and are intended to mean a natural or synthetic compound containing two or more amino acids.
Amino acids present in a protein include the common amino acids alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, methionine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan, and tyrosine as well as less common naturally occurring amino acids, modified amino acids or synthetic compounds, such as alpha-asparagine, 2-aminobutanoic acid or 2-aminobutyric acid, 4- aminobutyric acid, 2-aminocapric acid (2-aminodecanoic acid), 6-aminocaproic acid, alpha- glutamine, 2-aminoheptanoic acid, 6-aminohexanoic acid, alpha-aminoisobutyric acid (2- aminoalanine), 3-aminoisobutyric acid, beta-alanine, allo-hydroxylysine, allo-isoleucine, 4- amino-7-methylheptanoic acid, 4-amino-5-phenylpentanoic acid, 2-aminopimelic acid, gamma- amino-beta-hydroxybenzenepentanoic acid, 2-aminosuberic acid, 2-carboxyazetidine, beta- alanine, beta-aspartic acid, biphenylalanine, 3,6-diaminohexanoic acid, butanoic acid, cyclobutyl alanine, cyclohexylalanine, cyclohexylglycine, N5-aminocarbonylornithine, cyclopentyl alanine, cyclopropyl alanine, 3-sulfoalanine, 2,4-diaminobutanoic acid, diaminopropionic acid, 2,4- diaminobutyric acid, diphenyl alanine, N,N-dimethylglycine, diaminopimelic acid, 2,3- diaminopropanoic acid, S-ethylthiocysteine, N-ethylasparagine, N-ethylglycine, 4-aza- phenylalanine, 4-fluoro-phenylalanine, gamma-glutamic acid, gamma-carboxyglutamic acid, hydroxyacetic acid, pyroglutamic acid, homoarginine, homocysteic acid, homocysteine, homohistidine, 2-hydroxyisovaleric acid, homophenylalanine, homoleucine, homoproline, homoserine, homoserine, 2-hydroxypentanoic acid, 5-hydroxylysine, 4-hydroxyproline, 2- carboxyoctahydroindole, 3-carboxyisoquinoline, isovaline, 2-hydroxypropanoic acid (lactic acid), mercaptoacetic acid, mercaptobutanoic acid, sarcosine, 4-methyl-3-hydroxyproline, mercaptopropanoic acid, norleucine, nipecotic acid, nortyrosine, norvaline, omega-amino acid, ornithine, penicillamine (3-mercaptovaline), 2-phenylglycine, 2-carboxypiperidine, sarcosine (N- methylglycine), 2-amino-3-(4-sulfophenyl)propionic acid, 1 -amino- 1-carboxycyclopentane, 3- thienylalanine, epsilon-N-trimethyllysine, 3-thiazolylalanine, thiazolidine 4-carboxylic acid, alpha-amino-2,4-dioxopyrimidinepropanoic acid, and 2-naphthylalanine. Accordingly, the term "protein" as used herein includes peptides having between 2 and about 2500 amino acids or having a molecular weight in the range of about 150 - 250,000 Daltons.
[0046] A protein is obtained by any of various methods known in the art illustratively including isolation from a cell or organism, chemical synthesis, expression of a nucleic acid and partial hydrolysis of proteins. Chemical methods of peptide synthesis are known in the art and include solid phase peptide synthesis and solution phase peptide synthesis for instance, or by the
method of Hackeng, TM, et al., Proc Natl Acad Sci U S A, 1997; 94(15):7845-50, the contents of which are incorporated herein by reference.
[0047] A protein included in an inventive composition or method may be a naturally occurring or non-naturally occurring protein. The term "naturally occurring" refers to a protein endogenous to a cell, tissue or organism (in this case a lyssavirus) and includes allelic variations. A non-naturally occurring protein is synthetic or produced apart from its naturally associated organism or modified and is not found in an unmodified cell, tissue or organism.
[0048] Modifications and changes can be made in the structure of the proteins that are the subject of the application and still obtain a molecule having similar characteristics as the wild- type protein. For example, certain amino acids can be substituted for other amino acids in a sequence without appreciable loss of activity or ability to interact with other proteins, lipids, carbohydrates, cofactors, or other molecules. Because it is the interactive capacity and nature of a protein that defines that protein's biological functional activity, certain amino acid sequence substitutions can be made in a protein sequence and nevertheless obtain a protein with like properties. For example, one or more amino acid substitutions, additions, or deletions can be made without altering the functional properties of SHIBV proteins. It is also appreciated that several mutations optionally increase, decrease, or do not change the immunogenicity of an inventive protein.
[0049] Conservative amino acid substitutions can be made in SHBIV polypeptides to produce derivatives. Conservative amino acid substitutions are art recognized substitutions of one amino acid for another amino acid having similar characteristics. For example, each amino acid may be described as having one or more of the following characteristics: electropositive, electronegative, aliphatic, aromatic, polar, hydrophobic and hydrophilic. A conservative substitution is a substitution of one amino acid having a specified structural or functional characteristic for another amino acid having the same characteristic. Acidic amino acids include aspartate, glutamate; basic amino acids include histidine, lysine, arginine; aliphatic amino acids include isoleucine, leucine and valine; aromatic amino acids include phenylalanine, glycine, tyrosine and tryptophan; polar amino acids include aspartate, glutamate, histidine, lysine, asparagine, glutamine, arginine, serine, threonine and tyrosine; and hydrophobic amino acids include alanine, cysteine, phenylalanine, glycine, isoleucine, leucine, methionine, proline, valine and tryptophan; and conservative substitutions include substitution among amino acids within each group. Amino acids may also be described in terms of relative size, alanine, cysteine,
aspartate, glycine, asparagine, proline, threonine, serine, valine, all typically considered to be small.
[0050] In making such changes, the hydropathic index of amino acids can be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a polypeptide is generally understood in the art. It is known that certain amino acids can be substituted for other amino acids having a similar hydropathic index or score and still result in a polypeptide with similar biological activity. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics. Those indices are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cysteine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (- 1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).
[0051] It is believed that the relative hydropathic character of the amino acid determines the secondary structure of the resultant polypeptide, which in turn defines the interaction of the polypeptide with other molecules, such as enzymes, substrates, receptors, antibodies, antigens, and the like. It is known in the art that an amino acid can be substituted by another amino acid having a similar hydropathic index and still obtain a functionally equivalent polypeptide. In such changes, the substitution of amino acids whose hydropathic indices are within + 2 is preferred, those within + 1 are particularly preferred, and those within + 0.5 are even more particularly preferred.
[0052] Substitution of like amino acids can also be made on the basis of hydrophilicity, particularly, where the biological functional equivalent polypeptide or peptide thereby created is intended for use in immunological embodiments. The following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 + 1); glutamate (+3.0 + 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); proline (-0.5 + 1); threonine (-0.4); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4). It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still obtain a biologically equivalent, and in particular, an immunologically equivalent polypeptide. In such changes, the substitution of amino acids whose hydrophilicity values are within + 2 is preferred, those within + 1 are particularly preferred, and those within + 0.5 are even more particularly preferred.
[0053] As outlined above, amino acid substitutions are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take various of the foregoing characteristics into consideration are well known to those of skill in the art and include (original residue: exemplary substitution): (Ala: Gly, Ser), (Arg: Lys), (Asn: Gin, His), (Asp: Glu, Cys, Ser), (Gin: Asn), (Glu: Asp), (Gly: Ala), (His: Asn, Gin), (He: Leu, Val), (Leu: lie, Val), (Lys: Arg), (Met: Leu, Tyr), (Ser: Thr), (Thr: Ser), (Tip: Tyr), (Tyr: Trp, Phe), and (Val: He, Leu). Embodiments of this disclosure thus contemplate functional or biological equivalents of a polypeptide as set forth above. In particular, embodiments of the polypeptides can include variants having about 50%, 60%, 70%, 80%, 90%, and 95% sequence identity to the polypeptide of interest.
[0054] An inventive glycoprotein is illustratively recombinant. An inventive protein may be coexpressed with associated tags, modifications, other proteins such as in a fusion peptide, or other modifications or combinations recognized in the art. Illustrative tags include 6x His, FLAG, biotin, ubiquitin, SUMO, or other tag known in the art. A tag is illustratively cleavable such as by linking to glycoprotein or an associated protein via an enzyme cleavage sequence that is cleavable by an enzyme known in the art illustratively including Factor Xa, thrombin, SUMOstar protein as obtainable from Lifesensors, Inc., Malvern, PA, or trypsin. It is further appreciated that chemical cleavage is similarly operable with an appropriate cleavable linker.
[0055] Protein expression is illustratively accomplished from transcription of nucleic acid sequence encoding glycoprotein or derivatives thereof, translation of RNA transcribed from glycoprotein nucleic acid sequence such as a cDNA sequence, modifications thereof, or fragments thereof. Protein expression is optionally performed in a cell based system such as in E. coli, Hela cells, or Chinese hamster ovary cells. It is appreciated that cell-free expression systems are similarly operable.
[0056] It is recognized that numerous derivatives of lyssavirus proteins are within the scope of the present invention including amino acid substitutions, alterations, modifications, or other amino acid changes that increase, decrease, or do not alter the function of the protein sequence. A derivative of a protein sequence is a sequence of amino acids that is not found in nature. Several post-translational modifications are similarly envisioned as within the scope of the present invention illustratively including incorporation of a non-naturally occurring amino acid, phosphorylation, glycosylation, addition of pendent groups such as biotin, fluorophores, lumiphores, radioactive groups, antigens, or other molecules.
