WO2013046136A1 - 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh - Google Patents

3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh Download PDF

Info

Publication number
WO2013046136A1
WO2013046136A1 PCT/IB2012/055133 IB2012055133W WO2013046136A1 WO 2013046136 A1 WO2013046136 A1 WO 2013046136A1 IB 2012055133 W IB2012055133 W IB 2012055133W WO 2013046136 A1 WO2013046136 A1 WO 2013046136A1
Authority
WO
WIPO (PCT)
Prior art keywords
optionally substituted
pyrimidin
phenyl
alkyl
group
Prior art date
Application number
PCT/IB2012/055133
Other languages
French (fr)
Inventor
Young Shin Cho
Julian Roy LEVELL
Bakary-Barry Toure
Fan Yang
Thomas CAFERRO
Huangshu Lei
Francois Lenoir
Gang Liu
Mark G. Palermo
Michael David SHULTZ
Troy Smith
Abran Q. Costales
Keith Bruce PFISTER
Martin Sendzik
Cynthia Shafer
James Sutton
Qian Zhao
Original Assignee
Novartis Ag
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AP2014007602A priority Critical patent/AP3907A/en
Priority to CN201280058052.3A priority patent/CN103958506B/en
Application filed by Novartis Ag filed Critical Novartis Ag
Priority to AU2012313888A priority patent/AU2012313888B2/en
Priority to KR1020147010827A priority patent/KR20140069235A/en
Priority to UAA201403086A priority patent/UA111503C2/en
Priority to EA201490696A priority patent/EA025183B1/en
Priority to SG11201400989TA priority patent/SG11201400989TA/en
Priority to CUP2014000036A priority patent/CU24269B1/en
Priority to JP2014532533A priority patent/JP6026544B2/en
Priority to EP12784701.0A priority patent/EP2771337B1/en
Priority to ES12784701.0T priority patent/ES2645968T3/en
Priority to US14/347,481 priority patent/US8957068B2/en
Priority to BR112014007310A priority patent/BR112014007310A2/en
Priority to NZ624040A priority patent/NZ624040B2/en
Priority to CA2849995A priority patent/CA2849995A1/en
Priority to MX2014003752A priority patent/MX342326B/en
Publication of WO2013046136A1 publication Critical patent/WO2013046136A1/en
Priority to ZA2014/02144A priority patent/ZA201402144B/en
Priority to MA36849A priority patent/MA35452B1/en
Priority to TNP2014000128A priority patent/TN2014000128A1/en
Priority to CR20140143A priority patent/CR20140143A/en
Priority to IL231786A priority patent/IL231786A/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/04—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/02—Drugs for disorders of the urinary system of urine or of the urinary tract, e.g. urine acidifiers
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/02—Antineoplastic agents specific for leukemia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/14—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D417/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/14—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing three or more hetero rings
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D471/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
    • C07D471/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
    • C07D471/04—Ortho-condensed systems
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
    • C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
    • C07D487/04—Ortho-condensed systems
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
    • C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
    • C07D487/08—Bridged systems
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
    • C07D487/12—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains three hetero rings
    • C07D487/18—Bridged systems
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D498/00—Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D498/02—Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms in which the condensed system contains two hetero rings
    • C07D498/10—Spiro-condensed systems
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D513/00—Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for in groups C07D463/00, C07D477/00 or C07D499/00 - C07D507/00
    • C07D513/02—Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for in groups C07D463/00, C07D477/00 or C07D499/00 - C07D507/00 in which the condensed system contains two hetero rings
    • C07D513/04—Ortho-condensed systems

Definitions

  • the present invention is directed to novel 3-pyrimidinyl-4-yl-oxazolidin-2-one compounds, compositions containing these compounds, the use of such compounds in the inhibition of mutant IDH proteins having a neomorphic activity and in the treatment of diseases or disorders associated with such mutant IDH proteins including, but not limited to, cell-proliferation disorders, such as cancer.
  • Isocitrate dehydrogenase is a key family of enzymes found in cellular metabolism. They are NADP + / NAD + and metal dependent oxidoreductases of the enzyme class EC 1 .1 .1.42.
  • the wild type proteins catalyze the oxidative decarboxylation of isocitrate to alpha-ketoglutarate generating carbon dioxide and NADPH / NADH in the process. They are also known to convert oxalosuccinate into alpha-ketoglutarate.
  • IDH1 cytosolic
  • IDH2 mitochondrial
  • glioma glioblastoma multiforme
  • paraganglioma supratentorial primordial neuroectodermal tumors
  • acute myeloid leukemia (AML) prostate cancer
  • thyroid cancer colon cancer
  • chondrosarcoma cholangiocarcinoma
  • peripheral T-cell lymphoma peripheral T-cell lymphoma
  • melanoma See L. Deng et al., Trends Mol. Med., 2010, 16, 387; T. Shibata et al., Am. J. Pathol., 201 1 , 178(3), 1395; Gaal et al., J.
  • this invention provides for a compound of formula (I)
  • R ⁇ -R ⁇ are defined herein.
  • this invention provides for a pharmaceutical composition
  • a pharmaceutical composition comprising a compound of formula (I), or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient.
  • this invention provides for the use of a compound of formula (I), or a pharmaceutically acceptable salt thereof, as an inhibitor of a mutant IDH protein having a neomorphic activity such as reducing alpha-ketoglutarate to 2-hydroxyglutarate (2-HG neomorphic activity).
  • this invention provides for the use of a compound of formula (I), or a pharmaceutically acceptable salt thereof, as an inhibitor of mutant IDH1 having a neomorphic activity, such as 2-HG neomorphic activity, and/or mutant IDH2 having a neomorphic activity, such as 2-HG neomorphic activity.
  • This invention further provides for the use of a compound of formula (I), or a pharmaceutically acceptable salt thereof, as an inhibitor of IDH1 having a mutation at residue 97, 100 or 132, for example G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V; and/or an inhibitor of I DH2 having a mutation at residue 140 or 172, for example R172K, R172M, R172S, R172G, and R172W.
  • a compound of formula (I), or a pharmaceutically acceptable salt thereof as an inhibitor of IDH1 having a mutation at residue 97, 100 or 132, for example G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V; and/or an inhibitor of I DH2 having a mutation at residue 140 or 172, for example R172K, R172M, R172S, R172G, and R172W.
  • this invention provides for a method of treating a disease or disorder associated with a mutant I DH protein having a neomorphic activity comprising administration of an effective amount of a compound according to formula (I), or a pharmaceutically acceptable salt thereof, to a subject in need thereof.
  • the disease or disorder is a cell proliferation disorder, such as cancer.
  • the cancer is brain cancer, such as glioma, glioblastoma multiforme, paraganglioma, and supratentorial primordial neuroectodermal tumors (pNET); leukemia, such as acute myeloid leukemia (AML), myelodysplastic syndrome, and chronic myelogenous leukemia (CML); skin cancer, including melanoma; prostate cancer; thyroid cancer; colon cancer; lung cancer; sarcoma, including central chondrosarcoma, central and periosteal chondroma; and fibrosarcoma.
  • the disease or disorder is D-2-hydroxyglutaric aciduria.
  • the invention provides for a compound of formula (I), or a pharmaceutically acceptable salt thereof, in combination with another therapeutic agent.
  • the present invention is directed to a compound of formula (I)
  • R and R 2 are each independently hydrogen, deuterium, halo, hydroxyl, NH2, aryl, heteroaryl, or optionally substituted C-1.4 alkyl,
  • C-1.4 alkyl is optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, and NH2;
  • R ⁇ A is hydrogen, deuterium, C-
  • R3b is hydrogen, deuterium, or C-
  • R ⁇ A and R 3b are joined together forming an optionally substituted 3-7 membered cycloalkyi ring or an optionally substituted 4-7 membered heterocyclic ring,
  • cycloalkyi and heterocyclic rings are each optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl;
  • R4a is hydrogen, C-
  • phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.4 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-
  • R ⁇ b js hydrogen, deuterium, or C-1.3 alkyl
  • R 4A and R 4B are joined together forming an optionally substituted 3-7 membered cycloalkyi ring or an optionally substituted 4-7 membered heterocyclic ring,
  • cycloalkyi and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl,
  • R5a js hydrogen or deuterium
  • R5b js hydrogen, deuterium, methyl, ethyl, CD3, CF3, CH2F, or CHF2 and
  • R6 is optionally substituted C-
  • aryl, heteroaryl, heterocyclic and C3.-10 cycloalkyi are optionally substituted with one to three substituents each independently selected from the group consisting of: halo; hydroxyl; cyano; nitro; C-1.4 alkoxy; C-1.3 haloalkyi; C-1.3 haloalkoxy;
  • _5 alkyl C3_g cycloalkyi optionally substituted with one to three substituents each independently selected from the group consisting of: hydroxyl, cyano, C-1.3 alkyl, C-1.3 alkoxy, and C-1.3 haloalkyi; phenyl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-
  • -NR b R b 5-6 membered heteroaryl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, C-1.3 alkyl, C-1.3 alkoxy; 5-6 membered heterocyclic optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH 2 , and C-
  • n 1 , 2, or 3 and
  • said C3.7 cycloalkyi and group of formula (a) are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-
  • phenyl and heteroaryl are optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, and C-1.3 alkyl,
  • heterocyclic is optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-1.4 alkyl, C3.5 cycloalkyl, -C(0)R' 3 , and -NRbRb; and
  • substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-
  • Alkyl refers to a monovalent saturated hydrocarbon chain having the specified number of carbon atoms.
  • .g alkyl refers to an alkyl group having from 1 to 6 carbon atoms.
  • Alkyl groups may be optionally substituted with one or more substituents as defined in formula (I).
  • Alkyl groups may be straight or branched. Representative branched alkyl groups have one, two, or three branches.
  • alkyl groups include, but are not limited to, methyl, ethyl, propyl (n-propyl and isopropyl), butyl (n-butyl, isobutyl, sec-butyl, and t-butyl), pentyl (n-pentyl, isopentyl, and neopentyl), and hexyl.
  • Alkoxy refers to any alkyl moiety attached through an oxygen bridge (i.e. a -O-
  • _3 alkyl group wherein C-1.3 alkyl is as defined herein).
  • examples of such groups include, but are not limited to, methoxy, ethoxy, and propoxy.
  • Aryl refers to a hydrocarbon ring system having an aromatic ring. Aryl groups are monocyclic ring systems or bicyclic ring systems. Monocyclic aryl ring refers to phenyl. Bicyclic aryl rings refer to naphthyl and to rings wherein phenyl is fused to a C5.
  • Aryl groups may be optionally substituted with one or more substituents as defined in formula (I).
  • Cycloalkyl refers to a saturated hydrocarbon ring system having the specified number of carbon atoms. Cycloalkyl groups are monocyclic or bicyclic ring systems. For example, C .10 cycloalkyl refers to a cycloalkyl group having from 5 to 10 carbon atoms.
  • Cycloalkyl groups may be optionally substituted with one or more substituents as defined in formula (I).
  • Examples of cycloalkyl groups include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and adamantanyl.
  • Cycloalkenyl refers to an unsaturated hydrocarbon ring system having the specified number of carbon atoms and having a carbon-carbon double bond within the ring.
  • C5.7 cycloalkenyl refers to a cycloalkenyl group having from 5 to 7 carbon atoms.
  • cycloalkenyl groups have one carbon-carbon double bond within the ring.
  • cycloalkeneyl groups have more than one carbon-carbon double bond within the ring.
  • Cycloalkenyl rings are not aromatic. Cycloalkenyl groups may be optionally substituted with one or more substituents as defined in formula (I).
  • Halo refers to the halogen radicals fluoro, chloro, bromo, and iodo.
  • Haloalkyi refers to an alkyl group wherein at least one hydrogen atom attached to a carbon atom within the alkyl group is replaced with halo.
  • the number of halo substituents includes, but is not limited to, 1 , 2, 3, 4, 5, or 6 substituents.
  • Haloalkyi includes, but is not limited to, monofluoromethyl, difluoroethyl, and trifluoromethyl.
  • Haloalkoxy refers to a haloalkyi moiety attached through an oxygen bridge (i.e. a -0-C-
  • An example of a haloalkoxy group is trifluoromethoxy.
  • Heteroaryl refers to an aromatic ring system containing from 1 to 5 heteroatoms. Heteroaryl groups containing more than one heteroatom may contain different heteroatoms. Heteroaryl groups may be optionally substituted with one or more substituents as defined in formula (I). Heteroaryl groups are monocyclic ring systems or are fused bicyclic ring systems. Monocyclic heteroaryl rings have from 5 to 6 ring atoms. Bicyclic heteroaryl rings have from 8 to 10 member atoms. Bicyclic heteroaryl rings include those ring systems wherein a heteroaryl ring is fused to a phenyl ring.
  • Heteroaryl includes, but is not limited to, pyrrolyl, pyrazolyl, imidazolyl, oxazolyl, isoxazolyl, oxadiazolyl (including 1 ,3,4-oxadiazolyl and 1 ,2,4-oxadiazolyl), thiazolyl, isothiazolyl, thiadiazolyl, furanyl, furanzanyl, thienyl, triazolyl, pyridinyl (including 2-, 3-, and 4- pyridinyl), pyrimidinyl, pyridazinyl, pyrazinyl, trazinyl, tetrazinyl, tetrzolyl, indonyl, isoindolyl, indolizinyl, indazolyl, purinyl, quinolinyl, isoquinolinyl, quinoxalinyl, quinazolinyl, benzimidazolyl
  • Heteroatom refers to a nitrogen, oxygen, or sulfur atom.
  • Heterocyclic refers to a 3 to 1 1 membered saturated or unsaturated monocyclic or bicyclic ring containing from 1 to 4 heteroatoms. Heterocyclic ring systems are not aromatic. Heterocyclic groups containing more than one heteroatom may contain different heteroatoms. Heterocyclic includes ring systems wherein a sulfur atom is oxidized to form SO or S02- Heterocyclic groups may be optionally substituted with one or more substituents as defined in formula (I). Heterocyclic groups are monocyclic, spiro, or fused or bridged bicyclic ring systems. Monocyclic heterocyclic rings have 3 to 7 ring atoms.
  • Examples of monocyclic heterocyclic groups include oxtanyl, tetrahydrofuranyl, dihydrofuranyl, 1 ,4-dioxanyl, morpholinyl, 1 ,4-dithianyl, piperazinyl, piperidinyl, 1 ,3- dioxolanyl, imidazolidinyl, imidazolinyl, pyrrolinyl, pyrrolidinyl, tetrahydropyranyl, dihydropyranyl, oxathiolanyl, dithiolanyl, 1 ,3-dioxanyl, 1 ,3-dithianyl, oxathianyl, thiomorpholinyl, tetrahydro-thiopyran 1 , 1 -dioxide, 1 ,4-diazepanyl, and the like.
  • Fused heterocyclic ring systems have from 8 to 1 1 ring atoms and include groups wherein a heterocyclic ring is fused to a phenyl ring, a heteroaryl ring or another heterocyclic ring.
  • fused heterocyclic rings include 2,3-dihydrobenzo[b][1 ,4]dioxinyl, octahydro- pyrrolo[1 ,2-a]pyrazinyl, octahydro-pyrido[1 ,2-a]pyrazinyl, octahydro-pyrrolo[3,4-c]pyrrolyl, 5,6,7,8-tetrahydro-[1 ,2,4]triazolo[4,3-a]pyrazinyl, 5,6,7,8-tetrahydro-imidazo[1 ,2- a]pyrazinyl and the like.
  • bridged heterocyclic groups examples include 3,8-diaza- bicyclo[3.2.1]octanyl, 3,8-diaza-bicyclo[4.2.0]octanyl and the like.
  • spiro heterocyclic groups examples include 4,7-diaza-spiro[2.5]octanyl and the like.
  • 4-7 membered heterocyclic refers to a heterocyclic group as defined above, having from 4 to 7 ring atoms and containing from 1 to 4 heteroatoms.
  • 5-6 membered heterocylic refers to a heterocyclic group as defined above, having 5 or 6 ring atoms and containing from 1 to 4 heteroatoms.
  • Optionally substituted indicates that a group, such as an alkyl, cycloalkyl, heteroaryl, heterocyclic, phenyl, and benzyl may be unsubstitued or the group may be substituted with one or more substituents as defined in formula (I).
  • “Pharmaceutically acceptable” means a compound which is suitable for pharmaceutical use.
  • Salts and solvates (e.g. hydrates and hydrates of salts) of compounds of the invention which are suitable for use in medicine are those where in the counterion or associated solvent is pharmaceutically acceptable.
  • salts and solvates having non-pharmaceutically acceptable counterions or associated solvents are within the scope of the present invention, for example, for use as intermediates in the preparation of other compounds of the invention and their pharmaceutically acceptable salts and solvates.
  • Substituted in reference to a group such as alkyl, phenyl, benzyl, heteroaryl, and heterocyclic, indicates that one or more hydrogen atoms attached to an atom within the group is replaced with a substituent selected from the group of defined substituents. It should be understood that the term “substituted” includes the implicit provision that such substitution be in accordance with permitted valence of the substituted atom and the substituent, and that the substitution results in a stable compound (i.e. one that does not spontaneously undergo transformation, for example, by hydrolysis, rearrangement, cyclization, or elimination and that is sufficiently robust to survive isolation from a reaction mixture).
  • a group may contain one or more substituents, one or more (as appropriate) atoms within the group may be substituted.
  • a single atom within the group may be substituted with more than one substituent as long as such substitution is accordance with the permitted valence of the atom.
  • Suitable substituents are defined for each substituted or optionally substituted group.
  • salts including pharmaceutically acceptable salts, of the compounds according to formula (I) may be prepared. These salts may be prepared in situ during the final isolation and purification of the compound, or by separately reacting the purified compound in its free acid or free base form with a suitable base or acid, respectively.
  • Pharmaceutically acceptable acid addition salts can be formed with inorganic acids and organic acids, e.g., acetate, aspartate, benzoate, besylate, bromide/hydrobromide, bicarbonate/carbonate, bisulfate/sulfate, camphorsulfonate, chloride/hydrochloride, chlortheophyllonate, citrate, ethandisulfonate, fumarate, gluceptate, gluconate, glucuronate, hippurate, hydroiodide/iodide, isethionate, lactate, lactobionate, laurylsulfate, malate, maleate, malonate, mandelate, mesylate, methylsulphate, naphthoate, napsylate, nicotinate, nitrate, octadecanoate, oleate, oxalate, palmitate, pamoate, phosphate/hydrogen phosphate/dihydrogen
  • Inorganic acids from which salts can be derived include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
  • Organic acids from which salts can be derived include, for example, acetic acid, propionic acid, glycolic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, toluenesulfonic acid, sulfosalicylic acid, and the like.
  • Pharmaceutically acceptable base addition salts can be formed with inorganic and organic bases.
  • Inorganic bases from which salts can be derived include, for example, ammonium salts and metals from columns I to XII of the periodic table.
  • the salts are derived from sodium, potassium, ammonium, calcium, magnesium, iron, silver, zinc, and copper; particularly suitable salts include ammonium, potassium, sodium, calcium and magnesium salts.
  • Organic bases from which salts can be derived include, for example, primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, basic ion exchange resins, and the like.
  • Certain organic amines include isopropylamine, benzathine, cholinate, diethanolamine, diethylamine, lysine, meglumine, piperazine and tromethamine.
  • the pharmaceutically acceptable salts of the present invention can be synthesized from a basic or acidic moiety, by conventional chemical methods.
  • such salts can be prepared by reacting free acid forms of these compounds with a stoichiometric amount of the appropriate base (such as Na, Ca, Mg, or K hydroxide, carbonate, bicarbonate or the like), or by reacting free base forms of these compounds with a stoichiometric amount of the appropriate acid.
  • a stoichiometric amount of the appropriate base such as Na, Ca, Mg, or K hydroxide, carbonate, bicarbonate or the like
  • Such reactions are typically carried out in water or in an organic solvent, or in a mixture of the two.
  • use of non-aqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile is desirable, where practicable.
  • Solvates, including pharmaceutically acceptable solvates, of the compounds of formula (I) may also be prepared.
  • “Solvate” refers to a complex of variable stoichiometry formed by a solute and solvent. Such solvents for the purpose of the invention may not interfere with the biological activity of the solute. Examples of suitable solvents include, but are not limited to, water, MeOH, EtOH, and AcOH. Solvates wherein water is the solvent molecule are typically referred to as hydrates. Hydrates include compositions containing stoichiometric amounts of water, as well as compositions containing variable amounts of water.
  • the compounds of formula (I), including salts and solvates thereof, may exist in crystalline forms, non-crystalline forms, or mixtures thereof.
  • the compound or salt or solvate thereof may also exhibit polymorphism, i.e. the capacity of occurring in different crystalline forms. These different crystalline forms are typically known as "polymorphs". Polymorphs have the same chemical composition but differ in packing, geometrical arrangement, and other descriptive properties of crystalline solid state. Polymorphs, therefore, may have different physical properties such as shape, density, hardness, deformability, stability, and dissolution properties. Polymorphs typically exhibit different melting points, IR spectra, and X-ray powder diffraction patterns, all of which may be used for identification.
  • different polymorphs may be produced, for example, by changing or adjusting the conditions used in crystallizing/recrystallizing a compound of formula (I).
  • the invention also includes various isomers of the compounds of formula (I).
  • “Isomer” refers to compounds that have the same composition and molecular weight but differ in physical and/or chemical properties. The structural difference may be in constitution (geometric isomers) or in the ability to rotate the plane of polarized light (stereosiomers). With regard to stereoisomers, the compounds of formula (I) may have one or more asymmetric carbon atom and may occur as racemates, racemic mixtures and as individual enantiomers or diastereomers. All such isomeric forms are included within the present invention, including mixtures thereof. If the compound contains a double bond, the substituent may be in the E or Z configuration. If the compound contains a disubstituted cycloalkyl, the cycloalkyl substituent may have a cis- or transconfiguration. All tautomeric forms are also intended to be included.
  • any asymmetric atom (e.g., carbon or the like) of a compound of formula (I) can be present in racemic or enantiomerically enriched, for example the (/?)-, (S)- or (Reconfiguration.
  • each asymmetric atom has at least 50 % enantiomeric excess, at least 60 % enantiomeric excess, at least 70 % enantiomeric excess, at least 80 % enantiomeric excess, at least 90 % enantiomeric excess, at least 95 % enantiomeric excess, or at least 99 % enantiomeric excess in the (R)- or (S)- configuration.
  • Substituents at atoms with unsaturated double bonds may, if possible, be present in cis- (Z)- or trans- (£)- form.
  • a compound of formula (I) can be in the form of one of the possible isomers, rotamers, atropisomers, tautomers or mixtures thereof, for example, as substantially pure geometric (cis or trans) isomers, diastereomers, optical isomers (antipodes), racemates or mixtures thereof.
  • Any resulting mixtures of isomers can be separated on the basis of the physicochemical differences of the constituents, into the pure or substantially pure geometric or optical isomers, diastereomers, racemates, for example, by chromatography and/or fractional crystallization.
  • any resulting racemates of final products or intermediates can be resolved into the optical antipodes by known methods, e.g., by separation of the diastereomeric salts thereof, obtained with an optically active acid or base, and liberating the optically active acidic or basic compound.
  • a basic moiety may thus be employed to resolve the compounds of the present invention into their optical antipodes, e.g., by fractional crystallization of a salt formed with an optically active acid, e.g., tartaric acid, dibenzoyl tartaric acid, diacetyl tartaric acid, di-0,0'-p-toluoyl tartaric acid, mandelic acid, malic acid or camphor-10-sulfonic acid.
  • Racemic products can also be resolved by chiral chromatography, e.g., high pressure liquid chromatography (HPLC) using a chiral adsorbent.
  • HPLC high pressure liquid chromatography
  • the invention includes unlabeled forms as well as isotopically labeled forms of compounds of formula (I).
  • Isotopically labeled compounds have structures depicted by the formulas given herein except that one or more atoms are replaced by an atom having a selected atomic mass or mass number.
  • isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as 2 H, 3 H, 11 C, 13 C, 14 C, 15 N, 18 F 31 P, 32 P, 35 S, 36 CI, 125 l respectively.
  • the invention includes various isotopically labeled compounds as defined herein, for example those into which radioactive isotopes, such as 3 H and 14 C, or those into which non-radioactive isotopes, such as 2 H and 13 C are present.
  • isotopically labelled compounds are useful in metabolic studies (with 14 C), reaction kinetic studies (with, for example 2 H or 3 H), detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays, or in radioactive treatment of patients.
  • PET positron emission tomography
  • SPECT single-photon emission computed tomography
  • an 18 F or labeled compound may be particularly desirable for PET or SPECT studies.
  • Isotopically-labeled compounds of formula (I) can generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the accompanying Examples and Preparations using an appropriate isotopically-labeled reagents in place of the non- labeled reagent previously employed.
  • D) may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements or an improvement in therapeutic index.
  • deuterium in this context is regarded as a substituent of a compound of the formula (I).
  • concentration of such a heavier isotope, specifically deuterium may be defined by the isotopic enrichment factor.
  • isotopic enrichment factor as used herein means the ratio between the isotopic abundance and the natural abundance of a specified isotope.
  • a substituent in a compound of this invention is denoted deuterium, such compound has an isotopic enrichment factor for each designated deuterium atom of at least 3500 (52.5% deuterium incorporation at each designated deuterium atom), at least 4000 (60% deuterium incorporation), at least 4500 (67.5% deuterium incorporation), at least 5000 (75% deuterium incorporation), at least 5500 (82.5% deuterium incorporation), at least 6000 (90% deuterium incorporation), at least 6333.3 (95% deuterium incorporation), at least 6466.7 (97% deuterium incorporation), at least 6600 (99% deuterium incorporation), or at least 6633.3 (99.5% deuterium incorporation).
  • One embodiment of the present invention is a compound according to formula (I) wherein:
  • each R1 and R ⁇ is independently hydrogen, deuterium, halo, hydroxyl, NH2, aryl, heteroaryl, or optionally substituted C-1.4 alkyl,
  • C-1.4 alkyl is optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, and NH2;
  • R ⁇ a is hydrogen, deuterium, C-
  • R3b is hydrogen, deuterium, or C-
  • R ⁇ a and R 3b are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
  • cycloalkyl and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C1.3 alkyl;
  • R4a is hydrogen, C-
  • phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-
  • R4b is hydrogen, deuterium, or C-1.3 alkyl
  • R ⁇ a and R 4b are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
  • cycloalkyl and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl,
  • R ⁇ a is hydrogen or deuterium
  • R 5b is hydrogen, deuterium, methyl, ethyl, CD3, CF3, CH2F, or CHF2 and
  • R6 is optionally substituted C-
  • aryl, heteroaryl, heterocyclic and C .10 cycloalkyi are optionally substituted with one to three substituents each independently selected from the group consisting of: halo; hydroxyl; cyano; nitro; C-1.3 alkoxy; C-1.3 haloalkyi; C-1.3 haloalkoxy;
  • NR B R B 5-6 membered heteroaryl; 5-6 membered heterocyclic optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH 2 , and C-
  • R5t> and R ⁇ are joined together forming an optionally substituted C3.7 cycloalkyi group
  • n 1 , 2, or 3 and
  • said C3.7 cycloalkyi and group of formula (a) are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-
  • R ⁇ is hydrogen, halo, or optionally substituted C-1.4 alkyl.
  • R ⁇ is hydrogen, fluoro, chloro, or methyl.
  • R ⁇ is hydrogen, fluoro or chloro.
  • R ⁇ is hydrogen.
  • R2 is hydrogen, halo or optionally substituted C-1.4 alkyl.
  • R2 is hydrogen, fluoro, chloro, or methyl.
  • R2 is hydrogen or fluoro.
  • R2 is hydrogen.
  • R ⁇ and R2 are both hydrogen.
  • R ⁇ a is hydrogen, C ⁇
  • R ⁇ a is hydrogen, methyl, or phenyl.
  • R ⁇ a is hydrogen or methyl.
  • R ⁇ a is hydrogen.
  • R3b is hydrogen or methyl.
  • R 3b is hydrogen.
  • R ⁇ a and R ⁇ b are both hydrogen.
  • R ⁇ a and R 3b are joined together forming oxetanyl or tetrahydro-2H-pyranyl.
  • R ⁇ a is hydrogen, C-
  • phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-
  • R ⁇ a j s hydrogen, C1.4 alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene.
  • R ⁇ a is hydrogen, C-1.4 alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted pyridinyl, or methylene-dibenzene. More suitably R ⁇ a is hydrogen, methyl, isopropyl, isobutyl, t- butyl, phenyl, 4-methoxyphenyl, 4-fluorophenyl, benzyl, or methylene-dibenzene.
  • R ⁇ a j hydrogen, methyl, ethyl, isopropyl, phenyl, 4-fluorophenyl, 4- methoxyphenyl, biphenyl, benzyl, or pyridinyl.
  • R ⁇ a js isopropyl.
  • R 4b is hydrogen or methyl.
  • R ⁇ a j s isopropyl and R ⁇ b js methyl. In another embodiment R ⁇ a j s isopropyl and R 4b is hydrogen.
  • R ⁇ a and R 4b are joined together forming cyclopentyl.
  • R ⁇ a j hydrogen. In another embodiment of the present invention R ⁇ a j s deuterium. In another embodiment of the present invention R5b is hydrogen, methyl, ethyl, or CF3. Suitably R 5b is methyl.
  • R ⁇ is optionally substituted heteroaryl, optionally substituted heterocyclic or optionally substituted C .10 cycloalkyi.
  • R ⁇ is methyl, C .10 cycloalkyi, optionally substituted phenyl, optionally substituted pyridinyl, optionally substituted pyrimidinyl, optionally substituted pyridazinyl, optionally substituted pyrazinyl, optionally substituted triazolyl, optionally substituted pyrazolyl, optionally substituted thiazolyl, optionally substitued 1 ,3,4-oxadiazolyl, optionally substituted 1 ,2,4-oxadiazolyl, optionally substitued isoxazolyl, thienyl, oxazolyl, quinolinyl, optionally substituted benzimidazolyl, benzthiazolyl, benzoxazolyl, tetrazolo[1 ,5-a]pyridinyl, imidazo[2, 1 -b][1 ,3,4]thiadiazolyl, optionally substituted piperidinyl, optionally
  • R ⁇ is phenyl optionally substituted with one or two substituents.
  • R ⁇ is optionally substituted 1 ,3,4-oxadiazolyl or 1 ,2,4- optionally substituted oxadiazolyl.
  • R6 is pyrimidinyl optionally substituted with one substituent.
  • R ⁇ is optionally substituted with one or two substituents each independently selected from the group consisting of: halo; hydroxy; nitro; C-1.4 alkoxy; C-1.3 haloalkyl; C-1.3 haloalkoxy; C-
  • substituents each independently selected from the group consisting of: halo; hydroxy; nitro; C-1.4 alkoxy; C-1.3 haloalkyl; C-
  • R 6 is substituted with one -CH2R a , -C(0)R a , -NHC(0)R a , -NHC(0)R b , -C(0)NHR a , -C(0)NHR b , -OR a , -NR a R b , -S0 2 NR b R b , -S02R a , or -SC>2R b group.
  • R 6 is substituted with one -CH2R a , -C(0)R a , or -OR a group.
  • R6 is phenyl substituted with one fluoro or chloro group and one -CH 2 R a , -C(0)R a , or -C(0)N HR a group wherein the -CH 2 R a , -C(0)R a , or
  • R ⁇ is phenyl substituted with one fluoro group and one -CH2R a , -C(0)R a , or -C(0)NHR a group wherein the -CH2R a , -C(0)R a , or -C(0)NHR a group is in the para position of the phenyl ring.
  • R ⁇ is phenyl substituted with one -CH2R a , -C(0)R a , or
  • R ⁇ is phenyl substituted by -CH2R a in the para position.
  • R a is phenyl optionally substituted with one or two substituents each independently selected from the group consisting of fluoro, chloro and bromo.
  • R a is an optionally substituted 5-6 membered heteroaryl.
  • R a is optionally substituted pyridinyl or optionally substituted pyrimidinyl.
  • R a is pyridinyl or pyrimidinyl optionally substituted with one trifluoromethyl.
  • R a is C5.7 cycloalkyl each of which is optionally substituted with one or two substituents each independently selected from the group consisting of fluoro, hydroxy, methyl, and C-1.3 haloalkoxy.
  • R a is optionally substituted heterocyclic.
  • R a is piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, tetrahydro-thiopyran 1 , 1 -dioxide, 1 ,4-diazepanyl, 4,7-diaza-spiro[2.5]octanyl, 3,8-diaza-bicyclo[3.2.1 ]octanyl, 3,8-diaza- bicyclo[4.2.0]octanyl, octahydro-pyrrolo[1 ,2-a]pyrazinyl, octahydro-pyrido[1 ,2-a]pyrazinyl, octahydro-pyrrolo[3,4-c]pyrrolyl, and 5,6,7,8-tetrahydro-imidazo[1 ,2-a]pyrazinyl each of which is optionally substituted with one to
  • R a is piperidinyl, piperazinyl, or morpholinyl each of which is optionally substitued with one to three substituents each independently selected from the group consisting of: hydroxy, fluoro, amino, dimethylamino, C-1.3 haloalkoxy, C-1.3 alkyl, and C3.5 cycloalkyi.
  • R ⁇ b and R ⁇ are joined together forming an optionally substituted C3.7 cycloalkyi group or an optionally substituted group of formula (a).
  • each Rb is independently hydrogen or methyl.
  • R2 is fluoro and R ⁇ 3 , R ⁇ b, R4a anc
  • R4b are each hydrogen.
  • R 4b is hydrogen
  • Selected compounds of the present invention include:
  • Selected compounds of the present invention include:
  • Selected compounds of the present invention include:
  • Embodiment 1 A compound of formula (I)
  • each R1 and R2 is independently hydrogen, deuterium, halo, hydroxyl, NH2, aryl, heteroaryl, or optionally substituted C-1.4 alkyl,
  • C-1.4 alkyl is optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, and NH2;
  • R3 3 is hydrogen, deuterium, C-
  • R3b is hydrogen, deuterium, or C-
  • R3a and R 3B are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
  • cycloalkyl and heterocyclic rings are each optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, N H2, and C-1.3 alkyl;
  • R4a is hydrogen, C-
  • phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-
  • R4b is hydrogen, deuterium, or C-1.3 alkyl
  • R ⁇ a and R 4b are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
  • cycloalkyl and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl, provided that only one of R ⁇ a and R 3b and R ⁇ a and R 4b are joined together forming a ring;
  • R5a js hydrogen or deuterium
  • R 5b is hydrogen, deuterium, methyl, ethyl, CD3, CF3, CH2F, or CHF2 and
  • R6 is optionally substituted C-
  • aryl, heteroaryl, heterocyclic and C5.-10 cycloalkyi are optionally substituted with one to three substituents each independently selected from the group consisting of: halo; hydroxyl; cyano; nitro; C-1.3 alkoxy; C-1.3 haloalkyi; C-1.3 haloalkoxy;
  • NR b R b 5-6 membered heteroaryl; 5-6 membered heterocyclic optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH 2 , and C-
  • R 5b and R6 are joined together forming an optionally substituted C3.7 cycloalkyi group
  • n 1 , 2, or 3 and
  • said C3.7 cycloalkyi and group of formula (a) are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-
  • phenyl and heteroaryl are optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl,
  • said 4-7 membered heterocyclic is optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl; and each R b is independently hydrogen or C-
  • Embodiment 2 The compound according to embodiment 1 wherein R2 is hydrogen; or a pharmaceutically acceptable salt thereof.