[0057] The present invention also provides a vector with an inventive nucleic acid sequence therein wherein the nucleic acid sequence optionally encodes an inventive protein. Illustrative vectors include a plasmid, cosmid, cationic lipids, non-liposomal cationic vectors, cationic cyclodextrin, viruses with RNA or DNA genetic material, polyethylenimines, histidylated polylysine, or other vector system known in the art. A vector is optionally a plasmid. A suitable vector optionally possesses cell type specific expression or other regulatory sequences or sequences operable to stimulate or inhibit gene or protein expression. A vector illustratively contains a selection marker such as an antibiotic resistance gene.
[0058] Also provided is a host cell transformed with an appropriate vector or with the inventive nucleic acid sequence, optionally that encodes an inventive protein or derivative. A host cell for expression of polypeptides and fragments thereof can be prokaryotic or eukaryotic, such as bacterial, plant, insect, fungus, yeast, and mammalian cells. Optional host cells include E. coli or Sf9 cells. An expression vector is introduced into a host cell using well-known techniques such as infection or transfection, including calcium phosphate transfection, liposome- mediated transfection, electroporation and sonoporation.
[0059] A method is also provided for recombinantly expressing a inventive nucleic acid or protein sequence or fragments thereof wherein a cell is transformed with an inventive nucleic acid sequence and cultured under suitable conditions that permit expression of nucleic acid sequence or protein either within the cell or secreted from the cell. Cell culture conditions are particular to cell type and expression vector. Culture conditions for particular vectors and cell types are within the level of skill in the art to design and implement without undue experimentation. Techniques for the expression and purification of recombinant proteins are known in the art (see Sambrook Eds., Molecular Cloning: A Laboratory Manual 3 ed. (Cold Spring Harbor, N.Y. 2001).
[0060] Some embodiments of the present invention are compositions containing nucleic acid that can be expressed as encoded polypeptides or proteins. The engineering of DNA segment(s) for expression in a prokaryotic or eukaryotic system may be performed by techniques generally known to those of skill in recombinant expression. It is believed that virtually any expression system may be employed in the expression of the claimed nucleic and amino sequences.
[0061] As used herein, the terms "engineered" and "recombinant" cells are synonymous with "host" cells and are intended to refer to a cell into which an exogenous DNA or RNA segment or gene, such as a cDNA or gene has been introduced. Therefore, engineered cells are
distinguishable from naturally occurring cells which do not contain a recombinantly introduced exogenous DNA segment or gene. A host cell is optionally a naturally occurring cell that is transformed with an exogenous DNA segment or gene or a cell that is not modified.
[0062] To express a recombinant encoded polypeptide in accordance with the present invention one optionally prepares an expression vector that includes a nucleic acid under the control of one or more promoters. To bring a coding sequence "under the control of a promoter, one positions the 5' end of the translational initiation site of the reading frame generally between about 1 and 50 nucleotides "downstream" of (i.e., 3' of) the chosen promoter. The "upstream" promoter stimulates transcription of the inserted DNA and promotes expression of the encoded recombinant protein. This is the meaning of "recombinant expression" in the context used here.
[0063] Many standard techniques are available to construct expression vectors containing the appropriate nucleic acids and transcriptional/translational control sequences in order to achieve protein or peptide expression in a variety of host-expression systems. Cell types available for expression include, but are not limited to, bacteria, such as E. coli and B. subtilis transformed with recombinant phage DNA, plasmid DNA or cosmid DNA expression vectors.
[0064] Certain examples of prokaryotic hosts are E. coli strain RR1, E. coli LE392, E. coli B, E. coli .chi. 1776 (ATCC No. 31537) as well as E. coli W3110 (F-, lambda-, prototrophic, ATCC No. 273325); bacilli such as Bacillus subtilis; and other enterobacteriaceae such as Salmonella typhimurium, Serratia marcescens, and various Pseudomonas species.
[0065] In general, plasmid vectors containing replicon and control sequences that are derived from species compatible with the host cell are used in connection with these hosts. The vector optionally carries a replication site, as well as marking sequences that are capable of providing phenotypic selection in transformed cells. For example, E. coli is often transformed using pBR322, a plasmid derived from an E. coli species. Plasmid pBR322 contains genes for ampicillin and tetracycline resistance and thus provides easy means for identifying transformed cells. The pBR322 plasmid, or other microbial plasmid or phage may also contain, or be modified to contain, promoters that can be used by the microbial organism for expression of its own proteins.
[0066] In addition, phage vectors containing replicon and control sequences that are compatible with the host cell can be used as transforming vectors in connection with these hosts. For example, the phage lambda may be utilized in making a recombinant phage vector that can be used to transform host cells, such as E. coli LE392.
[0067] Further useful vectors include pIN vectors and pGEX vectors, for use in generating glutathione S-transferase (GST) soluble fusion proteins for later purification and separation or cleavage. Other suitable fusion proteins are those with β-galactosidase, ubiquitin, or the like.
[0068] Promoters that are most commonly used in recombinant DNA construction include the β-lactamase (penicillinase), lactose and tryptophan (trp) promoter systems. While these are the most commonly used, other microbial promoters have been discovered and utilized, and details concerning their nucleotide sequences have been published, enabling those of skill in the art to ligate them functionally with plasmid vectors.
[0069] For expression in Saccharomyces, the plasmid YRp7, for example, is commonly used. This plasmid contains the trpl gene, which provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example ATCC No. 44076 or PEP4-1. The presence of the trpl lesion as a characteristic of the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan.
[0070] Suitable promoting sequences in yeast vectors include the promoters for 3- phosphoglycerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3- phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6- phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase. In constructing suitable expression plasmids, the termination sequences associated with these genes are also ligated into the expression vector 3' of the sequence desired to be expressed to provide polyadenylation of the mRNA and termination.
[0071] Other suitable promoters that have the additional advantage of transcription controlled by growth conditions include the promoter region for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, and the aforementioned glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization.
[0072] In addition to microorganisms, cultures of cells derived from multicellular organisms may also be used as hosts. In principle, any such cell culture is operable, whether from vertebrate or invertebrate culture. In addition to mammalian cells, these include insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus); and plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing one or more coding sequences.
[0073] In a useful insect system, Autographica californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes. The virus grows in Spodoptera frugiperda cells. The isolated nucleic acid coding sequences are cloned into non-essential regions (for example the polyhedron gene) of the virus and placed under control of an AcNPV promoter (for example, the polyhedron promoter). Successful insertion of the coding sequences results in the inactivation of the polyhedron gene and production of non-occluded recombinant virus (i.e., virus lacking the proteinaceous coat coded for by the polyhedron gene). These recombinant viruses are then used to infect Spodoptera frugiperda cells in which the inserted gene is expressed (e.g., U.S. Patent No. 4,215,051).
[0074] Examples of useful mammalian host cell lines are VERO and HeLa cells, Chinese hamster ovary (CHO) cell lines, W138, BHK, COS-7, 293, HepG2, NIH3T3, RIN and MDCK cell lines. In addition, a host cell may be chosen that modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the encoded protein.
[0075] Different host cells have characteristic and specific mechanisms for the post- translational processing and modification of proteins. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed. Expression vectors for use in mammalian cells optionally include an origin of replication (as necessary), a promoter located in front of the gene to be expressed, along with any necessary ribosome binding sites, RNA splice sites, polyadenylation site, and transcriptional terminator sequences. The origin of replication may be provided either by construction of the vector to include an exogenous origin, such as may be derived from SV40 or other viral (e.g., Polyoma, Adeno, VSV, BPV) source, or may be provided by the host cell chromosomal replication mechanism. If the vector is integrated into the host cell chromosome, the latter is often sufficient.
[0076] The promoters may be derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the vaccinia virus 7.5K promoter). Further, it is also possible, and may be desirable, to utilize promoter or control sequences normally associated with the desired gene sequence, provided such control sequences are compatible with the host cell systems.
[0077] A number of viral based expression systems may be utilized, for example, commonly used promoters are derived from polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40
(SV40). The early and late promoters of SV40 virus are useful because both are obtained easily from the virus as a fragment that also contains the SV40 viral origin of replication. Smaller or larger SV40 fragments may also be used, provided there is included the approximately 250 bp sequence extending from the HmdIII site toward the Bgll site located in the viral origin of replication.
[0078] In cases where an adenovirus is used as an expression vector, the coding sequences may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence. This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region El or E3) will result in a recombinant virus that is viable and capable of expressing proteins in infected hosts.
[0079] Specific initiation signals may also be required for efficient translation of the claimed isolated nucleic acid coding sequences. These signals include the ATG initiation codon and adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may additionally need to be provided. One of ordinary skill in the art would readily be capable of determining this need and providing the necessary signals. It is well known that the initiation codon must be in-frame (or in-phase) with the reading frame of the desired coding sequence to ensure translation of the entire insert. These exogenous translational control signals and initiation codons can be of a variety of origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements or transcription terminators.
[0080] In eukaryotic expression, one will also typically desire to incorporate into the transcriptional unit an appropriate polyadenylation site if one was not contained within the original cloned segment. Typically, the poly A addition site is placed about 30 to 2000 nucleotides downstream of the termination site of the protein at a position prior to transcription termination.
[0081] For long-term, high-yield production of recombinant proteins, stable expression is optionally achieved. For example, cell lines that stably express constructs encoding proteins may be engineered. Rather than using expression vectors that contain viral origins of replication, host cells can be transformed with vectors controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker. Following the introduction of foreign DNA, engineered cells may be allowed to grow for 1-2 days in an enriched medium, and then are switched to a selective medium. The
selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci, which in turn can be cloned and expanded into cell lines.
[0082] A number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes, in tk", hgprt" or aprt" cells, respectively. Also, antimetabolite resistance can be used as the basis of selection for: dhfr, which confers resistance to methotrexate; gpt, which confers resistance to mycophenolic acid; neo, which confers resistance to the aminoglycoside G-418; and hygro, which confers resistance to hygromycin. It is appreciated that numerous other selection systems are known in the art that are similarly operable in the present invention.
[0083] It is contemplated that the isolated nucleic acids of the disclosure may be "overexpressed", i.e., expressed in increased levels relative to its natural expression in cells of its indigenous host, or even relative to the expression of other nucleic acids or proteins in a recombinant host cell. Overexpression may be assessed by a variety of methods, including radio-labeling and/or protein purification. However, simple and direct methods are may be used, for example, those involving SDS/PAGE and protein staining or immunoblotting, followed by quantitative analyses, such as densitometric scanning of the resultant gel or blot. A specific increase in the level of the recombinant nucleic acid or protein in comparison to the level in natural host cells is indicative of overexpression, as is a relative abundance of the specific protein in relation to the other proteins produced by the host cell and, e.g., visible on a gel.
[0084] Other methods, primers, isolation techniques, sequencing techniques, and characterization techniques are known to those of skill in the art and are similarly operable herein. Illustratively, one can reconstitute SHIBV viruses de novo from isolated genes such as by assembly of virus particles with captured genes illustratively by the techniques of or modifications of Gonzalez, SA, and Affranchino, JL, J. Gen. Virol., 1995; 76:2357-2360, the contents of which are incorporated herein by reference.
[0085] Further aspects of the present disclosure concern the purification, and in particular embodiments, the substantial purification, of an encoded protein or peptide. The term "purified" or "isolated" protein or peptide as used herein, is intended to refer to a composition, isolatable from other components, wherein the nucleic acid, protein or peptide is purified to any degree relative to its naturally-obtainable state, i.e., relative to its purity within a cell, relative to is purity within a virion, or relative to its purity within an infective organism. An isolated nucleic acid,
protein, or peptide also refers to a nucleic acid, protein or peptide, free from the environment in which it may naturally occur.
[0086] Generally, "purified" or "isolated" will refer to a nucleic acid, protein or peptide composition that has been subjected to fractionation to remove various other components, and which composition substantially retains its expressed biological activity, if any. Where the term "substantially" purified is used, this designation will refer to a composition in which the nucleic acid, protein or peptide forms the major component of the composition, such as constituting about 50% or more of the nucleic acids or proteins in the composition.
[0087] Various methods for quantifying the degree of purification of the nucleic acid, protein or peptide will be known to those of skill in the art. These include, for example, determining the specific activity of an active fraction, or assessing the number of polypeptides within a fraction by SDS/PAGE analysis. An optional method for assessing the purity of a fraction is to calculate the specific activity of the fraction, to compare it to the specific activity of the initial extract, and to thus calculate the degree of purity, herein assessed by a "-fold purification number." The actual units used to represent the amount of activity will, of course, be dependent upon the particular assay technique chosen to follow the purification and whether or not the expressed nucleic acid, protein or peptide exhibits a detectable activity.
[0088] Various techniques suitable for use in protein purification will be well known to those of skill in the art. These include, for example: precipitation with ammonium sulphate, polyethylene glycol, antibodies and the like or by heat denaturation, followed by centrifugation; chromatography steps such as ion exchange, gel filtration, reverse phase, hydroxylapatite and affinity chromatography; isoelectric focusing; gel electrophoresis; and combinations of such and other techniques. As is generally known in the art, it is believed that the order of conducting the various purification steps may be changed, or that certain steps may be omitted, and still result in a suitable method for the preparation of a substantially purified protein or peptide.
[0089] There is no general requirement that the nucleic acid, protein or peptide always be provided in its most purified state. Indeed, it is contemplated that less substantially purified products will have utility in certain embodiments. Partial purification may be accomplished by using fewer purification steps in combination, or by utilizing different forms of the same general purification scheme. For example, it is appreciated that a cation-exchange column chromatography performed utilizing an HPLC apparatus will generally result in a greater -fold purification than the same technique utilizing a low pressure chromatography system. Methods exhibiting a lower degree of relative purification may have advantages in total recovery of
product, or in maintaining the activity of an expressed protein. A protein or nucleic acid is optionally substantially purified to a purity of 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, or any value or range therebetween.
[0090] It is known that the migration of a polypeptide can vary, sometimes significantly, with different conditions of SDS/PAGE (Capaldi et al., Biochem. Biophys. Res. Comm., 76:425, 1977). It will therefore be appreciated that under differing electrophoresis conditions, the apparent molecular weights of purified or partially purified expression products may vary.
[0091] The inventive method also illustratively includes isolation of glycoprotein from a host cell or host cell medium. Methods of protein isolation illustratively include column chromatography, affinity chromatography, gel electrophoresis, filtration, or other methods known in the art. In some embodiments, glycoprotein is expressed with a tag operable for affinity purification. A tag is optionally a 6x His tag. A 6x His tagged inventive protein is illustratively purified by Ni-NTA column chromatography or using an anti-6x His tag antibody fused to a solid support. (Geneway Biotech, San Diego, CA) Other tags and purification systems are similarly operable.
[0092] It is appreciated that an inventive protein is optionally not tagged. In this embodiment and other embodiments purification is optionally achieved by methods known in the art illustratively including ion-exchange chromatography, affinity chromatography using anti- glycoprotein antibodies, precipitation with salt such as ammonium sulfate, streptomycin sulfate, or protamine sulfate, reverse phase chromatography, size exclusion chromatography such as gel exclusion chromatography, HPLC, immobilized metal chelate chromatography, or other methods known in the art. One of skill in the art may select the most appropriate isolation and purification techniques without departing from the scope of this invention.
[0093] Inventive nucleic acids, proteins or fragments thereof are optionally chemically synthesized. Methods of protein chemical synthesis have produced proteins greater than 600 amino acids in length with or without the inclusion of modifications such as glycosylation and phosphorylation. Methods of chemical protein and peptide synthesis illustratively include solid phase protein chemical synthesis. Illustrative methods of chemical protein synthesis are reviewed by Miranda, LP, Peptide Science, 2000, 55:217-26 and Kochendoerfer GG, Curr Opin Drug Discov Devel. 2001; 4(2):205-14, the contents of which are incorporated herein by reference.
[0094] Proteins of this invention are optionally be characterized by immunological measurements including, without limitation, western blot, macromolecular mass determinations
by biophysical determinations, SDS-PAGE/staining, HPLC and the like, antibody recognition assays, cell viability assays, apoptosis assays, and assays to infer immune protection or immune pathology by adoptive transfer of cells, proteins or antibodies.
[0095] Vaccines and methods for their use to induce active immunity and protection against lyssavirus induced illness in a subject are provided according to the present invention.
[0096] The term "vaccine composition" is used herein to refers to a composition including a biological agent (e.g. protein or nucleic acid) capable of inducing an immune response in a subject inoculated with the vaccine composition. In particular embodiments, the biological agent is a live attenuated and/or inactive SHIBV. In further embodiments, the biological agent is an antigenic portion of a SHIBV.
[0097] A SHIBV included in a vaccine composition according to the present invention is a live attenuated SHIBV or an inactivated SHIBV. The choice of live attenuated SHIBV or inactivated SHIBV depends on factors such as route of vaccine composition administration. The isolated SHIBV is optionally treated to inactivate or attenuate the lyssavirus. Thus, in particular embodiments a vaccine for lyssavirus includes a live attenuated SHBIV or an inactivated human SHBIV.
[0098] The term "live attenuated SHIBV" refers to a SHIBV having the ability to infect an appropriate host or host cell and replicate and the term is used to distinguish an "inactivated" SHIBV. The term "live attenuated SHIBV" refers to a SHIBV characterized by substantially diminished virulence compared to wild type SHIBV. The term "virulence" is used to describe the degree of pathogenicity of a SHIBV to a host cell or a host organism. Virulence is determined using any of various assays recognized in the art. For example, virulence may be assessed by exposing cultured host cells to an attenuated SHIBV and determining the number of cells which display a pathogenic response and/or the severity of pathogenic response elicited. Diminished virulence is present where an attenuated SHIBV has decreased capability to cause one or more pathogenic effects in a host cell and/or host organism.
[0099] The term "inactivated" SHIBV is used herein to refer to SHIBV that has been killed and which is therefore capable of neither replication nor infection of a host cell or host organism.
[00100] Inactivation is achieved by any of various techniques illustratively including inactivation using one or more chemical agents, thermal inactivation and/or UV light inactivation.
[00101] Chemical agents used to inactivate a SHIBV are known in the art and include such agents as ethyleneimines such as binary ethyleneimine; cross-linking aldehydes such as
formaldehyde and glutaraldehyde; proteases illustratively including pronase, trypsin and/or chymotrypsin; and detergents such as octylphenol ethoxylates and alkyl trimethylammonium salts. SHIBV may be inactivated by treatment with a base, for example by incubation of the lyssavirus at a pH above pH 10.0.
[00102] Thermal inactivation may be achieved by heating at temperatures above 50° centigrade, for example.
[00103] Inactivation is assessed by techniques standard in the art, illustratively including sampling virus at various times during an inactivation procedure and observing cytopathic effects or infectivity of a sample on suitable cells, such as mouse neuroblastoma (MNA) cells.
[00104] It is appreciated that, in addition to live attenuated and inactivated SHIBV, an antigenic portion of a SHIBV is optionally included in a vaccine composition of the present invention. Thus, for example, a SHIBV-derived protein or peptide capable of inducing an immunological response in a subject is considered within the scope of the present invention.