  • Embodiment 3 The compound according to embodiment 2 wherein is hydrogen, halo, or optionally substituted C-1.4 alkyl; or a pharmaceutically acceptable salt thereof.
  • Embodiment 4 The compound according to embodiment 3 wherein is hydrogen, fluoro, chloro, or methyl; or a pharmaceutically acceptable salt thereof.
  • Embodiment 5 The compound according to embodiment 4 wherein R ⁇ a is hydrogen, C-
  • Embodiment 6 The compound according to embodiment 5 wherein R3 b is hydrogen or methyl; or a pharmaceutically acceptable salt thereof.
  • Embodiment 7 The compound according to embodiment 6 wherein R ⁇ a is hydrogen, methyl, or phenyl; or a pharmaceutically acceptable salt thereof.
  • Embodiment 8 The compound according to embodiment 7 wherein R ⁇ a is hydrogen, C-
  • phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-
  • Embodiment 9 The compound according to embodiment 8 wherein R ⁇ b j s hydrogen or methyl; or a pharmaceutically acceptable salt thereof.
  • Embodiment 10 The compound according to embodiment 9 wherein R ⁇ a is hydrogen, C-
  • Embodiment 1 1 .
  • Embodiment 12 The compound according to embodiment 1 1 wherein R ⁇ a j s H; or a pharmaceutically acceptable salt thereof.
  • Embodiment 13 The compound according to embodiment 12 wherein R ⁇ b j s hydrogen, methyl, ethyl, or CF3.
  • Embodiment 14 The compound according to embodiment 13 wherein R ⁇ is isopropyl, optionally substituted aryl, optionally substituted pyrazolyl, optionally substituted pyridinyl, 2,3-dihydrobenzofuranyl, 2,3-dihydrobenzo[b][1 ,4]dioxinyl, or optionally substituted C .10 cycloalkyl; or a pharmaceutically acceptable salt thereof.
  • Embodiment 15 A pharmaceutical composition comprising a compound according to embodiment 1 , or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient.
  • Embodiment 16 A method for the treatment of a disease or disorder associated with a mutant IDH protein having a neomorphic activity comprising administration of a therapeutically effective amount of a compound according to embodiment 1 , or a pharmaceutically acceptable salt thereof, to subject in need of thereof.
  • Embodiment 17 A method for the treatment of a disease or disorder associated with a mutant IDH protein having a neomorphic activity comprising administration of a therapeutically effective amount of a compound according to embodiment 1 , or a pharmaceutically acceptable salt thereof, and another therapeutic agent to subject in need of thereof.
  • the compounds of the present invention may be made by a variety of methods, including standard chemistry. Suitable synthetic routes are depicted in the Schemes given below.
  • the compounds of formula (I) may be prepared by methods known in the art of organic synthesis as set forth in part by the following synthetic schemes. In the schemes described below, it is well understood that protecting groups for sensitive or reactive groups are employed where necessary in accordance with general principles or chemistry. Protecting groups are manipulated according to standard methods of organic synthesis (T. W. Greene and P. G. M. Wuts, "Protective Groups in Organic Synthesis", Third edition, Wiley, New York 1999). These groups are removed at a convenient stage of the compound synthesis using methods that are readily apparent to those skilled in the art. The selection processes, as well as the reaction conditions and order of their execution, shall be consistent with the preparation of compounds of formula (I).
  • the present invention includes both possible stereoisomers and includes not only racemic compounds but the individual enantiomers and/or diastereomers as well.
  • a compound When a compound is desired as a single enantiomer or diastereomer, it may be obtained by stereospecific synthesis or by resolution of the final product or any convenient intermediate. Resolution of the final product, an intermediate, or a starting material may be effected by any suitable method known in the art. See, for example, "Stereochemistry of Organic Compounds" by E. L. Eliel, S. H. Wilen, and L. N. Mander (Wiley-lnterscience, 1994).
  • the compounds described herein may be made from commercially available starting materials or synthesized using known organic, inorganic, and/or enzymatic processes.
  • Non-commercial aminoacids can be prepared following the procedures of Scheme 1 . Conversion of ketone 1 to the corresponding imidazolidine-2,4-dione 2 followed by hydrolysis provides aminoacid 3.
  • aminoalcohol precursor of oxazolidinone
  • R 3a R 3b
  • protected aminoester 5 is treated with an appropriate Grignard reagent to give protected aminoalcohol 6 which goes through basic or acidic deprotection step.
  • R 3a ⁇ R 3b protected aminoacid 8 is converted into Weinreb amide 9 which is treated with different Grignard reagents sequentially to provide protected aminoalcohol 10. Either basic or acidic deprotection of 10 gives 11.
  • Oxazolidinone 12 is coupled with dihalogen-pyrimidine 13 in the presence of NaH and the resulting 14 is treated with primary amine 15 under several different reaction conditions as shown in Scheme 3 to provide 16.
  • intermediate 14 can be prepared by coupling the amino alcohol 11 and dihalogen-pyrimidine 13 in the presence of a base such as diisopropylethyl amine resulting in intermediate 17 which can be treated with triphosgene in the presence of a base such as 2,6-lutidine resulting in intermediate 14.
  • a base such as diisopropylethyl amine
  • the compounds of the present invention are inhibitors of a mutant IDH protein having a neomorphic activity and are therefore useful in the treatment of diseases or disorders associated with such proteins including, but not limited to, cell proliferation disorders, such as cancer.
  • mutant IDH protein having a neomorphic activity examples include mutant IDH1 and mutant IDH2.
  • a neomorphic activity associated with mutant IDH1 and mutant IDH2 is the ability to produce 2-hydroxyglutarate (2-HG neomorphic activity), specifically R-2- HG (R-2-HG neomorphic activity).
  • Mutations in IDH 1 associated with 2-HG neomorphic activity, specifically R-2-HG neomorphic activity include mutations at residues 97, 100, and 132, e.g. G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V.
  • Mutations in IDH2 associated with 2-HG neoactivity, specifically R-2-HG neomorphic activity, include mutations at residues 140 and 172, e.g. R140Q, R140G, R172K, R172M, R172S, R172G, and R172W.
  • Cell-proliferation disorders associated with a mutant IDH protein having a neomorphic activity include, but are not limited to, cancer.
  • cancers include Acute Lymphoblastic Leukemia, Adult; Acute Lymphoblastic Leukemia, Childhood; Acute Myeloid Leukemia, Adult; Adrenocortical Carcinoma; Adrenocortical Carcinoma, Childhood; AIDS-Related Lymphoma; AIDS-Related Malignancies; Anal Cancer; Astrocytoma, Childhood Cerebellar; Astrocytoma, Childhood Cerebral; Bile Duct Cancer, Extrahepatic; Bladder Cancer; Bladder Cancer, Childhood; Bone Cancer, Osteosarcoma/Malignant Fibrous Histiocytoma; Brain Stem Glioma, Childhood; Brain Tumor, Adult; Brain Tumor, Brain Stem Glioma, Childhood; Brain Tumor, Cerebellar Astrocytoma, Childhood; Brain Tumor, Cerebral
  • the cancer associated with a mutant IDH protein having a neomorphic acitvity is brain cancer, such as astrocytic tumor (e.g., pilocytic astrocytoma, subependymal giant-cell astrocytoma, diffuse astrocytoma, pleomorphic xanthoastrocytoma, anaplastic astrocytoma, astrocytoma, giant cell glioblastoma, glioblastoma, secondary glioblastoma, primary adult glioblastoma, and primary pediatric glioblastoma); oligodendroglial tumor (e.g., oligodendroglioma, and anaplastic oligodendroglioma); oligoastrocytic tumor (e.g., oligoastrocytoma, and anaplastic oligoastrocytoma); ependymoma (e.g., myxop
  • the cancer associated with a mutant IDH protein having a neomorphic acitvity is leukemia, such as acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), chronic myelogenous leukemia (CML), myeloproliferative neoplasm (MPN), MDS.MPN including chronic myelomonocytic leukemia, post MDS AML, post MPN AML, post MDS/MPN AML, del(5q)-associated high risk MDS or AML, blast-phase chronic myelogenous leukemia, angioimmunoblastic lymphoma and acute lymphoblastic leukemia.
  • AML acute myeloid leukemia
  • MDS myelodysplastic syndrome
  • CML chronic myelogenous leukemia
  • MPN myeloproliferative neoplasm
  • MDS.MPN including chronic myelomonocytic leukemia, post MDS AML, post
  • the cancer associated with a mutant IDH protein having a neomorphic activity is skin cancer, including melanoma.
  • the cancer associated with a mutant IDH protein having a neomorphic activity is prostate cancer, thyroid cancer, colon cancer, or lung cancer.
  • the cancer associated with a mutant IDH protein having a neomorphic activity is sarcoma, including central chondrosarcoma, central and periosteal chondroma, and fibrosarcoma. In another embodiment the cancer associated with a mutant IDH protein having a neomorphic activity is cholangiocarcinoma.
  • Another disease or disorder associated with a mutant IDH protein having R-2-HG neomorphic activity is D-2-hydroxyglutaric aciduria.
  • Another disease or disorder associated with a mutant IDH protein having R-2-HG neomorphic activity is Diller disease and Mafucci syndrome.
  • neomorphic activity refers to a gain of novel activity of a protein that the wild-type protein does not have or does not exhibit to a significant degree.
  • a neomorphic activity associated with a mutant form of IDH 1 and IDH2 is the ability to reduce alpha-ketoglutarate to 2-hydroxyglutarate (i.e. 2-HG, specifically R-2-HG).
  • the wild type form of IDH1 and IDH2 does not have the ability to reduce alpha-ketoglutarate to 2-hydroxyglutarate (i.e. 2-HG, specifically R-2-HG) or if it does have this ability, it does not produce significant (i.e. harmful or disease causing) amounts of 2-HG.
  • the term "subject" refers to an animal. Typically the animal is a mammal. A subject also refers to for example, primates (e.g., humans, male or female), cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice, fish, birds and the like. In certain embodiments, the subject is a primate. In yet other embodiments, the subject is a human.
  • primates e.g., humans, male or female
  • the subject is a primate.
  • the subject is a human.
  • the term "therapeutically effective amount" in reference to a compound of the invention means an amount of the compound sufficient to treat the subject's disease or condition, but low enough to avoid serious sides effects (at a reasonable benefit/risk ratio) within the scope of sound medical judgment.
  • a therapeutically effective amount of a compound will vary with the particular compound chosen (e.g. consider the potency, efficacy, and half-life of the compound); the route of administration chosen; the condition being treated; the severity of the condition being treated; the age, size, weight, and physical condition of the subject being treated; the medical history of the subject being treated; the duration of the treatment; the nature of the concurrent therapy; the desired therapeutic effect; and like factors and can be routinely determined by the skilled artisan.
  • the term “treat”, “treating” or “treatment” of any disease or disorder refers in one embodiment, to ameliorating the disease or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof).
  • “treat”, “treating” or “treatment” refers to alleviating or ameliorating at least one physical parameter including those which may not be discernible by the patient.
  • “treat”, “treating” or “treatment” refers to modulating the disease or disorder, either physically, (e.g., stabilization of a discernible symptom), physiologically, (e.g., stabilization of a physical parameter), or both.
  • “treat”, “treating” or “treatment” refers to preventing or delaying the onset or development or progression of the disease or disorder.
  • a subject is "in need of” a treatment if such subject would benefit biologically, medically or in quality of life from such treatment.
  • the compounds of the present invention may be administered by any suitable route including oral and parenteral administration.
  • Parenteral administration is typically by injection or infusion and includes intravenous, intramuscular, and subcontaneous injection or infusion.
  • the compounds of the invention may be administered once or according to a dosing regimen wherein a number of doses are administered at varying intervals of time for a given period of time. For example, doses may be administered one, two, three, or four times per day. Doses may be administered until the desired therapeutic effect is achieved or indefinitely to maintain the desired therapeutic effect. Suitable dosing regimens for a compound of the invention depend on the pharmacokinetic properties of that compound, such as absorption, distribution and half life which can be determined by the skilled artisan.
  • suitable dosing regimens including the duration such regimens are administered, for a compound of the invention depend on the disease or condition being treated, the severity of the disease or condition, the age and physical condition of the subject being treated, the medical history of the subject being treated, the nature of concurrent therapy, the desired therapeutic effect, and like factors within the knowledge and expertise of the skilled artisan. It will be further understood by such skilled artisans that suitable dosing regimens may require adjustment given an individual subject's response to the dosing regimen or over time as the individual subject needs change. Typical daily dosages may vary depending upon the particular route of administration chosen. Typical daily dosages for oral administration, to a human weighing approximately 70kg would range from about 5mg to about 500mg of a compound of formula (I).
  • One embodiment of the present invention provides for a method of treating a disease or disorder associated with a mutant form of IDH having a neomorphic activity comprising administration of a therapeutically effective amount of a compound of formula (I) to a subject in need of treatment thereof.
  • the disease or disorder associated with a mutant form of IDH having a neomorphic activity is a cell proliferation disorder.
  • the cell proliferation disorder is cancer.
  • the cancer is a cancer associated with mutant IDH1 having 2-HG neomorphic activity or mutant IDH2 having 2-HG neomorphic activity.
  • the neomorphic activity is R-2-HG neomorphic activity.
  • the cancer is associated with mutant IDH1 having 2-HG or R-2-HG neomorphic activity having a mutation at residues 97, 100, or 132, such as G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V.
  • the cancer is associated with mutant IDH2 having 2-HG or R-2-HG neomorphic activity having a mutation at residues 140 or 172, e.g. R140Q, R140G, R172K, R172M, R172S, R172G, and R172W.
  • the cancer is brain cancer, leukemia, skin cancer, prostate cancer, thyroid cancer, colon cancer, lung cancer or sarcoma.
  • the cancer is glioma, glioblastoma multiforme, paraganglioma, suprantentorial primordial neuroectodermal tumors, acute myeloid leukemia, myelodysplastic syndrome, chronic myelogenous leukemia, melanoma, prostate, thyroid, colon, lung, central chondrosarcoma, central and periosteal chondroma tumors, fibrosarcoma, and cholangiocarcinoma.
  • Another embodiment of the present invention provides for a method of treating a disease or disorder associated with a mutant form of IDH having R-2-HG neomorphic activity comprising administration of a therapeutically effective amount of a compound according to formula (I) to a subject in need thereof wherein the disease or disorder is D- 2-hydroxyglutaric aciduria, Oilier Disease, or Mafucci Syndrome.
  • the therapy is a disease or disorder associated with a mutant form of IDH having a neomorphic activity.
  • the therapy is a cell proliferation disorder associated with a mutant form of IDH having a neomorphic activity.
  • the therapy is cancer.
  • the therapy is a cancer associated with a mutant IDH protein having a neomorphic activity, such as mutant IDH1 having 2-HG neomorphic activity or mutant IDH2 having 2-HG neomorphic activity.
  • the neomorphic activity is R-2-HG neomorphic activity.
  • the cancer is associated with mutant IDH1 having 2-HG or R-2-HG neomorphic activity having a mutation at residues 97, 100, or 132, such as G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V.
  • the cancer is associated with mutant IDH2 having 2-HG or R-2-HG neomorphic activity having a mutation at residue at residues R140 or 172, e.g. R140Q, R140G, R172K, R172M, R172S, R172G, and R172W.
  • the cancer is brain cancer, leukemia, skin cancer, prostate cancer, thyroid cancer, colon cancer, lung cancer or sarcoma.
  • the cancer is glioma, glioblastoma multiforme, paraganglioma, suprantentorial primordial neuroectodermal tumors, acute myeloid leukemia, myelodysplastic syndrome, chronic myelogenous leukemia, melanoma, prostate, thyroid, colon, lung, central chondrosarcoma, central and periosteal chondroma tumors, fibrosarcoma, and cholangiocarcinoma.
  • Another embodiment of the present invention provides for the use of a compound of formula (I) in therapy wherein the therapy is D-2-hydroxyglutaric aciduria, Oilier Disease, or Mafucci Syndrome.
  • Another embodiment of the present invention provides for the use of a compound according to formula (I) in the manufacture of a medicament for the treatment of disease or disorder associated with a mutant form of IDH having a neomorphic activity.
  • the disease or disorder associated with a mutant form of IDH having a neomorphic activity is a cell proliferation disorder.
  • the cell proliferation disorder is cancer.
  • the cancer is a cancer associated with a mutant IDH protein having a neomorphic activity, such as mutant IDH1 having 2-HG neomorphic activity or mutant IDH2 having 2-HG neomorphic activity.
  • the neomorphic activity is R-2-HG neomorphic activity.
  • the cancer is associated with mutant IDH1 having 2-HG or R-2-HG neomorphic activity having a mutation at residues 97, 100, or 132, such as G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V.
  • the cancer is associated with mutant IDH2 having 2-HG or R-2-HG neomorphic activity having a mutation at residue at residues 140 or 172, e.g. R140Q, R140G, R172K, R172M, R172S, R172G, and R172W.
  • the cancer is brain cancer, leukemia, skin cancer, prostate cancer, thyroid cancer, colon cancer, lung cancer or sarcoma.
  • the cancer is glioma, glioblastoma multiforme, paraganglioma, suprantentorial primordial neuroectodermal tumors, acute myeloid leukemia, myelodysplastic syndrome, chronic myelogenous leukemia, melanoma, prostate, thyroid, colon, lung, central chondrosarcoma, central and periosteal chondroma tumors, fibrosarcoma, and cholangiocarcinoma.
  • Another embodiment of the present invention provides for the use of a compound according to formula (I) in the manufacture of a medicament for the treatment of disease or disorder associated with a mutant form of IDH having R-2-HG neomorphic activity wherein the disease or disorder is D-2-hydroxyglutaric aciduria, Oilier Disease, or Mafucci Syndrome.
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising a compound of formula (I) and a pharmaceutically acceptable carrier or excipient.
  • the pharmaceutical compositions of the invention may be prepared and packaged in bulk form wherein a therapeutically effective amount of a compound of the invention can be extracted and then given to a subject, such as with powders or syrups.
  • the pharmaceutical compositions of the invention may be prepared and packaged in unit dosage form wherein each physically discrete unit contains a therapeutically effective amount of a compound of the invention.
  • the pharmaceutical compositions of the invention typically contain from about 5mg to 500mg of a compound of formula (I).
  • pharmaceutically acceptable carrier or excipient means a pharmaceutically acceptable material, composition or vehicle that, for example, are involved in giving form or consistency to the pharmaceutical composition.
  • Each excipient must be compatible with the other ingredients of the pharmaceutical composition when commingled such that interactions which would substantially reduce the efficacy of the compound of the invention when administered to a subject and interactions which would result in pharmaceutical compositions that are not pharmaceutically acceptable are avoided.
  • each excipient must, of course, be of sufficiently high purity to render it pharmaceutically acceptable.
  • the compound of the invention and the pharmaceutically acceptable carrier or excipient(s) will typically be formulated into a dosage form adapted for administration to the subject by the desired route of administration.
  • dosage forms include those adapted for (1 ) oral administration such as tablets, capsules, caplets, pills, troches, powders, syrups, elixirs, suspensions, solutions, emulsions, sachets, and cachets; and (2) parenteral administration such as sterile solutions, suspensions, and powders for reconstitution.
  • suitable pharmaceutically acceptable excipients will vary depending upon the particular dosage form chosen.
  • suitable pharmaceutically acceptable excipients may be chosen for a particular function that they may serve in the composition.
  • certain pharmaceutically acceptable excipients may be chosen for their ability to facilitate the production of uniform dosage forms. Certain pharmaceutically acceptable excipients may be chosen for their ability to facilitate the production of stable dosage forms. Certain pharmaceutically acceptable excipients may be chosen for their ability to facilitate the carrying or transporting of the compound or compounds of the invention, once administered to the subject, from one organ or portion of the body to another organ or another portion of the body. Certain pharmaceutically acceptable excipients may be chosen for their ability to enhance patient compliance.
  • Suitable pharmaceutically acceptable excipients include the following types of excipients: diluents, lubricants, binders, disintegrants, fillers, glidants, granulating agents, coating agents, wetting agents, solvents, co-solvents, suspending agents, emulsifiers, sweeteners, flavoring agents, flavor masking agents, coloring agents, anti-caking agents, hemectants, chelating agents, plasticizers, viscosity increasing agents, antioxidants, preservatives, stabilizers, surfactants, and buffering agents.
  • Skilled artisans possess the knowledge and skill in the art to enable them to select suitable pharmaceutically acceptable carriers and excipients in appropriate amounts for the use in the invention.
  • resources available to the skilled artisan which describe pharmaceutically acceptable carriers and excipients and may be useful in selecting suitable pharmaceutically acceptable carriers and excipients. Examples include Remington's Pharmaceutical Sciences (Mack Publishing Company), The Handbook of Pharmaceutical Additives (Gower Publishing Limited), and The Handbook of Pharmaceutical Excipients (the American Pharmaceutical Association and the Pharmaceutical Press).
  • compositions of the invention are prepared using techniques and methods known to those skilled in the art. Some methods commonly used in the art are described in Remington's Pharmaceutical Sciences (Mack Publishing Company).
  • the invention is directed to a solid oral dosage form such as a tablet or capsule comprising a therapeutically effective amount of a compound of the invention and a diluent or filler.
  • Suitable diluents and fillers include lactose, sucrose, dextrose, mannitol, sorbitol, starch (e.g. corn starch, potato starch, and pre-gelatinized starch), cellulose and its derivatives, (e.g. microcrystalline cellulose), calcium sulfate, and dibasic calcium phosphate.
  • the oral solid dosage form may further comprise a binder. Suitable binders include starch (e.g.
  • the oral solid dosage form may further comprise a disintegrant. Suitable disintegrants include crospovidone, sodium starch glycolate, croscarmelose, alginic acid, and sodium carboxymethyl cellulose.
  • the oral solid dosage form may further comprise a lubricant. Suitable lubricants include stearic acid, magnesium stearate, calcium stearate, and talc.
  • dosage unit formulations for oral administration can be microencapsulated.
  • the composition can also be prepared to prolong or sustain the release as, for example, by coating or embedding particulate material in polymers, wax, or the like.
  • the compounds of the invention may also be coupled with soluble polymers as targetable drug carriers.
  • soluble polymers can include polyvinylpyrrolidone, pyrancopolymer, polyhydroxypropylmethacrylamidephenol, polyhydroxyethylaspartamidephenol, or polyethyleneoxidepolylysine substituted with palmitoyl residues.
  • the compounds of the invention may be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example polylactic acid, polepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanacrylates and cross-linked or amphipathic block copolymers of hydrogels.
  • the invention is directed to a liquid oral dosage form.
  • Oral liquids such as solution, syrups and elixirs can be prepared in dosage unit form so that a given quantity contains a predetermined amount of a compound of the invention.
  • Syrups can be prepared by dissolving the compound of the invention in a suitably flavored aqueous solution; while elixirs are prepared through the use of a non-toxic alcoholic vehicle.
  • Suspensions can be formulated by dispersing the compound of the invention in a non-toxic vehicle.
  • Solubilizers and emulsifiers such as ethoxylated isostearyl alcohols and polyoxy ethylene sorbitol ethers, preservatives, flavor additives such as peppermint oil or other natural sweeteners or saccharin or other artificial sweeteners and the like can also be added.
  • the invention is directed to parenteral administration.
  • compositions adapted for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
  • the compositions may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
  • Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets.
  • the compound of the present invention may be administered either simultaneously with, or before or after, one or more other therapeutic agent(s).
  • the compound of the present invention may be administered separately, by the same or different route of administration, or together in the same pharmaceutical composition as the other agent(s).
  • the invention provides a product comprising a compound of formula (I) and at least one other therapeutic agent as a combined preparation for simultaneous, separate or sequential use in therapy.
  • the therapy is the treatment of a disease or disorder associated with a mutant form of IDH.
  • Products provided as a combined preparation include a composition comprising the compound of formula (I) and the other therapeutic agent(s) together in the same pharmaceutical composition, or the compound of formula (I) and the other therapeutic agent(s) in separate form, e.g. in the form of a kit.
  • the invention provides a pharmaceutical composition comprising a compound of formula (I) and another therapeutic agent(s).
  • the pharmaceutical composition may comprise a pharmaceutically acceptable excipient, as described above.
  • the invention provides a kit comprising two or more separate pharmaceutical compositions, at least one of which contains a compound of formula (I).
  • the kit comprises means for separately retaining said compositions, such as a container, divided bottle, or divided foil packet.
  • a container, divided bottle, or divided foil packet An example of such a kit is a blister pack, as typically used for the packaging of tablets, capsules and the like.
  • the kit of the invention may be used for administering different dosage forms, for example, oral and parenteral, for administering the separate compositions at different dosage intervals, or for titrating the separate compositions against one another.
  • the kit of the invention typically comprises directions for administration.
  • the compound of the invention and the other therapeutic agent may be manufactured and/or formulated by the same or different manufacturers. Moreover, the compound of the invention and the other therapeutic agent may be brought together into a combination therapy: (i) prior to release of the combination product to physicians (e.g. in the case of a kit comprising the compound of the invention and the other therapeutic agent); (ii) by the physician themselves (or under the guidance of the physician) shortly before administration; (iii) in the patient themselves, e.g. during sequential administration of the compound of the invention and the other therapeutic agent.
  • the invention provides the use of a compound of formula (I) for treating a disease or disorder associated with a mutant form of IDH, wherein the medicament is prepared for administration with another therapeutic agent.
  • the invention also provides the use of another therapeutic agent for treating a disease or disorder associated with a mutant form of IDH, wherein the medicament is administered with a compound of formula (I).
  • the invention also provides a compound of formula (I) for use in a method of treating a disease or disorder associated with a mutant form of IDH, wherein the compound of formula (I) is prepared for administration with another therapeutic agent.
  • the invention also provides another therapeutic agent for use in a method of treating a disease or disorder associated with a mutant form of IDH, wherein the other therapeutic agent is prepared for administration with a compound of formula (I).
  • the invention also provides a compound of formula (I) for use in a method of treating a disease or disorder associated with a mutant form of IDH, wherein the compound of formula (I) is administered with another therapeutic agent.
  • the invention also provides another therapeutic agent for use in a method of treating a disease or disorder associated with a mutant form of I DH, wherein the other therapeutic agent is administered with a compound of formula (I).
  • the invention also provides the use of a compound of formula (I) for treating a disease or disorder associated with a mutant form of I DH, wherein the patient has previously (e.g. within 24 hours) been treated with another therapeutic agent.
  • the invention also provides the use of another therapeutic agent for treating a disease or disorder associated with a mutant form of I DH, wherein the patient has previously (e.g. within 24 hours) been treated with a compound of formula (I).
  • the other therapeutic agent is selected from: vascular endothelial growth factor (VEGF) receptor inhibitors, topoisomerase II inhibitors, smoothen inhibitors, alkylating agents, anti-tumor antibiotics, anti-metabolites, retinoids, and other cytotoxic agents.
  • VEGF vascular endothelial growth factor
  • vascular endothelial growth factor (VEGF) receptor inhibitors include, but are not limited to, bevacizumab (sold under the trademark Avastin® by Genentech/Roche), axitinib, (A/-methyl-2-[[3-[(£)-2-pyridin-2-ylethenyl]-1 H-indazol-6- yl]sulfanyl]benzamide, also known as AG013736, and described in PCT Publication No.
  • topoisomerase I I inhibitors include but are not limited to, etoposide (also known as VP-16 and Etoposide phosphate, sold under the tradenames Toposar®, VePesid® and Etopophos®), and teniposide (also known as VM-26, sold under the tradename Vumon®).
  • etoposide also known as VP-16 and Etoposide phosphate, sold under the tradenames Toposar®, VePesid® and Etopophos®
  • teniposide also known as VM-26, sold under the tradename Vumon®
  • alkylating agents include but are not limited to, temozolomide (sold under the tradenames Temodar® and Temodal® by Schering-Plough/Merck), dactinomycin (also known as actinomycin-D and sold under the tradename Cosmegen®), melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, sold under the tradename Alkeran®), altretamine (also known as hexamethylmelamine (HMM), sold under the tradename Hexalen®), carmustine (sold under the tradename BiCNU®), bendamustine (sold under the tradename Treanda®), busulfan (sold under the tradenames Busulfex® and Myleran®), carboplatin (sold under the tradename Paraplatin®), lomustine (also known as CCNU, sold under the tradename CeeNU®), cisplatin (also known as CDDP, sold under the tradenames P
  • anti-tumor antibiotics include, but are not limited to, doxorubicin (sold under the tradenames Adriamycin® and Rubex®), bleomycin (sold under the tradename lenoxane®), daunorubicin (also known as dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, sold under the tradename Cerubidine®), daunorubicin liposomal (daunorubicin citrate liposome, sold under the tradename DaunoXome®), mitoxantrone (also known as DHAD, sold under the tradename Novantrone®), epirubicin (sold under the tradename EllenceTM), idarubicin (sold under the tradenames Idamycin®, Idamycin PFS®), and mitomycin C (sold under the tradename Mutamycin®).
  • doxorubicin sold under the tradenames Adriamycin® and Rubex®
  • bleomycin sold under the trade
  • anti-metabolites include, but are not limited to, claribine (2- chlorodeoxyadenosine, sold under the tradename leustatin®), 5-fluorouracil (sold under the tradename Adrucil®), 6-thioguanine (sold under the tradename Purinethol®), pemetrexed (sold under the tradename Alimta®), cytarabine (also known as arabinosylcytosine (Ara-C), sold under the tradename Cytosar-U®), cytarabine liposomal (also known as Liposomal Ara-C, sold under the tradename DepoCytTM), decitabine (sold under the tradename Dacogen®), hydroxyurea (sold under the tradenames Hydrea®, DroxiaTM and MylocelTM), fludarabine (sold under the tradename Fludara®), floxuridine (sold under the tradename FUDR®), cladribine (also known as 2-ch
  • retinoids examples include, but are not limited to, alitretinoin (sold under the tradename Panretin®), tretinoin (a ⁇ -trans retinoic acid, also known as ATRA, sold under the tradename Vesanoid®), Isotretinoin (13-c/s-retinoic acid, sold under the tradenames Accutane®, Amnesteem®, Claravis®, Clarus®, Decutan®, Isotane®, Izotech®, Oratane®, Isotret®, and Sotret®), and bexarotene (sold under the tradename Targretin®).
  • Panretin® tretinoin (a ⁇ -trans retinoic acid, also known as ATRA, sold under the tradename Vesanoid®)
  • Isotretinoin 13-c/s-retinoic acid
  • cytotoxic agents include, but are not limited to, arsenic trioxide (sold under the tradename Trisenox®), asparaginase (also known as L-asparaginase, and Erwinia L-asparaginase, sold under the tradenames Elspar® and Kidrolase®).
  • Trisenox® arsenic trioxide
  • asparaginase also known as L-asparaginase, and Erwinia L-asparaginase, sold under the tradenames Elspar® and Kidrolase®.
  • LCMS data (also reported herein as simply MS) were recorded using a Waters System (Acuity UPLC and a Micromass ZQ mass spectrometer; Column: Acuity HSS C18 1 .8- micron, 2.1 x 50 mm; gradient: 5-95 % acetonitrile in water with 0.05 % TFA over a 1.8 min period; flow rate 1.2 mL/min; molecular weight range 200-1500; cone Voltage 20 V; column temperature 50 °C). All masses reported are those of the protonated parent ions unless recorded otherwise.
  • HRMS Method A ESI-MS data were recorded using a Synapt G2 HDMS (TOF mass spectrometer, Waters) with electrospray ionization source. The resolution of the MS system was approximately 15000.
  • Leucine Enkephalin was used as lock mass (internal standards) infused from lockspary probe. The compound was infused into the mass spectrometer by UPLC (Acquity, Waters) from sample probe. The separation was performed on Acquity UPLC BEH C18 1x50 mm column at 0.2 mL/min flow rate with the gradient from 5% to 95% in 3 min.
  • Solvent A was Water with 0.1 % Formic Acid and solvent B was Acetonitrile with 0.1 % Formic Acid. The mass accuracy of the system has been found to be ⁇ 5 ppm with lock mass.
  • HRMS methods A and B are referred to throughout as HRMS(A) or HRMS(B), respectively.
  • the reaction mixture was stirred at 4 °C for 15 min, warmed up to room temperature and stirred for an additional 1 h.
  • the mixture was treated with saturated NH 4 CI (25 mL), followed by CH2CI2 (50 mL) and the resulting mixture was stirred for 20 min.
  • the layers were separated and the organic layer was washed with water.
  • the combined aqueous layers were extracted with CH2CI2 (50 mL).
  • the combined organic layers were dried over Na2S04, filtered and concentrated to give (R)-4-isobutyloxazolidin-2-one (3.22 g) in 88% yield.
  • the crude product was used for the next reaction without purification.
  • Step 1 Preparation of 4-(amino(phenyl)methyl)tetrahydro-2H-pyran-4-ol
  • the milky white mixture was extracted with DCM (1x), ethyl acetate/THF (1 :1 ; 1x) and ethyl acetate (2x).
  • the organic layers (DCM and ethyl acetate solutions independently) were washed with saturated aqueous NaHC03 solution, dried over Na2S04, filtered off and concentrated under reduced pressure providing crude 4-(amino(phenyl)methyl)tetrahydro-2H-pyran-4-ol, which was directly used in the next reaction without further purification.
  • Step 2 Preparation of 4-phenyl-1 ,8-dioxa-3-azaspiro[4.5]decan-2-one
  • Step 2 Preparation of (S)-tert-butyl 1 -(biphenyl-4-yl)-2-hydroxyethylcarbamate
  • Step 1 Preparation of Methyl 2-(tert-butoxycarbonylamino)-2-methylpropanoate
  • 2-(tert-butoxycarbonylamino)-2-methylpropanoic acid 10.03 g, 49.4 mmol
  • MeOH/DCM 60mL/140ml_
  • Trimethylsilyl trimethylsilyl
  • the reaction mixture was stirred for 30 minutes.
  • Acetic acid was added drop wise to quench (trimethylsilyl)diazomethane.
  • the reaction mixture was concentrated under reduced pressure to afford the desired product as a white solid (10.56 g).
  • Step 2 Preparation of tert-butyl 3-hydroxy-2,3-dimethylbutan-2-ylcarbamate
  • the capped tube was heated to 100°C for 16 h. After cooling the reaction mixture was diluted with EtOAc (10 mL) and washed with water (10 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 10 mL). Combined organics were dried over Na2S04, filtered and concentrated. The crude material was purified through silica gel column chromatography (EtOAc in Heptane 12 to 100%) to give a white solid (50 mg, 49.3% yield).
  • the vial was sealed, evacuated and purged with dry nitrogen three times before adding dioxane (1 .6 mL).
  • the reaction mixture was heated to 100°C for 16 hours in an oil bath. After cooling the reaction was diluted with EtOAc (10 mL) and washed with water (10 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 10 mL). Combined organics were dried over Na2S04, filtered and concentrated.
  • the crude material was purified through silica gel column chromatography (EtOAc in Heptane 12 to 100%) to give a white solid (65 mg, 58.9% yield).