[00105] Vaccine compositions are provided according to embodiments of the present invention which include one or more SHIBV polypeptides and/or an immunogenic fragment of one or more SHIBV polypeptides. In particular embodiments of an inventive vaccine composition, a SHIBV polypeptide, a derivative thereof, and/or an immunogenic fragment thereof is included.
[00106] Accordingly, the present invention provides a virus including an nucleoprotein having SEQ ID NO: 2 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 2.
[00107] The present invention provides a virus including an phosphoprotein having SEQ ID NO: 3 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 3.
[00108] The present invention provides a virus including an matrix protein having SEQ ID NO: 4 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than
87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 4.
[00109] The present invention provides a virus including an glycoprotein having SEQ ID NO: 5 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 5.
[00110] The present invention provides a virus including an polymerase protein having SEQ ID NO: 6 or having an amino acid sequence that is greater than 80%, is greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, greater than 90%, greater than 91%, greater than 92%, greater than 93%, greater than 94%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% identical to SEQ ID NO: 6.
[00111] In particular embodiments of the invention, a SHIBV for inclusion in a vaccine composition of the present invention is prepared by standard methods typically used for preparation of live or inactivated SHIBV. For example, generally a compatible cell type is inoculated with a SHIBV and the cells are maintained under conditions which allow for viral replication and production of infectious particles.
[00112] Inventive viral proteins of the present invention are optionally modified to increase their immunogenicity. In a non-limiting example, the antigen may be coupled to chemical compounds or immunogenic carriers, provided that the coupling does not interfere with the desired biological activity of either the antigen or the carrier. For a review of some general considerations in coupling strategies, see Antibodies , A Laboratory Manual, Cold Spring Harbor Laboratory, ed. E. Harlow and D. Lane (1988). Useful immunogenic carriers known in the art include, without limitation: keyhole limpet hemocyanin (KLH); bovine serum albumin (BSA); ovalbumin; PPD (purified protein derivative of tuberculin); red blood cells; tetanus toxoid; cholera toxoid; agarose beads; activated carbon; or bentonite. Useful chemical compounds for coupling include, without limitation, dinitrophenol groups and arsonilic acid.
[00113] SHIBV particles are harvested, typically from cell culture supernatant for inclusion in a vaccine composition. The SHIBV particles may be isolated from the cell culture
supernatant, for example by filtration and/or centrifugation. The isolated SHIBV particles are optionally lyophilized, such as for later resuspension in a pharmaceutically acceptable carrier.
[00114] The term "pharmaceutically acceptable carrier" refers to a carrier which is substantially non-toxic to a subject and substantially inert to the lyssavirus included in a vaccine composition. A pharmaceutically acceptable carrier is a solid, liquid or gel in form and is typically sterile and pyrogen free.
[00115] A vaccine composition of the present invention may be in any form suitable for administration to a subject.
[00116] A vaccine composition is administered by any suitable route of administration including oral and parenteral such as intravenous, intradermal, intramuscular, mucosal, nasal, or subcutaneous routes of administration.
[00117] For example, a vaccine composition for parenteral administration may be formulated as an injectable liquid including a SHIBV, SHBIV protein or nucleic acid, or fragment thereof, and a pharmaceutically acceptable carrier. Examples of suitable aqueous and nonaqueous carriers include water, ethanol, polyols such as propylene glycol, polyethylene glycol, glycerol, and the like, suitable mixtures thereof; vegetable oils such as olive oil; and injectable organic esters such as ethyloleate. Proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of a desirable particle size in the case of dispersions, and/or by the use of a surfactant, such as sodium lauryl sulfate. A stabilizer is optionally included such as, for example, sucrose, EDTA, EGTA, and an antioxidant.
[00118] A solid dosage form for administration or for suspension in a liquid prior to administration illustratively includes capsules, tablets, powders, and granules. In such solid dosage forms, a SHIBV, SHBIV protein or nucleic acid, or fragment thereof, is admixed with at least one carrier illustratively including a buffer such as, for example, sodium citrate or an alkali metal phosphate illustratively including sodium phosphates, potassium phosphates and calcium phosphates; a filler such as, for example, starch, lactose, sucrose, glucose, mannitol, and silicic acid; a binder such as, for example, carboxymethylcellulose, alignates, gelatin, polyvinylpyrrolidone, sucrose, and acacia; a humectant such as, for example, glycerol; a disintegrating agent such as, for example, agar-agar, calcium carbonate, plant starches such as potato or tapioca starch, alginic acid, certain complex silicates, and sodium carbonate; a solution retarder such as, for example, paraffin; an absorption accelerator such as, for example, a quaternary ammonium compound; a wetting agent such as, for example, cetyl alcohol, glycerol monostearate, and a glycol; an adsorbent such as, for example, kaolin and bentonite; a lubricant
such as, for example, talc, calcium stearate, magnesium stearate, a solid polyethylene glycol or sodium lauryl sulfate; a preservative such as an antibacterial agent and an antifungal agent, including for example, sorbic acid, gentamycin and phenol; and a stabilizer such as, for example, sucrose, EDTA, EGTA, and an antioxidant.
[00119] Solid dosage forms optionally include a coating such as an enteric coating. The enteric coating is typically a polymeric material. Enteric coating materials optionally have the characteristics of being bioerodible, gradually hydrolyzable and/or gradually water-soluble polymers. The amount of coating material applied to a solid dosage generally dictates the time interval between ingestion and drug release. A coating is applied having a thickness such that the entire coating does not dissolve in the gastrointestinal fluids at pH below 3 associated with stomach acids, yet dissolves above pH 3 in the small intestine environment. It is expected that any anionic polymer exhibiting a pH-dependent solubility profile is readily used as an enteric coating in the practice of the present invention to achieve delivery of the active agent to the lower gastrointestinal tract. The selection of the specific enteric coating material depends on properties such as resistance to disintegration in the stomach; impermeability to gastric fluids and active agent diffusion while in the stomach; ability to dissipate at the target intestine site; physical and chemical stability during storage; non-toxicity; and ease of application.
[00120] Suitable enteric coating materials illustratively include cellulosic polymers such as hydroxypropyl cellulose, hydroxyethyl cellulose, hydroxypropyl methyl cellulose, methyl cellulose, ethyl cellulose, cellulose acetate, cellulose acetate phthalate, cellulose acetate trimellitate, hydroxypropylmethyl cellulose phthalate, hydroxypropylmethyl cellulose succinate and carboxymethylcellulose sodium; acrylic acid polymers and copolymers, preferably formed from acrylic acid, methacrylic acid, methyl acrylate, ammonium methylacrylate, ethyl acrylate, methyl methacrylate and/or ethyl; vinyl polymers and copolymers such as polyvinyl pyrrolidone, polyvinyl acetate, polyvinylacetate phthalate, vinylacetate crotonic acid copolymer, and ethylene- vinyl acetate copolymers; shellac; and combinations thereof. A particular enteric coating material includes acrylic acid polymers and copolymers described for example U.S. Patent No. 6,136,345.
[00121] The enteric coating optionally contains a plasticizer to prevent the formation of pores and cracks that allow the penetration of the gastric fluids into the solid dosage form. Suitable plasticizers illustratively include, triethyl citrate (Citroflex 2), triacetin (glyceryl triacetate), acetyl triethyl citrate (Citroflec A2), Carbowax 400 (polyethylene glycol 400), diethyl phthalate, tributyl citrate, acetylated monoglycerides, glycerol, fatty acid esters, propylene glycol, and
dibutyl phthalate. In particular, a coating composed of an anionic carboxylic acrylic polymer typically contains approximately 10% to 25% by weight of a plasticizer, particularly dibutyl phthalate, polyethylene glycol, triethyl citrate and triacetin. The coating can also contain other coating excipients such as detackifiers, antifoaming agents, lubricants (e.g., magnesium stearate), and stabilizers (e.g. hydroxypropylcellulose, acids or bases) to solubilize or disperse the coating material, and to improve coating performance and the coated product.
[00122] Liquid dosage forms for oral administration include lyssavirus and a pharmaceutically acceptable carrier formulated as an emulsion, solution, suspension, syrup, or elixir. A liquid dosage form of a vaccine composition of the present invention may include a wetting agent, an emulsifying agent, a suspending agent, a sweetener, a flavoring, or a perfuming agent.
[00123] Detailed information concerning customary ingredients, equipment and processes for preparing dosage forms is found in Pharmaceutical Dosage Forms: Tablets, eds. H. A. Lieberman et al., New York: Marcel Dekker, Inc., 1989; and in L.V. Allen, Jr. et al., Ansel's Pharmaceutical Dosage Forms and Drug Delivery Systems, 8th Ed., Philadelphia, PA: Lippincott, Williams & Wilkins, 2004, throughout and in chapter 16; A. R. Gennaro, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins, 21st ed., 2005, particularly chapter 89; and J. G. Hardman et al., Goodman & Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill Professional, 10th ed., 2001.
[00124] An adjuvant is optionally included in a virus composition according to embodiments of the present invention. Adjuvants are known in the art and illustratively include Freund's adjuvant, aluminum hydroxide, aluminum phosphate, aluminum oxide, saponin, dextrans such as DEAE-dextran, vegetable oils such as peanut oil, olive oil, and/or vitamin E acetate, mineral oil, bacterial lipopolysaccharides, peptidoglycans, and proteoglycans.
[00125] The term "subject" is used herein to refer to a human, non-human animals, illustratively including other primates, cows, horses, sheep, goats, pigs, dogs, cats, birds, poultry, and rodents such as mice or rats.
[00126] Viral proteins of the present invention may also be used in the form of pharmaceutically acceptable salts. Suitable acids and bases which are capable of forming salts with the proteins of the present invention are well known to those of skill in the art, and include inorganic and organic acids and bases.
[00127] The proteins and nucleic acid sequences or anti-sense sequences of the invention, alone or in combination with other antigens, antibodies, nucleic acid sequences or anti-sense
sequences may further be used in diagnostic methods, therapeutic compositions and in methods for treating humans and/or animals with disease or at risk of disease or infection. For example, one such therapeutic composition may be formulated to contain a carrier or diluent and one or more Shimoni bat virus proteins or protein fragments of the invention. For diagnostic purposes, as an example the original or synthesized G gene is optionally inserted into foreign vectors (for example, a pseudotype lentiviral vector), and further used for specific virus-neutralization diagnostic assays. Suitable pharmaceutically acceptable carriers facilitate administration of the proteins but are physiologically inert and/or nonharmful.
[00128] Optionally, the inventive composition may also contain conventional pharmaceutical ingredients, such as preservatives, or chemical stabilizers. Suitable ingredients operable herein include, for example, casamino acids, sucrose, gelatin, phenol red, N-Z amine, monopotassium diphosphate, lactose, lactalbumin hydrolysate, and dried milk.
[00129] In particular embodiments, a vaccine composition including a SHIBV, and/or SHIBV polypeptides and/or an immunogenic fragment of one or more SHIBV polypeptides, stimulates generation of neutralizing antibodies to a SHIBV or other immunological response in a subject. Methods of inducing an immunological response against a SHIBV-mediated disease in a subject are provided according to embodiments of the present invention which include administering a therapeutic amount of a vaccine composition including at least one SHIBV, SHIBV protein, or fragment thereof.
[00130] The phrase "therapeutically effective amount" is used herein to refer to an amount effective to induce an immunological response sufficient to prevent or ameliorate signs or symptoms of a lyssavirus-mediated disease. Induction of an immunological response in a subject can be determined by any of various techniques known in the art, illustratively including detection of anti-lyssavirus antibodies, measurement of anti-lyssavirus antibody titer and/or lymphocyte proliferation assay. Illustrative methods for detection of anti-lyssavirus antibodies are illustrated by Hanlon, CA., et al., Virus Res., 2005; l l l(l):44-54, the contents of which are incorporated herein by reference. Signs and symptoms of lyssavirus-mediated disease may be monitored to detect induction of an immunological response to administration of a vaccine composition of the present invention in a subject. An immunological response is illustratively a reduction of clinical signs and symptoms of lyssavirus-mediated disease. An immunological response is illustratively, development of anti- lyssavirus antibodies, activation of T-cells, B- cells, or other immune cells following administration of an inventive composition, or other immune responses known in the art.
[00131] In some embodiments, a method of inducing an immunological response against a lyssavirus-mediated disease in a subject includes administering 10 4 to 108 ffu of live attenuated vaccine or 1 to 25 micrograms of inactivated virus in a typical vaccine composition.
[00132] In some embodiments, a method of inducing an immunological response against a lyssavirus-mediated disease in a subject includes administering a therapeutically effective amount of a vaccine composition including a SHIBV, polypeptide fragments thereof, derivatives thereof, or combinations thereof.
[00133] Administration of a vaccine composition according to a method of the present invention includes administration of one or more doses of a vaccine composition to a subject at one time in particular embodiments. Alternatively, two or more doses of a vaccine composition are administered at time intervals of days, weeks, or years. A suitable schedule for administration of vaccine composition doses depends on several factors including age and health status of the subject, type of vaccine composition used and route of administration, for example. One of skill in the art is able to readily determine a dose and schedule of administration to be administered to a particular subject.
[00134] Also provided is a method for detecting the presence of a lyssavirus virus or a nucleic acid molecule derived from a lyssavirus in a biological sample including contacting a sample with an agent that selectively binds to the a nucleic acid molecule with a sequence that represents at least a portion of SEQ ID NO: 1; or a protein sequence encoded by at least a portion of SEQ ID NO: 1, and detecting whether the agent binds to the virus or the nucleic acid molecule derived therefrom in the sample. In some embodiments the agent has a nucleic acid sequence that hybridizes under stringent conditions with at least a portion of SEQ ID NO: 1, but optionally, has 100% sequence identity or less than 100% sequence identity. In some embodiments, the agent is a nucleic acid molecule with a nucleotide sequence having between 4 and 6600 contiguous nucleotides of the nucleotide sequence of SEQ ID NO: 1, or a complement thereof.
[00135] An agent optionally selectively binds a protein with a sequence of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or combinations thereof.
[00136] The term "selectively binds" describes binding to a target nucleic acid sequence or amino acid sequence with less than 1% cross reactivity toward another nucleic acid sequence or amino acid sequence present in a sample.
[00137] As used herein, the term "hybridizes under stringent conditions" describes conditions for hybridization and washing under which nucleotide sequences having at least 30%, 35%,
40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity to each other typically remain hybridized to each other. Such hybridization conditions are described in, for example but not limited to, Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1 6.3.6.; Basic Methods in Molecular Biology, Elsevier Science Publishing Co., Inc., N.Y. (1986), pp.75 78, and 84 87; and Molecular Cloning, Cold Spring Harbor Laboratory, N.Y. (1982), pp.387 389, and are well known to those skilled in the art. A non-limiting example of stringent hybridization conditions is hybridization in 6x sodium chloride/sodium citrate (SSC), 0.5% SDS at about 68°C followed by one or more washes in 2xSSC, 0.5% SDS at room temperature. Another non-limiting example of stringent hybridization conditions is hybridization in 6x SSC at about 45°C followed by one or more washes in 0.2x SSC, 0.1% SDS at 50to 65 °C.
[00138] An agent is illustratively any molecule that will selectively bind at least a portion of a nucleic acid sequence with the sequence of SEQ ID NO: 1 or a protein encoded by at least a portion of SEQ ID NO: 1, or derivatives thereof. Illustrative examples of an agent include an antibody, other proteinaceous molecules, an aptamer, a nucleotide sequence, other molecules such as low molecular weight compositions with a molecular weight below 2000 Daltons, or other nucleic acid or protein binding compositions known in the art.
[00139] An agent is illustratively an antibody. Such antibodies can be polyclonal or monoclonal. An intact antibody, a fragment thereof (e.g., Fab or F(ab')2), or an engineered variant thereof (e.g., sFv) can also be used. Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass thereof. Methods of producing antibodies directed to specific sequences of protein or nucleic acid are known in the art. Optional methods of producing and screening for antibodies that will act as an agent are described by Birch, JR, and Racher, AJ, Advanced Drug Delivery Reviews, 2006; 58:671- 685.
[00140] A biological sample is any sample derived from a biological source including an animal, plant, tissue, or cell. A biological sample is illustratively tissue derived from brain such as the brain stem or cerebellum, other neuronal tissue, kidney, heart, or other tissue. In some embodiments, a biological sample is blood, plasma, serum, urine, feces, saliva, nasal secretions, lung aspirate, cerebrospinal fluid, or skin.
[00141] A process of the invention illustratively includes detecting whether the agent binds to the virus or the nucleic acid molecule derived therefrom in the sample. Detection is by any method known in the art suitable for detecting the binding of an agent to a nucleic acid molecule or a protein. Illustrative examples include PCR related techniques such as PCR, RT-PCR, realtime PCR (qRT-PCR), hybridization of labeled agents where an agent is illustratively labeled
with a radioactive or fluorescent molecule, mass spectrometry, electrophoresis or other technique known in the art. Illustrative examples of detecting the binding of an agent to a protein sequence include gel electrophoresis (e.g. SDS-PAGE and others), enzyme linked immunosorbent assay (ELISA), mass spectrometry, gradient sedimentation, fluorescence, NMR, liquid chromatography, and other methods known in the art. Illustrative examples of methods suitable for detection are described in references listed herein.
[00142] Various aspects of the present invention are illustrated by the following non-limiting examples. The examples are for illustrative purposes and are not a limitation on any practice of the present invention. It will be understood that variations and modifications can be made without departing from the spirit and scope of the invention.
Example I:
[00143] Sequencing the SHIBV genome. Total RNA was extracted from bat brain homogenates using TRIZol (Invitrogen Corp. Carlsbad, CA) and subjected to RT-PCR with subsequent direct sequencing on the AB 13730 automated sequencer (Applied Biosystems, Foster City, CA). Genome termini are circularized by RNA ligation, amplified by RT-PCR, cloned and sequenced as described previously (Kuzmin et al., J. Clin. Microbiol, 2008; 46(4):1451-1461). Each DNA strand of a given PCR product is sequenced at least twice. The sequence assembly, alignment and consensus sequence generation, as well as DNA translation into deduced amino acids are performed in BioEdit software (Hall, TA., Nucl. Acids. Symp. Ser., 1999; 41:95-98).
[00144] The length of the complete SHIBV genome is 12045 nucleotides (GenBank Accession No. GU170201). The genome consists of 5 structural genes, common for all lyssaviruses, and non-coding regions that are most similar to those described in the phylogroup II lyssaviruses. Characteristics and alignments of particular genes of SHIBV are illustrated in Kuzmin, I, et al., Virus Res., 2010;149(2):197-210.