  • DavePhos ligand [2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl] (59 mg, 0.15 mmol), and Pd(OAc)2 (17 mg, 0.075 mmol) in 6 mL toluene was heated at 100°C for 1 h. The mixture was cooled to room temperature, and filtered through Celite. Filter cake was rinsed with 30 mL EtOAc. The filtrate was poured into 20 mL water. Layers were separated, and the aqueous was further extracted with EtOAc (20 mL).
  • Step 1 A solution of 1 -(5-fluoropyrimidin-2-yl)ethanone (700 mg, 5.0 mmol) and 4- fluorophenol (616 mg, 5.50 mmol) in 6 mL DMF was treated with potassium carbonate (829 mg 6.0 mmol) and heated to 50°C for 3.5 h. The reaction mixture was poured into 20 mL water, and extracted with EtOAc (2 x 20 mL). Organics were washed with 20 mL each water, brine, and dried over Na2S04. Mixture was filtered and concentrated on silica gel.
  • Step 2 1-(5-(4-fluorophenoxy)pyrimidin-2-yl)ethanone (290 mg, 1.25 mmol), NH40Ac (1.9 g, 24.6 mmol), and NaBH 3 CN (314 mg, 5.00 mmol) were taken up in 20 mL 200 proof EtOH, and heated at 130 C for 3 minutes in a microwave apparatus. The mixture was concentrated to remove the EtOH. Crude was taken up in 30 ml water + 25 mL EtOAc. 6N NaOH was added until aqueous pH was -10. Separated layers, and extracted aqueous with EtOAc (25 ml).
  • Step 1 Preparation of tert-butyl 1 -(methoxy(methyl)amino)-2-methyl-1 -oxopropan- 2-yl carbamate
  • Step 2 Preparation of (S)-tert-butyl 2-methyl-4-oxopentan-3-ylcarbamate
  • THF 100 ml.
  • methyl lithium 1.071 g, 48.7 mmol
  • Cold bath was replaced with -40 °C bath (MeCN in dry ice) removed and the reaction was stirred for 4 hours.
  • Saturated NH 4 CI solution (10ml_) was then added cautiously to quench the reaction.
  • Step 1 Preparation of tert-butyl 1 -(methoxy(methyl)amino)-2-methyl-1 -oxopropan- 2-ylcarbamate
  • Step 2 Preparation of (S)-tert-butyl (1 -cyclopropyl-2-hydroxyethyl)carbamate
  • LiBH 4 LiBH 4
  • methanol methanol
  • Step 3 To a microwave vial with stir bar was added (R)-N-((S)-1-(4-bromo-2-fluorophenyl)ethyl)- 2-methylpropane-2- (1 g, 3.10 mmol), isopropenyl boronic acid pinacol ester (1.51 ml, 8.07 mmol), DME (8 ml), sodium carbonate (7.76 ml, 15.5 mmol) (2.0 M aq) and PdCI 2 (dppf). CH2CI2 adduct (0.127 g, 0.155 mmol). Vessel was capped and heated by microwave irradiation for 20 min at 100 °C. Reaction mixture was diluted with a saturated solution of NH 4 CI.
  • Reaction mixture was cooled to 0 °C whereupon a second addition of diethylzinc (1.0M in hexanes) (13.1 mL, 13.1 mmol) took place followed by the addition of chloroiodomethane (0.95 mL, 13.1 mmol).
  • Reaction mixture allowed to warm to room temperature and stirred 18 hours under argon.
  • Reaction mixture was cooled to 0 °C in a ice bath and to the cold reaction mixture was slowly added a saturated solution of NH 4 CI.
  • the aqueous mixture was extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated onto silica gel.
  • 1 ,2-dibromoethane (0.1 1 ml, 1.22 mmol) and tetrabutylammonium bromide (19 mg, 0.06 mmol) were added and reaction mixture allowed to stir an additional 18 hours.
  • a third addition of 1 ,2-dibromoethane (0.1 1 ml, 1 .22 mmol) was added and the reaction mixture heated to 50 °C for an additional 18 hours in a preheated aluminum tray.
  • the reaction mixture was quenched with a saturated solution of NH 4 CI and the aqueous mixture extracted with EtOAc. Organics combined and washed twice with water, brine, dried (Na2S04), filtered and concentrated.
  • Step 2 To a solution of (R,E)-N-(2-fluoro-4-(trifluoromethyl)benzylidene)-2-methylpropane-2- sulfinamide (7.3 g, 24.7 mmol) in CH2CI2 (247 mL) cooled to 0°C (water/ice bath) under nitrogen, was added 3M methyl magnesium bromide (33 mL, 99 mmol) in Et 2 0. Reaction mixture allowed to stir for 30 min at 0°C, then gradually allowed to warm to room temperature and stirred for 1 hour at room temperature. Reaction mixture was cooled to 0°C then quenched with the slow addition of a saturated solution of NH 4 CI. Aqueous mixture extracted with EtOAc.
  • Step 1 To a round bottom flask with stir bar was added 4-((S)-1 aminoethyl-2-chlorobenzoic acid HCI salt (1.05 g, 4.45 mmol) followed by the addition of THF (40 ml_). To this solution was added DIEA (1 .86 ml, 10.7 mmol). The reaction mixture becomes cloudy white followed by the addition of di-tert-butyl dicarbonate (1 .07 g, 4.89 mmol). Resulting reaction mixture allowed to stir for 18 hours at room temperature. At which time the reaction mixture was then heated to 60 °C for 2 hours in a oil bath.
  • Step 1 Mitsunobu A
  • Step 1 Mitsunobu B
  • Step 1 Preparation of 1 -bromo-4-(difluoromethyl)-2-fluorobenzene
  • Step 3 Preparation of (R,E)-N-(4-(difluoromethyl)-2-fluorobenzylidene)-2- methylpropane-2-sulfinamide
  • Step 2 Preparation of (R,E)-2-methyl-N-(4-(pyrimidin-5- yloxy)benzylidene)propane-2-sulfinamide
  • Step 3 Preparation of 2-methyl-N-((S)-1 -(4-(pyrimidin-5- yloxy)phenyl)ethyl)propane-2-sulfinamide
  • the suspension was stirred for -3 hour while slowly warming to -20 °C.
  • the mixture was cooled to --40 °C, and additional methylmagnesium bromide (3M in diethylether; 0.4mL) was added.
  • the suspension was stirred for 30 min and allowed to warm to -10 °C.
  • the mixture was quenched slowly over 10 min with saturated aqueous NH 4 CI solution (10 mL).
  • the mixture was diluted with saturated aqueous NH 4 CI solution (30 mL) and water (15 mL).
  • the separated aqueous phase was extract with DCM (2x 75 mL).
  • the combined organic layers were washed with brine (50 mL), dried over Na2S04, filtered off and concentrated under reduced pressure.
  • Step 4 Preparation of (S)-1 -(4-(pyrimidin-5-yloxy)phenyl)ethanamine To 2-methyl-N-((S)-1-(4-(pyrimidin-5-yloxy)phenyl)ethyl)propane-2-sulfinamid (55 mg, 0.172 mmol) was added 4M HCI in dioxane (800 ⁇ _, 3.20 mmol) to give a white suspension. This resulting mixture was stirred at room temperature for -35 min and concentrated under reduced pressure to provide crude (S)-1-(4-(pyrimidin-5- yloxy)phenyl)ethanamine (44 mg) as its HCI salt, which was used without further purification. LCMS m/z 217.1 (M + H) + , Rt 0.37 min.
  • Step 1 Preparation of ethyl 5,6-dichloronicotinate
  • Step 3 Preparation of ethyl 5-chloro-6-(1 ,1 -difluoroethyl)nicotinate
  • Step 4 Preparation of (5-chloro-6-(1 ,1 -difluoroethyl)pyridin-3-yl)methanol
  • Step 5 Preparation of 5-chloro-6-(1 ,1 -difluoroethyl)nicotinaldehyde
  • Step 1 Preparation of ethyl 5-chloro-6-(2,2,2-trifluoroethoxy)nicotinate

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)
  • Nitrogen Condensed Heterocyclic Rings (AREA)
  • Epidemiology (AREA)
  • Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention is directed to a compound of formula (I) or a pharmaceutically acceptable salt thereof, wherein R1-R6 are defined herein. The invention is also directed to compositions containing a compound of formula (I) and to the use of such compounds in the inhibition of mutant IDH proteins having a neomorphic activity. The invention is further directed to the use of a compound of formual (I) in the treatment of diseases or disorders associated with such mutant IDH proteins including, but not limited to, cell-proliferation disorders, such as cancer.

Description

3-PYRIMIDIN-4-YL-OXAZOLIDIN-2-ONES AS INHIBITORS OF MUTANT IDH
FIELD OF THE INVENTION
The present invention is directed to novel 3-pyrimidinyl-4-yl-oxazolidin-2-one compounds, compositions containing these compounds, the use of such compounds in the inhibition of mutant IDH proteins having a neomorphic activity and in the treatment of diseases or disorders associated with such mutant IDH proteins including, but not limited to, cell-proliferation disorders, such as cancer. BACKGROUND OF THE INVENTION
Isocitrate dehydrogenase (IDH) is a key family of enzymes found in cellular metabolism. They are NADP+ / NAD+ and metal dependent oxidoreductases of the enzyme class EC 1 .1 .1.42. The wild type proteins catalyze the oxidative decarboxylation of isocitrate to alpha-ketoglutarate generating carbon dioxide and NADPH / NADH in the process. They are also known to convert oxalosuccinate into alpha-ketoglutarate. Mutations in IDH1 (cytosolic) and IDH2 (mitochondrial) have been identified in multiple cancer types including, but not limited to, glioma, glioblastoma multiforme, paraganglioma, supratentorial primordial neuroectodermal tumors, acute myeloid leukemia (AML), prostate cancer, thyroid cancer, colon cancer, chondrosarcoma, cholangiocarcinoma, peripheral T-cell lymphoma, and melanoma. (See L. Deng et al., Trends Mol. Med., 2010, 16, 387; T. Shibata et al., Am. J. Pathol., 201 1 , 178(3), 1395; Gaal et al., J. Clin. Endocrinol. Metab. 2010; Hayden et al., Cell Cycle, 2009; Balss et al., Acta Neuropathol., 2008). The mutations have been found at or near key residues in the active site: G97D, R100, R132, H133Q, and A134D for IDH1 , and R140 and R172 for IDH2. (See L. Deng et al., Nature, 2009, 462, 739; L. Sellner et al., Eur. J. Haematol., 201 1 , 85, 457).
These mutant forms of IDH are shown to have a neomorphic activity (also known as a gain of function activity), reducing alpha-ketoglutarate to 2-hydroxyglutarate (2-HG). (See P.S. Ward et al., Cancer Cell, 2010, 17, 225) In general, production of 2-HG is enantiospecific, resulting in generation of the D-enantiomer (also known as R enantiomer or R-2-HG). Normal cells have low native levels of 2-HG, whereas cells harboring these mutations in IDH1 or IDH2 show significantly elevated levels of 2-HG. High levels of 2- HG have been detected in tumors harboring the mutations. For example, high levels of 2- HG have been detected in the plasma of patients with mutant IDH containing AML. (See S. Gross et al., J. Exp. Med., 2010, 207(2), 339). High levels of 2-HG are highly associated with tumorigenesis. Mutant IDH2 is also associated with the rare neurometabolic disorder D-2- hydroxyglutaric aciduria type II (D-2-HGA type II). Germline mutations were found at R140 in IDH2 in 15 pateints having D-2-HGA type II. Patients having this disorder also have consistently increased levels of D-2-HG in their urine, plasma and cerebrospinal fluid. (See Kranendijk, M. et al., Science, 2010, 330, 336). Finally, patients with Oilier Disease and Mafucci Syndrome (two rare disorders that predispose to cartilaginous tumors) have been shown to be somatically mosaic for IDH1 and 2 mutations and exhibit high levels of D-2-HG. (See Amary et al., Nature Genetics , 201 1 and Pansuriya et al., Nature Genetics, 201 1 ).
Thus, there is a need for small molecule inhibitors of mutant IDH proteins having a neomorphic activity for the treatment of diseases and disorders associated with these proteins.
SUMMARY OF THE INVENTION
In one aspect, this invention provides for a compound of formula (I)
Figure imgf000004_0001
or a pharmaceutically acceptable salt thereof, wherein R^-R^ are defined herein.
In a second aspect, this invention provides for a pharmaceutical composition comprising a compound of formula (I), or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient.
In a third aspect, this invention provides for the use of a compound of formula (I), or a pharmaceutically acceptable salt thereof, as an inhibitor of a mutant IDH protein having a neomorphic activity such as reducing alpha-ketoglutarate to 2-hydroxyglutarate (2-HG neomorphic activity). Suitably, this invention provides for the use of a compound of formula (I), or a pharmaceutically acceptable salt thereof, as an inhibitor of mutant IDH1 having a neomorphic activity, such as 2-HG neomorphic activity, and/or mutant IDH2 having a neomorphic activity, such as 2-HG neomorphic activity. This invention further provides for the use of a compound of formula (I), or a pharmaceutically acceptable salt thereof, as an inhibitor of IDH1 having a mutation at residue 97, 100 or 132, for example G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V; and/or an inhibitor of I DH2 having a mutation at residue 140 or 172, for example R172K, R172M, R172S, R172G, and R172W.
In a fourth aspect, this invention provides for a method of treating a disease or disorder associated with a mutant I DH protein having a neomorphic activity comprising administration of an effective amount of a compound according to formula (I), or a pharmaceutically acceptable salt thereof, to a subject in need thereof. In one embodiment, the disease or disorder is a cell proliferation disorder, such as cancer. In another embodiment, the cancer is brain cancer, such as glioma, glioblastoma multiforme, paraganglioma, and supratentorial primordial neuroectodermal tumors (pNET); leukemia, such as acute myeloid leukemia (AML), myelodysplastic syndrome, and chronic myelogenous leukemia (CML); skin cancer, including melanoma; prostate cancer; thyroid cancer; colon cancer; lung cancer; sarcoma, including central chondrosarcoma, central and periosteal chondroma; and fibrosarcoma. In another embodiment the disease or disorder is D-2-hydroxyglutaric aciduria.
In a fifth aspect the invention provides for a compound of formula (I), or a pharmaceutically acceptable salt thereof, in combination with another therapeutic agent.
These and other aspects of the present invention are described further in the following detailed description of the invention. DETAI LED DESCRI PTION OF THE I NVENTION
The present invention is directed to a compound of formula (I)
A compound of formula (I)
Figure imgf000005_0001
wherein:
R and R2 are each independently hydrogen, deuterium, halo, hydroxyl, NH2, aryl, heteroaryl, or optionally substituted C-1.4 alkyl,
wherein said C-1.4 alkyl is optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, and NH2; R^A is hydrogen, deuterium, C-|.g alkyl, phenyl, or benzyl and
R3b is hydrogen, deuterium, or C-|.g alkyl; or
R^A and R3b are joined together forming an optionally substituted 3-7 membered cycloalkyi ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyi and heterocyclic rings are each optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl;
R4a is hydrogen, C-|.g alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene,
wherein said phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.4 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-|.g alkyl,
C3_g cycloalkyi, phenyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy, -COORB, -S02RB, -NHC(0)RB, and -NRBRB and
R^b js hydrogen, deuterium, or C-1.3 alkyl; or
R4A and R4B are joined together forming an optionally substituted 3-7 membered cycloalkyi ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyi and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl,
provided that only one of R^A and R3D and R4A and R4B are joined together forming a ring;
R5a js hydrogen or deuterium;
R5b js hydrogen, deuterium, methyl, ethyl, CD3, CF3, CH2F, or CHF2 and
R6 is optionally substituted C-|.g alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclic, or optionally substituted C3.-10 cycloalkyi, wherein said C-|.g alkyl is optionally substituted with one substituent selected from the group consisting of hydroxyl, C-1.3 alkoxy and -ORA,
wherein said aryl, heteroaryl, heterocyclic and C3.-10 cycloalkyi are optionally substituted with one to three substituents each independently selected from the group consisting of: halo; hydroxyl; cyano; nitro; C-1.4 alkoxy; C-1.3 haloalkyi; C-1.3 haloalkoxy;
C-| _5 alkyl; C3_g cycloalkyi optionally substituted with one to three substituents each independently selected from the group consisting of: hydroxyl, cyano, C-1.3 alkyl, C-1.3 alkoxy, and C-1.3 haloalkyi; phenyl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-| _3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-| .g alkyl, C3_g cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy, -COORb, -SC>2 b, -NHC(0)Rb, and
-NRbRb; 5-6 membered heteroaryl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, C-1.3 alkyl, C-1.3 alkoxy; 5-6 membered heterocyclic optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-| _3 alkyl; -CH2Ra; -ORa; -C(0)Ra; -NRaRb; -COORa; -S02Ra;
-S02Rb; NHC(0)Ra; -NHC(0)Rb; -C(0)NRaRb; -C(0)N HRb; and -S02NRbRb; or R5b and R6 are joined together forming an optionally substituted C3.7 cycloalkyi group
Figure imgf000007_0001
or an optionally substituted group of formula (a): (a),
wherein n is 1 , 2, or 3 and
said C3.7 cycloalkyi and group of formula (a) are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-| _g alkyl, C3_g cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, benzyloxy, -COORb, -S02Rb, -NHC(0)Rb, and -NRbRb; each Ra is independently optionally substituted phenyl, optionally substituted heteroaryl, optionally substituted heterocyclic, or optionally substituted C3.7 cycloalkyi,
wherein said phenyl and heteroaryl are optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, and C-1.3 alkyl,
wherein said heterocyclic is optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-1.4 alkyl, C3.5 cycloalkyl, -C(0)R'3, and -NRbRb; and
wherein said C3.7 cycloalkyl is optionally substituted with one to three
substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-| _3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl; and each Rb is independently hydrogen or C-| .g alkyl.
"Alkyl" refers to a monovalent saturated hydrocarbon chain having the specified number of carbon atoms. For example, C-| .g alkyl refers to an alkyl group having from 1 to 6 carbon atoms. Alkyl groups may be optionally substituted with one or more substituents as defined in formula (I). Alkyl groups may be straight or branched. Representative branched alkyl groups have one, two, or three branches. Examples of alkyl groups include, but are not limited to, methyl, ethyl, propyl (n-propyl and isopropyl), butyl (n-butyl, isobutyl, sec-butyl, and t-butyl), pentyl (n-pentyl, isopentyl, and neopentyl), and hexyl.
"Alkoxy" refers to any alkyl moiety attached through an oxygen bridge (i.e. a -O-
C-| _3 alkyl group wherein C-1.3 alkyl is as defined herein). Examples of such groups include, but are not limited to, methoxy, ethoxy, and propoxy.
"Aryl" refers to a hydrocarbon ring system having an aromatic ring. Aryl groups are monocyclic ring systems or bicyclic ring systems. Monocyclic aryl ring refers to phenyl. Bicyclic aryl rings refer to naphthyl and to rings wherein phenyl is fused to a C5.
7 cycloalkyl or C5.7 cycloalkenyl ring as defined herein. Aryl groups may be optionally substituted with one or more substituents as defined in formula (I).
"Cycloalkyl" refers to a saturated hydrocarbon ring system having the specified number of carbon atoms. Cycloalkyl groups are monocyclic or bicyclic ring systems. For example, C .10 cycloalkyl refers to a cycloalkyl group having from 5 to 10 carbon atoms.
Cycloalkyl groups may be optionally substituted with one or more substituents as defined in formula (I). Examples of cycloalkyl groups include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and adamantanyl.
"Cycloalkenyl" refers to an unsaturated hydrocarbon ring system having the specified number of carbon atoms and having a carbon-carbon double bond within the ring. For example, C5.7 cycloalkenyl refers to a cycloalkenyl group having from 5 to 7 carbon atoms. In certain embodiments, cycloalkenyl groups have one carbon-carbon double bond within the ring. In other embodiments, cycloalkeneyl groups have more than one carbon-carbon double bond within the ring. Cycloalkenyl rings are not aromatic. Cycloalkenyl groups may be optionally substituted with one or more substituents as defined in formula (I).
"Halo" refers to the halogen radicals fluoro, chloro, bromo, and iodo.
"Haloalkyi" refers to an alkyl group wherein at least one hydrogen atom attached to a carbon atom within the alkyl group is replaced with halo. The number of halo substituents includes, but is not limited to, 1 , 2, 3, 4, 5, or 6 substituents. Haloalkyi includes, but is not limited to, monofluoromethyl, difluoroethyl, and trifluoromethyl.
"Haloalkoxy" refers to a haloalkyi moiety attached through an oxygen bridge (i.e. a -0-C-|_3 haloalkyi group wherein C-1.3 haloalkyi is as defined herein). An example ofa haloalkoxy group is trifluoromethoxy.
"Heteroaryl" refers to an aromatic ring system containing from 1 to 5 heteroatoms. Heteroaryl groups containing more than one heteroatom may contain different heteroatoms. Heteroaryl groups may be optionally substituted with one or more substituents as defined in formula (I). Heteroaryl groups are monocyclic ring systems or are fused bicyclic ring systems. Monocyclic heteroaryl rings have from 5 to 6 ring atoms. Bicyclic heteroaryl rings have from 8 to 10 member atoms. Bicyclic heteroaryl rings include those ring systems wherein a heteroaryl ring is fused to a phenyl ring. Heteroaryl includes, but is not limited to, pyrrolyl, pyrazolyl, imidazolyl, oxazolyl, isoxazolyl, oxadiazolyl (including 1 ,3,4-oxadiazolyl and 1 ,2,4-oxadiazolyl), thiazolyl, isothiazolyl, thiadiazolyl, furanyl, furanzanyl, thienyl, triazolyl, pyridinyl (including 2-, 3-, and 4- pyridinyl), pyrimidinyl, pyridazinyl, pyrazinyl, trazinyl, tetrazinyl, tetrzolyl, indonyl, isoindolyl, indolizinyl, indazolyl, purinyl, quinolinyl, isoquinolinyl, quinoxalinyl, quinazolinyl, benzimidazolyl, benzopyranyl, benzopyranyl, benzoxazolyl, benzoisoxazolyl, benzofuranyl, benzothiazolyl, benzothienyl, naphthyridinyl, 1 H- pyrrolo[2,3-b]pyridinyl, tetrazolo[1 ,5-a]pyridinyl, imidazo[2, 1-b][1 ,3,4]thiadiazolyl and the like.
"Heteroatom" refers to a nitrogen, oxygen, or sulfur atom.
"Heterocyclic" refers to a 3 to 1 1 membered saturated or unsaturated monocyclic or bicyclic ring containing from 1 to 4 heteroatoms. Heterocyclic ring systems are not aromatic. Heterocyclic groups containing more than one heteroatom may contain different heteroatoms. Heterocyclic includes ring systems wherein a sulfur atom is oxidized to form SO or S02- Heterocyclic groups may be optionally substituted with one or more substituents as defined in formula (I). Heterocyclic groups are monocyclic, spiro, or fused or bridged bicyclic ring systems. Monocyclic heterocyclic rings have 3 to 7 ring atoms. Examples of monocyclic heterocyclic groups include oxtanyl, tetrahydrofuranyl, dihydrofuranyl, 1 ,4-dioxanyl, morpholinyl, 1 ,4-dithianyl, piperazinyl, piperidinyl, 1 ,3- dioxolanyl, imidazolidinyl, imidazolinyl, pyrrolinyl, pyrrolidinyl, tetrahydropyranyl, dihydropyranyl, oxathiolanyl, dithiolanyl, 1 ,3-dioxanyl, 1 ,3-dithianyl, oxathianyl, thiomorpholinyl, tetrahydro-thiopyran 1 , 1 -dioxide, 1 ,4-diazepanyl, and the like. Fused heterocyclic ring systems have from 8 to 1 1 ring atoms and include groups wherein a heterocyclic ring is fused to a phenyl ring, a heteroaryl ring or another heterocyclic ring. Examples of fused heterocyclic rings include 2,3-dihydrobenzo[b][1 ,4]dioxinyl, octahydro- pyrrolo[1 ,2-a]pyrazinyl, octahydro-pyrido[1 ,2-a]pyrazinyl, octahydro-pyrrolo[3,4-c]pyrrolyl, 5,6,7,8-tetrahydro-[1 ,2,4]triazolo[4,3-a]pyrazinyl, 5,6,7,8-tetrahydro-imidazo[1 ,2- a]pyrazinyl and the like. Examples of bridged heterocyclic groups include 3,8-diaza- bicyclo[3.2.1]octanyl, 3,8-diaza-bicyclo[4.2.0]octanyl and the like. Examples of spiro heterocyclic groups include 4,7-diaza-spiro[2.5]octanyl and the like.
"4-7 membered heterocyclic" refers to a heterocyclic group as defined above, having from 4 to 7 ring atoms and containing from 1 to 4 heteroatoms.
"5-6 membered heterocylic" refers to a heterocyclic group as defined above, having 5 or 6 ring atoms and containing from 1 to 4 heteroatoms.
"Optionally substituted" indicates that a group, such as an alkyl, cycloalkyl, heteroaryl, heterocyclic, phenyl, and benzyl may be unsubstitued or the group may be substituted with one or more substituents as defined in formula (I).
"Oxo" refers to a C=0 group.
"Pharmaceutically acceptable" means a compound which is suitable for pharmaceutical use. Salts and solvates (e.g. hydrates and hydrates of salts) of compounds of the invention which are suitable for use in medicine are those where in the counterion or associated solvent is pharmaceutically acceptable. However, salts and solvates having non-pharmaceutically acceptable counterions or associated solvents are within the scope of the present invention, for example, for use as intermediates in the preparation of other compounds of the invention and their pharmaceutically acceptable salts and solvates.
"Substituted" in reference to a group such as alkyl, phenyl, benzyl, heteroaryl, and heterocyclic, indicates that one or more hydrogen atoms attached to an atom within the group is replaced with a substituent selected from the group of defined substituents. It should be understood that the term "substituted" includes the implicit provision that such substitution be in accordance with permitted valence of the substituted atom and the substituent, and that the substitution results in a stable compound (i.e. one that does not spontaneously undergo transformation, for example, by hydrolysis, rearrangement, cyclization, or elimination and that is sufficiently robust to survive isolation from a reaction mixture). When it is stated that a group may contain one or more substituents, one or more (as appropriate) atoms within the group may be substituted. In addition, a single atom within the group may be substituted with more than one substituent as long as such substitution is accordance with the permitted valence of the atom. Suitable substituents are defined for each substituted or optionally substituted group.
The skilled artisan will appreciate that salts, including pharmaceutically acceptable salts, of the compounds according to formula (I) may be prepared. These salts may be prepared in situ during the final isolation and purification of the compound, or by separately reacting the purified compound in its free acid or free base form with a suitable base or acid, respectively.
Pharmaceutically acceptable acid addition salts can be formed with inorganic acids and organic acids, e.g., acetate, aspartate, benzoate, besylate, bromide/hydrobromide, bicarbonate/carbonate, bisulfate/sulfate, camphorsulfonate, chloride/hydrochloride, chlortheophyllonate, citrate, ethandisulfonate, fumarate, gluceptate, gluconate, glucuronate, hippurate, hydroiodide/iodide, isethionate, lactate, lactobionate, laurylsulfate, malate, maleate, malonate, mandelate, mesylate, methylsulphate, naphthoate, napsylate, nicotinate, nitrate, octadecanoate, oleate, oxalate, palmitate, pamoate, phosphate/hydrogen phosphate/dihydrogen phosphate, polygalacturonate, propionate, stearate, succinate, subsalicylate, tartrate, tosylate and trifluoroacetate salts.
Inorganic acids from which salts can be derived include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
Organic acids from which salts can be derived include, for example, acetic acid, propionic acid, glycolic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, toluenesulfonic acid, sulfosalicylic acid, and the like. Pharmaceutically acceptable base addition salts can be formed with inorganic and organic bases.
Inorganic bases from which salts can be derived include, for example, ammonium salts and metals from columns I to XII of the periodic table. In certain embodiments, the salts are derived from sodium, potassium, ammonium, calcium, magnesium, iron, silver, zinc, and copper; particularly suitable salts include ammonium, potassium, sodium, calcium and magnesium salts.
Organic bases from which salts can be derived include, for example, primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, basic ion exchange resins, and the like. Certain organic amines include isopropylamine, benzathine, cholinate, diethanolamine, diethylamine, lysine, meglumine, piperazine and tromethamine. The pharmaceutically acceptable salts of the present invention can be synthesized from a basic or acidic moiety, by conventional chemical methods. Generally, such salts can be prepared by reacting free acid forms of these compounds with a stoichiometric amount of the appropriate base (such as Na, Ca, Mg, or K hydroxide, carbonate, bicarbonate or the like), or by reacting free base forms of these compounds with a stoichiometric amount of the appropriate acid. Such reactions are typically carried out in water or in an organic solvent, or in a mixture of the two. Generally, use of non-aqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile is desirable, where practicable. Lists of additional suitable salts can be found, e.g., in "Remington's Pharmaceutical Sciences", 20th ed., Mack Publishing Company, Easton, Pa., (1985); and in "Handbook of Pharmaceutical Salts: Properties, Selection, and Use" by Stahl and Wermuth (Wiley-VCH, Weinheim, Germany, 2002).
Solvates, including pharmaceutically acceptable solvates, of the compounds of formula (I) may also be prepared. "Solvate" refers to a complex of variable stoichiometry formed by a solute and solvent. Such solvents for the purpose of the invention may not interfere with the biological activity of the solute. Examples of suitable solvents include, but are not limited to, water, MeOH, EtOH, and AcOH. Solvates wherein water is the solvent molecule are typically referred to as hydrates. Hydrates include compositions containing stoichiometric amounts of water, as well as compositions containing variable amounts of water.
The compounds of formula (I), including salts and solvates thereof, may exist in crystalline forms, non-crystalline forms, or mixtures thereof. The compound or salt or solvate thereof may also exhibit polymorphism, i.e. the capacity of occurring in different crystalline forms. These different crystalline forms are typically known as "polymorphs". Polymorphs have the same chemical composition but differ in packing, geometrical arrangement, and other descriptive properties of crystalline solid state. Polymorphs, therefore, may have different physical properties such as shape, density, hardness, deformability, stability, and dissolution properties. Polymorphs typically exhibit different melting points, IR spectra, and X-ray powder diffraction patterns, all of which may be used for identification. One of ordinary skill in the art will appreciate that different polymorphs may be produced, for example, by changing or adjusting the conditions used in crystallizing/recrystallizing a compound of formula (I).
The invention also includes various isomers of the compounds of formula (I). "Isomer" refers to compounds that have the same composition and molecular weight but differ in physical and/or chemical properties. The structural difference may be in constitution (geometric isomers) or in the ability to rotate the plane of polarized light (stereosiomers). With regard to stereoisomers, the compounds of formula (I) may have one or more asymmetric carbon atom and may occur as racemates, racemic mixtures and as individual enantiomers or diastereomers. All such isomeric forms are included within the present invention, including mixtures thereof. If the compound contains a double bond, the substituent may be in the E or Z configuration. If the compound contains a disubstituted cycloalkyl, the cycloalkyl substituent may have a cis- or transconfiguration. All tautomeric forms are also intended to be included.
Any asymmetric atom (e.g., carbon or the like) of a compound of formula (I) can be present in racemic or enantiomerically enriched, for example the (/?)-, (S)- or (Reconfiguration. In certain embodiments, each asymmetric atom has at least 50 % enantiomeric excess, at least 60 % enantiomeric excess, at least 70 % enantiomeric excess, at least 80 % enantiomeric excess, at least 90 % enantiomeric excess, at least 95 % enantiomeric excess, or at least 99 % enantiomeric excess in the (R)- or (S)- configuration. Substituents at atoms with unsaturated double bonds may, if possible, be present in cis- (Z)- or trans- (£)- form.
Accordingly, as used herein a compound of formula (I) can be in the form of one of the possible isomers, rotamers, atropisomers, tautomers or mixtures thereof, for example, as substantially pure geometric (cis or trans) isomers, diastereomers, optical isomers (antipodes), racemates or mixtures thereof.
Any resulting mixtures of isomers can be separated on the basis of the physicochemical differences of the constituents, into the pure or substantially pure geometric or optical isomers, diastereomers, racemates, for example, by chromatography and/or fractional crystallization.
Any resulting racemates of final products or intermediates can be resolved into the optical antipodes by known methods, e.g., by separation of the diastereomeric salts thereof, obtained with an optically active acid or base, and liberating the optically active acidic or basic compound. In particular, a basic moiety may thus be employed to resolve the compounds of the present invention into their optical antipodes, e.g., by fractional crystallization of a salt formed with an optically active acid, e.g., tartaric acid, dibenzoyl tartaric acid, diacetyl tartaric acid, di-0,0'-p-toluoyl tartaric acid, mandelic acid, malic acid or camphor-10-sulfonic acid. Racemic products can also be resolved by chiral chromatography, e.g., high pressure liquid chromatography (HPLC) using a chiral adsorbent.
The invention includes unlabeled forms as well as isotopically labeled forms of compounds of formula (I). Isotopically labeled compounds have structures depicted by the formulas given herein except that one or more atoms are replaced by an atom having a selected atomic mass or mass number. Examples of isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as 2H, 3H, 11C, 13C, 14C, 15N, 18F 31 P, 32P, 35S, 36CI, 125l respectively. The invention includes various isotopically labeled compounds as defined herein, for example those into which radioactive isotopes, such as 3H and 14C, or those into which non-radioactive isotopes, such as 2H and 13C are present. Such isotopically labelled compounds are useful in metabolic studies (with 14C), reaction kinetic studies (with, for example 2H or 3H), detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays, or in radioactive treatment of patients. In particular, an 18F or labeled compound may be particularly desirable for PET or SPECT studies. Isotopically-labeled compounds of formula (I) can generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the accompanying Examples and Preparations using an appropriate isotopically-labeled reagents in place of the non- labeled reagent previously employed.
Furthermore, substitution with heavier isotopes, particularly deuterium (i.e., 2H or
D) may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements or an improvement in therapeutic index. It is understood that deuterium in this context is regarded as a substituent of a compound of the formula (I). The concentration of such a heavier isotope, specifically deuterium, may be defined by the isotopic enrichment factor. The term "isotopic enrichment factor" as used herein means the ratio between the isotopic abundance and the natural abundance of a specified isotope. If a substituent in a compound of this invention is denoted deuterium, such compound has an isotopic enrichment factor for each designated deuterium atom of at least 3500 (52.5% deuterium incorporation at each designated deuterium atom), at least 4000 (60% deuterium incorporation), at least 4500 (67.5% deuterium incorporation), at least 5000 (75% deuterium incorporation), at least 5500 (82.5% deuterium incorporation), at least 6000 (90% deuterium incorporation), at least 6333.3 (95% deuterium incorporation), at least 6466.7 (97% deuterium incorporation), at least 6600 (99% deuterium incorporation), or at least 6633.3 (99.5% deuterium incorporation).