Example 2:
[00145] Alignment with known lyssavirus sequences. A set of representative lyssaviruses is shown in Table 1. For the phylogroup II lyssaviruses, all available sequences are included, whereas for the phylogroup I lyssaviruses, a selection is made to cover the intrinsic diversity of each species. Multiple alignments for each viral gene, and for the alignment of concatenated coding regions of the N, P, M, G and L genes (both nucleotide and deduced amino acid sequences), are produced using the ClustalX program (Jeanmougin et al., 1998). The identity
values are calculated in BioEdit. Neighbor joining (NJ) phylogenetic analysis is performed in MEGA program (Kumar et al., 2001), using p-distances, Kimura-2 parameters and Maximum composite likelihood models, for 1000 bootstrap replicates. Bayesian analysis (BI) is performed using BEAST software (Drummond and Rambaut, 2007), with the general time-reversible model incorporating both invariant sites and a gamma distribution (GTR+I+G). Two simultaneous analyses, each with four Markov chains, are run for 1,000,000 generations and sampled every 1,000 generations. Trees generated prior to the stabilization of likelihood scores are discarded (burning = 250). The remaining trees are used to build a 50% majority rule consensus tree. Maximum likelihood (ML) analysis is performed using the PHYLIP package (Felsenstain, 1993) for 100 bootstrap replicates. Nucleotide substitution models used transition/transversion ratios varying from 2 to 4, with empirical base frequencies, and a gamma distribution of rate variations among sites. The gamma parameter for each alignment was determined using PAUP* (Swofford, 2003).
[00146] Table 1:
Virus species Species isolated Country GenBank accession
and code from No
RABV:
SAD B19 Laboratory strain M31046
PV Laboratory strain M13215
9147FRA Red fox France EU293115
AY956319 Human (ex a Germany AY956319
dog) India)
8764THA Human (ex a Thailand EU293111
dog)
9704ARG Bat Tadarida Argentina EU293116
brasiliensis
SHBRV-18 Human (ex bat USA AY705373
Lasionycteris
noctivagans)
LBV:
LBVAFR1999 France (ex EF547447
Bat Rousettus or Egypt) EF547418 aegyptiacus EF547445
EF547432
LBVSEN1985 Senegal EF547448
EF547419
Bat Eidolon
EF547446 helvum
EF547433
(0406SEN) EU293108 KE131 Bat Eidolon Kenya EU259198 helvum
KE576 Bat Rousettus Kenya GU170202 aegyptiacus
LBVNIG1956 Nigeria EF547459
EF547407
Bat Eidolon
EF547444 helvum
EF547431
(8619NGA) EU293110 LBVCAR1974 Central African EF547449
Bat
Republic EF547417
Micropteropus
EF547443 pussilus
EF547430
LBVZIM1986 Zimbabwe EF547450
EF547416
Cat
EF547442
EF547429
LagSA2004 South Africa EF547458
Bat
EF547415
Epomophorus
EF547440 wahlbergi
EF547428
LagSA2003 Bat South Africa EF547451
Epomophorus EF547413 wahlbergi EF547434
EF547421
Mongoose2004 South Africa EF547453
EF547409
Mongoose
EF547438 EF547423
LBVSA1980 South Africa EF547454
Bat
EF547411
Epomophorus
EF547441 wahlbergi
EF547424
LBVSA1982 South Africa EF547455
Bat
EF547410
Epomophorus
EF547439 wahlbergi
EF547425
MOKV:
Y09762 Cat Zimbabwe Y09762
86100CAM Shrew Cameroon EU293117
86101RCA Central African EU293118
A rodent
Republic
DUVV:
94286SA Bat Miniopterus South Africa EU293120 sp. (?)
86132SA Human (ex a bat) South Africa EU293119 EBLV-1:
8918FRA Bat Eptesicus France EU293112 serotinus
03002FRA Bat Eptesicus France EU293109 serotinus
RV9 Bat Eptesicus Germany EF157976 serotinus
EBLV2:
RV1333 Human (ex a bat) United Kingdom EF157977
9018HOL Bat Myotis The Netherlands EU293114
dasycneme
AF418014 Human (ex a bat) Australia AF418014
AF081020 Bat Saccolaimus Australia AF081020
albiventris
NC_003243 Bat Saccolaimus Australia NC_003243
albiventris
Λ RAY Bat Myotis blythi Kyrghyzstan EF614259
KHUV Bat Myotis Tajikistan EF614261
mystacinus
IRKV Bat Murina Russia EF614260
leucogaster
WCBV Bat Miniopterus Russia EF614258
schreibersi
[00147] The aligned sequences of N+P+M+G+L genes of available lyssaviruses (total length of the alignment 10922 nucleotides), as well as the deduced protein sequences (total length of the alignment 3639 amino acids) are assembled and used for comparison to a concatenated SHIBV from the deduced amino acid sequences obtained from the genome sequence of Example 1. Characteristics and alignments of particular genes of SHIBV as well as the concatenated sequences are illustrated in Kuzmin, I, et al., Virus Res., 2010;149(2):197-210.
Example 3:
[00148] Monoclonal antibody typing of SHIBV. The newly isolated virus and representatives of all described lineages of LBV and MOKV are inoculated intracranially into suckling or 3-week-old mice. When clinical signs of rabies are observed, the mice are euthanized, and brain impressions made on 4-well teflon-coated slides (Cel-Line, Erie Scientific, Portsmouth, NH). After overnight fixation in cold acetone, the samples are subjected to typing via the indirect fluorescent antibody test, using a panel of anti-nucleocapsid monoclonal antibodies (N-MAbs) of the Centers for Disease Control and Prevention (CDC, Atlanta, GA, USA), and N-MAb 422-5 of the Wistar Institute (Philadelphia, PA, USA), as described by Smith et al., Ad. Virus Res., 1989; 36:215-253.
[00149] The CDC N-MAb panel was developed primarily for discrimination of RABV antigenic variants (Smith, 1989), such that phylogroup I lyssaviruses represent greater variety of antigenic patterns than phylogroup II lyssaviruses (Table 2). Representatives of all four phylogenetically distant lineages of LBV demonstrate the same pattern (except isolate KE576, which was different by one N-MAb). MOKV is distinguished from LBV in reaction with one N- MAb only. Patterns of SHIBV are different from those of LBV by two N-MAbs (C2 and C4), and from those of MOKV by one N-MAb (C4). The positive reaction of SHIBV with the C2 MAb is similar to that of MOKV, WCBV, and many representatives of RABV (Smith, 1989). In addition, as with other African non-RABV lyssaviruses, SHIBV reacts with the Wistar N-MAb 422-5, in contrast to all other lyssaviruses.
[00150] Table 2:
[00151] Methods involving conventional biological techniques are described herein. Such techniques are generally known in the art and are described in detail in methodology treatises such as Molecular Cloning: A Laboratory Manual, 2nd ed., vol. 1-3, ed. Sambrook et al., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989; and Current Protocols in Molecular Biology, ed. Ausubel et al., Greene Publishing and Wiley-Interscience, New York,
1992 (with periodic updates). Immunological methods (e.g., preparation of antigen- specific antibodies, immunoprecipitation, and immunoblotting) are described, e.g., in Current Protocols in Immunology, ed. Coligan et al., John Wiley & Sons, New York, 1991; and Methods of Immunological Analysis, ed. Masseyeff et al., John Wiley & Sons, New York, 1992.
[00152] Various modifications of the present invention, in addition to those shown and described herein, will be apparent to those skilled in the art of the above description. Such modifications are also intended to fall within the scope of the appended claims.
[00153] Patents and publications mentioned in the specification are indicative of the levels of those skilled in the art to which the invention pertains. These patents and publications are incorporated herein by reference to the same extent as if each individual application or publication was specifically and individually incorporated herein by reference for the material for which it is cited as well as all other teaching contained therein.
[00154] The foregoing description is illustrative of particular embodiments of the invention, but is not meant to be a limitation upon the practice thereof. The following claims, including all equivalents thereof, are intended to define the scope of the invention.
REFERENCE LIST
Badrane, H., Bahloul, C, Perrin, P., Tordo, N., 2001. Evidence of two lyssavirus phylogroups with distinct pathogenecity and immunogenecity. J. Virol. 75, 3268-3276. Bahloul, C, Jacob, Y., Tordo, N., Perrin, P. 1998. DNA-based immunization for exploring the enlargement of immunological cross -reactivity against the lyssaviruses. Vaccine 16, 417-425.
Belikov, S.I., Leonova, G.N., Kondratov, I.G., Romanova, E.V., Pavlenko, E.V., 2009. Isolation and genetic characterisation of a new lyssavirus strain in the Primorskiy kray. East Siberian J. Infect. Pathol. 16(3), 68-69.
Benmansour, A., Leblois, H., Coulon, P., Tuffereau, C, Gaudin, Y., Flamand, A., Lafay, F., 1991. Antigenicity of rabies virus glycoprotein. J. Virol. 65(8), 4198-4203. Botvinkin, A.D., Poleschuk, E.M., Kuzmin, I.V., Borisova, T.I., Gazaryan, S.V., Yager, P. and Rupprecht, C.E., 2003. Novel lyssavirus isolated from bats Russia. Emerging Infect. Dis. 9, 1623-1625.
Bourhy, H., Kissi, B. and Tordo, N., 1993. Molecular diversity of the Lyssavirus genus. Virology 194, 70-81.
Biichen- Osmond, C, 2003. Taxonomy and Classification of Viruses. In: Murray, P.R., Baron, E.J., Jorgensen, J. H., Pfaller, M.A., Yolken, R. H. (Eds). Manual of Clinical Microbiology, 8th Edition. Vol 2. ASM Press, Washington, DC, pp. 1217-1226.
Dean, D.J., M. K. Abelseth, Atanasiu, P., 1996. The fluorescent antibody test. In: Meslin, F.- X., Kaplan, M.M., Koprowski, H. (Eds.). Laboratory techniques in rabies, 4th ed. WHO, Geneva, Switzerland, pp. 88-93.