Representative Embodiments
Various embodiments of the invention are described herein. It will be recognized that features specified in each embodiment may be combined with other specified features to provide for further embodiments. One embodiment of the present invention is a compound according to formula (I) wherein:
each R1 and R^ is independently hydrogen, deuterium, halo, hydroxyl, NH2, aryl, heteroaryl, or optionally substituted C-1.4 alkyl,
wherein said C-1.4 alkyl is optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, and NH2;
R^a is hydrogen, deuterium, C-| .g alkyl, phenyl, or benzyl and
R3b is hydrogen, deuterium, or C-| .g alkyl; or
R^a and R3b are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyl and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C1.3 alkyl;
R4a is hydrogen, C-| .g alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene,
wherein said phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-| .g alkyl,
C3_g cycloalkyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy,
COORb, S02Rb, NHC(0)Rb, and NRbRb and
R4b is hydrogen, deuterium, or C-1.3 alkyl; or
R^a and R4b are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyl and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl,
provided that only one of R^a and R^b and R^a and R^b are joined together forming a ring;
R^a is hydrogen or deuterium; R5b is hydrogen, deuterium, methyl, ethyl, CD3, CF3, CH2F, or CHF2 and
R6 is optionally substituted C-|.g alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclic, or optionally substituted C .10 cycloalkyi, wherein said C-|.g alkyl is optionally substituted with one substituent selected from the group consisting of hydroxyl, C-1.3 alkoxy and -ORA;
wherein said aryl, heteroaryl, heterocyclic and C .10 cycloalkyi are optionally substituted with one to three substituents each independently selected from the group consisting of: halo; hydroxyl; cyano; nitro; C-1.3 alkoxy; C-1.3 haloalkyi; C-1.3 haloalkoxy;
C-|_5 alkyl; 03.5 cycloalkyi; phenyl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-|_3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-|.g alkyl, 03.5 cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy, COORB, SC>2 b, NHC(0)RB, and
NRBRB; 5-6 membered heteroaryl; 5-6 membered heterocyclic optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-| _3 alkyl; -CH2RA; -ORA; -C(0)RA; -NRARB; -COORA; -S02RA; NHC(0)RA; and -S02NRBRB; or
R5t> and R^ are joined together forming an optionally substituted C3.7 cycloalkyi group
Figure imgf000016_0001
or an optionally substituted group of formula (a): (a),
wherein n is 1 , 2, or 3 and
said C3.7 cycloalkyi and group of formula (a) are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-|.g alkyl, 03.5 cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, benzyloxy, COORB, S02RB, NHC(0)RB, and NRBRB; each RA is independently optionally substituted phenyl, optionally substituted heteroaryl, or optionally substituted 4-7 membered heterocyclic, wherein said phenyl and heteroaryl are optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl,
wherein said 4-7 membered heterocyclic is optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl; and each Rb is independently hydrogen or C-| .g alkyl. In another embodiment of the present invention R^ is hydrogen, halo, or optionally substituted C-1.4 alkyl. Suitably is hydrogen, fluoro, chloro, or methyl. In another embodiment R^ is hydrogen, fluoro or chloro. Suitably R^ is hydrogen.
In another embodiment of the present invention R2 is hydrogen, halo or optionally substituted C-1.4 alkyl. Suitably R2 is hydrogen, fluoro, chloro, or methyl. In another embodiment R2 is hydrogen or fluoro. In another embodiment of the present invention R2 is hydrogen.
In another embodiment of the present invention R^ and R2 are both hydrogen. In another embodiment of the present invention R^a is hydrogen, C<| _g alkyl, or phenyl. Suitably R^a is hydrogen, methyl, or phenyl. Suitably R^a is hydrogen or methyl. Suitably R^a is hydrogen.
In another embodiment of the present invention R3b is hydrogen or methyl. Suitably R3b is hydrogen.
In another embodiment R^a and R^b are both hydrogen.
In another embodiment of the present invention R^a and R3b are joined together forming oxetanyl or tetrahydro-2H-pyranyl.
Another embodiment of the present invention is a compound according to formula
(II).
Figure imgf000017_0001
In another embodiment of the present invention R^a is hydrogen, C-| .g alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene,
wherein said phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-| .g alkyl,
C3_g cycloalkyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy,
-COORb, -S02Rb,- NHC(0)Rb, and- NRbRb .
In another embodiment of the present invention R^a js hydrogen, C1.4 alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene. Suitably R^a is hydrogen, C-1.4 alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted pyridinyl, or methylene-dibenzene. More suitably R^a is hydrogen, methyl, isopropyl, isobutyl, t- butyl, phenyl, 4-methoxyphenyl, 4-fluorophenyl, benzyl, or methylene-dibenzene. In another embodiment R^a js hydrogen, methyl, ethyl, isopropyl, phenyl, 4-fluorophenyl, 4- methoxyphenyl, biphenyl, benzyl, or pyridinyl. Suitably R^a js isopropyl.
In another embodiment of the present invention R4b is hydrogen or methyl.
Suitably R^b js hydrogen.
In another embodiment R^a js isopropyl and R^b js methyl. In another embodiment R^a js isopropyl and R4b is hydrogen.
In another embodiment of the present invention R^a and R4b are joined together forming cyclopentyl.
Another embodiment of the present invention is a compound according to formula
(Il l)
Figure imgf000018_0001
In another embodiment of the present invention R^a js hydrogen. In another embodiment R^a js deuterium. In another embodiment of the present invention R5b is hydrogen, methyl, ethyl, or CF3. Suitably R5b is methyl.
In another embodiment of the present invention is isopropyl, optionally substituted aryl, optionally substituted pyrazolyl, optionally substituted pyridinyl, 2,3- dihydrobenzofuranyl, 2,3-dihydrobenzo[b][1 ,4]dioxinyl, or optionally substituted C .10 cycloalkyi. Suitably is isopropyl, optionally substituted phenyl, optionally substituted naphthyl, pyrazolyl, pyridinyl, 2,3-dihydrobenzofuranyl, 2,3-dihydrobenzo[b][1 ,4]dioxinyl, or C .10 cycloalkyi, wherein said phenyl and naphthyl are each optionally substituted with one to three substituents each independently selected from the group consisting of: fluoro, chloro, bromo, hydroxy, cyano, methoxy, trifluoromethyl, methyl, t-butyl, phenyl, pyrrolyl, piperidinyl, 4-methylpiperazinyl, morpholinyl, phenoxy, and -SO2NH2.
In another embodiment of the present invention R^ is optionally substituted heteroaryl, optionally substituted heterocyclic or optionally substituted C .10 cycloalkyi.
In another embodiment of the present invention R^ is methyl, C .10 cycloalkyi, optionally substituted phenyl, optionally substituted pyridinyl, optionally substituted pyrimidinyl, optionally substituted pyridazinyl, optionally substituted pyrazinyl, optionally substituted triazolyl, optionally substituted pyrazolyl, optionally substituted thiazolyl, optionally substitued 1 ,3,4-oxadiazolyl, optionally substituted 1 ,2,4-oxadiazolyl, optionally substitued isoxazolyl, thienyl, oxazolyl, quinolinyl, optionally substituted benzimidazolyl, benzthiazolyl, benzoxazolyl, tetrazolo[1 ,5-a]pyridinyl, imidazo[2, 1 -b][1 ,3,4]thiadiazolyl, optionally substituted piperidinyl, optionally substituted piperazinyl, tetrahydrofuranyl, tetrahydropyranyl, optionally substituted tetrahydro-thiopyran 1 , 1 -dioxide, 1 H-pyrrolo[2,3- b]pyridinyl, 2,3-dihydro-benzo[1 ,4]dioxinyl, 5,6,7,8-tetrahydro-[1 ,2,4]trazolo[4,3- a]pyrazinyl, 4,5,6,7-tetrahydro-benzothiazolyl, or indolizinyl, wherein said phenyl, pyridinyl, pyrimidinyl, pyridazinyl, pyrazinyl, triazolyl, pyrazolyl, thiazolyl, 1 ,3,4- oxadiazolyl, 1 ,2,4-oxadiazolyl, isoxazolyl, benzimidazolyl, piperidinyl, piperazinyl, and tetrahydro-thiopyran1 , 1 -dioxide are each optionally substituted with one or two substituents as defined in formula (I). Suitably R^ is phenyl optionally substituted with one or two substituents. Suitably R^ is optionally substituted 1 ,3,4-oxadiazolyl or 1 ,2,4- optionally substituted oxadiazolyl. Suitably R6 is pyrimidinyl optionally substituted with one substituent.
In another embodiment R^ is optionally substituted with one or two substituents each independently selected from the group consisting of: halo; hydroxy; nitro; C-1.4 alkoxy; C-1.3 haloalkyl; C-1.3 haloalkoxy; C-| .g alkyl; 03.5 cycloalkyi optionally substituted with one substituent selected from the group consisting of: cyano, C-1.3 alkyl, and C-1.3 alkoxy; phenyl optionally substituted with one or two substituents each independently selected from the group consisting of: fluoro, chloro, methyl, cyano, and methoxy; and 5- 6 membered heteroaryl (for example, imidazolyl, pyrazolyl, trazolyl, and pyridinyl) optionally substituted with one or two methyl groups.
In another embodiment is substituted with one -CH2 a, -C(0)Ra, -NHC(0)Ra, -NHC(0)Rb, -C(0)NHRa, -C(0)NHRb, -ORa, -NRaRb, -S02NRbRb, -S02Ra, or -SC>2Rb group. Suitably R6 is substituted with one -CH2Ra, -C(0)Ra, or -ORa group.
In another embodiment R6 is phenyl substituted with one fluoro or chloro group and one -CH2Ra, -C(0)Ra, or -C(0)N HRa group wherein the -CH2Ra, -C(0)Ra, or
-C(0)NHRa group is in the para position of the phenyl ring. Suitably R^ is phenyl substituted with one fluoro group and one -CH2Ra, -C(0)Ra, or -C(0)NHRa group wherein the -CH2Ra, -C(0)Ra, or -C(0)NHRa group is in the para position of the phenyl ring. In another embodiment R^ is phenyl substituted with one -CH2Ra, -C(0)Ra, or
-C(0)NHRa group in the para position. In another embodiment R^ is phenyl substituted by -CH2Ra in the para position.
In another embodiment Ra is phenyl optionally substituted with one or two substituents each independently selected from the group consisting of fluoro, chloro and bromo.
In another embodiment Ra is an optionally substituted 5-6 membered heteroaryl.
Suitably Ra is optionally substituted pyridinyl or optionally substituted pyrimidinyl.
Suitably Ra is pyridinyl or pyrimidinyl optionally substituted with one trifluoromethyl.
In another embodiment Ra is C5.7 cycloalkyl each of which is optionally substituted with one or two substituents each independently selected from the group consisting of fluoro, hydroxy, methyl, and C-1.3 haloalkoxy.
In another embodiment Ra is optionally substituted heterocyclic. Suitably Ra is piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, tetrahydro-thiopyran 1 , 1 -dioxide, 1 ,4-diazepanyl, 4,7-diaza-spiro[2.5]octanyl, 3,8-diaza-bicyclo[3.2.1 ]octanyl, 3,8-diaza- bicyclo[4.2.0]octanyl, octahydro-pyrrolo[1 ,2-a]pyrazinyl, octahydro-pyrido[1 ,2-a]pyrazinyl, octahydro-pyrrolo[3,4-c]pyrrolyl, and 5,6,7,8-tetrahydro-imidazo[1 ,2-a]pyrazinyl each of which is optionally substituted with one to three substituents each independently selected from the group consisting of: hydroxy, fluoro, amino, dimethylamino, C-1.3 haloalkoxy,
C-| _3 alkyl, and C3.5 cycloalkyi. Suitably Ra is piperidinyl, piperazinyl, or morpholinyl each of which is optionally substitued with one to three substituents each independently selected from the group consisting of: hydroxy, fluoro, amino, dimethylamino, C-1.3 haloalkoxy, C-1.3 alkyl, and C3.5 cycloalkyi.
In another embodiment of the present invention R^b and R^ are joined together forming an optionally substituted C3.7 cycloalkyi group or an optionally substituted group of formula (a).
In another embodiment of the present invention each Rb is independently hydrogen or methyl.
In another embodiment is hydrogen, R2 is fluoro and R^3, R^b, R4a anc| R4b are each hydrogen.
Another embodiment of the present invention is a compound according to formula
(IV).
Figure imgf000021_0001
Another embodiment of the present invention is a compound according to formula
Figure imgf000021_0002
is phenyl and R4b is hydrogen.
Selected compounds of the present invention include:
(S)-4-isopropy-3-(2-(((S)-1 -(4-(2-yl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one;
N-(4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)phenyl)cyclohexanecarboxamide; (S)-3-(2-(((S)-1 -(3-fluoro-4-((4-methylpiperazin-1 - yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one;
(S)-4-isopropyl-3-(2-(((S)-1 -(4-((3,3,4-trimethylpiperazin-1- yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one;
2-fluoro-N-(4-hydroxy-4-methylcyclohexyl)-4-((S)-1-((4-((S)-4-isopropyl-2-oxooxazolidin- 3-yl)pyrimidin-2-yl)amino)ethyl)benzamide;
(S)-3-(2-((S)-1-(4-((4-amino-4-methylpiperidin-1-yl)methyl)phenyl)ethylamino)pyrimid yl)-4-isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1 -(4-((4-(dimethylamino)piperidin-1 -yl)methyl)phenyl)ethylamino)pyrimi 4-yl)-4-isopropyloxazolidin-2-one;
(S)-4-isopropyl-3-(2-((S)-1 -(4-((4-methylpiperazin-1 - yl)methyl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one;
(S)-4-isopropyl-4-methyl-3-(2-((S)-1-(4-((4-methylpiperazin-1- yl)methyl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one;
(S)-4-isopropyl-3-(2-((S)-1 -(6-phenylpyridin-3-yl)ethylamino)pyrimidin-4-yl)oxazolidin-2- one;
(S)-3-(2-((S)-1 -(4-benzoylphenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one; (S)-4-isopropyl-3-(2-(((S)-1-(5-phenyl-1 ,3,4-thiadiazol-2-yl)ethyl) amino) pyrimidin-4- yl)oxazolidin-2-one;
(4S)-4-isopropyl-3-(2-(1 -(5-phenylpyrimidin-2-yl)ethylamino)pyrimidin-4-yl)oxazolidi one;
3-(5-fluoro-2-((1 -(5-(4-fluoro-3-methylphenyl)pyridin-2-yl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one;
(S)-4-isopropyl-3-(2-(((S)-1-(1-(3-methoxyphenyl)-1 H-pyrazol-4-yl)ethyl)amino)pyrimidin- 4-yl)oxazolidin-2-one;
(S)-3-(2-(((S)-1 -(5-(4-fluorophenyl)-1 ,3,4-oxadiazol-2-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-4-isopropyl-3-(2-(((S)-1 -(3-(m-tolyl)-1 ,2,4-oxadiazol-5-yl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one;
(S)-3-(2-(((S)-1 -(3-(4-fluorophenyl)-1 ,2,4-oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(5-(4-fluoro-2-methylphenyl)pyrimidin-2-yl)ethylamino)pyrimidin-4-yl)-4^ isopropyloxazolidin-2-one;
(S)-4-lsopropyl-3-{2-[(3-p-tolyl-[1 ,2,4]oxadiazol-5-ylmethyl)-amino]-pyrimidin-4-yl}- oxazolidin-2-one; (S)-4-isopropyl-3-(2-((S)-1 -(4-(1 -methyl-1 H-pyrazo
yl)oxazolidin-2-one;
(S)-3-(2-((S)-1 -(2-fluoro-4-isopropylphenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(4-isobutoxy-3-methylphenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one;
(S)-3-(5-fluoro-2-(((S)-1-(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
2-fluoro-N-(frans-4-hydroxycyclohexyl)-4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzamide;
(S)-3-(5-fluoro-2-((S)-1 -(3-fluoro-4-(piperidine-1-carbonyl)phenyl)ethylamino)pyrimidin-4- yl)-4-isopropyloxazolidin-2-one;
N-cyclohexyl-2-fluoro-4-((S)-1-(5-fluoro-4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin- 2-ylamino)ethyl)benzamide;
N-cyclohexyl-2-fluoro-4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzamide; and
(S)-3-(5-f I u oro-2-((S )- 1 -(2-f I u oro-4-(trifl ^
isopropyloxazolidin-2-one.
Selected compounds of the present invention include:
(S)-3-(2-(((S)-1 -(3-fluoro-4-((3,3,4-trimethylpiperazin-1- yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(4-((4,4-difluoropiperidin-1 -yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)^ 4-isopropyloxazolidin-2-one;
(S)-3-(5-fluoro-2-(1 -(4-phenoxyphenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one;
(S)-3-(2-((S)-1-(4-(4-fluorophenoxy)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(4-(((2S,6R)-2,6-dimethylmorpholino)methyl)phenyl)ethyl^
4-yl)-4-isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(5-(4-chlorophenyl)-1 ,2,4-oxadiazol-3-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(5-(4-fluoro-3-methylphenyl)pyridin-2-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one; (S)-3-(2-((S)-1 -(5-(4-fluorophenoxy)pyrimidin-2-^
isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(5-(4-fluorophenoxy)pyrazin-2-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-4-isopropyl-3-(2-((S)-1 -(5-(3-(trifluoromethyl)phenyl)pyrimidin-2- yl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one; and
(S)-3-(2-((S)-1-(5-(4-fluoro-3-methylphenyl)pyrimidin-2-yl)ethylamino)pyrimidin isopropyloxazolidin-2-one. Selected compounds of the present invention include:
(S)-3-(2-(1-(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethylamino)-5-fluoropyrimidin-4-yl)- 4,4-dimethyloxazolidin-2-one;
(S)-3-(6-chloro-2-(1 -(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one;
(S)-3-(2-((S)-1 -(2-fluoro-4-(1 -methylcyclopropyl) phenyl) ethylamino) pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1 -(2-fluoro -4-(trifluoromethyl) phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
2-chloro-N-cyclopentyl-4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzamide;
(S)-3-(2-((S)-1-(4-((3,3-difluoropiperidin-1 -yl)methyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1 -(4-(4,7-diazaspiro[2.5]octan-4-ylmethyl)phenyl)ethylamino)pyrimidin-4-yl)- 4-isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(4-((4-acetylpiperazin-1 -yl)methyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one;
(S)-3-(5-fluoro-2-(((S)-1-(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one; and
2-fluoro-N-(trans-4-hydroxycyclohexyl)-4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzamide.
Enumerated Embodiments
Embodiment 1 . A compound of formula (I)
Figure imgf000025_0001
wherein:
each R1 and R2 is independently hydrogen, deuterium, halo, hydroxyl, NH2, aryl, heteroaryl, or optionally substituted C-1.4 alkyl,
wherein said C-1.4 alkyl is optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, and NH2;
R33 is hydrogen, deuterium, C-|.g alkyl, phenyl, or benzyl and
R3b is hydrogen, deuterium, or C-|.g alkyl; or
R3a and R3B are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyl and heterocyclic rings are each optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, N H2, and C-1.3 alkyl;
R4a is hydrogen, C-|.g alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene,
wherein said phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-|.g alkyl,
C3_g cycloalkyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy,
COORB, S02RB, NHC(0)RB, and NRBRB and
R4b is hydrogen, deuterium, or C-1.3 alkyl; or
R^a and R4b are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyl and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl, provided that only one of R^a and R3b and R^a and R4b are joined together forming a ring;
R5a js hydrogen or deuterium; R5b is hydrogen, deuterium, methyl, ethyl, CD3, CF3, CH2F, or CHF2 and
R6 is optionally substituted C-| .g alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclic, or optionally substituted C5.-10 cycloalkyi, wherein said C-| .g alkyl is optionally substituted with one substituent selected from the group consisting of hydroxyl, C-1.3 alkoxy and -ORa;
wherein said aryl, heteroaryl, heterocyclic and C5.-10 cycloalkyi are optionally substituted with one to three substituents each independently selected from the group consisting of: halo; hydroxyl; cyano; nitro; C-1.3 alkoxy; C-1.3 haloalkyi; C-1.3 haloalkoxy;
C-| _5 alkyl; C3_g cycloalkyi; phenyl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-| _3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-| .g alkyl, C3_g cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy, COORb, SC>2Rb, NHC(0)Rb, and
NRbRb; 5-6 membered heteroaryl; 5-6 membered heterocyclic optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-| _3 alkyl; -CH2Ra; -ORa; -C(0)Ra; -NRaRb; -COORa;
-S02Ra; NHC(0)Ra; and -S02NRbRb; or
R5b and R6 are joined together forming an optionally substituted C3.7 cycloalkyi group
or an optionally substituted group of formula (a):
Figure imgf000026_0001
wherein n is 1 , 2, or 3 and
said C3.7 cycloalkyi and group of formula (a) are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-| .g alkyl, C3_g cycloalkyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, benzyloxy, COORb, S02Rb, NHC(0)Rb, and NRbRb; each Ra is independently optionally substituted phenyl, optionally substituted heteroaryl, or optionally substituted 4-7 membered heterocyclic,
wherein said phenyl and heteroaryl are optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl,
wherein said 4-7 membered heterocyclic is optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl; and each Rb is independently hydrogen or C-| .g alkyl; or a pharmaceutically acceptabble salt thereof.
Embodiment 2. The compound according to embodiment 1 wherein R2 is hydrogen; or a pharmaceutically acceptable salt thereof.
Embodiment 3. The compound according to embodiment 2 wherein is hydrogen, halo, or optionally substituted C-1.4 alkyl; or a pharmaceutically acceptable salt thereof.
Embodiment 4. The compound according to embodiment 3 wherein is hydrogen, fluoro, chloro, or methyl; or a pharmaceutically acceptable salt thereof.
Embodiment 5. The compound according to embodiment 4 wherein R^a is hydrogen, C-| _5 alkyl, phenyl, or benzyl and R3b is hydrogen or C-| .g alkyl; or a pharmaceutically acceptable salt thereof.
Embodiment 6. The compound according to embodiment 5 wherein R3b is hydrogen or methyl; or a pharmaceutically acceptable salt thereof.
Embodiment 7. The compound according to embodiment 6 wherein R^a is hydrogen, methyl, or phenyl; or a pharmaceutically acceptable salt thereof. Embodiment 8. The compound according to embodiment 7 wherein R^a is hydrogen, C-| _5 alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene,
wherein said phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-| .g alkyl,
C3-6 cycloalkyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy, COORb, S02Rb, NHC(0)Rb, and NRbRb and
R^b js hydrogen or C-1.3 alkyl; or a pharmaceutically acceptable salt thereof.
Embodiment 9. The compound according to embodiment 8 wherein R^b js hydrogen or methyl; or a pharmaceutically acceptable salt thereof.
Embodiment 10. The compound according to embodiment 9 wherein R^a is hydrogen, C-| _4 alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene; or a pharmaceutically acceptable salt thereof.
Embodiment 1 1 . The compound according to embodiment 10 wherein R^a js hydrogen, methyl, isopropyl, isobutyl, t-butyl, phenyl, 4-methoxyphenyl, 4-fluorophenyl, benzyl, or methylene-dibenzene; or a pharmaceutically acceptable salt thereof.
Embodiment 12. The compound according to embodiment 1 1 wherein R^a js H; or a pharmaceutically acceptable salt thereof.
Embodiment 13. The compound according to embodiment 12 wherein R^b js hydrogen, methyl, ethyl, or CF3.
Embodiment 14. The compound according to embodiment 13 wherein R^ is isopropyl, optionally substituted aryl, optionally substituted pyrazolyl, optionally substituted pyridinyl, 2,3-dihydrobenzofuranyl, 2,3-dihydrobenzo[b][1 ,4]dioxinyl, or optionally substituted C .10 cycloalkyl; or a pharmaceutically acceptable salt thereof. Embodiment 15. A pharmaceutical composition comprising a compound according to embodiment 1 , or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient.
Embodiment 16. A method for the treatment of a disease or disorder associated with a mutant IDH protein having a neomorphic activity comprising administration of a therapeutically effective amount of a compound according to embodiment 1 , or a pharmaceutically acceptable salt thereof, to subject in need of thereof.
Embodiment 17. A method for the treatment of a disease or disorder associated with a mutant IDH protein having a neomorphic activity comprising administration of a therapeutically effective amount of a compound according to embodiment 1 , or a pharmaceutically acceptable salt thereof, and another therapeutic agent to subject in need of thereof.
General Synthetic Procedures
The compounds of the present invention may be made by a variety of methods, including standard chemistry. Suitable synthetic routes are depicted in the Schemes given below.
The compounds of formula (I) may be prepared by methods known in the art of organic synthesis as set forth in part by the following synthetic schemes. In the schemes described below, it is well understood that protecting groups for sensitive or reactive groups are employed where necessary in accordance with general principles or chemistry. Protecting groups are manipulated according to standard methods of organic synthesis (T. W. Greene and P. G. M. Wuts, "Protective Groups in Organic Synthesis", Third edition, Wiley, New York 1999). These groups are removed at a convenient stage of the compound synthesis using methods that are readily apparent to those skilled in the art. The selection processes, as well as the reaction conditions and order of their execution, shall be consistent with the preparation of compounds of formula (I).
Those skilled in the art will recognize if a stereocenter exists in the compounds of formula (I). Accordingly, the present invention includes both possible stereoisomers and includes not only racemic compounds but the individual enantiomers and/or diastereomers as well. When a compound is desired as a single enantiomer or diastereomer, it may be obtained by stereospecific synthesis or by resolution of the final product or any convenient intermediate. Resolution of the final product, an intermediate, or a starting material may be effected by any suitable method known in the art. See, for example, "Stereochemistry of Organic Compounds" by E. L. Eliel, S. H. Wilen, and L. N. Mander (Wiley-lnterscience, 1994).
The compounds described herein may be made from commercially available starting materials or synthesized using known organic, inorganic, and/or enzymatic processes.
Scheme 1.
Figure imgf000030_0001
Non-commercial aminoacids can be prepared following the procedures of Scheme 1 . Conversion of ketone 1 to the corresponding imidazolidine-2,4-dione 2 followed by hydrolysis provides aminoacid 3.
Scheme 2.
A
H2CI2
MeOH idazole,
Figure imgf000031_0001
When aminoalcohol, precursor of oxazolidinone, is not commercially available, it can be prepared from aminoacid 3 following the procedures of Scheme 2. When R3a = R3b, protected aminoester 5 is treated with an appropriate Grignard reagent to give protected aminoalcohol 6 which goes through basic or acidic deprotection step. When R3a≠ R3b, protected aminoacid 8 is converted into Weinreb amide 9 which is treated with different Grignard reagents sequentially to provide protected aminoalcohol 10. Either basic or acidic deprotection of 10 gives 11. Insertion of CO unit into 7 or 11 to provide oxazolidinone 12 is accomplished with several reagents, including (but not limited to) triphosgene, Εί^ΟΟβ or N-N'-darbonyldiimidazole, as shown in Scheme 2. Scheme 3.
Figure imgf000032_0001
Oxazolidinone 12 is coupled with dihalogen-pyrimidine 13 in the presence of NaH and the resulting 14 is treated with primary amine 15 under several different reaction conditions as shown in Scheme 3 to provide 16.
Scheme 4.
Figure imgf000032_0002
Alternately intermediate 14 can be prepared by coupling the amino alcohol 11 and dihalogen-pyrimidine 13 in the presence of a base such as diisopropylethyl amine resulting in intermediate 17 which can be treated with triphosgene in the presence of a base such as 2,6-lutidine resulting in intermediate 14.
Methods of Use
The compounds of the present invention are inhibitors of a mutant IDH protein having a neomorphic activity and are therefore useful in the treatment of diseases or disorders associated with such proteins including, but not limited to, cell proliferation disorders, such as cancer.
Examples of a mutant IDH protein having a neomorphic activity are mutant IDH1 and mutant IDH2. A neomorphic activity associated with mutant IDH1 and mutant IDH2 is the ability to produce 2-hydroxyglutarate (2-HG neomorphic activity), specifically R-2- HG (R-2-HG neomorphic activity). Mutations in IDH 1 associated with 2-HG neomorphic activity, specifically R-2-HG neomorphic activity, include mutations at residues 97, 100, and 132, e.g. G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V. Mutations in IDH2 associated with 2-HG neoactivity, specifically R-2-HG neomorphic activity, include mutations at residues 140 and 172, e.g. R140Q, R140G, R172K, R172M, R172S, R172G, and R172W.
Cell-proliferation disorders associated with a mutant IDH protein having a neomorphic activity include, but are not limited to, cancer. Examples of such cancers include Acute Lymphoblastic Leukemia, Adult; Acute Lymphoblastic Leukemia, Childhood; Acute Myeloid Leukemia, Adult; Adrenocortical Carcinoma; Adrenocortical Carcinoma, Childhood; AIDS-Related Lymphoma; AIDS-Related Malignancies; Anal Cancer; Astrocytoma, Childhood Cerebellar; Astrocytoma, Childhood Cerebral; Bile Duct Cancer, Extrahepatic; Bladder Cancer; Bladder Cancer, Childhood; Bone Cancer, Osteosarcoma/Malignant Fibrous Histiocytoma; Brain Stem Glioma, Childhood; Brain Tumor, Adult; Brain Tumor, Brain Stem Glioma, Childhood; Brain Tumor, Cerebellar Astrocytoma, Childhood; Brain Tumor, Cerebral Astrocytoma/Malignant Glioma, Childhood; Brain Tumor, Ependymoma, Childhood; Brain Tumor, Medulloblastoma, Childhood; Brain Tumor, Supratentorial Primitive Neuroectodermal Tumors, Childhood; Brain Tumor, Visual Pathway and Hypothalamic Glioma, Childhood; Brain Tumor, Childhood (Other); Breast Cancer; Breast Cancer and Pregnancy; Breast Cancer, Childhood; Breast Cancer, Male; Bronchial Adenomas/Carcinoids, Childhood; Carcinoid Tumor, Childhood; Carcinoid Tumor, Gastrointestinal; Carcinoma, Adrenocortical; Carcinoma, Islet Cell; Carcinoma of Unknown Primaiy; Central Nervous System Lymphoma, Primary; Cerebellar Astrocytoma, Childhood; Cerebral Astrocytoma/Malignant Glioma, Childhood; Cervical Cancer; Childhood Cancers; Chronic Lymphocytic Leukemia; Chronic Myelogenous Leukemia; Chronic Myeloproliferative Disorders; Clear Cell Sarcoma of Tendon Sheaths; Colon Cancer; Colorectal Cancer, Childhood; Cutaneous T-Cell Lymphoma; Endometrial Cancer; Ependymoma, Childhood; Epithelial Cancer, Ovarian; Esophageal Cancer; Esophageal Cancer, Childhood; Ewing's Family of Tumors; Extracranial Germ Cell Tumor, Childhood; Extragonadal Germ Cell Tumor; Extrahepatic Bile Duct Cancer; Eye Cancer, Intraocular Melanoma; Eye Cancer, Retinoblastoma; Gallbladder Cancer; Gastric (Stomach) Cancer; Gastric (Stomach) Cancer, Childhood; Gastrointestinal Carcinoid Tumor; Germ Cell Tumor, Extracranial, Childhood; Germ Cell Tumor, Extragonadal; Germ Cell Tumor, Ovarian; Gestational Trophoblastic Tumor; Glioma, Childhood Brain Stem; Glioma, Childhood Visual Pathway and Hypothalamic; Hairy Cell Leukemia; Head and Neck Cancer; Hepatocellular (Liver) Cancer, Adult (Primary); Hepatocellular (Liver) Cancer, Childhood (Primary); Hodgkin's Lymphoma, Adult; Hodgkin's Lymphoma, Childhood; Hodgkin's Lymphoma During Pregnancy; Hypopharyngeal Cancer; Hypothalamic and Visual Pathway Glioma, Childhood; Intraocular Melanoma; Islet Cell Carcinoma (Endocrine Pancreas); Kaposi's Sarcoma; Kidney Cancer; Laryngeal Cancer; Laryngeal Cancer, Childhood; Leukemia, Acute Lymphoblastic, Adult; Leukemia, Acute Lymphoblastic, Childhood; Leukemia, Acute Myeloid, Adult; Leukemia, Acute Myeloid, Childhood; Leukemia, Chronic Lymphocytic; Leukemia, Chronic Myelogenous; Leukemia, Hairy Cell; Lip and Oral Cavity Cancer; Liver Cancer, Adult (Primary); Liver Cancer, Childhood (Primary); Lung Cancer, Non-Small Cell; Lung Cancer, Small Cell; Lymphoblastic Leukemia, Adult Acute; Lymphoblastic Leukemia, Childhood Acute; Lymphocytic Leukemia, Chronic; Lymphoma, AIDS- Related; Lymphoma, Central Nervous System (Primary); Lymphoma, Cutaneous T-Cell; Lymphoma, Hodgkin's, Adult; Lymphoma, Hodgkin's, Childhood; Lymphoma, Hodgkin's During Pregnancy; Lymphoma, Non-Hodgkin' s, Adult; Lymphoma, Non- Hodgkin's, Childhood; Lymphoma, Non- Hodgkin's During Pregnancy; Lymphoma, Primary Central Nervous System; Macroglobulinemia, Waldenstrom's; Male Breast Cancer; Malignant Mesothelioma, Adult; Malignant Mesothelioma, Childhood; Malignant Thymoma; Medulloblastoma, Childhood; Melanoma; Melanoma, Intraocular; Merkel Cell Carcinoma; Mesothelioma, Malignant; Metastatic Squamous Neck Cancer with Occult Primary; Multiple Endocrine Neoplasia Syndrome, Childhood; Multiple Myeloma/Plasma Cell Neoplasm; Mycosis Fungoides; Myelodysplastic Syndromes; Myelogenous Leukemia, Chronic; Myeloid Leukemia, Childhood Acute; Myeloma, Multiple; Myeloproliferative Disorders, Chronic; Nasal Cavity and Paranasal Sinus Cancer; Nasopharyngeal Cancer; Nasopharyngeal Cancer, Childhood; Neuroblastoma; Non-Hodgkin's Lymphoma, Adult; Non-Hodgkin's Lymphoma, Childhood; Non- Hodgkin's Lymphoma During Pregnancy; Non-Small Cell Lung Cancer; Oral Cancer, Childhood; Oral Cavity and Lip Cancer; Oropharyngeal Cancer; steosarcoma/Malignant Fibrous Histiocytoma of Bone; Ovarian Cancer, Childhood; Ovarian Epithelial Cancer; Ovarian Germ Cell Tumor; Ovarian Low Malignant Potential Tumor; Pancreatic Cancer; Pancreatic Cancer, Childhood; Pancreatic Cancer, Islet Cell; Paranasal Sinus and Nasal Cavity Cancer; Parathyroid Cancer; Penile Cancer; Pheochromocytoma; Pineal and Supratentorial Primitive Neuroectodermal Tumors, Childhood; Pituitary Tumor; Plasma Cell Neoplasm/Multiple Myeloma; Pleuropulmonary Blastoma; Pregnancy and Breast Cancer; Pregnancy and Hodgkin's Lymphoma; Pregnancy and Non-Hodgkin's Lymphoma; Primary Central Nervous System Lymphoma; Primary Liver Cancer, Adult; Primary Liver Cancer, Childhood; Prostate Cancer; Rectal Cancer; Renal Cell (Kidney) Cancer; Renal Cell Cancer, Childhood; Renal Pelvis and Ureter, Transitional Cell Cancer; Retinoblastoma; Rhabdomyosarcoma, Childhood; Salivary Gland Cancer; Salivary Gland Cancer, Childhood; Sarcoma, Ewing's Family of Tumors; Sarcoma, Kaposi's; Sarcoma (Osteosarcoma)/Malignant Fibrous Histiocytoma of Bone; Sarcoma, Rhabdomyosarcoma, Childhood; Sarcoma, Soft Tissue, Adult; Sarcoma, Soft Tissue, Childhood; Sezary Syndrome; Skin Cancer; Skin Cancer, Childhood; Skin Cancer (Melanoma); Skin Carcinoma, Merkel Cell; Small Cell Lung Cancer; Small Intestine Cancer; Soft Tissue Sarcoma, Adult; Soft Tissue Sarcoma, Childhood; Squamous Neck Cancer with Occult Primary, Metastatic; Stomach (Gastric) Cancer; Stomach (Gastric) Cancer, Childhood; Supratentorial Primitive Neuroectodermal Tumors, Childhood; T- Cell Lymphoma, Cutaneous; Testicular Cancer; Thymoma, Childhood; Thymoma, Malignant; Thyroid Cancer; Thyroid Cancer, Childhood; Transitional Cell Cancer of the Renal Pelvis and Ureter; Trophoblastic Tumor, Gestational; Unknown Primary Site, Cancer of, Childhood; Unusual Cancers of Childhood; Ureter and Renal Pelvis, Transitional Cell Cancer; Urethral Cancer; Uterine Sarcoma; Vaginal Cancer; Visual Pathway and Hypothalamic Glioma, Childhood; Vulvar Cancer; Waldenstrom's Macro globulinemia; and Wilms' Tumor.
In another embodiment the cancer associated with a mutant IDH protein having a neomorphic acitvity is brain cancer, such as astrocytic tumor (e.g., pilocytic astrocytoma, subependymal giant-cell astrocytoma, diffuse astrocytoma, pleomorphic xanthoastrocytoma, anaplastic astrocytoma, astrocytoma, giant cell glioblastoma, glioblastoma, secondary glioblastoma, primary adult glioblastoma, and primary pediatric glioblastoma); oligodendroglial tumor (e.g., oligodendroglioma, and anaplastic oligodendroglioma); oligoastrocytic tumor (e.g., oligoastrocytoma, and anaplastic oligoastrocytoma); ependymoma (e.g., myxopapillary ependymoma, and anaplastic ependymoma); medulloblastoma; primitive neuroectodermal tumor, schwannoma, meningioma, meatypical meningioma, anaplastic meningioma; and pituitary adenoma. In another embodiment, the brain cancer is glioma, glioblastoma multiforme, paraganglioma, or suprantentorial primordial neuroectodermal tumors (sPNET).
In another embodiment the cancer associated with a mutant IDH protein having a neomorphic acitvity is leukemia, such as acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), chronic myelogenous leukemia (CML), myeloproliferative neoplasm (MPN), MDS.MPN including chronic myelomonocytic leukemia, post MDS AML, post MPN AML, post MDS/MPN AML, del(5q)-associated high risk MDS or AML, blast-phase chronic myelogenous leukemia, angioimmunoblastic lymphoma and acute lymphoblastic leukemia.
In another embodiment the cancer associated with a mutant IDH protein having a neomorphic activity is skin cancer, including melanoma.
In another embodiment the cancer associated with a mutant IDH protein having a neomorphic activity is prostate cancer, thyroid cancer, colon cancer, or lung cancer.
In another embodiment the cancer associated with a mutant IDH protein having a neomorphic activity is sarcoma, including central chondrosarcoma, central and periosteal chondroma, and fibrosarcoma. In another embodiment the cancer associated with a mutant IDH protein having a neomorphic activity is cholangiocarcinoma.
Another disease or disorder associated with a mutant IDH protein having R-2-HG neomorphic activity is D-2-hydroxyglutaric aciduria.
Another disease or disorder associated with a mutant IDH protein having R-2-HG neomorphic activity is Diller disease and Mafucci syndrome.
As used herein the term "neomorphic activity" refers to a gain of novel activity of a protein that the wild-type protein does not have or does not exhibit to a significant degree. For example, a neomorphic activity associated with a mutant form of IDH 1 and IDH2 is the ability to reduce alpha-ketoglutarate to 2-hydroxyglutarate (i.e. 2-HG, specifically R-2-HG). The wild type form of IDH1 and IDH2 does not have the ability to reduce alpha-ketoglutarate to 2-hydroxyglutarate (i.e. 2-HG, specifically R-2-HG) or if it does have this ability, it does not produce significant (i.e. harmful or disease causing) amounts of 2-HG.
As used herein, the term "subject" refers to an animal. Typically the animal is a mammal. A subject also refers to for example, primates (e.g., humans, male or female), cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice, fish, birds and the like. In certain embodiments, the subject is a primate. In yet other embodiments, the subject is a human.
As used herein, the term "therapeutically effective amount" in reference to a compound of the invention means an amount of the compound sufficient to treat the subject's disease or condition, but low enough to avoid serious sides effects (at a reasonable benefit/risk ratio) within the scope of sound medical judgment. A therapeutically effective amount of a compound will vary with the particular compound chosen (e.g. consider the potency, efficacy, and half-life of the compound); the route of administration chosen; the condition being treated; the severity of the condition being treated; the age, size, weight, and physical condition of the subject being treated; the medical history of the subject being treated; the duration of the treatment; the nature of the concurrent therapy; the desired therapeutic effect; and like factors and can be routinely determined by the skilled artisan.
As used herein, the term "treat", "treating" or "treatment" of any disease or disorder refers in one embodiment, to ameliorating the disease or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof). In another embodiment "treat", "treating" or "treatment" refers to alleviating or ameliorating at least one physical parameter including those which may not be discernible by the patient. In yet another embodiment, "treat", "treating" or "treatment" refers to modulating the disease or disorder, either physically, (e.g., stabilization of a discernible symptom), physiologically, (e.g., stabilization of a physical parameter), or both. In yet another embodiment, "treat", "treating" or "treatment" refers to preventing or delaying the onset or development or progression of the disease or disorder.
As used herein, a subject is "in need of" a treatment if such subject would benefit biologically, medically or in quality of life from such treatment.
The compounds of the present invention may be administered by any suitable route including oral and parenteral administration. Parenteral administration is typically by injection or infusion and includes intravenous, intramuscular, and subcontaneous injection or infusion.
The compounds of the invention may be administered once or according to a dosing regimen wherein a number of doses are administered at varying intervals of time for a given period of time. For example, doses may be administered one, two, three, or four times per day. Doses may be administered until the desired therapeutic effect is achieved or indefinitely to maintain the desired therapeutic effect. Suitable dosing regimens for a compound of the invention depend on the pharmacokinetic properties of that compound, such as absorption, distribution and half life which can be determined by the skilled artisan. In addition, suitable dosing regimens, including the duration such regimens are administered, for a compound of the invention depend on the disease or condition being treated, the severity of the disease or condition, the age and physical condition of the subject being treated, the medical history of the subject being treated, the nature of concurrent therapy, the desired therapeutic effect, and like factors within the knowledge and expertise of the skilled artisan. It will be further understood by such skilled artisans that suitable dosing regimens may require adjustment given an individual subject's response to the dosing regimen or over time as the individual subject needs change. Typical daily dosages may vary depending upon the particular route of administration chosen. Typical daily dosages for oral administration, to a human weighing approximately 70kg would range from about 5mg to about 500mg of a compound of formula (I).
One embodiment of the present invention provides for a method of treating a disease or disorder associated with a mutant form of IDH having a neomorphic activity comprising administration of a therapeutically effective amount of a compound of formula (I) to a subject in need of treatment thereof. In one embodiment, the disease or disorder associated with a mutant form of IDH having a neomorphic activity is a cell proliferation disorder. In another embodiment, the cell proliferation disorder is cancer. In another embodiment, the cancer is a cancer associated with mutant IDH1 having 2-HG neomorphic activity or mutant IDH2 having 2-HG neomorphic activity. In another embodiment the neomorphic activity is R-2-HG neomorphic activity. In another embodiment the cancer is associated with mutant IDH1 having 2-HG or R-2-HG neomorphic activity having a mutation at residues 97, 100, or 132, such as G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V. In another embodiment the cancer is associated with mutant IDH2 having 2-HG or R-2-HG neomorphic activity having a mutation at residues 140 or 172, e.g. R140Q, R140G, R172K, R172M, R172S, R172G, and R172W. In another embodiment the cancer is brain cancer, leukemia, skin cancer, prostate cancer, thyroid cancer, colon cancer, lung cancer or sarcoma. In another embodiment the cancer is glioma, glioblastoma multiforme, paraganglioma, suprantentorial primordial neuroectodermal tumors, acute myeloid leukemia, myelodysplastic syndrome, chronic myelogenous leukemia, melanoma, prostate, thyroid, colon, lung, central chondrosarcoma, central and periosteal chondroma tumors, fibrosarcoma, and cholangiocarcinoma.
Another embodiment of the present invention provides for a method of treating a disease or disorder associated with a mutant form of IDH having R-2-HG neomorphic activity comprising administration of a therapeutically effective amount of a compound according to formula (I) to a subject in need thereof wherein the disease or disorder is D- 2-hydroxyglutaric aciduria, Oilier Disease, or Mafucci Syndrome.
Another embodiment of the present invention provides for the use of a compound of formula (I) in therapy. In a further embodiment the therapy is a disease or disorder associated with a mutant form of IDH having a neomorphic activity. In another embodiment the therapy is a cell proliferation disorder associated with a mutant form of IDH having a neomorphic activity. In another embodiment the therapy is cancer. In another embodiment the therapy is a cancer associated with a mutant IDH protein having a neomorphic activity, such as mutant IDH1 having 2-HG neomorphic activity or mutant IDH2 having 2-HG neomorphic activity. In another embodiment the neomorphic activity is R-2-HG neomorphic activity. In another embodiment the cancer is associated with mutant IDH1 having 2-HG or R-2-HG neomorphic activity having a mutation at residues 97, 100, or 132, such as G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V. In another embodiment the cancer is associated with mutant IDH2 having 2-HG or R-2-HG neomorphic activity having a mutation at residue at residues R140 or 172, e.g. R140Q, R140G, R172K, R172M, R172S, R172G, and R172W. In another embodiment the cancer is brain cancer, leukemia, skin cancer, prostate cancer, thyroid cancer, colon cancer, lung cancer or sarcoma. In another embodiment the cancer is glioma, glioblastoma multiforme, paraganglioma, suprantentorial primordial neuroectodermal tumors, acute myeloid leukemia, myelodysplastic syndrome, chronic myelogenous leukemia, melanoma, prostate, thyroid, colon, lung, central chondrosarcoma, central and periosteal chondroma tumors, fibrosarcoma, and cholangiocarcinoma.
Another embodiment of the present invention provides for the use of a compound of formula (I) in therapy wherein the therapy is D-2-hydroxyglutaric aciduria, Oilier Disease, or Mafucci Syndrome.
Another embodiment of the present invention provides for the use of a compound according to formula (I) in the manufacture of a medicament for the treatment of disease or disorder associated with a mutant form of IDH having a neomorphic activity. In one embodiment the disease or disorder associated with a mutant form of IDH having a neomorphic activity is a cell proliferation disorder. In another embodiment, the cell proliferation disorder is cancer. In another embodiment the cancer is a cancer associated with a mutant IDH protein having a neomorphic activity, such as mutant IDH1 having 2-HG neomorphic activity or mutant IDH2 having 2-HG neomorphic activity. In another embodiment the neomorphic activity is R-2-HG neomorphic activity. In another embodiment the cancer is associated with mutant IDH1 having 2-HG or R-2-HG neomorphic activity having a mutation at residues 97, 100, or 132, such as G97D, R100Q, R132H, R132C, R132S, R132G, R132L, and R132V. In another embodiment the cancer is associated with mutant IDH2 having 2-HG or R-2-HG neomorphic activity having a mutation at residue at residues 140 or 172, e.g. R140Q, R140G, R172K, R172M, R172S, R172G, and R172W. In another embodiment the cancer is brain cancer, leukemia, skin cancer, prostate cancer, thyroid cancer, colon cancer, lung cancer or sarcoma. In another embodiment the cancer is glioma, glioblastoma multiforme, paraganglioma, suprantentorial primordial neuroectodermal tumors, acute myeloid leukemia, myelodysplastic syndrome, chronic myelogenous leukemia, melanoma, prostate, thyroid, colon, lung, central chondrosarcoma, central and periosteal chondroma tumors, fibrosarcoma, and cholangiocarcinoma.
Another embodiment of the present invention provides for the use of a compound according to formula (I) in the manufacture of a medicament for the treatment of disease or disorder associated with a mutant form of IDH having R-2-HG neomorphic activity wherein the disease or disorder is D-2-hydroxyglutaric aciduria, Oilier Disease, or Mafucci Syndrome.
Compositions
In another aspect, the present invention provides a pharmaceutical composition comprising a compound of formula (I) and a pharmaceutically acceptable carrier or excipient. The pharmaceutical compositions of the invention may be prepared and packaged in bulk form wherein a therapeutically effective amount of a compound of the invention can be extracted and then given to a subject, such as with powders or syrups. Alternatively, the pharmaceutical compositions of the invention may be prepared and packaged in unit dosage form wherein each physically discrete unit contains a therapeutically effective amount of a compound of the invention. When prepared in unit dosage form, the pharmaceutical compositions of the invention typically contain from about 5mg to 500mg of a compound of formula (I).
As used herein the term "pharmaceutically acceptable carrier or excipient" means a pharmaceutically acceptable material, composition or vehicle that, for example, are involved in giving form or consistency to the pharmaceutical composition. Each excipient must be compatible with the other ingredients of the pharmaceutical composition when commingled such that interactions which would substantially reduce the efficacy of the compound of the invention when administered to a subject and interactions which would result in pharmaceutical compositions that are not pharmaceutically acceptable are avoided. In addition, each excipient must, of course, be of sufficiently high purity to render it pharmaceutically acceptable.
The compound of the invention and the pharmaceutically acceptable carrier or excipient(s) will typically be formulated into a dosage form adapted for administration to the subject by the desired route of administration. For example, dosage forms include those adapted for (1 ) oral administration such as tablets, capsules, caplets, pills, troches, powders, syrups, elixirs, suspensions, solutions, emulsions, sachets, and cachets; and (2) parenteral administration such as sterile solutions, suspensions, and powders for reconstitution. Suitable pharmaceutically acceptable excipients will vary depending upon the particular dosage form chosen. In addition, suitable pharmaceutically acceptable excipients may be chosen for a particular function that they may serve in the composition. For example, certain pharmaceutically acceptable excipients may be chosen for their ability to facilitate the production of uniform dosage forms. Certain pharmaceutically acceptable excipients may be chosen for their ability to facilitate the production of stable dosage forms. Certain pharmaceutically acceptable excipients may be chosen for their ability to facilitate the carrying or transporting of the compound or compounds of the invention, once administered to the subject, from one organ or portion of the body to another organ or another portion of the body. Certain pharmaceutically acceptable excipients may be chosen for their ability to enhance patient compliance.
Suitable pharmaceutically acceptable excipients include the following types of excipients: diluents, lubricants, binders, disintegrants, fillers, glidants, granulating agents, coating agents, wetting agents, solvents, co-solvents, suspending agents, emulsifiers, sweeteners, flavoring agents, flavor masking agents, coloring agents, anti-caking agents, hemectants, chelating agents, plasticizers, viscosity increasing agents, antioxidants, preservatives, stabilizers, surfactants, and buffering agents.
Skilled artisans possess the knowledge and skill in the art to enable them to select suitable pharmaceutically acceptable carriers and excipients in appropriate amounts for the use in the invention. In addition, there are a number of resources available to the skilled artisan, which describe pharmaceutically acceptable carriers and excipients and may be useful in selecting suitable pharmaceutically acceptable carriers and excipients. Examples include Remington's Pharmaceutical Sciences (Mack Publishing Company), The Handbook of Pharmaceutical Additives (Gower Publishing Limited), and The Handbook of Pharmaceutical Excipients (the American Pharmaceutical Association and the Pharmaceutical Press).
The pharmaceutical compositions of the invention are prepared using techniques and methods known to those skilled in the art. Some methods commonly used in the art are described in Remington's Pharmaceutical Sciences (Mack Publishing Company).
In one aspect, the invention is directed to a solid oral dosage form such as a tablet or capsule comprising a therapeutically effective amount of a compound of the invention and a diluent or filler. Suitable diluents and fillers include lactose, sucrose, dextrose, mannitol, sorbitol, starch (e.g. corn starch, potato starch, and pre-gelatinized starch), cellulose and its derivatives, (e.g. microcrystalline cellulose), calcium sulfate, and dibasic calcium phosphate. The oral solid dosage form may further comprise a binder. Suitable binders include starch (e.g. corn starch, potato starch, and pre-gelatinized starch) gelatin, acacia, sodium alginate, alginic acid, tragacanth, guar gum, povidone, and cellulose and its derivatives (e.g. microcrystalline cellulose). The oral solid dosage form may further comprise a disintegrant. Suitable disintegrants include crospovidone, sodium starch glycolate, croscarmelose, alginic acid, and sodium carboxymethyl cellulose. The oral solid dosage form may further comprise a lubricant. Suitable lubricants include stearic acid, magnesium stearate, calcium stearate, and talc.
Where appropriate, dosage unit formulations for oral administration can be microencapsulated. The composition can also be prepared to prolong or sustain the release as, for example, by coating or embedding particulate material in polymers, wax, or the like.
The compounds of the invention may also be coupled with soluble polymers as targetable drug carriers. Such polymers can include polyvinylpyrrolidone, pyrancopolymer, polyhydroxypropylmethacrylamidephenol, polyhydroxyethylaspartamidephenol, or polyethyleneoxidepolylysine substituted with palmitoyl residues. Furthermore, the compounds of the invention may be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example polylactic acid, polepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanacrylates and cross-linked or amphipathic block copolymers of hydrogels.
In another aspect, the invention is directed to a liquid oral dosage form. Oral liquids such as solution, syrups and elixirs can be prepared in dosage unit form so that a given quantity contains a predetermined amount of a compound of the invention. Syrups can be prepared by dissolving the compound of the invention in a suitably flavored aqueous solution; while elixirs are prepared through the use of a non-toxic alcoholic vehicle. Suspensions can be formulated by dispersing the compound of the invention in a non-toxic vehicle. Solubilizers and emulsifiers such as ethoxylated isostearyl alcohols and polyoxy ethylene sorbitol ethers, preservatives, flavor additives such as peppermint oil or other natural sweeteners or saccharin or other artificial sweeteners and the like can also be added.
In another aspect, the invention is directed to parenteral administration.
Pharmaceutical compositions adapted for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. The compositions may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets.
Combinations
The compound of the present invention may be administered either simultaneously with, or before or after, one or more other therapeutic agent(s). The compound of the present invention may be administered separately, by the same or different route of administration, or together in the same pharmaceutical composition as the other agent(s).
In one embodiment, the invention provides a product comprising a compound of formula (I) and at least one other therapeutic agent as a combined preparation for simultaneous, separate or sequential use in therapy. In one embodiment, the therapy is the treatment of a disease or disorder associated with a mutant form of IDH. Products provided as a combined preparation include a composition comprising the compound of formula (I) and the other therapeutic agent(s) together in the same pharmaceutical composition, or the compound of formula (I) and the other therapeutic agent(s) in separate form, e.g. in the form of a kit.
In one embodiment, the invention provides a pharmaceutical composition comprising a compound of formula (I) and another therapeutic agent(s). Optionally, the pharmaceutical composition may comprise a pharmaceutically acceptable excipient, as described above.
In one embodiment, the invention provides a kit comprising two or more separate pharmaceutical compositions, at least one of which contains a compound of formula (I). In one embodiment, the kit comprises means for separately retaining said compositions, such as a container, divided bottle, or divided foil packet. An example of such a kit is a blister pack, as typically used for the packaging of tablets, capsules and the like.
The kit of the invention may be used for administering different dosage forms, for example, oral and parenteral, for administering the separate compositions at different dosage intervals, or for titrating the separate compositions against one another. To assist compliance, the kit of the invention typically comprises directions for administration.
In the combination therapies of the invention, the compound of the invention and the other therapeutic agent may be manufactured and/or formulated by the same or different manufacturers. Moreover, the compound of the invention and the other therapeutic agent may be brought together into a combination therapy: (i) prior to release of the combination product to physicians (e.g. in the case of a kit comprising the compound of the invention and the other therapeutic agent); (ii) by the physician themselves (or under the guidance of the physician) shortly before administration; (iii) in the patient themselves, e.g. during sequential administration of the compound of the invention and the other therapeutic agent.
Accordingly, the invention provides the use of a compound of formula (I) for treating a disease or disorder associated with a mutant form of IDH, wherein the medicament is prepared for administration with another therapeutic agent. The invention also provides the use of another therapeutic agent for treating a disease or disorder associated with a mutant form of IDH, wherein the medicament is administered with a compound of formula (I).
The invention also provides a compound of formula (I) for use in a method of treating a disease or disorder associated with a mutant form of IDH, wherein the compound of formula (I) is prepared for administration with another therapeutic agent. The invention also provides another therapeutic agent for use in a method of treating a disease or disorder associated with a mutant form of IDH, wherein the other therapeutic agent is prepared for administration with a compound of formula (I). The invention also provides a compound of formula (I) for use in a method of treating a disease or disorder associated with a mutant form of IDH, wherein the compound of formula (I) is administered with another therapeutic agent. The invention also provides another therapeutic agent for use in a method of treating a disease or disorder associated with a mutant form of I DH, wherein the other therapeutic agent is administered with a compound of formula (I).
The invention also provides the use of a compound of formula (I) for treating a disease or disorder associated with a mutant form of I DH, wherein the patient has previously (e.g. within 24 hours) been treated with another therapeutic agent. The invention also provides the use of another therapeutic agent for treating a disease or disorder associated with a mutant form of I DH, wherein the patient has previously (e.g. within 24 hours) been treated with a compound of formula (I).
In one embodiment, the other therapeutic agent is selected from: vascular endothelial growth factor (VEGF) receptor inhibitors, topoisomerase II inhibitors, smoothen inhibitors, alkylating agents, anti-tumor antibiotics, anti-metabolites, retinoids, and other cytotoxic agents.
Examples of vascular endothelial growth factor (VEGF) receptor inhibitors include, but are not limited to, bevacizumab (sold under the trademark Avastin® by Genentech/Roche), axitinib, (A/-methyl-2-[[3-[(£)-2-pyridin-2-ylethenyl]-1 H-indazol-6- yl]sulfanyl]benzamide, also known as AG013736, and described in PCT Publication No. WO 01 /002369), Brivanib Alaninate ((S)-((R)-1 -(4-(4-Fluoro-2-methyl-1 H-indol-5-yloxy)- 5-methylpyrrolo[2, 1 -f\[\ ,2,4]triazin-6-yloxy)propan-2-yl)2-aminopropanoate, also known as BMS-582664), motesanib (N-(2,3-dihydro-3,3-dimethyl-1 H-indoi-6-y!)-2-[(4- pyridinyimethyj)amino]-3-pyfidinecarboxamide. and described in PCT Publication No. WO 02/068470), pasireotide (also known as SO 230, and described in PCT Publication No. WO 02/010192), and sorafenib (sold under the tradename Nexavar®).
Examples of topoisomerase I I inhibitors, include but are not limited to, etoposide (also known as VP-16 and Etoposide phosphate, sold under the tradenames Toposar®, VePesid® and Etopophos®), and teniposide (also known as VM-26, sold under the tradename Vumon®).
Examples of alkylating agents, include but are not limited to, temozolomide (sold under the tradenames Temodar® and Temodal® by Schering-Plough/Merck), dactinomycin (also known as actinomycin-D and sold under the tradename Cosmegen®), melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, sold under the tradename Alkeran®), altretamine (also known as hexamethylmelamine (HMM), sold under the tradename Hexalen®), carmustine (sold under the tradename BiCNU®), bendamustine (sold under the tradename Treanda®), busulfan (sold under the tradenames Busulfex® and Myleran®), carboplatin (sold under the tradename Paraplatin®), lomustine (also known as CCNU, sold under the tradename CeeNU®), cisplatin (also known as CDDP, sold under the tradenames Platinol® and Platinol®-AQ), chlorambucil (sold under the tradename Leukeran®), cyclophosphamide (sold under the tradenames Cytoxan® and Neosar®), dacarbazine (also known as DTIC, DIC and imidazole carboxamide, sold under the tradename DTIC-Dome®), altretamine (also known as hexamethylmelamine (HMM) sold under the tradename Hexalen®), ifosfamide (sold under the tradename Ifex®), procarbazine (sold under the tradename Matulane®), mechlorethamine (also known as nitrogen mustard, mustine and mechloroethamine hydrochloride, sold under the tradename Mustargen®), streptozocin (sold under the tradename Zanosar®), thiotepa (also known as thiophosphoamide, TESPA and TSPA, and sold under the tradename Thioplex®.
Examples of anti-tumor antibiotics include, but are not limited to, doxorubicin (sold under the tradenames Adriamycin® and Rubex®), bleomycin (sold under the tradename lenoxane®), daunorubicin (also known as dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, sold under the tradename Cerubidine®), daunorubicin liposomal (daunorubicin citrate liposome, sold under the tradename DaunoXome®), mitoxantrone (also known as DHAD, sold under the tradename Novantrone®), epirubicin (sold under the tradename Ellence™), idarubicin (sold under the tradenames Idamycin®, Idamycin PFS®), and mitomycin C (sold under the tradename Mutamycin®).
Examples of anti-metabolites include, but are not limited to, claribine (2- chlorodeoxyadenosine, sold under the tradename leustatin®), 5-fluorouracil (sold under the tradename Adrucil®), 6-thioguanine (sold under the tradename Purinethol®), pemetrexed (sold under the tradename Alimta®), cytarabine (also known as arabinosylcytosine (Ara-C), sold under the tradename Cytosar-U®), cytarabine liposomal (also known as Liposomal Ara-C, sold under the tradename DepoCyt™), decitabine (sold under the tradename Dacogen®), hydroxyurea (sold under the tradenames Hydrea®, Droxia™ and Mylocel™), fludarabine (sold under the tradename Fludara®), floxuridine (sold under the tradename FUDR®), cladribine (also known as 2-chlorodeoxyadenosine (2-CdA) sold under the tradename Leustatin™), methotrexate (also known as amethopterin, methotrexate sodim (MTX), sold under the tradenames Rheumatrex® and Trexall™), and pentostatin (sold under the tradename Nipent®).
Examples of retinoids include, but are not limited to, alitretinoin (sold under the tradename Panretin®), tretinoin (a\\-trans retinoic acid, also known as ATRA, sold under the tradename Vesanoid®), Isotretinoin (13-c/s-retinoic acid, sold under the tradenames Accutane®, Amnesteem®, Claravis®, Clarus®, Decutan®, Isotane®, Izotech®, Oratane®, Isotret®, and Sotret®), and bexarotene (sold under the tradename Targretin®).
Examples of other cytotoxic agents include, but are not limited to, arsenic trioxide (sold under the tradename Trisenox®), asparaginase (also known as L-asparaginase, and Erwinia L-asparaginase, sold under the tradenames Elspar® and Kidrolase®).
Intermediates and Examples
The following examples are intended to be illustrative only and not limiting in any way. Unless otherwise noted, the following Intermediates and Examples were purified vial silica gel column chromatograph using RediSep® Rf columns from Teledyne Isco,
Inc. Abbreviations used are those conventional in the art or the following:
ACN acetonitrial
BSA bovine serum albumin
C Celsius
CDI 1 , 1 '-carbonyldiimidazole
d doublet
dd doublet of doublets
DAST diethylaminosulfur trifluoride
DEAD diethyl azodicarboxylate
DIPEA NN-diisopropylethylamine
DMF N,N-dimethylformamide
DMSO dimethylsulfoxide
DTT dithiothreitol
EtOAc ethyl acetate
EtOH ethanol
g gram
h hour(s)HATU 2-(1 H-7-azabenzotriazol-1-yl)-1 , 1 ,3,3-tetramethyluronium hexafluorophosphate
HEPES 4-(2-hydroxyethyl)-1-piperazineethylanesulfonic acid
HPLC high pressure liquid chromatography
Hunig's Base NN-diisopropylethylamine
kg kilogram
L liter
LC liquid chromatographyLCMS liquid chromatography and mass spectrometry MeOH methanol
MS mass spectrometry
m multiplet min minutes
ml. milliliter(s)
μΜ micromolar
m/z mass to charge ratio
nm nanometer
nM nanomolar
N normal
NADPH nicotinamide adenine dinucleotide phosphate
NMP N-methylpyrrolidone
NMR nuclear magnetic resonance
PdCI2(dppf).CH2CI2 1 , 1 '-bis(diphenylphosphino)ferrocene-palladium(ll)dichloride dichloromethane complex
pTsOH p-toluenesulfonic acid
rac racemic
Rt retention time
s singlet
sat. saturated
t triplet
TBTU 0-(Benzotriazol-1 -yl)-N,N,N',N'-tetramethyluronium tetrafluoroborate
TCEP tris(2-carboxyethyl)phosphine
TEA triethylamine
TFA trifluoroacetic acid
THF tetrahydrofuran
TLC thin layer chromatography
TMS-CN trimethylsilyl cyanide
Instrumentation
LCMS:
LCMS data (also reported herein as simply MS) were recorded using a Waters System (Acuity UPLC and a Micromass ZQ mass spectrometer; Column: Acuity HSS C18 1 .8- micron, 2.1 x 50 mm; gradient: 5-95 % acetonitrile in water with 0.05 % TFA over a 1.8 min period; flow rate 1.2 mL/min; molecular weight range 200-1500; cone Voltage 20 V; column temperature 50 °C). All masses reported are those of the protonated parent ions unless recorded otherwise.
High Resolution Mass Spectrometry (HRMS): HRMS Method A: ESI-MS data were recorded using a Synapt G2 HDMS (TOF mass spectrometer, Waters) with electrospray ionization source. The resolution of the MS system was approximately 15000. Leucine Enkephalin was used as lock mass (internal standards) infused from lockspary probe. The compound was infused into the mass spectrometer by UPLC (Acquity, Waters) from sample probe. The separation was performed on Acquity UPLC BEH C18 1x50 mm column at 0.2 mL/min flow rate with the gradient from 5% to 95% in 3 min. Solvent A was Water with 0.1 % Formic Acid and solvent B was Acetonitrile with 0.1 % Formic Acid. The mass accuracy of the system has been found to be <5 ppm with lock mass.
HRMS Method B: LC-MS/ESI-MS data were recorded on an Acquity G2 Xevo QTof - Rs(FWHM) > 20000 Accuracy < 5 ppm. The separation was performed on Acquity CSH 1 .7μηη 2.1 x50mm - 50°C column Eluent A: Water + 3.75 mM ammonium acetate. Eluent B: Acetonitrile. Gradient: from 2 to 98% B in 4.4 min - flow 1 .0 mL/min.
HRMS methods A and B are referred to throughout as HRMS(A) or HRMS(B), respectively.
Intermediates
Intermediate A: (R)-4-isobutyloxazolidin-2-one
Figure imgf000048_0001
To a cooled (4 °C) solution of (R)-2-amino-4-methylpentan-1 -ol (2.98 g, 25.4 mmol) and triethylamine (7.6 mL, 54 mmol, 2.1 equiv) in CH2CI2 (80 mL) was added dropwise a solution of triphosgene (2.52g, 8.49 mmol, 0.334 equiv) in 10 ml of CH2CI2 over 30 min.
The reaction mixture was stirred at 4 °C for 15 min, warmed up to room temperature and stirred for an additional 1 h. The mixture was treated with saturated NH4CI (25 mL), followed by CH2CI2 (50 mL) and the resulting mixture was stirred for 20 min. The layers were separated and the organic layer was washed with water. The combined aqueous layers were extracted with CH2CI2 (50 mL). The combined organic layers were dried over Na2S04, filtered and concentrated to give (R)-4-isobutyloxazolidin-2-one (3.22 g) in 88% yield. The crude product was used for the next reaction without purification. 1H NMR (400 MHz, CD3OD) δ 4.53 - 4.47 (m, 1 H), 4.00 - 3.92 (m, 2 H), 1.67 (ddq, J = 13, 8.0, 6.5 Hz, 1 H), 1 .56 - 1 .48 (m, 1 H), 1.40 - 1.32 (m, 1 H), 0.95 (d, J = 6.1 Hz, 3 H), 0.93 (d, J = 6.1 Hz, 3 H).
The Intermediates in Table 1 were prepared by a method similar to the one described for the preparation of Intermediate A.
Table 1.
Figure imgf000049_0001
Figure imgf000050_0001
Table 2. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 1.
Figure imgf000050_0002
L: 3-oxa-1 -azaspiro[4.4]nonan- (CDCI3) δ 5.62 (br s, 1 H), 4.25 (s, 2 no UV signal 2-one H), 1.90 - 1.65 (m, 8 H)
Intermediate M: 4-phenyl-1 ,8-dioxa-3-azaspiro[4.5]decan-2-one
Figure imgf000051_0001
Step 1 : Preparation of 4-(amino(phenyl)methyl)tetrahydro-2H-pyran-4-ol
To dihydro-2H-pyran-4(3H)-one (1001 mg, 10 mmol) and triethylamine (0.279 mL, 2.00 mmol) was slowly added TMS-CN (1 190 mg, 12.00 mmol) [Caution: exothermic reaction]. After stirring for 1 hour, the mixture was concentrated under reduced pressure. The residue, dissolved in diethyl ether (10 mL), was added dropwise to phenylmagnesium bromide (3M solution in diethyl ether, 4.33 mL, 13.00 mmol). Additional ~5 mL of diethyl ether was added and the suspension was stirred for ~4 hour. To the reaction mixture was added very slowly MeOH (3.0 mL), followed by the careful and slow additions of NaBH4 (454 mg, 12.00 mmol) and MeOH (12 mL) in portions (gas development observed). The reaction mixture was stirred overnight and water (~6 mL) was added carefully, followed by 10% aqueous HCI solution (-20 mL). The mixture was vigrously stirred for 4 hour and diethyl ether was added. The separated organic layer was extracted with 10% aqueous HCI solution (1 x -20 mL). The combined aqueous layers were washed with diethylether (2x). The acidic layers were made basic by the addition of 6N aqueous NaOH solution. The milky white mixture was extracted with DCM (1x), ethyl acetate/THF (1 :1 ; 1x) and ethyl acetate (2x). The organic layers (DCM and ethyl acetate solutions independently) were washed with saturated aqueous NaHC03 solution, dried over Na2S04, filtered off and concentrated under reduced pressure providing crude 4-(amino(phenyl)methyl)tetrahydro-2H-pyran-4-ol, which was directly used in the next reaction without further purification.
Yellowish liquid. Yield: 451 mg. LCMS m/z 208.2 (M + H)+, Rt 0.29 min.
Step 2: Preparation of 4-phenyl-1 ,8-dioxa-3-azaspiro[4.5]decan-2-one
To a mixture of CDI (388 mg, 2.394 mmol) in THF (1.5 mL) was added slowly a solution of 4-(amino(phenyl)methyl)tetrahydro-2H-pyran-4-ol (451 mg, 2.176 mmol) in THF (3 mL). The mixture was stirred under argon for -5 hours. The mixture was diluted with saturated aqueous NaHC03 solution and DCM. The separated aqueous layer was extracted with DCM (2x) and the combined organic layers were washed with 0.5N aqueous HCI solution and brine, dried over sodium sulfate, filtered off and concentrated under reduced pressure. The residue was purified by column chromatography [Si02, 12 g, 0 - 100% heptane/ethyl acetate] providing 4-phenyl-1 ,8-dioxa-3-azaspiro[4.5]decan-2- one as a white solid. Yield: 330 mg. LCMS m/z 234.1 (M + H)+; Rt 0.52 min.