Delmas, O., Holmes, E.C., Talbi, C, Larrous, F., Dacheux, L., Bouchier, C, Bourhy, H., 2008. Genomic diversity and evolution of the lyssaviruses. PloS One. 3(4), e2057.
Dietzschold, B, Wunner, W.H., Wiktor, T.J., Lopes, A.D., Lafon, M., Smith, C.L., Koprowski, H. 1983 Characterization of an antigenic determinant of the glycoprotein that correlates with pathogenicity of rabies virus. Proc. Natl. Acad .Sci. USA. 80, 70-74. Dietzschold, B., Rupprecht, C.R., Tollis, M., Lafon, M., Mattei, J., Wiktor, T.J. and
Koprowski, H., 1988. Antigenic diversity of the glycoprotein and nucleocapsid proteins of rabies and rabies-related viruses: implications for epidemiology and control of rabies. Rev. Infect. Dis. 10 (Suppl. 4), 785-798. Drummond, A.J., Rambaut, A, 2007 BEAST: Bayesian evolutionary analysis by sampling trees. BMC Evol. Biol. 7, 214.
Faber, M., Faber, M.L., Papaneri, A., Bette, M., Weihe, E., Dietzschold, B., Schnell, M,J., 2005. A single amino acid change in rabies virus glycoprotein increases virus spread and enhances virus pathogenicity. J. Virol. 79(22), 14141-14148.
Familusi, J.B., Moore, D.L., 1972. Isolation of a rabies related virus from the cerebrospinal fluid of a child with 'aseptic meningitis'. African J. Med. Sci. 3, 93-96. Familusi, J.B., Osunkoya, B.O., Moore, D.L., Kemp, G.E., Fabiyi, A., 1972. A fatal human infection with Mokola virus. Am. J. Trop. Med. Hyg. 21, 959-963.
Felsenstein, J. 1993. PHYLIP: Phylogenetic inference package (version 3.5c) Dept. of Genetics, University of Washington, Seattle, WA, USA.
Fooks, A.R., Brookes, S.M., Johnson, N., McElhinney, L.M., Hutson, A.M., 2003a. European bat lyssaviruses: an emerging zoonosis. Epidemiol. Infect. 131(3), 1029-1039.
Fooks, A.R., McElhinney, L.M., Pounder, D.J., Finnegan, C.J., Mansfield, K., Johnson, N., Brookes, S.M., Parsons, G., White, K., Mclntyre, P.G. and Nathwani, D., 2003b. Case report: isolation of a European bat lyssavirus type 2a from a fatal human case of rabies encephalitis. J. Med. Virol. 71, 281-289.
Hall, T.A. 1999. BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl. Acids. Symp. Ser. 41, 95-98.
Hanlon, C.A., Kuzmin, I.V., Blanton, J.D., Weldon, W.C., Manangan, J.S. and Rupprecht, C.E., 2005. Efficacy of rabies biologies against new lyssaviruses from Eurasia. Virus Res. I l l, 44-54.
ICTV Official Taxonomy: Updates since the 8th Report. Vertebrate. http://talk.ictvonline.Org/media/p/1208.aspx (accessed 10/14/2009).
Jallet, C, Jacob, Y., Bahloul, C, Drings, A., Desmezieres, E., Tordo, N., Perrin, P. 1999. Chimeric lyssavirus glycoproteins with increased immunological potential, J. Virol. 73, 225-233.
Jeanmougin, F., Thompson, J.D., Gouy, M., Higgins, D.G., Gibson, T.J. 1998. Multiple sequence alignment with Clustal X. Trends. Biochem. Sci. 23, 403-405.
Johnson, N., McElhinney, L.M., Smith, J., Lowings, P., Fooks, A.R., 2002. Phylogenetic comparison of the genus Lyssavirus using distal coding sequences of the glycoprotein and nucleoprotein genes. Arch. Virol. 147, 2111-2123.
Kissi, B., Tordo, N., Bourhy, H. 1995. Genetic polymorphism in the rabies virus nucleoprotein gene. Virology 209, 526-537.
Koprowski, H., 1996. The mouse inoculation test. In: Meslin, F.-X., Kaplan, M.M., Koprowski, H. (Eds.). Laboratory techniques in rabies, 4th ed. WHO, Geneva, Switzerland, pp. 80-86.
Kumar, S., Tamura, K., Jakobsen, I.B., Nei, M. 2001. MEGA2: molecular evolutionary genetics analysis software. Bioinformatics 17, 1244-1245.
Kuzmin, I.V., Botvinkin, A.D., Poleschuk, E.M., Orciari, L.A., Smith, J.S. and Rupprecht, C.E. (2006). Bat rabies surveillance in the former Soviet Union. Dev. Biol. (Basel). 125, 273- 282.
Kuzmin, I.V., Hughes, G.J., Botvinkin, A.D., Orciari, L.A. and Rupprecht, C.E., 2005. Phylogenetic relationships of Irkut and West Caucasian bat viruses within the Lyssavirus genus and suggested quantitative criteria based on the N gene sequence for lyssavirus genotype definition. Virus Res. I l l, 28-43.
Kuzmin, I.V., Niezgoda, M., Franka, R., Agwanda, B., Markotter, W., Beagley, J.C., Urazova, O.Y., Breiman, R.F., Rupprecht, C.E., 2008a. Possible emergence of West Caucasian bat virus in Africa. Emerging Infect. Dis. 14(12), 1887- 1889.
Kuzmin, I.V., Niezgoda, M., Franka, R., Agwanda, B., Markotter, W., Beagley, J.C., Urazova, O.Y., Breiman, R.F., Rupprecht, C.E., 2008b. Lagos bat virus in Kenya. J. Clin. Microbiol. 46(4), 1451-1461. Kuzmin, I.V., Orciari, L.A., Arai, Y.T., Smith, J.S., Hanlon, C.A., Kameoka, Y. and
Rupprecht, C.E., 2003. Bat lyssaviruses (Aravan and Khujand) from Central Asia: phylogenetic relationships according to N, P and G gene sequences. Virus Res. 97, 65-79.
Le Mercier, P., Jacob, Y., Tordo, N., 1997. The complete Mokola virus genome sequence: structure of the RNA-dependent RNA polymerase. J. Gen. Virol. 78, 1571-1576.
Lentz, T.L., Burrage, T.G., Smith, A.L., Crick, J., Tignor, G.H., 1982. Is the acetylcholine receptor a rabies virus receptor? Science. 215(4529), 182-184. Markotter, W., Kuzmin, I., Rupprecht, C.E., Nel, L.H., 2008a. Phylogeny of Lagos bat virus: challenges for lyssavirus taxonomy. Virus Res. 135(1), 10-21.
Markotter, W., Kuzmin, I.V., Rupprecht, C.E., Nel, L.H., 2009. Lagos bat virus virulence in mice inoculated by the peripheral route. Epidemiol. Infect. 137(8), 1155-1162.
Markotter, W., Van Eeden, C, Kuzmin, I.V., Rupprecht, C.E., Paweska, J.T., Swanepoel, R., Fooks, A.R., Sabeta, C.T., Cliquet, F., Nel, L.H., 2008b. Epidemiology and pathogenicity of African bat lyssaviruses. Dev. Biol. (Basel). 131, 317-325.
Nel, L., Jacobs, J., Jafta, J., Von Teichman, B., Bingham, J. 2000. New Cases of Mokola Virus Infection in South Africa: A Genotypic Comparison of Southern African Virus Isolates. Virus Genes 20, 103-106.
Nel, L.H., Niezgoda, M., Hanlon, C.A., Morril, P.A., Yager, P.A., Rupprecht, C.E., 2003. A comparison of DNA vaccines for the rabies-related virus, Mokola. Vaccine. 21, 2598-2606.
Pavey, C.R., Burwell, C.J., 1997. The diet of the diadem leaf-nosed bat Hipposideros diadema: confirmation of a morphologically-based prediction of carnivory. J. Zool. 243(2), 295 - 303.
Poch, O., Blumberg, B. M., Bougueleret, L., Tordo, N., 1990. Sequence comparison of five polymerases (L proteins) of unsegmented negative- strand RNA viruses: theoretical assignment of functional domains. J. Gen. Virol. 71, 1153-1162.
Prehaud, C, Coulon, P., LaFay, F., Thiers, C, Flamand, A., 1988. Antigenic site II of the rabies virus glycoprotein: structure and role in viral virulence. J. Virol. 62(1), 1-7. Rakotoarivelo, A. A., Ralisata, M., Ravoahangimalala, O.R., Rakotomalala, M.R., Racey,
P. A., Jenkins, R.K.B., 2009. The food habits of a Malagasy Giant: Hipposideros commersoni (E. Geoffroy, 1813). African J. Ecol. 47(3), 283-288.
Rupprecht, C.E., Dietzschold, B., Wunner, W.H. Koprowski, H., 1991. Antigenic relationships of lyssaviruses. In: Baer, G.M. (Ed.) The natural history of rabies. 2nd Edition, CRC Press, Boca Raton, pp.69-100.
Sabeta, C.T., Markotter, W., Mohale, D.K., Shumba, W., Wandeler, A.I., Nel, L.H., 2007. Mokola virus in domestic mammals, South Africa. Emerging Inf. Dis. 13(9), 1371-1373.
Shope, R.E. 1982. Rabies-related viruses. Yale J. Biol. Med. 55, 271-275.