Intermediate N: (S)-4-(biphenyl-4-yl)oxazolidin-2-one
Figure imgf000052_0001
Step 1 : Preparation of vinylbiphenyl
To a suspension of methyltriphenylphosphonium bromide (5.10 g, 14.27 mmol) in THF (26 mL) was slowly added potassium tert-butoxide (1 M solution in THF, 14.27 mL) over -20 min at 0 °C. The reaction mixture was allowed to warm up to room temperature and stirred for 10 min. The mixture was cooled to 0°C and a solution of 4- biphenylcarbaldehyde (2.0 g, 10.98 mmol) in THF (9 mL) was added over 20 min. The reaction mixture was allowed to warm up to room temperature and stirred for -19 hour. The mixture was filtered and the filtrate was concentrated under reduced pressure. The residue was dissolved/suspended in DCM and filtered through a silica pad and the filtrate was concentrated under reduced pressure. The residue was purified by column chromatography [Si02, 80 g, EtOAc/heptane] to provide vinylbiphenyl (1 .845 g) as a white solid. LCMS Rt 0.79 min.
Step 2: Preparation of (S)-tert-butyl 1 -(biphenyl-4-yl)-2-hydroxyethylcarbamate
To a solution of tert-butyl carbamate (2.82 g, 24.08 mmol) in 1-propanol (30 mL) was added aqueous NaOH solution (0.38M, 61.5 mL, 23.36 mmol). The mixture was stirred for 5 min and 1 ,3-dichloro-5,5-dimethylimidazolidine-2,4-dione (2.351 g, 1 1 .93 mmol) was added. The mixture was stirred stirred for 10 min and (DHQ)2PHAL (0.303 g, 0.388 mmol), dissolved in 1-propanol (30 mL), was added followed by a solution of vinylbiphenyl (1 .4 g, 7.77 mmol) in 1 -propanol (60 mL). A suspension of potassium osmate dihydrate (0.1 14 g, 0.31 1 mmol) in aqueous NaOH solution, (0.38M, 0.613 mL, 0.233 mmol) was added and the mixture was stirred for - 16 hours. The reaction mixture was diluted with water (200 mL) and extracted with EtOAc (3 x 200 mL). The combined organic layers were washed with brine (2x 400 mL), dried over sodium sulfate, filtered off and concentrated under reduced pressure. The residue was purified by column chromatography [Si02, 80 g, EtOAc/heptane] to provide (S)-tert-butyl 1-(biphenyl-4-yl)-2- hydroxyethylcarbamate (609 mg). LCMS m/z 258.2 (M + H; loss of f-Bu)+, Rt 0.97 min. 1 H NMR (400 MHz, CD3OD) δ ppm 7.62 - 7.56 (m, 4 H), 7.45 - 7.37 (m, 4 H), 7.34 - 7.2(m, 1 H), 4.69 (t, J = 5.8 Hz, 1 H), 3.76 - 3.63 (m, 2H), 1.44 (br. s., 9 H)
Step 3: Preparation of (S)-2-amino-2-(biphenyl-4-yl)ethanol
To a solution of (S)-tert-butyl 1 -(biphenyl-4-yl)-2-hydroxyethylcarbamate (608 mg, 1 .940 mmol) in MeOH (3 mL) was added HCI (4M in dioxane, 8 mL) at room temperature. The mixture was stirred for 1 hour and concentrated under reduced pressure. The residue was dissolved in DCM (10 mL)/water (1.0 mL) and stirred with NaHCC>3 for 1 hour. The mixture was filtered off and rinsed with DCM. The filtrate was dried over sodium sulfate, filtered off and concentrated under reduced pressure providing (S)-2-amino-2-(biphenyl- 4-yl)ethanol (171 mg) as a white solid. LCMS m/z 214.2 (M + H)+, Rt 0.58 min. Step 4: Preparation of (S)-4-(biphenyl-4-yl)oxazolidin-2-one
To a solution of (S)-2-amino-2-(biphenyl-4-yl)ethanol (171 mg, 0.802 mmol) in THF (12 mL) under argon atmosphere was added CDI (132 mg, 0.814 mmol). The solution was stirred at room temperature for 2 hours. The mixture was diluted with saturated aqueous NaHC03 solution (40 mL) and extracted with EtOAc (2x 30 mL). The combined organic layers were washed with 0.5M aqueous HCI solution (30 mL), brine (40 mL), dried over sodium sulfate, filtered off and concentrated under reduced pressure. The residue was dissolved in DCM and concentrated under rduced pressure to provide crude (S)-4- (biphenyl-4-yl)oxazolidin-2-one (156 mg) as a beige solid, which was used without further purification. LCMS m/z 240.1 (M + H)+, Rt 0.80 min.
1 H NMR (400 MHz, CD3OD) δ ppm 4.19 (dd, J=8.61 , 6.50 Hz, 1 H) 4.80 (t, J=8.73 Hz, 1 H) 5.05 (dd, J=8.78, 6.48 Hz, 1 H) 7.31 - 7.38 (m, 1 H) 7.39 - 7.54 (m, 4 H) 7.55 - 7.71 (m, 4 H).
Intermediate P: 4,4,5,5-tetramethyloxazolidin-2-one
Figure imgf000053_0001
Step 1 : Preparation of Methyl 2-(tert-butoxycarbonylamino)-2-methylpropanoate To a solution of 2-(tert-butoxycarbonylamino)-2-methylpropanoic acid (10.03 g, 49.4 mmol) in MeOH/DCM (60mL/140ml_) at room temperature was added drop wise (trimethylsilyl)diazomethane (37.0 mL, 74.0 mmol). The reaction mixture was stirred for 30 minutes. Acetic acid was added drop wise to quench (trimethylsilyl)diazomethane. The reaction mixture was concentrated under reduced pressure to afford the desired product as a white solid (10.56 g). LCMS m/z 240.2 (M + Na)+, Rt 0.71 min.
Step 2: Preparation of tert-butyl 3-hydroxy-2,3-dimethylbutan-2-ylcarbamate
To a solution of methyl 2-(tert-butoxycarbonylamino)-2-methylpropanoate (10.56 g, 48.6 mmol) in THF (300ml_) at 0 °C was added drop wise methylmagnesium bromide (64.8 mL, 194 mmol). Cold bath was removed after 1 hour. The reaction was stirred at 20 °C for 4 hours. The reaction was cooled back 0 °C and quenched with saturated NH4CI solution (10mL). The reaction mixture was then allowed to warm to room temperature, and diluted with EtOAc (100mL) and water (50mL). The phases were separated and the aqueous layer was extracted with EtOAc (2x100mL). The combined organics were then dried (Na2S04) and concentrated. The residue was purified via silica gel flash chromatography (0-20% EtOAc-Hexanes) to afford the desired product as a white solid (9.02 g). LCMS m/z 240.1 (M + Na)+, Rt 0.78 min. Step 3: Preparation of 4,4,5, 5-tetramethyloxazolidin-2-one
To tert-butyl 3-hydroxy-2,3-dimethylbutan-2-ylcarbamate (10.02 g, 46.1 mmol) in THF (300 ml) was added portion wise potassium 2-methylpropan-2-olate (7.24 g, 64.6 mmol). The reaction was stirred for five hours and quenched with HCI (1 M, 66mL) to pH=2. The reaction mixture was then concentrated under vacuum to about one third of the volume, and diluted with water (50mL). The aqueous layer was then extracted with DCM (3x100mL). The combined organic was washed with brine (50mL), dried (Na2S04) and concentrated to give crude product as a light tan oil (6.25 g). LCMS m/z 144.1 (M + H)+, Rt 0.42 min. The Intermediates in Table 2b were prepared by a method similar to the one described for the preparation of Intermediate P. Table 2b.
Figure imgf000055_0002
Intermediate 1 : (R)-3-(2-chloropyrimidin-4-yl)-4-phenyloxazolidin-2-one
Figure imgf000055_0001
A solution of (R)-4-phenyloxazolidin-2-one (2.9484 g, 18.07 mmol) and 2,4- dichloropyrimidine (3.1872 g, 21 .39 mmol, 1 .184 equiv) in DMF (30 mL) was treated with NaH (95 %, 0.4773 g, 18.89 mmol, 1.046 equiv), then the resulting mixture (yellow to red cloudy) was stirred at room temperature for 3 h. The reaction mixture was diluted with EtOAc (200 mL), washed with sat. NH4CI (75 mL) and 4% aqueous NaCI (2 x 100 mL), dried over Na2S04, filtered and concentrated. Silica gel column chromatography
(EtOAc/Heptane 0 to 40%) provided (R)-3-(2-chloropyrimidin-4-yl)-4-phenyloxazolidin-2- one (2.7020 g, white sticky solid) in 46.9% yield. 1H NMR (400 MHz, CD3OD) δ 8.47 (d, J = 5.6 Hz, 1 H), 8.18 (d, J = 6.1 Hz, 1 H), 7.38 - 7.30 (m, 5 H), 5.81 (dd, J = 8.6, 3.5 Hz, 1 H), 4.88 (t, J = 8.6 Hz, 1 H), 4.37 (dd, J = 8.6, 3.5 Hz, 1 H) ; MS m/z 276.4 (M + H)+. The Intermediates in Table 3 were prepared by a method similar to the one described for the preparation of Intermediate 1.
Table 3.
Figure imgf000056_0001
Figure imgf000057_0001
Figure imgf000058_0001
Intermediate 29 Intermediate 30
Figure imgf000058_0002
Table 4. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 3.
Figure imgf000058_0003
Figure imgf000059_0001
Figure imgf000060_0001
Figure imgf000061_0001
Intermediate 31 : (S)-3-(2-fluoropyrimidin-4-yl)-4-isopropyloxazolidin
Figure imgf000061_0002
A solution of 2,4-difluoropyrimidine (3.5 mL, 41 mmol) and (S)-4-isopropyloxazolidin-2- one (5.3 g 41 mmol) in 30 mL DMF was cooled to 0 °C under N2 atmosphere. NaH (2.1 g of 60% suspension, 53 mmol) was slowly added. Bubbling exotherm observed. Internal temp was kept below 5 °C. After 5 minutes, cold bath was removed. Reaction mixture (a sandy suspension) was allowed to warm to room temp and stir 18 h. The reaction mixture was diluted with water (100 mL) and extracted with (3 x 75 mL) EtOAc. Organic layer was washed with 50 mL each water, and brine. Dried over Na2S04, and concentrated on silica gel in vacuo. Column chromatography (EtOAc/heptane 10 to 100% gradient) gave 3.1 g (S)-3-(2-fluoropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (IV) as a crystalline white solid (33%). 1H NMR (400 MHz, CDCI3) δ 8.50 (dd, J = 5.8, 2.2 Hz, 1 H), 8.19 (dd, J = 5.8, 3.8 Hz, 1 H), 4.79 (dt, J = 8.1 , 3.5 Hz, 1 H), 4.48 - 4.34 (m, 2H), 2.64 (heptd, J = 7.0, 3.6 Hz, 1 H), 1 .01 (d, J = 7.0 Hz, 3H), 0.90 (d, J = 6.9 Hz, 3H). MS m/z 471.8 and 471 .8 (M + H)+.
The Intermediates in Table 4b were prepared by a method similar to the one described for the preparation of Intermediate 1 and 31. Table 4b.
Figure imgf000062_0001
Figure imgf000063_0001
Table 4c. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 4b.
Figure imgf000063_0002
43: 3-(2-chloro-5- MS m/z (M + fluoropyrimidin-4-yl)-4,4- H)+ 246.0, Rt dimethyloxazolidin-2-one 0.70 min
44: 3-(2-chloro-5- MS m/z (M + fluoropyrimidin-4-yl)oxazolidin- H)+ 218.0, Rt
2-one 0.47 min
Intermediate 46: (S)-4-(biphenyl-4-yl)-3-(2-chloropyrimidin-4-yl)oxazolidin-2-one
Figure imgf000064_0001
To a solution of 2,4-dichloropyrimidine (46.5 mg, 0.312 mmol) and (S)-4-(biphenyl-4- yl)oxazolidin-2-one (74.7 mg, 0.312 mmol) in DMF (700 μΙ_) was added NaH (60%wt., 10.49 mg, 0.437 mmol) in two portions within ~5 min [Caution: exotherm; gas development] at room temperature (water bath). The reaction mixture was stirred for 1 .5 hour. The mixture was diluted with EtOAc (25 ml_), stirred for 5 min and then diluted slowly with diluted brine (10 ml_; 1 :1 brine/water). The mixture was poured into diluted brine (40 ml.) and EtOAc (25 ml_). The separated organic phase was washed with diluted brine (3x 40 ml), dried over Na2S04, filtered off and concentrated under reduced pressure. The residue was purified by column chromatography [Si02, 40 g, EtOAc/heptane] to provide (S)-4-(biphenyl-4-yl)-3-(2-chloropyrimidin-4-yl)oxazolidin-2- one (49.5 mg). LCMS m/z 352.2 (M + H)+, Rt 1.06 min.
Intermediate 47 : 3-(2-chloropyrimidin-4-yl)-4-phenyl-1 ,8-dioxa-3- azaspiro[4.5]decan-2-one
Figure imgf000064_0002
To a mixture of 4-phenyl-1 ,8-dioxa-3-azaspiro[4.5]decan-2-one (300 mg, 1.286 mmol) and 2,4-dichloropyrimidine (192 mg, 1 .286 mmol) in DMF (7 mL) under argon was added NaH (60%wt, 67.9 mg, 2.83 mmol) in two portions. The mixture was stirred for ~1 hour. The reaction mixture was carefully poured into ice-colled 0.25N aqueous HCI solution. DCM and aqueous NaHCC>3 solution were added. The separated aqueous layer was extracted with DCM (3x) and ethyl acetate (1 x). The organic layers (DCM and ethyl acetate containing layers independently) were washed with brine, dried over Na2S04 and filtered off. The organic layers were combined and concentrated under reduced pressure providing crude 3-(2-chloropyrimidin-4-yl)-4-phenyl-1 ,8-dioxa-3- azaspiro[4.5]decan-2-one (330 mg) as a yellowish liquid, which was directly used in the next reaction without further purification. LCMS m/z 346.1 (M + H)+, Rt 0.83 min.
Intermediate 48 : 7-(2-chloropyrimidin-4-yl)-8-phenyl-2,5-dioxa-7- azaspiro[3.4]octan-6-one
Figure imgf000065_0001
Prepared using similar methods as described above for 3-(2-chloropyrimidin-4-yl)-4- phenyl-1 ,8-dioxa-3-azaspiro[4.5]decan-2-one, but starting with oxetan-3-one.
LCMS m/z 318.1 (M + H)+, Rt 0.78 min. Intermediate 50: 3-(2-chloro-5-fluoropyrimidin-4-yl)-5,5-dimethyloxazolidin-2-one
Figure imgf000065_0002
Step 1
A solution of 2,4-dichloro-5-fluoropyrimidine (2 g, 1 1.98 mmol) in acetonitrile (10 mL) was cooled to -40 °C, avoiding freezing. To this solution was added diisopropylamine (3.82 mL, 21 .88 mmol) followed by 1 -amino-2-methylpropan-2-ol (1 .5 g, 16.83 mmol). The reaction mixture was removed from the cooling bath, warmed to room temperature and allowed to stir overnight (-18 hours). Solvents were removed in vacuo and the residue was taken up in a minimum of dichloromethane (-1.5-2 mL) and diluted with heptane until slightly cloudy. This mixture was loaded onto a 40 gram BioRad silica gel cartridge. Purification by flash chromatorgraphy (Analogix System, 20 min gradient, 0-25% methanol/dichloromethane, 40 mL/min.) provided 1 -(2-chloro-5-fluoropyrimidin-4- ylamino)-2-methylpropan-2-ol as a white solid. LCMS m/z 220.1 , 221 .8 (M + H)+, Rt 0.49 min.
Step 2
To a suspension of 1-(2-chloro-5-fluoropyrimidin-4-ylamino)-2-methylpropan-2-ol (400 mg, 1.82) in DCM/ethylacetate (5 mL) was added 2,6-lutidine (1 mL, 8.59 mmol). The reaction was cooled to -78°C and triphosgene (292 mg, 0.983 mmol) was added in a single portion. The reaction was removed from the cooling bath and allowed to warm to room temperature. The reaction had a pinkish coloration at this time. LCMS indicated consumption of starting material and conversion the intermediate acyl chloroformate adduct of 1 -(2-chloro-5-fluoropyrimidin-4-ylamino)-2-methylpropan-2-ol. The reaction was sealed and stirred overnight. The reaction was stirred at room temperature overnight to provide only partial closure of the intermediate acyl formate to the cyclic carbamate. The reaction (sealed) was then heated at 60°C for ~4 hours until intermediate acyl chloroformate was consumed. Reaction was cooled to room temperature, diluted with DCM (-50 mL) and washed with water (1 x50 mL) and sat. NaHCC>3 (1 x50 mL). Aqueous layers were back extracted with DCM (-50 mL). The combined organics were dried over MgS04, filtered and concentrated in vacuo. The solid was dissolved in DCM (-15 mL) and celite (-4 gram) was added. The mixture was concentrated and dried in vacuo to provide a solid pre-load for subsequent purification. Purification by flash chromatography(Analogix System, 80 gram silica gel column, 25 min. gradient, 0-25% methanol/dichloromethane, 40 mL/min) provided 3-(2-chloro-5-fluoropyrimidin-4-yl)-5,5- dimethyloxazolidin-2-one as a white solid. 1 H NMR (400 MHz, METHANOL-c/4) δ ppm 1 .58 (s, 8 H) 4.02 (s, 2 H) 8.59 (d, J=3.13 Hz, 1 H): LCMS m/z (M + H)+ 246.1 , 247.8.0, Rt 0.61 min The Intermediates in Table 4d were prepared by methods similar to the one described for the preparation of Intermediate 50. Table 4d.
Figure imgf000067_0002
Table 4e. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 4d.
Figure imgf000067_0003
Intermediate 53: 3-(2,6-dichloropyrimidin-4-yl)-4,4-dimethyloxazolidin-2-one
Figure imgf000067_0001
A solution of 4,4-dimethyloxazolidin-2-one (0.103 g, 0.895 mmol) and 2,4,6- trichloropyrimidine (0.181 g, 0.984 mmol, 1.10 equiv) in DMF (3 mL) was treated with NaH (60 %, 0.0429 g, 1.07 mmol, 1.2 equiv), then the resulting mixture (yellow) was stirred at room temperature for 1 h. The reaction mixture was diluted with EtOAc (20 mL), washed with saturated aqueous NaCI (2 x 20 mL), dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 0 to 40%) provided3- (2,6-dichloropyrimidin-4-yl)-4,4-dimethyloxazolidin-2-one (0.146 g, white solid) in 62.3% yield. 1H NMR (300 MHz, CDCI3) δ 8.14 (s,1 H), 4.16 (s, 2 H), 1.74 (s, 9H); LCMS m/z 261 .9 (M + H)+, Rt 0.91 min. The Intermediates in Table 4f were prepared by a method similar to the one described for the preparation of Intermediate 53. Table 4f.
Figure imgf000068_0002
Table 4g. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 4f.
Figure imgf000068_0003
Intermediate 56 : (S)-methyl 4-(1 -(tert-butoxycarbonylamino)ethyl)benzoate
Figure imgf000068_0001
To a solution of (S)-methyl 4-(1 -aminoethyl)benzoate (4.9 g, 22.7 mmol) in DCM (1 14 ml.) was added di-tert-butyl dicarbonate (5.95 g, 27.3 mmol) and triethylamine (6.97 ml_, 50 mmol). The solution was stirred for 16 h at room temperature then washed with water and brine. The organic layer was dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/heptane 0 to 80%) provided (S)-methyl 4-(1-(tert- butoxycarbonylamino)ethyl)benzoate as a white solid (6.35 g, 100% yield). 1 H NMR (400 MHz, CDCI3) δ 8.04 - 7.96 (m, 2H), 7.40 - 7.33 (m, 2H), 4.83 (s, 1 H), 3.91 (s, 3H), 1 .43 - 1 .23 (m, 12H); MS m/z 224.0 (M - 56 + H).
Intermediate 57 : (S)-tert-butyl 1 -(4-(hydroxymethyl)phenyl)ethylcarbamate
Figure imgf000069_0001
To a cooled (0 °C) solution of (S)-methyl 4-(1-(tert-butoxycarbonylamino)ethyl)benzoate (6.35 g, 22.7 mmol) in THF (1 14 mL) was added a solution of LAH in THF (2.0 M, 13.64 ml_, 27.3 mmol) and the resulting mixture was stirred at room temperature for 40 min. The reaction mixture was quenched by addition of a 1 N NaOH solution until gas evolution ceased. The reaction mixture was filtered, washed with EtOAc. After separation, the aqueous phase was washed with EtOAc (2 x 150 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/heptane 0 to 100%) provided (S)-tert-butyl 1-(4- (hydroxymethyl)phenyl)ethylcarbamate as a white solid (5.01 g, 84% yield).
1 H NMR (400 MHz, CDCI3) δ 7.35 - 7.23 (m, 4H), 4.80 - 4.71 (m, 1 H), 4.67 (s,2H), 2.04 (bs, 1 H), 1.47 - 1.37 (m, 12H); MS m/z 196.0 (M - 56 + H).
Intermediate 58: (S)-tert-butyl 1-(4-(chloromethyl)phenyl)ethylcarbamate
Figure imgf000069_0002
To a solution of (S)-tert-butyl 1-(4-(hydroxymethyl)phenyl)ethylcarbamate (503 mg, 2 mmol) in DCM (10 mL) was added methanesulfonyl chloride (275 mg, 2.4 mmol) and triethylamine (0.56 mL, 4 mmol). The solution was stirred for 16 h at room temperature then washed with water and brine. After separation, the organic phase was dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/heptane 0 to 80%) provided (S)-tert-butyl 1-(4-(chloromethyl)phenyl)ethylcarbamate as a white solid (254 g, 47.1 % yield).
1 H NMR (400 MHz, CDCI3) δ 7.40 - 7.24 (m, 4H), 4.79 (s, 1 H), 4.58 (s, 2H), 1.50 - 1 .30 (br m, 12H); MS m/z 214.0 (M - 56 + H). Intermediate 59: (S)-tert-butyl 1 -(4-((5,6-dihydro-[1 ,2,4]triazolo[4,3-a]pyrazin-7(8H)- yl)methyl)phenyl)ethylcarbamate
Figure imgf000070_0001
A solution of (S)-tert-butyl 1-(4-(chloromethyl)phenyl)ethylcarbamate (127 mg, 0.47 mmol), 5,6,7,8-tetrahydro-[1 ,2,4]triazolo[4,3-a]pyrazine (91 mg, 0.56 mmol) and DIPEA (183 mg, 1.41 mmol) in DMSO (2.3 mL) was heated at 80 °C for 16 h. The reaction mixture was diluted with EtOAc (20 mL) and washed with water (20 mL). After separation, the aqueous phase was washed with EtOAc (2 x 15 mL). Combined organics were dried over Na2S04, filtered and concentrated. The crude product was used to next step without further purification.
MS m/z 358.3 (M + H)
Intermediate 60: (S)-1-(4-((5,6-dihydro-[1 ,2,4]triazolo[4,3-a]pyrazin
yl)methyl)phenyl)ethanamine
Figure imgf000070_0002
To a solution of (S)-tert-butyl 1 -(4-((5,6-dihydro-[1 ,2,4]triazolo[4,3-a]pyrazin-7(8H)- yl)methyl)phenyl)ethylcarbamate (168 mg, 0.47 mmol) in DCM (2 mL) was added TFA (2 mL, 26 mmol) slowly at -78 °C. The reaction was stirred at room temperature for 1 h then concentrated and diluted with DCM (10 mL). The solution was stirred with 3 eq. of MP- carbonate resin (3.28 mmol/g, Biotage) for 1 hour at room temperature. The resin was removed by filtration and washed (2 x 5 mL) with DCM. The filtrate was concentrated and the crude residue was used to next step without further purification.
MS m/z 258.2 (M + H).
Intermediate 61 : (S)-4-(1-(tert-butoxycarbonylamino)ethyl)-2-fluorobenzoic acid
Figure imgf000071_0001
To a solution of (S)-4-(1-aminoethyl)-2-fluorobenzoic acid (5 g, 22.76 mmol) in water (66 ml.) and THF (66 ml.) was added di-tert-butyl dicarbonate (6.95 g, 31.9 mmol) and sodium carbonate (5.74 g, 68.3 mmol). The solution was stirred for 16 h at room temperature then THF was removed under reduced pressure. The aqueous solution was acidified with 1 N HCI to pH 3-4 and extracted with EtOAc (3 x 60 ml_). Combined organics were dried over Na2S04, filtered and concentrated to give a white solid (1 .94 g,
30.1 % yield). The crude product was used to next step without further purification.
1 H NMR (400 MHz, MeOD) δ 7.89 (t, J = 7.8 Hz, 1 H), 7.20 (dd, J = 8.2, 1 .7 Hz, 1 H), 7.13 (dd, J = 12.0, 1 .6 Hz, 1 H), 4.70 (d, J = 7.1 Hz, 1 H), 1.47 - 1.35 (m, 12H); MS m/z 282.0 (M - H).
Intermediate 62: (S)-tert-butyl 1-(3-fluoro-4-(methoxy(methyl)carbamoyl)phenyl) ethylcarbamate
Figure imgf000071_0002
A solution of (S)-4-(1-(tert-butoxycarbonylamino)ethyl)-2-fluorobenzoic acid (1.416 g, 5mmol), Ν,Ο-dimethylhydroxylamine hydrochloride (732 mg, 7.5 mmol), HATU (2.85 g, 7.5 mmol) and DIPEA (3.49 ml_, 20 mmol) in DMF (25 ml.) was stirred at room temperature for 16 h. The reaction mixture was diluted with EtOAc and washed with water. After separation, the aqueous phase was washed with EtOAc (2 x 75 ml_). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/heptane 12 to 100%) provided (S)-tert-butyl 1-(3-fluoro- 4-(methoxy(methyl)carbamoyl)phenyl)ethylcarbamate as a white solid (1.5 g, 92 % yield). 1 H NMR (400 MHz, CDCI3) δ 7.40 (t, J = 7.4 Hz, 1 H), 7.13 (dd, J = 7.8, 1 .6 Hz, 1 H), 7.04 (dd, J = 10.7, 1.6 Hz, 1 H), 4.80 (br s, 1 H), 3.56 (s, 3H), 3.34 (s, 3H), 1.50 - 1.29 (m, 12H); MS m/z 327.1 (M + H). Intermediate 63 : (S)-tert-butyl 1 -(3-fluoro-4-formylphenyl)ethylcarbamate
Figure imgf000072_0001
Procedure 1 : To a cooled (0 °C) solution of (S)-tert-butyl 1 -(3-fluoro-4- (methoxy(methyl)carbamoyl)phenyl)ethylcarbamate (1 .175 g, 3.6 mmol) in THF (36 mL) was added a solution of LAH in THF (1 .0 M, 18 mL, 18 mmol) and the resulting mixture was stirred at 0 °C for 20 min. The reaction mixture was quenched by addition of a saturated Na2S04 solution until gas evolution ceased. The reaction mixture was extracted with EtOAc (2 x 100 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/heptane 12 to 100%) provided (S)-tert-butyl 1 -(3-fluoro-4-formylphenyl)ethylcarbamate as a white solid (760 mg, 79% yield).
Procedure 2: A solution of (S)-tert-butyl 1 -(4-bromo-3-fluorophenyl)ethylcarbamate (318 mg, 1 mmol) in dry THF (5 mL) was cooled to -78 °C. BuLi (2.5 M, 840 μΙ_, 2.1 mmol) was added dropwise and the resulting solution was stirred at -78 °C for 1 h. Then DMF (232 L, 3.00 mmol) was added in one portion. The reaction was stirred for another 30 min at -78 °C then quenched with sat. NH4CI solution. The reaction was stirred at room temperature for another 30 min then diluted with EtOAc, washed with water and brine. The separated organic was dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/heptane 0 to 80%) provided (S)-tert-butyl 1 -(3-fluoro-4- formylphenyl)ethylcarbamate as a white solid (70 mg, 26.2% yield).
1 H NMR (400 MHz, CDCI3) δ 10.31 (s, 1 H), 7.87 - 7.80 (m, 1 H), 7.20 (dd, J = 8.2, 1 .3 Hz, 1 H), 7.1 1 (dd, J = 1 1 .5, 1 .4 Hz, 1 H), 4.80 (br s, 1 H), 1 .45 (br s, 12H); MS m/z 212.1 (M - 56 + H).
Intermediate 64: (S)-tert-butyl 1 -(3-fluoro-4-((3,3,4-trimethylpiperazin-1 - yl)methyl)phenyl)ethyl carbamate
Figure imgf000073_0001
(General procedure A for reductive amination)
A solution of (S)-tert-butyl 1-(3-fluoro-4-formylphenyl)ethylcarbamate (267 mg, 1 mmol) and 1 ,2,2-trimethylpiperazine dihydrochloride (402 mg, 2 mmol) in THF (5 mL) was stirred at room temperature for 1 h and treated with sodium triacetoxyborohydride (848 mg, 4 mmol). The resulting mixture was stirred at room temperature for 16 h. The reaction mixture was quenched with saturated aqueous solution of NaHCO-3 (15 mL) and extracted with EtOAc (3 x 25 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (MeOH/CH2Cl2 0 to 10%) provided (S)-tert-butyl 1 -(3-fluoro-4-((3,3,4-trimethylpiperazin-1-yl)methyl)phenyl)ethylcarbamate as a white solid (186 mg, 49% yield).
1 H NMR (400 MHz, CDCI3) δ 7.35 (t, J = 7.7 Hz, 1 H), 7.03 (dd, J = 7.9, 1 .9 Hz, 1 H), 6.95 (dd, J = 1 1 .1 , 1 .8 Hz, 1 H), 4.77 (s, 1 H), 3.49 (s, 2H), 2.56 (br s, 4H), 2.24 (br s, 5H), 1 .42 (br s, 12H), 1 .04 (s, 6H); MS m/z 380.4 (M + H).
Intermediate 65: tert-butyl (1 S)-1 -(4-((3,4-dimethylpiperazin-1- yl)methyl)phenyl)ethyl carbamate
Figure imgf000073_0002
A solution of (S)-tert-butyl 1 -(4-formylphenyl)ethylcarbamate (84.1 mg, 0.337 mmol) [obtained from (S)-1-(4-bromophenyl)ethanamine following the procedure of Hashihayata, Takashi PCT Int. Appl., 2008081910, 10 Jul 2008] and 1 ,2- dimethylpiperazine (86.3 mg, 0.756 mmol, 2.24 equiv) in THF (1.5 mL) was stirred at room temperature for 65 min and treated with sodium triacetoxyborohydride (277.2 mg, 1 .308 mmol, 3.88 equiv). The resulting mixture was stirred at room temperature for 16 hours. The reaction mixture was quenched with saturated aqueous solution of NaHCO-3
(15 mL) and extracted with EtOAc (5 x 15 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (MeOH/CH2Cl2 0 to 20%) provided tert-butyl (1 S)-1 -(4-((3,4-dimethylpiperazin-1-yl)methyl)phenyl)ethyl carbamate (90.7 mg) in 34.5% yield. 1 H NMR (400 MHz, CD3OD) δ 7.29 (s, 4 H), 4.68 (br s, 1 H), 3.54 - 3.47 (m, 2 H), 3.37 (s, 1 H), 2.84 - 2.74 (m, 3 H), 2.38 (td, J = 12, 2.5 Hz, 1 H), 2.31 (s, 3 H), 2.28 - 2.22 (m, 2 H), 1.94 - 1.89 (m, 1 H), 1.40 (br s, 9 H), 1.38 (d, J = 6.9 Hz, 3 H), 1 .06 (d, J = 6.3 Hz, 3 H); MS m/z 348.2 (M + H)
Intermediate 66: (R,E)-2-methyl-N-((3-methyl-1 H-pyrazol-4-yl)methylene)propane-2- sulfinamide
Figure imgf000074_0001
3-methyl-1 H-pyrazole-4-carbaldehyde (2.03g, 18.44mmol) was dissolved in THF (30ml) and (R)-2-methylpropane-2-sulfinamide (2.35, 19.39mmol) was added followed by Ti(OEt)4 (8.41 mmol, 36.90mmol). The resulting reaction mixture was stirred at 80°C for 18h. LCMS shows mostly product. The reaction mixture was diluted with EtOAc (300 ml_), washed with 4% aqueous NaCI (2 x 150, 2X50 ml_). The combined aq. layers were back extracted with EtOAc (100ml). The combined organic layers were washed with brine (100ml), dried over Na2S04, filtered and concentrated. Purified by column chromatography (REDI 80g, EtOAc/heptane 20-100% over 33 min 100% for 7min.) to give title compound (2.25g, 10.55mmol).
1 H NMR (400 MHz, MeOD) δ 8.55 (s, 1 H), 2.53 (s, 3H), 1.25 (s, 9H). MS 214.2 m/z (M+H)
Intermediate 67: (R)-2-methyl-N-((S)-1 -(3-methyl-1 H-pyrazol-4-yl)ethyl)propane-2- sulfinamide
Figure imgf000074_0002
(R,E)-2-methyl-N-((3-methyl-1 H-pyrazol-4-yl)methylene)propane-2-sulfinamide (2.25g, 10.55mmol) was dissolved in THF and cooled to 0C. Methylmagnesium bromide (3M, 12.5ml, 37.5mmol) was added dropwise and the resulting solution was stirred for 1 h. Ice bath was removed and the reaction was stirred for another 15h. Another 2.5eq. of methylmagnesium bromide MeMgBr was added (at 0°C
). Not a lot of change by LCMS.
The reaction mixture was quenched with sat NH4CI and the aq. layer was washed with THF (2X). Combined organic layers washed with brine, dried over Na2S04, filtered and concentrated to give title compound (1 .79g, 7.80mmol)
1 H NMR (400 MHz, MeOD) δ 7.48 (s, 1 H), 4.49 (qd, J = 6.7, 4.7 Hz, 1 H), 2.26 (s, 3H), 1 .57 (dd, J = 6.5, 1 .3 Hz, 3H), 1 .23 (s, 9H). MS 230.2 m/z (M+H) Intermediate 68: (R)-N-((S)-1-(1-benzyl-3-methyl-1 H-pyrazol-4-yl)ethyl)-2- methylpropane-2-sulfinamide
Figure imgf000075_0001
(R)-2-methyl-N-((S)-1-(3-methyl-1 H-pyrazol-4-yl)ethyl)propane-2-sulfinamide (290mg, 1 .26mmol) was dissolved in DMF (5ml) and added dropwise to a solution of Cs2C03 (458mg, 1.41 mmol) in DMF (4ml). The resulting reaction mixture was stirred at room temperature for 15min. benzylbromide (216mg, 1 .26mmol) was added and the reaction was stirred at room temperature for 2h. LCMS shows mostly product with some starting pyrazole. Added another 0.1 ml of BnBr and 135mg of Cs2C03. Stirred another 24H at 50°C.The reaction mixture was diluted with EtOAc (300 mL), washed with 4% aqueous NaCI (2 x 150, 2X50 mL). The combined aq. layers were back extracted with EtOAc (100ml). The combined organic layers were washed with brine (100ml), dried over Na2S04, filtered and concentrated. Silica gel chromatography, EtOAc/heptane 20-80% to give title compound (mix of regioisomers, 150mg, 0.470mmol).
1 H NMR (400 MHz, MeOD) δ 7.54 (s, 0.6H), 7.46 (s, 0.4H), 7.36 - 6.99 (m, 5H), 5.31 (s, 0.8H), 5.21 (s, 1 .2H), 4.44 (t, J = 6.9 Hz, 1 H), 2.21 (2s, 3H), 1.54 (2dt, 3H), 1 .17 (s, 9H). MS 320.2 m/z (M+H) Intermediate 69:
(S)-1-(1-benzyl-3-methyl-1 H-pyrazol-4-yl)ethanamine hydrochloride
Figure imgf000076_0001
(R)-N-((S)-1 -(1 -benzyl-3-methyl-1 H-pyrazol-4-yl)ethyl)-2-methylpropane-2-sulfinamide was dissolved in dioxane (5ml) and 4N HCI in dioxane (1 .2ml, 10eq.) was added. Stirred 1 H at room termperature. The solvents were removed and co-vapped twice with CH2CI2-
Some t-butyl observed by NMR. Resubmitted to reaction conditions and work-up to give title compound.
1 H NMR mixture of regioisomers (400 MHz, MeOD) δ 8.00 (s, 0.7H), 7.80 (s, 0.3H), 7.52 - 6.96 (m, 5H), 5.40 (s, 0.6H), 5.36 (s, 1 .4H), 4.47 (q, J = 6.9 Hz, 1 H), 2.34 (s, 2.1 H), 2.32 (s, 0.9H), 1 .62 (2d, J = 6.9 Hz, 3H).
MS 216.3 m/z (M+H)
The Intermediates in Table 4h were prepared by methods substantially similar to those described for the preparation of Intermediates 56 through 69.
Table 4h.
Figure imgf000076_0002
Figure imgf000077_0001
Figure imgf000078_0001
Figure imgf000079_0001
Intermediate 1 18 Intermediate 1 19 Intermediate 120
Figure imgf000079_0002
Intermediate 121 Intermediate 122 Intermediate 123
Figure imgf000079_0003
Intermediate 124 Intermediate 125
Figure imgf000079_0004
Table 4i. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 4h.
Figure imgf000079_0005
Figure imgf000080_0001
Figure imgf000081_0001
Figure imgf000082_0001
Figure imgf000083_0001
Intermediate 126: (S)-(4-(1 -aminoethyl)-3-fluorophenyl)methanol
Figure imgf000084_0001
To a cooled (0 °C) suspension of (S)-methyl 4-(1 -aminoethyl)-3-fluorobenzoate hydrochloride (0.109 g, 0.468 mmol) in THF (15 mL) was added a solution of LAH in THF (2.0 M, 1 .05 mL, 2.10 mmol, 4.49 equiv) and the resulting mixture was stirred at 0 °C for 2 h 20 min and at room temperature for 2 1/2 h. The reaction mixture was quenched by addition of a mixture of Na2S04 decahydrate and Celite (1 :1 by weight) until gas evolution ceased. The reaction mixture was filtered, washed with EtOAc. The filtrate was concentrated and used for the next reaction without purification.
1 H NMR (400 MHz, CD3OD) δ 7.43 (t, J = 7.7 Hz, 1 H), 7.15 (d, J = 8.1 Hz, 1 H), 7.08 (d, J = 12 Hz, 1 H), 4.60 (s, 2 H), 4.32 (q, J = 6.6 Hz, 1 H), 1 .42 - 1 .40 (m, 3 H).
Intermediate 127: 4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzaldehyde
Figure imgf000084_0002
A solution of (S)-3-(2-((S)-1 -(4-(hydroxymethyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one (285 mg, 0.8 mmol) and manganese dioxide (2.78 g, 32 mmol, 40 equiv) in DCM (16 mL) was stirred at room temperature for 30 min. The solution was filtered through a pad of celite and washed with DCM. The filtrated was concentrated and used to next step without further purification.
Intermediate 128: tert-butyl 4-(4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzyl)-2,2-dimethylpiperazine-1 -carboxylate
Figure imgf000085_0001
A solution of 4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzaldehyde (71 mg, 0.2 mmol) and tert-butyl 2,2-dimethylpiperazine-1- carboxylate (47.1 mg, 0.22 mmol) in MeOH (4 mL) was added acetic acid (14.4 mg, 0.24 mmol) and 5-Ethyl-2-methylpyridine borane complex (27 mg, 0.2 mmol, sigma aldrich). The solution was stirred at 50 °C for 4 h then 5 drops of water was added. The solution was stirred at room temperature for another 2 h then diluted with EtOAc (10 mL) and washed with water (10 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 10 mL). Combined organics were dried over Na2S04, filtered and concentrated. The crude material was purified through Silica gel column chromatography (MeOH/EtOAc 0 to 10%) to give tert-butyl 4-(4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin- 3-yl)pyrimidin-2-ylamino)ethyl)benzyl)-2,2-dimethylpiperazine-1-carboxylate as a white solid (80 mg, 72.4% yield).
1 H NMR (400 MHz, CDCI3) δ 8.18 (br s, 1 H), 7.44 (d, J = 5.7 Hz, 1 H), 7.24-7.29 (m, 4H), 5.46 (br s, 1 H), 5.03 (br s, 1 H), 4.59-4.63 (m, 1 H), 4.29 (t, J = 8.7 Hz, 1 H), 4.22 (dd, J = 9.1 , 3.1 Hz, 1 H), 3.44 (br s, 4H), 2.40 (s, 2H), 2.16 (s, 2H), 1 .54 (d, J = 6.9 Hz, 3H), 1.45 (s, 9H), 1 .36 (s, 6H), 0.80 - 0.57 (m, 6H); MS m/z 252.1 (M + H).
Intermediate 129: tert-butyl 1 -(4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzyl)-4-methylpiperidin-4-ylcarbamate
Figure imgf000085_0002
Prepared by a method similar to that described for the preparation of Intermediate 128. 1 H NMR (400 MHz, CDCI3) 8.17 (d, J = 5.7 Hz, 1 H), 7.43 (d, J = 5.7 Hz, 1 H), 7.26 (br s, 4H), 5.40 (br s, 1 H), 5.02 (br s, 1 H), 4.60 (dt, J = 8.2, 3.1 Hz, 1 H), 4.34 - 4.19 (m, 3H), 3.47 (br s, 2H), 2.54 (br s, 2H), 2.26 (br s, 2H), 1 .95 (br s, 3H), 1.60 (br s, 2H), 1.53 (d, J = 6.9 Hz, 3H), 1.43 (s, 9H), 1.33 (s, 3H), 0.69 (br s, 3H), 0.63 (br s, 3H). MS m/z 553.6 (M + H). Intermediate 130: tert-butyl (S)-1 -(4-bromophenyl)ethyl(4-((S)-4-isopropyl-2- oxooxazolidin-3-yl)pyrimidin-2-yl)carbamate
Figure imgf000086_0001
To a solution of (S)-3-(2-((S)-1 -(4-bromophenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one (1.62 g, 4 mmol) in THF (20 mL) was added di-tert-butyl dicarbonate (1 .31 g, 6 mmol), DMAP (49 mg, 0.4 mmol) and DIPEA (1.40 mL, 8 mmol). The solution was stirred at 50 °C for 7 days then concentrated under reduced pressure. The residue was diluted with EtOAc (40 mL) and washed with water and brine. The organic layer was dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/heptane 0 to 80%) provided tert-butyl (S)-1-(4- bromophenyl)ethyl(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-yl)carbamate as a white solid (1 .03 g, 50.9% yield).
1 H NMR (400 MHz, CDCI3) δ 8.57 (d, J = 5.8 Hz, 1 H), 7.99 (d, J = 5.8 Hz, 1 H), 7.44 - 7.39 (m, 2H), 7.33 - 7.28 (m, 2H), 5.63 (q, J = 7.2 Hz, 1 H), 4.63 (dt, J = 8.0, 3.3 Hz, 1 H), 4.39 - 4.26 (m, 2H), 2.47-2.39 (m, 1 H), 1 .66 (d, J = 7.1 Hz, 3H), 1.30 (s, 9H), 0.84 (d, J = 7.0, 3H),0.83 (d, J = 7.0, 3H); MS m/z 507.0 (M + H).
Intermediate 131 : tert-butyl 4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-yl((S)-1- (4-(1-methyl-1 H-pyrazol-4-yl)phenyl)ethyl)carbamate
Figure imgf000086_0002
In a 5 mL microwave vial a solution of tert-butyl (S)-1-(4-bromophenyl)ethyl(4-((S)-4- isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-yl)carbamate (101 mg, 0.2 mmol), 1-methyl-4- (4,4,5,5-tetramethyl-1 ,3,2-dioxaborolan-2-yl)-1 H-pyrazole (50 mg, 0.24 mmol), Sodium bicarbonate (0.2 mL, 0.4 mmol, 2 M aqueous solution) in Dioxane (2 mL) was bubbled N2 for 3 min then Cl2Pd(dppf)CH2Cl2 (16 mg, 0.02 mmol) was added. The capped tube was heated to 100°C for 16 h. After cooling the reaction mixture was diluted with EtOAc (10 mL) and washed with water (10 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 10 mL). Combined organics were dried over Na2S04, filtered and concentrated. The crude material was purified through silica gel column chromatography (EtOAc in Heptane 12 to 100%) to give a white solid (50 mg, 49.3% yield).
1 H NMR (400 MHz, CDCI3) δ 8.57 (d, J = 5.7 Hz, 1 H), 7.97 (d, J = 5.8 Hz, 1 H), 7.74 (s, 1 H), 7.59 (s, 1 H), 7.39 (s, 4H), 5.71 (q, J = 7.0 Hz, 1 H), 4.65 (dt, J = 8.1 , 3.2 Hz, 1 H), 4.36 - 4.24 (m, 2H), 3.94 (s, 3H), 2.50-2.42 (m, 1 H), 1.71 (d, J = 7.0 Hz, 3H), 1.29 (s, 9H), 0.82 (d, J = 7.0 Hz, 3H), 0.80 (d, J = 7.0 Hz, 3H); MS m/z 507.1 (M + H).
Intermediate 132: tert-butyl (S)-1 -(4-(cyclohexanecarboxamido)phenyl)ethyl(4-((S)-4- isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-yl)carbamate
Figure imgf000087_0001
In a 5 ml microwave reaction vial was added tert-butyl (S)-1-(4-bromophenyl)ethyl(4-((S)- 4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-yl)carbamate (101 mg, 0.2 mmol), cyclohexanecarboxamide (30 mg, 0.24 mol), cesium carbonate (91 mg, 0.28 mmol), XANTPHOS (7 mg, 0.012 mmol, strem chemicals), and Pd2(dba)3 (4 mg, 0.02 mmol). The vial was sealed, evacuated and purged with dry nitrogen three times before adding dioxane (1 .6 mL). The reaction mixture was heated to 100°C for 16 hours in an oil bath. After cooling the reaction was diluted with EtOAc (10 mL) and washed with water (10 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 10 mL). Combined organics were dried over Na2S04, filtered and concentrated. The crude material was purified through silica gel column chromatography (EtOAc in Heptane 12 to 100%) to give a white solid (65 mg, 58.9% yield).
1 H NMR (400 MHz, CDCI3) δ 8.55 (d, J = 5.8 Hz, 1 H), 7.95 (d, J = 5.8 Hz, 1 H), 7.48 - 7.43 (m, 2H), 7.38 - 7.32 (m, 2H), 7.13 (br s, 1 H), 5.66 (q, J = 7.1 Hz, 1 H), 4.64 (dt, J = 8.2, 3.2 Hz, 1 H), 4.38 - 4.26 (m, 2H), 2.51 - 2.43 (m, 1 H), 2.20 (tt, J = 1 1.8, 3.5 Hz, 1 H), 1 .95 (d, J = 13.2, 2H), 1.87 - 1.81 (m, 2H), 1.71- 1 .68 (m, 4H), 1 .60 - 1.47 (m, 2H), 1 .33-1.25(m, 12H), 0.85 (d, J = 6.9 Hz, 3H), 0.82 (d, J = 6.9 Hz, 3H); MS m/z 552.1 (M + H).
Intermediate 133: (S)-methyl 2-((4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- yl)amino)propanoate
Figure imgf000088_0001
To a solution of (S)-methyl 2-aminopropanoate (270 mg, 2.0 mmol, 1.2 equv.in 10 ml of DMSO) and (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (430 mg, 1.8 mmol, 1 .0 equv.) was added DIPEA (805 mg, 6.23 mmol, 3.5 equiv), and the reaction mixture was heated at 1 10 °C for 120 min. The reaction mixture was poured into water (40ml) and extracted with EtOAc (2x30 ml.) and washed with water (30 ml_). After separation, the aqueous phase was extracted with EtOAc (3 x 8 ml_). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (ethyl acetate in heptane 10 to 80%) to provide (S)-methyl 2-((4-((S)-4-isopropyl-2- oxooxazolidin-3-yl)pyrimidin-2-yl)amino)propanoate (260 mg, white solid) in 47.4% yield. LCMS m/z 309.1 (M + H)+ RT=1 .53 min.
Intermediate 134: (S)-2-((4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin yl)amino)propanehydrazide
Figure imgf000088_0002
To a solution of (S)-methyl 2-((4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- yl)amino)propanoate (120 mg, 0.39 mmol in 5 ml of MeOH) was added 99% hydrazine hydrate, the reaction solution was stirred at room temperature overnight (24 hours), the solvent was removed to yield the desired product (99 mg) in 78% yield, and was used for next step without purification. LCMS m/z 309.1 (M + H)+ RT=1.25 min. Intermediate 135: (S)-tert-butyl (1-hydrazinyl-1 -oxopropan-2-yl)carbamate
Figure imgf000089_0001
A solution of hydrazine (234 mg, 7.31 mmol, 1 .5 equv. in 8 ml of THF) was added to (S)- methyl 2-(tert-butoxycarbonylamino)propanoate (1000 mg, 4.88 mmol, 1 .0 equv.), it was stirred in a sealed tube and refluxed (72°C) overnight (18 hours), the solvent was removed to yield the desired product (880 mg, white solid) in 84% yield.
Intermediate 136: (S)-tert-butyl (1-(2-benzoylhydrazinyl)-1-oxopropan-2-yl)carbamate
Figure imgf000089_0002
To a solution of (S)-tert-butyl (1-hydrazinyl-1-oxopropan-2-yl)carbamate (293 mg, 1.44 mmol, 1 .0 equv. in 3 ml of DCM) was added benzoyl fluoride (179 mg, 1.44 mmol in 2 ml of DCM), the reaction solution was stirred at room temperature for 50 min., the solvent was removed to yield the desired product. 1H NMR (400 MHz, CDCI3) δ 7.89 - 7.78 (m, 2H), 7.54 (t, J = 7.4 Hz, 1 H), 7.43 (t, J = 7.6 Hz, 2H), 5.32 (b, 1 H), 4.45 (b, 1 H), 1 .46 (s, 9H).
Intermediate 137: (S)-tert-butyl (1 -(5-phenyl-1 ,3,4-thiadiazol-2-yl)ethyl)carbamate
Figure imgf000089_0003
To a solution of (S)-tert-butyl (1-(2-benzoylhydrazinyl)-1-oxopropan-2-yl)carbamate (155 mg, 0.5 mmol, 1 .0 equv. in 5 ml of THF) was added Lawesson's reagent (36.4 mg, 0.5 mmol, 1.0 equv.) the reaction mixture was stirred at reflux for 3 hours, the reaction mixture was filtered and the solvent was removed to yield the crude product. Silica gel column chromatography (ethyl acetate in heptane 10 to 50%) to provide (S)-tert-butyl (1- (5-phenyl-1 ,3,4-thiadiazol-2-yl)ethyl)carbamate (1 14.6 mg, white solid) in 70.7% yield. 1 H NMR (400 MHz, CD2CI2) δ 7.94 - 7.72 (m, 2H), 7.52 - 7.26 (m, 3H), 5.59 (b, 1 H), 5.1 1 (b, 1 H), 1.57 (d, J = 7.0 Hz, 3H), 1 .34 (s, 9H). Intermediate 138: (S)-1-(5-phenyl-1 ,3,4-thiadiazol-2-yl)ethanamine
Figure imgf000090_0001
To a solution of (S)-tert-butyl (1-(5-phenyl-1 ,3,4-thiadiazol-2-yl)ethyl)carbamate (1 10 mg, 0.4 mmol, in 5 ml of DCM ) was added 1 ml of TFA, the reaction mixture was stirred at room temperature for 3 hours, the solvent was removed to yield the desired product (52 mg) in 66.8% yield. LCMS m/z 206.0 (M + H)+ RT=0.97min.
Intermediate 139: 1-(5-(3-(trifluoromethyl)phenyl)pyrimidin-2-yl)ethanone
Figure imgf000090_0002
A cloudy solution of 1 -(5-bromopyrimidin-2-yl)ethanone (300 mg, 1 .49 mmol), 3- (trifluoromethyl)phenylboronic acid (567 mg, 2.98 mmol), K3PO4 (950 mg, 4.48 mmol),
DavePhos ligand [2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl] (59 mg, 0.15 mmol), and Pd(OAc)2 (17 mg, 0.075 mmol) in 6 mL toluene was heated at 100°C for 1 h. The mixture was cooled to room temperature, and filtered through Celite. Filter cake was rinsed with 30 mL EtOAc. The filtrate was poured into 20 mL water. Layers were separated, and the aqueous was further extracted with EtOAc (20 mL). Combined organics were washed with water (20mL) and brine (20mL), dried over Na2S04, filtered and concentrated directly onto silica gel. Column chromatography (10 - 100% EtOAc/heptane) gave 0.26 g 1 -(5-(3-(trifluoromethyl)phenyl)pyrimidin-2-yl)ethanone (V) as tan solid. MS m/z 267.1 (M + H)+. 1H NMR (400 MHz, CDCI3) δ 9.16 (s, 2H), 7.93 - 7.69 (m, 4H), 2.87 (s, 3H).
The Following intermediates were prepared using a method similar to that described for the preparation of Intermediate 139. Using Anal. RP-HPLC Column = Inertsil C8 Column, 3.0 μηη, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1 .70 min; 0.3 min 95% B; 2.1 min 1 %B.)
Intermediate 140: 1-(5-(3,4-dichlorophenyl)pyrimidin-2-yl)ethanone.
Figure imgf000091_0001
Anal. RP-HPLC tR = 1 .17 min. MS m/z 266.9 (M + H)+.
Intermediate 141 : 1-(5-(3-fluoro-2-methylphenyl)pyrimidin-2-yl)ethanone.
Figure imgf000091_0002
Anal. RP-HPLC tR = 1 .07 min. MS m/z 231.1 (M + H)+.
Intermediate 142: 1-(5-(4-fluoro-2-methylphenyl)pyrimidin-2-yl)ethanone.
Figure imgf000091_0003
Anal. RP-HPLC tR = 1 .18 min. MS m/z 231.1 (M + H)+.
Intermediate 143: 1-(5-(5-fluoro-2-methylphenyl)pyrimidin-2-yl)ethanone
Figure imgf000092_0001
Anal. RP-HPLC tR = 1 .16 min. MS m/z 231.2 (M + H)+.
Intermediate 144: 1-(5-(4-fluoro-3-methylphenyl)pyrimidin-2-yl)ethanone
Figure imgf000092_0002
1 H NMR (400 MHz, CDCI3) δ 9.09 (s, 2H), 7.52 - 7.41 (m, 2H), 7.24 - 7.16 (m, 1 H), 2.85 (s, 3H), 2.41 (d, J = 2.0 Hz, 3H). Anal. RP-HPLC tR = 1 .20 min. MS m/z 231.0 (M + H)+.
Intermediate 145: 1-(5-(2,3-dichlorophenyl)pyrimidin-2-yl)ethanone
Figure imgf000092_0003
Anal. RP- HPLC tR = 1 .15 min. MS m/z 267.9 (M + H)+. Intermediate 146: 1-(5-(4-fluoro-3-methylphenyl)pyridin-2-yl)ethanone.
Figure imgf000092_0004
1 H NMR (400 MHz, CDCI3) δ 8.88 (dd, J = 2.3, 0.8 Hz, 1 H), 8.13 (dd, J = 8.1 , 0.8 Hz, 1 H), 7.98 (dd, J = 8.1 , 2.3 Hz, 1 H), 7.50 - 7.39 (m, 2H), 7.21 - 7.12 (m, 1 H), 2.78 (s, 3H), 2.42 - 2.36 (m, 3H). Anal. RP-HPLC tR = 1 .40 min. MS m/z 230.8 (M + H)+. Intermediate 147: 1-(5-(3-(trifluoromethyl)phenyl)pyrimidin-2-yl)ethanamine
Figure imgf000093_0001
1 -(5-(3-(Trifluoromethyl)phenyl)pyrimidin-2-yl)ethanone (260 mg, 0.977 mmol), NH40Ac (1.13 g, 14.6 mmol), and NaBH3CN (245 mg, 3.91 mmol) were taken up in 8 mL 200 proof EtOH, and heated at 120°C for 5 minutes in a microwave apparatus. The mixture was concentrated to remove the EtOH. Crude was taken up in 30 ml water + 25 mL EtOAc. 6N NaOH was added until aqueous pH was -10. Separated layers, and extracted aqueous with EtOAc (25 ml). The combined organic layer was washed with 25 mL brine and dried with Na2S04- Filtered and concentrated with reduced pressure to give 262 mg crude yellow oil, which was carried forward without further purification. Anal. RP-HPLC tR = 0.90 min. (Column = Inertsil C8 Column, 3.0 μηι, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 268.1 (M + H)+. The Following intermediates were prepared using a method similar to that described for the preparation of Intermediate 147.
Intermediate 148: 1-(5-(3,4-dichlorophenyl)pyrimidin-2-yl)ethanamine.
Figure imgf000093_0002
Anal. RP-HPLC tR = 1 .09 min (Gradient: 2 to 98% B in 1 .7 min - flow 1 mL/min. Eluent A: Water + 3.75 mM NH4Ac + 2% ACN. Column: Acquity CSH 1 .7μπι 2.1 x50mm - 50°C.) MS m/z 268.4 (M + H)+. Intermediate 149: 1-(5-(3-fluoro-2-methylphenyl)pyrimidin-2-yl)ethanamine.
Figure imgf000094_0001
Anal. RP-HPLC tR = 0.99 min. (Gradient: 2 to 98% B in 1.7 min - flow 1 mL/min. Eluent A: Water + 3.75 mM NH4Ac + 2% ACN. Column: Acquity CSH 1 .7μΓη 2.1 x50mm - 50°C.) MS m/z 232.4 (M + H)+.
Intermediate 150: 1-(5-(4-fluoro-2-methylphenyl)pyrimidin-2-yl)ethanamine.
Figure imgf000094_0002
Anal. RP-HPLC tR = 0.87 min. (Column = Inertsil C8 Column, 3.0 μπι, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 231 .0 (M)-.
Intermediate 151 : 1-(5-(5-fluoro-2-methylphenyl)pyrimidin-2-yl)ethanamine
Figure imgf000094_0003
Anal. RP-HPLC tR = 0.79 min. (Column = Inertsil C8 Column, 3.0 μπι, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 232.0 (M + H)+.
Intermediate 152: 1-(5-(4-fluoro-3-methylphenyl)pyrimidin-2-yl)ethanamine
Figure imgf000095_0001
Anal. RP-HPLC tR = 0.81 min. (Column = Inertsil C8 Column, 3.0 m, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 231 .9 (M + H)+.
Intermediate 153: 1-(5-(2,3-dichlorophenyl)pyrimidin-2-yl)ethanamine
Figure imgf000095_0002
Anal. RP-HPLC tR = 1 .01 min. (Column = Inertsil C8 Column, 3.0 m, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 269.0 (M + H)+.
Intermediate 154: 1-(5-(4-fluoro-3-methylphenyl)pyridin-2-yl)ethanamine
Figure imgf000095_0003
Anal. RP-HPLC tR = 0.92 min. (Column = Inertsil C8 Column, 3.0 m, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 230.9 (M + H)+.
Intermediate 155: 1-(5-(4-fluorophenoxy)pyrimidin-2-yl)ethanamine
Figure imgf000096_0001
Step 1 : A solution of 1 -(5-fluoropyrimidin-2-yl)ethanone (700 mg, 5.0 mmol) and 4- fluorophenol (616 mg, 5.50 mmol) in 6 mL DMF was treated with potassium carbonate (829 mg 6.0 mmol) and heated to 50°C for 3.5 h. The reaction mixture was poured into 20 mL water, and extracted with EtOAc (2 x 20 mL). Organics were washed with 20 mL each water, brine, and dried over Na2S04. Mixture was filtered and concentrated on silica gel. Column chromatography (10 - 100% EtOAc/hept) gave 295 mg (25%) 1 -(5-(4- fluorophenoxy)pyrimidin-2-yl)ethanone as a white solid used directly in the following step. MS m/z 233.2 (M + H)+. 1H NMR (400 MHz, CDCI3) δ 8.55 (s, 2H), 7.23 - 7.07 (m, 4H), 2.78 (s, 3H).
Step 2: 1-(5-(4-fluorophenoxy)pyrimidin-2-yl)ethanone (290 mg, 1.25 mmol), NH40Ac (1.9 g, 24.6 mmol), and NaBH3CN (314 mg, 5.00 mmol) were taken up in 20 mL 200 proof EtOH, and heated at 130 C for 3 minutes in a microwave apparatus. The mixture was concentrated to remove the EtOH. Crude was taken up in 30 ml water + 25 mL EtOAc. 6N NaOH was added until aqueous pH was -10. Separated layers, and extracted aqueous with EtOAc (25 ml). The combined organic layer was washed with 25 mL brine and dried with Na2S04- Filtered and concentrated with reduced pressure to give 275 mg crude tan oil, which was carried forward without further purification. Major product Anal. RP-HPLC tR = 1 .26 min. (Column = Inertsil C8 Column, 3.0 μηι, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 234.1 (M + H)+. The Following intermediates were prepared using methods similar to those described for the preparation of Intermediate 155. Intermediate 156: 1-(5-(2,4-difluorophenoxy)pyrimidin-2-yl)ethanamine
Figure imgf000097_0001
Anal. RP-HPLC tR = 0.81 min. (Column = Inertsil C8 Column, 3.0 m, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 252.1 (M + H)+.
Intermediate 157: 1-(5-(5-bromopyridin-3-yloxy)pyrimidin-2-yl)ethanamine
Figure imgf000097_0002
Anal. RP-HPLC tR = 1 .29 min. (Column = Inertsil C8 Column, 3.0 m, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 297.3 (M + H)+.
Intermediate 158: 1-(5-(3-chloro-4-fluorophenoxy)pyrimidin-2-yl)ethanamine
Figure imgf000097_0003
Anal. RP-HPLC tR = 1 .40 min. (Column = Inertsil C8 Column, 3.0 μηι, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 268.0 (M + H)+. Intermediate 159: 1-(5-(pyridin-3-yloxy)pyrimidin-2-yl)ethanamine
Figure imgf000098_0001
Anal. RP-HPLC tR = 1 .21 min. (Column = Inertsil C8 Column, 3.0 μηι, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 218.4 (M + H)+.
Intermediate 160: 1-(5-(5-(trifluoromethyl)pyridin-2-yloxy)pyrimidin-2-yl)ethanamine
Figure imgf000098_0002
Anal. RP-HPLC tR = 1 .16 min. (Column = Inertsil C8 Column, 3.0 m, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 285.4 (M + H)+.
Intermediate 161 : 4-(4-fluorophenoxy)pyrimidine-2-carbonitrile
Figure imgf000098_0003
A solution of 4-chloropyrimidine-2-carbonitrile (0.63 g, 4.51 mmol) and 4-fluorophenol (0.51 g, 4.51 mmol) in 5 mL DMF was cooled to 0°C under N2 atmosphere. NaH (0.217 g of 60% suspension, 5.42 mmol) was slowly added. Bubbling exotherm observed. Internal temp was kept below 5°C. After 15 minutes, cold bath was removed. The reaction mixture was allowed to warm to room temp and stir 1 h. The reaction mixture was diluted with water (40 mL) and extracted with (3 x 25 mL) EtOAc. The organic layer was washed with 40 mL each water, and brine. Dried over Na2S04, and concentrated on silica gel in vacuo. Column chromatography (EtOAc/heptane 10 to 100% gradient) gave 0.72 g (74%) of (4-fluorophenoxy)pyrimidine-2-carbonitrile as a crystalline white solid. Anal. RP-HPLC tR = 1 .38 min, Gradient: 2 to 98% B in 1 .7 min - flow 1 mL/min. Eluent A: Water + 3.75 mM NH4Ac + 2% ACN. Column: Acquity CSH 1.7μπι 2.1x50mm - 50°C. MS m/z 216.1 (M + H)+.
Intermediate 162: 1-(4-(4-fluorophenoxy)pyrimidin-2-yl)ethanone
Figure imgf000099_0001
4-(4-fluorophenoxy)pyrimidine-2-carbonitrile (450 mg, 2.09 mmol) was suspended in 12 mL anhydrous ether under N2 atmosphere. Vessel was cooled to 0° C. MeMgBr (3.1 mL of 1 .0 M solution in butyl ether, 3.10 mmol) was added over 5 min. The yellow-green suspension was stirred 30 minutes, then quenched with 50 mL sat'd NH4CI solution. Adjusted pH to ~6 with cone. HCI. The mixture was extracted with (2 x 40 mL) EtOAc. Washed organics with 30 mL brine, and dried over Na2S04- Filtered and concentrated on silica gel. Column chromatography (10 - 100% EtOAc in hept) gave 157 mg (32%) 1- (4-(4-fluorophenoxy)pyrimidin-2-yl)ethanone as a yellow oil. Anal. RP-HPLC tR = 1.44 min. (Column = Inertsil C8 Column, 3.0 μηη, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 233.2 (M + H)+.
Intermediate 163: 1-(4-(4-fluorophenoxy)pyrimidin-2-yl)ethanol
Figure imgf000099_0002
1 -(4-(4-fluorophenoxy)pyrimidin-2-yl)ethanone (0.150 g 0.646 mmol) was taken up in 2.5 mL 4:1 MeOH:DCM, and cooled to 0°C. NaBH4 (49 mg 1 .30 mmol) was added. Fizzing was observed. After 10 min, cold bath was removed, and the reaction was stirred 1 h. Solvent was removed in vacuo. White residue was taken up in 10 mL water, and extracted with (2 x 10 mL) EtOAc. Washed organics with 10 mL brine. Dried over Na2SC>4. Filtered and concentrated to give 143 mg (95%) 1-(4-(4- fluorophenoxy)pyrimidin-2-yl)ethanol as a colorless oil. Anal. RP-HPLC tR = 1.38 min. (Column = Inertsil C8 Column, 3.0 μηη, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 235.1 (M + H)+.
Intermediate 164: 2-(1 -azidoethyl)-4-(4-fluorophenoxy)pyrimidine
Figure imgf000100_0001
Under N2 atmosphere, 1 -(4-(4-fluorophenoxy)pyrimidin-2-yl)ethanol (140 mg, 0.598 mmol) was dissolved in 3 mL anhydrous DCM. Triethylamine (0.175 mL, 1 .26 mmol) was added, and the mixture was cooled to 0° C. MsCI (0.070 mL, 0.897 mmol) was added, and the mixture was stirred 15 minutes. Maintaining 0°C, DCM solvent was removed under N2 stream. Residue was taken up in 2 mL dry DMF. NaN3 (78 mg, 1 .19 mmol) added, and the reaction was stirred at rt for 24 h. Mixture was poured into 20 mL water, and extracted with 20 mL EtOAc. Organic layer was washed with 20 mL brine and dried over Na2S04- Filtered and concentrated to give 120 mg (77%) 2-(1 -azidoethyl)-4-(4- fluorophenoxy)pyrimidine as a yellow oil. 1H NMR (400 MHz, CDCI3) δ 8.49 (d, J = 5.7 Hz, 1 H), 7.16 - 6.90 (m, 4H), 6.70 (d, J = 5.7 Hz, 1 H), 4.34 (q, J = 6.9 Hz, 1 H), 1.55 - 1 .46 (m, 3H).
Intermediate 165: 1-(4-(4-fluorophenoxy)pyrimidin-2-yl)ethanamine
Figure imgf000101_0001
2-(1 -azidoethyl)-4-(4-fluorophenoxy)pyrimidine (120 mg, 0.463 mmol) was dissolved in 2 ml. neat EtOH. 24.6 mg (0.023 mmol) of 10% Palladium on carbon catalyst was added. With vigorous stirring, the reaction vial was evacuated and purged 3 times with H2. The reaction vessel was fitted with an H2 balloon and stirred for 2 h. The mixture was filtered through Celite and concentrated in vacuo to give 75 mg (69%) 1 -(4-(4- fluorophenoxy)pyrimidin-2-yl)ethanamine as a brown oil. 1H NMR (400 MHz, CDCI3) δ 8.45 (d, J = 5.7 Hz, 1 H), 7.13 - 6.92 (m, 4H), 6.59 (d, J = 5.7 Hz, 1 H), 4.00 (q, J = 6.8 Hz, 1 H), 1.34 - 1 .30 (m, 3H). Anal. RP-HPLC tR = 1 .18 min. (Column = Inertsil C8 Column, 3.0 μηη, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1 .70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 234.2 (M + H)+.
The Following intermediates were prepared using methods similar to those described for the preparation of Intermediates 161 to 165.
Intermediate 166: 1 -(5-(4-fluorophenoxy)pyridin-2-yl)ethanamine
Figure imgf000101_0002
Anal. RP-HPLC tR = 0.91 min. (Column = Inertsil C8 Column, 3.0 μηι, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 233.1 (M + H)+.
Intermediate 167: 1 -(5-(4-fluorophenoxy)pyrazin-2-yl)ethanamine
Figure imgf000102_0001
Anal. RP-HPLC tR = 1 .39 min. (Column = Inertsil C8 Column, 3.0 m, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 217.1 (Major fragment + H)+.
Intermediate 168: 1-(2-(4-fluorophenoxy)pyrimidin-5-yl)ethanamine
Figure imgf000102_0002
Anal. RP-HPLC tR = 1 .20 min. (Column = Inertsil C8 Column, 3.0 m, 3.0 x 30 mm. Column Temperature =50°C. Eluents =A: Water (5 mM Ammonium formate, 2% ACN); B: ACN. Flow Rate =2 mL/min. Gradient =0 min 5% B; 5% to 95% B in 1.70 min; 0.3 min 95% B; 2.1 min 1 %B.) MS m/z 233.9 (M + H)+.
Intermediate 169: (S)-4-lsopropyl-3-[2-((S)-1-methyl-prop-2-ynylamino)-pyrimidin-4-yl]- oxazolidin-2-one
Figure imgf000102_0003
To a solution of compound (S)-3-(2-Chloro-pyrimidin-4-yl)-4-isopropyl-oxazolidin-2-one (1.03 g , 4.3 mmol) in DMSO (12 mL) was added methyl-prop-2-ynylamine HCI salt (450 mg, 4.3 mmol) and diisopropylethylamine (2.2 mL, 12.6 mmol). The reaction was heated to 1 10C for 18 hours. The reaction mixture was diluted with EtOAc (50 mL) and washed with water (25 mL) and brine (25 mL). The organic layer was dried over Na2S04, filtered and concentrated. The crude material was purified on silica gel column chromatography (EtOAc/Heptane 0 to 75%) provided (S)-4-lsopropyl-3-[2-((S)-1-methyl-prop-2- ynylamino)-pyrimidin-4-yl]-oxazolidin-2-one (360 mg) in 31 % yield.