Shope, R.E., Murphy, F.A., Harrison, A.K., Causey, O.R., Kemp, G.E., Simpson, D.I.H., Moore, D. 1970. Two African viruses serologically and morphologically related to rabies virus. J. Virol. 6, 690-692. Smith, J.S., 1989. Rabies virus epitopic variation: use in ecologic studies. Ad. Virus Res. 36,
215-253.
Swofford, D.L., 2003. PAUP*. Phylogenetic Analysis Using Parsimony (*and other methods) version 4. Sunderland ,MA: Sinauer Associates.
Takayama-Ito, M., Ito, N., Yamada, K., Minamoto, N., Sugiyama, M., 2004. Region at amino acids 164 to 303 of the rabies virus glycoprotein plays an important role in pathogenicity for adult mice. J. Neurovirol. 10(2), 131-135. Tignor, G.H., Shope, R.E., Bhatt, P.N., Percy, D.H., 1973. Experimental infection of dogs and monkeys with two rabies serogroup viruses, Lagos bat and Mokola (IbAn 27377): clinical, serologic, virologic and fluorescent-antibody studies. J. Infect. Dis. 128, 471-478.
Tordo, N., Badrane, H., Bourhy, H., Sacramento, D. 1993. Molecular epidemiology of Lyssaviruses: focus on the glycoprotein and pseudogenes. Onderstepoort J. Vet. Res. 60, 315- 323. van Thiel, P.P., de Bie, R.M., Eftimov, F., Tepaske, R., Zaaijer, H.L., van Doornum, G.J., Schutten, M., Osterhaus, A.D., Majoie, C.B., Aronica, E., Fehlner- Gardiner, C, Wandeler, A. I., Kager, P.A., 2009. Fatal human rabies due to Duvenhage Virus from a bat in Kenya: failure of treatment with coma-induction, ketamine, and antiviral drugs. PLoS Negl. Trop. Dis. 3(7), e428.
Vaughan, T., 1977. Foraging behaviour of the giant leaf-nosed bat (Hipposideros commersoni). African J. Ecol. 15(4), 237 - 249.
Warrilow, D., 2005. Australian bat lyssavirus: a recently discovered new rhabdo virus. Curr. Top. Microbiol. Immunol. 292, 25-44.
Webster W.A., Casey, G.A., 1996. Virus isolation in neuroblastoma cell culture. In: Meslin, F.-X., Kaplan, M.M., Koprowski, H. (Eds.). Laboratory techniques in rabies, 4th ed. WHO, Geneva, Switzerland, pp. 96-104. Wiktor, T.J., Koprowski, H., 1980. Antigenic variants of rabies virus. J. Exp. Med. 152(1),
99-112.
Wu, X., Franka, R., Velasco- Villa, A., Rupprecht, C.E., 2007. Are all lyssavirus genes equal for phylogenetic analyses? Virus Res. 129(2), 91-103.
Claims
1. An isolated nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1, or a complement thereof.
2. A portion of the nucleic acid molecule of SEQ ID NO: 1 corresponding to at least one of the lyssavirus structural genes N, P, M, G, or L.
3. An isolated protein with the sequence of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, a fragment thereof, or derivative thereof.
4. An isolated peptide sequence that is SEQ ID NO: 5, a fragment thereof, or a derivative thereof.
5. A process for detecting the presence of a lyssavirus virus or a nucleic acid molecule derived from a lyssavirus in a biological sample comprising:
(a) contacting a sample with an agent that selectively binds to the a nucleic acid molecule with a sequence comprising at least a portion of SEQ ID NO: 1; or a protein sequence encoded by at least a portion of SEQ ID NO: 1; and
(b) detecting whether the agent binds to the virus or the nucleic acid molecule derived therefrom in the sample.
6. The method of claim 5, wherein the agent is an antibody.
7. The method of claim 6, wherein the agent is a nucleic acid molecule comprising a nucleotide sequence having between 4 and 6600 contiguous nucleotides of the nucleotide sequence of SEQ ID NO: 1, or a complement thereof.
8. A vaccine composition for inducing an immunological response against a lyssavirus in a subject, comprising:
a pharmaceutically acceptable carrier admixed with an isolated lyssavirus strain of Shimoni bat virus.
9. A vaccine composition for inducing an immunological response against a lyssavirus in a subject, comprising:
a pharmaceutically acceptable carrier admixed with an isolated protein sequence encoded by at least a portion of SEQ ID NO: 1.
10. A vaccine composition for inducing an immunological response against a lyssavirus in a subject, comprising:
a pharmaceutically acceptable carrier admixed with an isolated nucleic acid sequence that has the sequence of least a portion of SEQ ID NO: 1, or derivative thereof.
11. The composition of claim 9 wherein said isolated protein sequence is SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or a derivative thereof.
12. The vaccine composition of any of claims 8-11 formulated for parenteral administration to a subject.
13. The vaccine composition of any of claims 8-11 formulated for oral administration to a subject.
14. The vaccine composition of any of claims 8-11 further comprising an adjuvant.
15. An isolated lysssavirus virus comprising a nucleic acid molecule having a nucleotide sequence of SEQ ID NO: 1 wherein each thymine is replaced with uracil.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US29498810P | 2010-01-14 | 2010-01-14 | |
| US61/294,988 | 2010-01-14 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2013081571A2 true WO2013081571A2 (en) | 2013-06-06 |
| WO2013081571A3 WO2013081571A3 (en) | 2013-10-17 |
Family
ID=48536218
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2011/021309 Ceased WO2013081571A2 (en) | 2010-01-14 | 2011-01-14 | Isolated lyssavirus nucleic acid and protein sequences |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2013081571A2 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113480630A (en) * | 2021-08-17 | 2021-10-08 | 贵州师范大学 | Hepialus longissimus source antibacterial peptide MS-CATH and application thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7238672B1 (en) * | 2000-04-17 | 2007-07-03 | Institut Pasteur | Chimeric lyssavirus nucleic acids and polypeptides |
| WO2005023849A2 (en) * | 2003-09-04 | 2005-03-17 | Crucell Holland B.V. | Antigenic peptides of rabies virus and uses thereof |
| EP1945780B1 (en) * | 2005-10-14 | 2015-09-16 | THE GOVERNMENT OF THE UNITED STATES OF AMERICA as represented by THE SECRETARY OF THE DEPARTMENT OF HEALTH AND HUMAN SERVICES | Rabies virus vector systems and compositions and methods thereof |
-
2011
- 2011-01-14 WO PCT/US2011/021309 patent/WO2013081571A2/en not_active Ceased
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113480630A (en) * | 2021-08-17 | 2021-10-08 | 贵州师范大学 | Hepialus longissimus source antibacterial peptide MS-CATH and application thereof |
| CN113480630B (en) * | 2021-08-17 | 2022-06-21 | 贵州师范大学 | Hepialus longissimus source antibacterial peptide MS-CATH and application thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2013081571A3 (en) | 2013-10-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US6720409B2 (en) | Anti-human influenza virus antibody | |
| CN105452270B (en) | Influenza virus vaccine and use thereof | |
| Sealy et al. | Association of increased receptor-binding avidity of influenza A (H9N2) viruses with escape from antibody-based immunity and enhanced zoonotic potential | |
| US20170267729A1 (en) | Vaccine antigens that direct immunity to conserved epitopes | |
| US12521430B2 (en) | Methods of generating broadly protective vaccine compositions comprising neuraminidase | |
| US11426459B2 (en) | Mutant of hemagglutinin protein of H3N2 subtype influenza virus and use thereof | |
| RU2410427C2 (en) | Canine influenza virus, compositions containing said virus and application thereof | |
| US20150306209A1 (en) | CANINE PARVOVIRUS TYPE 2c ISOLATES AND METHODS OF USE | |
| JPH0789992A (en) | Immunogenic artificial polypeptides | |
| JP5730204B2 (en) | Modified peptide vaccine derived from influenza M2 | |
| US10596250B2 (en) | Methods of treating and preventing influenza infections | |
| WO2018013704A1 (en) | Engineered influenza polynucleotides, viruses, vaccines and methods of making and using the same | |
| TWI329515B (en) | ||
| JP2005538343A (en) | Purified subfragment encoding neuraminidase, recombinant neuraminidase, and its use in animal prevention | |
| WO2013081571A2 (en) | Isolated lyssavirus nucleic acid and protein sequences | |
| KR101637955B1 (en) | Universal influenza virus vaccine composition | |
| EP1633399A2 (en) | Recombinant antibodies and compositions and methods for making and using the same | |
| KR102091281B1 (en) | Recombinant Influenza A virus H5N6 strain and Vaccine Composition for Highly Pathogenic Influenza A virus comprising the same | |
| KR101908905B1 (en) | Recombinant influenza virus to form cross-protection against multiple subtypes h9 and h5 of influenza viruses and vaccine comprising the same | |
| KR102365039B1 (en) | Suspension Cell Culture Adapted Vaccine Strain Derived from Foot-and-mouth disease virus of A/ASIA/Sea-97 Lineage and Method of Preparing the Same | |
| KR101768600B1 (en) | Universal influenza virus canine vaccine composition | |
| JP7167088B2 (en) | Influenza virus vaccine and its use | |
| US9891225B2 (en) | Compositions and methods for simultaneous detection of HCV antigen/antibody | |
| Roubidoux | Evading Immunological Pressure towards Conserved Epitopes of the Influenza Virus Hemagglutinin Alters Viral Antigenicity and Fitness | |
| AU2023323947A1 (en) | Vaccines for the treatment and prevention of seasonal and emerging infections |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11876707 Country of ref document: EP Kind code of ref document: A2 |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 11876707 Country of ref document: EP Kind code of ref document: A2 |