LC-MS m/z : 275.1 (M - Boc)+; RT.: 1.33 min. Intermediate 170: (S)-4,6-difluoro-N-(1-phenylethyl)pyrimidin-2-amine
Figure imgf000103_0001
A solution of 2,4,6-trifluoropyrimidine (128.4 mg, 0.96 mmol) and isopropylethylamine (0.50 mL, 2.9 mmol, 3 equiv) in dioxane (5 mL) was cooled to 0 °C with an ice bath. After 30 min, the ice bath was removed, and the reaction was allowed to warm to room temperature. After stirriing overnight, the reaction was concentrated to a light brown oil and purified by silica gel column chromatography (EtOAc/Heptane 0 to 100%) to provide (S)-4,6-difluoro-N-(1-phenylethyl)pyrimidin-2-amine (151.2 mg, white solid) in 45% yield. 1 H NMR (400 MHz, CD3OD) δ 7.35 - 7.40 (m, 2H), 7.29 - 7.34 (m, 2H), 7.20 - 7.26 (m, 1 H), 5.84 (s, 1 H), 5.08 (q, J = 6.91 Hz, 1 H), 1.52 (d, J = 7.04 Hz, 3H); LCMS m/z 236.1 (M + H)+, Rt 0.95 min.
Intermediate 171 : (S)-4,6-difluoro-N-(1-(2-fluoro-4-(trifluoromethyl)phenyl)ethyl) pyrimidin-2-amine
Figure imgf000103_0002
Intermediate 171 was prepared by a method similar to the one described for the preparation of Intermediate 170. 1H NMR (400 MHz, CD3OD) 7.58 (t, J = 7.63 Hz, 1 H), 7.34 - 7.48 (m, 2H), 5.84 (br. s., 1 H), 5.35 (q, J = 6.91 Hz, 1 H), 1.54 (d, J = 7.04 Hz, 3H). MS m/z 321 .9 (M + H)+, Rt 1.1 1 min.
Intermediate 172: tert-butyl 3-hydroxy-2-methylbutan-2-ylcarbamate
,Boc
HN OH Step 1 : Preparation of tert-butyl 1 -(methoxy(methyl)amino)-2-methyl-1 -oxopropan- 2-yl carbamate
2-(tert-butoxycarbonylamino)-2-methylpropanoic acid (6.62 g, 32.6 mmol), 0,N- dimethylhydroxylamine hydrochloride (3.50 g, 35.8 mmol), and HATU (14.86 g, 39.1 mmol) were combined in DMF (100 ml_). To this solution was added Hunig'sBase (17.07 ml_, 98 mmol). The reaction was stirred for overnight (17 hours). The reaction was then concentrated under vacuum and the residue was diluted with EtOAc (300ml_) and washed with water (2x80ml_). The organic layer was washed with brine, dried (Na2S04), and concentrated under reduced pressure. The residue was purified via silica gel flash chromatography (10-50 percent EtOAc-Hexanes) to afford the desired product as a white solid (6.36 g). LCMS m/z 247.2 (M + H)+, Rt 0.61 min.
Step 2: Preparation of tert-butyl 2-methyl-3-oxobutan-2-ylcarbamate
To a solution of tert-butyl 1 -(methoxy(methyl)amino)-2-methyl-1 -oxopropan-2- ylcarbamate (4.26 g, 17.30 mmol) in THF (100 ml.) at -70 °C was added drop wise methyl lithium (32.4 ml_, 51 .9 mmol). Cold bath was replaced with -40 °C bath and the reaction was stirred for 4 hours. Saturated NH4CI solution (10ml_) was then added cautiously to quench the reaction. The reaction mixture was then allowed to warm to room temperature, and diluted with EtOAc (100ml_) and water (50ml_). The phases were separated and the aqueous layer was extracted with EtOAc (2x100ml_). The combined organics were then dried (Na2S04) and concentrated under reduced pressure. The residue was purified via silica gel flash chromatography (10-50% EtOAc-Hexanes) to afford the desired product as a white solid (2.36 g). LCMS m/z 224.2 (M + Na)+, Rt 0.7 min.
Step 3: Preparation of tert-butyl 3-hydroxy-2-methylbutan-2 -ylcarbamate
To a solution of tert-butyl 2-methyl-3-oxobutan-2-ylcarbamate (2.36g, 1 1.73 mmol) in MeOH (30ml_) at 0 °C was added portion wise NaBH4 (0.887 g, 23.45 mmol). Cold bath was removed and the reaction was stirred for 1 hour. HCI solution (1 M, 0.2ml_) was then added cautiously to quench the reaction. The reaction mixture was then concentrated and diluted with EtOAc (50ml_) and water (10ml_). The phases were separated and the aqueous layer was extracted with EtOAc (2x20ml_). The combined organics were then dried (Na2S04) and concentrated under reduced pressure. The residue was purified via silica gel flash chromatography (10-50% EtOAc-Hexanes) to afford the desired product as a white solid (2.12 g). LCMS m/z 204.1 (M + H)+, Rt 0.69 min.
Intermediate 173: tert-butyl ((3S)-2-hydroxy-4-methylpentan-3-yl)carbamate
Figure imgf000105_0001
Step 1 : Preparation of tert-butyl 1 -(methoxy(methyl)amino)-2-methyl-1 -oxopropan- 2-yl carbamate
To a solution of (S)-2-(tert-butoxycarbonylamino)-3-methylbutanoic acid (5.86 g, 27.0 mmol) in DCM (100ml_) at 0 °C was added portion wise di(1 H-imidazol-1-yl)methanone (4.81 g, 29.7 mmol). Cold bath was removed and the reaction was stirred at 20 °C for 30 minutes. Ο,Ν-dimethylhydroxylamine hydrochloride (3.16 g, 32.4 mmol) was then added and followed by slow addition of triethylamine (3.28 g, 32.4 mmol). The reaction mixture was stirred at 20 °C for overnight (18 hr), and diluted with DCM (200ml_) and washed with HCI (1 M, 2x50ml_) and saturated NaHCC>3 solution (2x50ml_), H20 (50ml_) and brine (50ml_). The organic was then dried (Na2S04) and concentrated under reduced pressure to give crude product (6.61 g). LCMS m/z 261.2 (M + H)+, Rt 0.77 min.
Step 2: Preparation of (S)-tert-butyl 2-methyl-4-oxopentan-3-ylcarbamate To a solution of (S)-tert-butyl 1-(methoxy(methyl)amino)-3-methyl-1 -oxobutan-2- ylcarbamate (4.23 g, 16.25 mmol) in THF (100 ml.) at -70 °C was added drop wise methyl lithium (1.071 g, 48.7 mmol). Cold bath was replaced with -40 °C bath (MeCN in dry ice) removed and the reaction was stirred for 4 hours. Saturated NH4CI solution (10ml_) was then added cautiously to quench the reaction. The reaction mixture was then allowed to warm to room temperature, and diluted with EtOAc (100ml_) and water (50ml_). The phases were separated and the aqueous layer was extracted with EtOAc (2x100ml_). The combined organics were then dried (Na2S04) and concentrated under reduced pressure. The residue was purified via silica gel flash chromatography (10-50% EtOAc-Hexanes) to afford the desired product as a white solid (3.01 g). LCMS m/z 238.2 (M + Na)+, Rt 0.78 min. Step 3: Preparation of tert-butyl 3-hydroxy-2-methylbutan-2-ylcarbamate
To a solution of (S)-tert-butyl 2-methyl-4-oxopentan-3-ylcarbamate (2.65 g, 12.31 mmol) in MeOH (30ml_) at 0 °C was added portion wise NaBH4 (0.931 g, 24.62 mmol). Cold bath was removed and the reaction was stirred for 1 hour. HCI solution (1 M, 0.3 ml.) was then added cautiously to quench the reaction. The reaction mixture was then concentrated and diluted with EtOAc (50ml_) and water (10ml_). The phases were separated and the aqueous layer was extracted with EtOAc (2x20ml_). The combined organics were then dried (Na2S04) and concentrated. The residue was purified via silica gel flash chromatography (10-50% EtOAc-Hexanes) to afford the desired product as a white solid (2.05 g). LCMS m/z 240.2 (M + Na)+, Rt 0.69 min.
Intermediate 174: (S)-tert-butyl (1 -cyclopropyl-2-hydroxyethyl)carbamate
Boc
HN' OH
Step 1 : Preparation of tert-butyl 1 -(methoxy(methyl)amino)-2-methyl-1 -oxopropan- 2-ylcarbamate
To (S)-2-(tert-butoxycarbonylamino)-2-cyclopropylacetic acid (5.01 g, 23.28 mmol) in MeOH (50ml_) was added drop wise trimethylsilyldiazomethane (18.62 ml, 37.2 mmol) until no bubbles. The reaction was stirred for 30 minutes and quenched with drops of HOAc (0.1 ml_). The reaction mixture was then concentrated under reduced pressure to give crude product as a light tan oil (5.35 g). LCMS m/z 252.1 (M + Na)+, Rt 0.77 min.
Step 2: Preparation of (S)-tert-butyl (1 -cyclopropyl-2-hydroxyethyl)carbamate To a solution of (S)-methyl 2-(tert-butoxycarbonylamino)-2-cyclopropylacetate (5.35 g, 23.33 mmol) in Et20 (100 ml) was added LiBH4 (0.762 g, 35.0 mmol), followed by drop wise addition of methanol (1 .420 ml, 35.0 mmol). The reaction was refluxed at 40 °C for one hour. The reaction mixture was then cooled to 0 °C, and quenched with HCI (1 M) until pH=2 for aqueous layer. The phases were separated and the aqueous layer was extracted with DCM (3x100ml_). The organic was then dried (Na2SC>4) and concentrated under reduced pressure to give final crude product (4.16 g). LCMS m/z 224.1 (M + Na)+, Rt 0.62 min. Intermediate 175: (R)-N-((S)-1-(2-fluoro-4-(1 -methylcyclopropyl)phenyl)ethyl)-2- methylpropane-2-sulfinamide
Figure imgf000107_0001
Step 1
To an oven dried round bottom flask with stir bar was added 4-bromo-2- fluorobenzaldehyde (5 g, 24.6 mmol), (R)-2-methylpropane-2-sulfinamide (3.28 g, 27.1 mmol) and DCE (49 ml_). To this mixture was then added copper (II) sulfate (5.90 g, 36.9 mmol). Reaction mixture was heated in a preheated oil bath to 55 °C for 18 hours. Reaction mixture was filtered through a pad celite, washing the solids with CH2CI2- The filtrate was concentrated to afford a viscous yellow oil of (R,E)-N-(4-bromo-2- fluorobenzylidene)-2-methylpropane-2-sulfinamide (7.73 g, 25.2 mmol, 103 % yield). 1 H NMR (400 MHz, CDCL3) δ 1.27 (s, 9 H) 7.31 - 7.42 (m, 2 H) 7.87 (t, J=7.87 Hz, 1 H) 8.83 (s, 1 H). LCMS m/z 307.9 (M + H)+, Rt 1.01 min.
Step 2
To a solution of (R,E)-N-(4-bromo-2-fluorobenzylidene)-2-methylpropane-2-sulfinamide (7.73 g, 25.2 mmol) in CH2CI2 (252 ml_), cooled to 0°C (water/ice bath) under nitrogen, was added 3M methyl magnesium bromide (33.7 ml_, 101 mmol) in Et20. Reaction mixture allowed to stir for 30 min at 0°C, then gradually allowed to warm to room temperature and stirred for 1 hour at room temperature. Reaction mixture was cooled to 0°C then quenched with the slow addition of a saturated solution of NH4CI. Aqueous mixture extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated onto silica gel. Silica gel column chromatography (EtOAc/Heptane 40 to 100%) provided (R)-N-((S)-1-(4-bromo-2- fluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (4.93 g, 15.3 mmol, 60% yield) as a white crystalline solid. 1H NMR (400 MHz, CDCL3) δ 1.20 (s, 9 H) 1 .56 (d, J=6.70 Hz, 3 H) 3.34 (br. s., 1 H) 4.77 - 4.87 (m, 1 H) 7.19 - 7.31 (m, 3 H). LCMS m/z 324.0 (M + H)+, Rt 0.90 min.
Step 3 To a microwave vial with stir bar was added (R)-N-((S)-1-(4-bromo-2-fluorophenyl)ethyl)- 2-methylpropane-2- (1 g, 3.10 mmol), isopropenyl boronic acid pinacol ester (1.51 ml, 8.07 mmol), DME (8 ml), sodium carbonate (7.76 ml, 15.5 mmol) (2.0 M aq) and PdCI2(dppf). CH2CI2 adduct (0.127 g, 0.155 mmol). Vessel was capped and heated by microwave irradiation for 20 min at 100 °C. Reaction mixture was diluted with a saturated solution of NH4CI. The aqueous mixture was extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated onto silica gel. Silica gel column chromatography (EtO Ac/ Heptane 50 to 100%) provided (R)-N-((S)-1 -(2-fluoro-4-(prop-1-en-2-yl)phenyl)ethyl)-2-methylpropane-2-sulfinamide (830 mg, 2.93 mmol, 94 % yield) as a pale brown crystalline. 1H NMR (400 MHz, DMSO) δ 1.08 - 1 .1 1 (m, 9 H) 1 .47 (d, J=6.80 Hz, 3 H) 2.09 (d, J=0.54 Hz, 3 H) 4.61 - 4.71 (m, 1 H) 5.14 (t, J=1 .32 Hz, 1 H) 5.43 (d, J=5.58 Hz, 1 H) 5.49 (s, 1 H) 7.24 - 7.30 (m, 1 H) 7.31 - 7.36 (m, 1 H) 7.41 - 7.47 (m, 1 H). LCMS m/z 284.0 (M + H)+, Rt 0.93 min. Step 4
To a round bottom flask containing (R)-N-((S)-1 -(2-fluoro-4-(prop-1-en-2-yl)phenyl)ethyl)- 2-methylpropane-2- (0.37 g, 1 .31 mmol) in DCE (13 mL) at 0 °C was added under argon diethylzinc (1.0M in hexanes) (13.1 mL, 13.1 mmol) followed by the dropwise addition of chloroiodomethane (0.95 mL, 13.1 mmol). Reaction mixture allowed to warm to room temperature and stirred for 1 hour. Reaction mixture was cooled to 0 °C whereupon a second addition of diethylzinc (1.0M in hexanes) (13.1 mL, 13.1 mmol) took place followed by the addition of chloroiodomethane (0.95 mL, 13.1 mmol). Reaction mixture allowed to warm to room temperature and stirred 18 hours under argon. Reaction mixture was cooled to 0 °C in a ice bath and to the cold reaction mixture was slowly added a saturated solution of NH4CI. The aqueous mixture was extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated onto silica gel. Silica gel column chromatography (EtOAc/Heptane 20 to 100%) provided a white crystalline of (R)-N-((S)-1 -(2-fluoro-4-(1- methylcyclopropyl)phenyl)ethyl)-2-methylpropane-2-sulfinamide (89 mg, 0.299 mmol, 22.92 % yield). 1H NMR (400 MHz, CDCL3) δ 0.75 - 0.79 (m, 2 H) 0.85 - 0.90 (m, 2 H) 1 .20 (s, 9 H) 1 .55 (s, 3 H) 1 .57 (d, J=6.80 Hz, 1 H) 3.34 (d, J=5.23 Hz, 1 H) 4.75 - 4.85 (m, 1 H) 6.90 (dd, J=12.30, 1.74 Hz, 1 H) 6.97 (dd, J=8.05, 1 .78 Hz, 1 H) 7.22 (t, J=7.97 Hz, 1 H). LCMS m/z 298.1 (M + H)+, Rt 1 .01 min. The Intermediates in Table 4k were prepared by a method similar to the one described for the preparation of Intermediate 175. Table 4k
Figure imgf000109_0002
Table 4m. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 4k.
Figure imgf000109_0003
Intermediate 178: (R)-N-((S)-1 -(4-(1 -ethoxycyclopropyl)-2-fluorophenyl)ethyl)-2- methylpropane-2-sulfinamide
Figure imgf000109_0001
Step l
To a microwave vial with stir bar was added (R)-N-((S)-1-(4-bromo-2-fluorophenyl)ethyl)- 2-methylpropane-2-sulfinamide (500 mg, 1.55 mmol) followed by the addition of tributyl(1-ethoxyvinyl)stannane (1 .12 g, 3.10 mmol), triethylamine (0.65 ml, 4.65 mmol) and PdCl2(dppf). CH2CI2 adduct (63 mg, 0.078 mmol). To the solids was added toluene (10 ml). Vial capped and heated in a preheated sand bath at 100 °C for 1 hour. Reaction mixture was loaded onto silica gel column. Silica gel column chromatography (MeOH/ CH2CI2 0 to 10% with 1 % NH4OH buffer) provided (R)-N-((S)-1 -(4-(1- ethoxyvinyl)-2-fluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (498 mg, 1.59 mmol, 102 % yield) as a brown viscous oil which crystallizes upon standing. 1 H NMR (400 MHz, CDCLs) δ 1.20 (s, 9 H) 1 .43 (t, J=6.97 Hz, 3 H) 1 .58 (d, J=6.75 Hz, 3 H) 3.35 (d, J=4.74 Hz, 1 H) 3.92 (q, J=6.96 Hz, 2H) 4.23 (d, J=2.79 Hz, 1 H) 4.65 (d, J=2.79 Hz, 1 H) 4.79 - 4.89 (m, 1 H) 7.16 - 7.20 (m, 1 H) 7.29 - 7.34 (m, 1 H) 7.39 (dd, J=8.07, 1 .66 Hz, 1 H).
Step 2
To a round bottom flask containing (R)-N-((S)-1-(4-(1-ethoxyvinyl)-2-fluorophenyl)ethyl)- 2-methylpropane-2-sulfinamide (0.49 g, 1.56 mmol) and chloroiodomethane (1.14 ml_, 15.6 mmol) in toluene (15 ml.) at 0 °C under argon was added diethylzinc (1.0M in hexanes) (15.6 ml_, 15.6 mmol). Reaction mixture allowed to warm to room temperature and stirred for 1 hour. Reaction mixture was cooled to 0 °C in an ice bath and to the cold reaction mixture was slowly added a saturated solution of NH4CI. The aqueous mixture was extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated onto silica gel. Silica gel column chromatography
(MeOH/CH2CI2 0 to 10%) provided (R)-N-((S)-1-(4-(1-ethoxycyclopropyl)-2- fluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (145 mg, 0.44 mmol, 28 % yield) as a viscous brown oil. 1H NMR (300 MHz, CDCL3) δ 0.93 - 0.99 (m, 2 H) 1 .14 - 1.20 (m, 3 H) 1 .21 (s, 9 H) 1 .22 - 1.27 (m, 2 H) 1.57 - 1 .61 (m, 4 H) 3.35 (d, J=4.98 Hz, 1 H) 3.45 (q, J=7.07 Hz, 2 H) 4.77 - 4.87 (m, 1 H) 6.98 (dd, J=7.58, 1 .43 Hz, 3 H) 7.00 - 7.03 (m, 4 H) 7.28 - 7.32 (m, 1 H). LCMS m/z 328.1 (M + H)+, Rt 0.95 min.
The Intermediate in Table 4n were prepared by a method similar to the one described for the preparation of Intermediate 178.
Table 4n.
Intermediate 179 Intermediate 180 Intermediate 181
F
Figure imgf000110_0001
Table 4p. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 4n.
Figure imgf000111_0002
Intermediate 182: (R)-N-((S)-1 -(4-(1 -cyanocyclopropyl)-2-fluorophenyl)ethyl)-2- methylpropane-2-sulfinamide
Figure imgf000111_0001
Step 1
To a microwave vial with a stir bar was added (R)-N-((S)-1-(4-bromo-2- fluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (300 mg, 0.93 mmol), 4- isoxazoleboronic acid pinacol ester (218 mg, 1 .12 mmol), PdCI2(dppf).CH2Cl2 adduct
(76 mg, 0.09 mmol), potassium fluoride (2.7 mL, 1.0 M in water, 2.79 mmol) and finally DMSO (9 mL). The reaction mixture was degassed with bubbling nitrogen (3 min) and the vial capped and heated in a preheated oil bath at 130 °C for 18 hours. The reaction mixture was diluted with a saturated solution of NH4CI and extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated onto silica gel. Silica gel column chromatography (EtOAc/Heptanes 40 to 100%) provided (R)-N-((S)-1 -(4-(cyanomethyl)-2-fluorophenyl)ethyl)-2-methylpropane-2- sulfinamide (136 mg, 0.48 mmol, 52 % yield) as a viscous brown oil. 1H NMR (400 MHz, CDCLs) δ 1.19 (s, 9 H) 1.57 (d, J=6.80 Hz, 3 H) 3.39 (d, J=4.35 Hz, 1 H) 3.74 (s, 2 H) 4.81 - 4.88 (m, 1 H) 7.04 (d, J=10.66 Hz, 1 H) 7.1 1 (d, J=7.97 Hz, 1 H) 7.38 (t, J=7.73 Hz, 1 H). LCMS m/z 283.0 (M + H)+, Rt 0.72 min. Step 2
To a scintillation vial containing (R)-N-((S)-1-(4-(cyanomethyl)-2-fluorophenyl)ethyl)-2- methylpropane-2- (86 mg, 0.31 mmol) and a stir bar was added toluene (2 ml_). To this mixture was then added tetrabutylammonium bromide (19 mg, 0.06 mmol) followed by the addition of NaOH (1.52 ml, 1 .0 M (aq), 1.52 mmol) and 1 ,2-dibromoethane (0.1 1 ml, 1 .22 mmol). Vial capped and reaction mixture was stirred vigorously at room temperature for 18 hours. Whereupon, 1 ,2-dibromoethane (0.1 1 ml, 1.22 mmol) and tetrabutylammonium bromide (19 mg, 0.06 mmol) were added and reaction mixture allowed to stir an additional 18 hours. A third addition of 1 ,2-dibromoethane (0.1 1 ml, 1 .22 mmol) was added and the reaction mixture heated to 50 °C for an additional 18 hours in a preheated aluminum tray. The reaction mixture was quenched with a saturated solution of NH4CI and the aqueous mixture extracted with EtOAc. Organics combined and washed twice with water, brine, dried (Na2S04), filtered and concentrated. Crude material was passed through a small plug of silica gel using 10%MeOH:90%DCM to elute product. The solution was concentrated to afford a viscous orange oil of (R)-N-((S)-1 -(4-(1 -cyanocyclopropyl)-2-fluorophenyl)ethyl)-2- methylpropane-2-sulfinamide (23 mg, 0.08 mmol, 24 % yield). 1H NMR (400 MHz, CDCLs) δ 1.20 (s, 9 H) 1 .38 - 1.44 (m, 2 H) 1.56 (d, J=6.75 Hz, 3 H) 1 .73 - 1.79 (m, 2 H) 3.37 (d, J=4.45 Hz, 1 H) 4.78 - 4.88 (m, 1 H) 6.94 (dd, J=1 1 .35, 1 .91 Hz, 1 H) 7.09 (dd, J=8.07, 1.91 Hz, 1 H) 7.34 (t, J=7.90 Hz, 1 H). LCMS m/z 309.2 (M + H)+, Rt 0.83 min.
Intermediate 183: (R)-N-((S)-1-(2-fluoro-4-isopropylphenyl)ethyl)-2-methylpropane-2- sulfinamide
Figure imgf000112_0001
To a round bottom flask containing (R)-N-((S)-1 -(2-fluoro-4-(prop-1-en-2-yl)phenyl)ethyl)- 2-methylpropane-2-sulfinamide (204 mg, 0.72 mmol) and a stir bar was added MeOH (7.2 ml_). To this solution was added palladium on carbon (77 mg, 10%, 0.07 mmol) in MeOH (1 ml_). A hydrogen atmosphere was inserted and the resulting reaction mixture stirred at room temperature for 18 hours, at which time more palladium on carbon was added (300 mg) in MeOH (5 ml_). A hydrogen atmosphere was inserted again and the reaction mixture allowed to stir an additional 18 hours at room temperature. The reaction mixture was filtered through a syringe filter and concentrated to afford a light brown viscous oil of (R)-N-((S)-1 -(2-fluoro-4-isopropylphenyl)ethyl)-2-methylpropane-2- sulfinamide (149 mg, 0.52 mmol, 73 % yield) which crystallizes upon standing. 1 H NMR (400 MHz, CDCIs) δ 1.20 (s, 9 H) 1.24 (d, J=5.87 Hz, 6 H) 1.58 (d, J=6.70 Hz, 3 H) 2.89 (dt, J=13.79, 6.90 Hz, 1 H) 3.35 (d, J=5.04 Hz, 1 H) 4.76 - 4.85 (m, 1 H) 6.90 (dd, J=12.03, 1.52 Hz, 1 H) 6.98 (dd, J=7.90, 1.54 Hz, 1 H) 7.24 (t, J=7.97 Hz, 1 H). LCMS m/z 286.3 (M + H)+, Rt 1 .01 min.
Intermediate 184: (R)-N-((S)-1-(4-cyclopropyl-2-fluorophenyl)ethyl)-2-methylpropane-2- sulfinamide
Figure imgf000113_0001
To a microwave vial containing a stir bar was added (R)-N-((S)-1-(4-bromo-2- fluorophenyl) ethyl)-2-methylpropane-2-sulfinamide (100 mg, 0.31 mmol) followed by the addition of potassium cyclopropyltnfluoroborate (459 mg, 3.10 mmol), cesium carbonate (506 mg, 1 .55 mmol) and Pd(OAc)2 (7 mg, 0.03 mmol) and di(1 -adamantyl)-n- butylphosphine (22 mg, 0.06 mmol), toluene (2.6 ml.) and finally water (0.5 ml_). The vial capped and heated by microwave irraditation for 20 min at 100 °C, followed by thermal heating at 100°C in a preheated aluminum tray for 18 hours. The reaction mixture was diluted with a saturated solution of NH4CI. The aqueous mixture extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated to afford a yellow crystalline of (R)-N-((S)-1 -(4-cyclopropyl-2- fluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (1 16 mg, 0.33 mmol, 106 % yield). LCMS m/z 284.0 (M + H)+, Rt 0.90 min.
Intermediate 185: (R)-N-((S)-1-(6-cyclopropylpyridin-3-yl)ethyl)-2-methylpropane-2- sulfinamide
Figure imgf000113_0002
(R)-N-((S)-1 -(6-cyclopropylpyridin-3-yl)ethyl)-2-methylpropane-2-sulfinamide is prepared with a method similar to that used to access Intermediate 184. MS m/z 267.1 (M + H)+, Rt 0.44 min. Intermediate 186: (R)-N-((S)-1-(2-fluoro-4-(1-methyl-1 H-pyrazol-4-yl)phenyl)ethyl)-2- methylpropane-2-sulfinamide
Figure imgf000114_0001
To a two microwave vials with stir bars were added (R)-N-((S)-1 -(4-bromo-2- fluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (1.5 g, 4.65 mmol), 1-methyl-4-1 H- pyrazoleboronic acid pinacol ester (2.91 g, 13.9 mmol), DME (20 mL), sodium carbonate (1 1.6 mL, 23.3 mmol, 2.0 M aq) and PdCl2(dppf).CH2Cl2 adduct (190 mg, 0.23 mmol) divided between the two vials. The vials were capped and heated by microwave irradiation for 20 min at 100 °C respectively. The reaction mixtures combined, diluted with a saturated solution of NH4CI and EtOAc. The phases were partitioned and the aqueous phase extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated onto silica gel. Silica gel column chromatography (EtOAc/Heptane 40 to 100%) provided a orange crystalline of (R)-N- ((S)-1 -(2-fluoro-4-(1 -methyl-1 H-pyrazol-4-yl)phenyl)ethyl)-2-methylpropane-2-sulfinamide (1.07 g, 3.31 mmol, 71 % yield. 1H NMR (400 MHz, CDCL3) δ ppm 1.21 (s, 9 H) 1.60 (d, J=6.80 Hz, 3 H) 3.36 (d, J=4.25 Hz, 1 H) 3.96 (s, 3 H) 4.79 - 4.91 (m, 1 H) 7.13 (dd, J=1 1.69, 1.61 Hz, 1 H) 7.23 (dd, J=8.00, 1 .64 Hz, 1 H) 7.30 - 7.37 (m, 1 H) 7.60 (s, 1 H) 7.74 (s, 1 H). LCMS m/z 324.0 (M + H)+, Rt 0.74 min.
The Intermediates in Table 4q were prepared by a method similar to the one described for the preparation of Intermediate 186.
Table 4q.
Figure imgf000114_0002
Table 4r. Chemical name, NMR chemical shifts and LCMS signal for each intermediate listed in Table 4q.
Figure imgf000115_0002
Intermediate 190: (R)-N-((S)-1-(2-fluoro-4-(trifluoromethyl)phenyl)ethyl)-2- methylpropane-2-sulfinamide
Figure imgf000115_0001
Step 1
To a oven dried round bottom flask with stir bar was added 2-fluoro-4-(trifluoromethyl) benzaldehyde (5 g, 26.0 mmol), (R)-2-methylpropane-2-sulfinamide (3.47 g, 28.6 mmol) and DCE (52 ml_). To this mixture was then added copper (II) sulfate (6.23 g, 39.0 mmol). The reaction mixture was heated in a preheated oil bath at 55 °C for 18 hours. The reaction mixture was filtered through a pad celite, washing the solids with DCE. The filtrate was concentrated to afford a viscous green oil of (R,E)-N-(2-fluoro-4- (trifluoromethyl)benzylidene)-2-methyl propane-2-sulfinamide (7.3 g, 24.7 mmol, 95 % yield). Material was taken onto next step without further purification. 1H NMR (400 MHz, CDCIs) δ ppm 1 .29 (s, 9 H) 7.44 (d, J=10.08 Hz, 1 H) 7.51 (d, J=8.27 Hz, 1 H) 8.13 (t, J=7.46 Hz, 1 H) 8.92 (s, 1 H). LCMS m/z 296.0 (M + H)+, Rt 1.02 min. Step 2 To a solution of (R,E)-N-(2-fluoro-4-(trifluoromethyl)benzylidene)-2-methylpropane-2- sulfinamide (7.3 g, 24.7 mmol) in CH2CI2 (247 mL) cooled to 0°C (water/ice bath) under nitrogen, was added 3M methyl magnesium bromide (33 mL, 99 mmol) in Et20. Reaction mixture allowed to stir for 30 min at 0°C, then gradually allowed to warm to room temperature and stirred for 1 hour at room temperature. Reaction mixture was cooled to 0°C then quenched with the slow addition of a saturated solution of NH4CI. Aqueous mixture extracted with EtOAc. Organic phases combined, washed with water, brine, dried (Na2S04), filtered and concentrated onto silica gel. Silica gel column chromatography (EtOAc/Heptane 40 to 100%) provided (R)-N-((S)-1 -(2-fluoro-4- (trifluoromethyl)phenyl)ethyl)-2-methylpropane-2-sulfinamide (4.68 g, 15.0 mmol, 61 % yield) as a white crystalline solid. 1H NMR (400 MHz, CDCL3) δ 1 .22 (s, 9 H) 1.60 (d, J=6.80 Hz, 3 H) 3.38 (d, J=4.01 Hz, 1 H) 4.87 - 4.97 (m, 1 H) 7.33 (d, J=10.32 Hz, 1 H) 7.39 - 7.45 (m, 1 H) 7.49 - 7.55 (m, 1 H). LCMS m/z 312.0 (M + H)+, Rt 0.92 min. Intermediate 191 : (R)-N-((S)-1 -(6-tert-butylpyridin-3-yl)ethyl)-2-methylpropane-2- sulfinamide
Figure imgf000116_0001
(R)-N-((S)-1 -(6-tert-butylpyridin-3-yl)ethyl)-2-methylpropane-2-sulfinamide is prepared with methods similar to those used to prepare Intermediate 190. 1 H NMR (400 MHz, CDCI3) δ 1 .22 (s, 9 H) 1.37 (s, 9 H) 1.57 (d, J=6.75 Hz, 3 H) 3.31 (d, J=3.37 Hz, 1 H) 4.56 - 4.65 (m, 1 H) 7.32 (d, J=8.22 Hz, 1 H) 7.57 (dd, J=8.24, 2.23 Hz, 1 H) 8.54 (d, J=2.05 Hz, 1 H). MS m/z 283.1 (M + H)+, Rt 0.51 min.
Intermediate 192: (S)-tert-butyl 1-(3-chloro-4-(cyclopentylcarbamoyl)phenyl)ethyl carbamate
Figure imgf000116_0002
Step 1 To a round bottom flask with stir bar was added 4-((S)-1 aminoethyl-2-chlorobenzoic acid HCI salt (1.05 g, 4.45 mmol) followed by the addition of THF (40 ml_). To this solution was added DIEA (1 .86 ml, 10.7 mmol). The reaction mixture becomes cloudy white followed by the addition of di-tert-butyl dicarbonate (1 .07 g, 4.89 mmol). Resulting reaction mixture allowed to stir for 18 hours at room temperature. At which time the reaction mixture was then heated to 60 °C for 2 hours in a oil bath. Di-tert-butyl dicarbonate (1.07 g, 4.89 mmol) and NMP (20 ml) were then added and the resulting reaction mixture allowed to stir for 2 hours at 60 °C. Volatiles were removed. The resulting oil was diluted with a saturated solution of NH4CI and the aqueous mixture extracted with EtOAc. The organic phases combined, washed twice with water, brine, dried (Na2S04), filtered and concentrated to a viscous yellow oil of (S)-4-(1-(tert-butoxycarbonylamino)ethyl)-2- chlorobenzoic acid (2.32 g, 6.19 mmol, 139 % yield) which contains some excess di-tert- butyl dicarbonate and NMP. LCMS m/z 284.9 (M + H)+(carboxylic acid fragment + CH3CN adduct), Rt 0.75 min.
Step 2
To a round bottom flask with stir bar was added (S)-4-(1-(tert- butoxycarbonylamino)ethyl)-2-chlorobenzoic acid (450 mg, 1 .20 mmol), cyclopentylamine (355 μΙ_, 3.60 mmol), EDC HCI (460 mg, 2.40 mmol), 1 -hydroxy-7-aza- benzotriazole (229 mg, 1 .68 mmol) and DMF (6 ml_). To this mixture was then added DIEA (629 μΙ_, 3.60 mmol). Reaction mixture was allowed to stir at room temperature for 18 hours. The reaction mixture was diluted with water and extracted with EtOAc. The organic phases were combined, washed with twice with water, brine, dried (Na2S04), filtered and concentrated to a brown crystalline of (S)-tert-butyl 1 -(3-chloro-4- (cyclopentylcarbamoyl) phenyl)ethylcarbamate (476 mg, 1.17 mmol, 97 % yield). LCMS m/z 367.0 (M + H)+, Rt 0.90 min.
The Intermediates in Table 4s were prepared by a method similar to the one described for the preparation of Intermediate 192. Table 4s.
Figure imgf000118_0002
Table 4t. Chemical name and LCMS signal for each intermediate listed in Table 4s.
Figure imgf000118_0003
Intermediate 195: (S)-tert-butyl 1-(3-hydroxyphenyl)ethylcarbamate
Figure imgf000118_0001
A slurry of (S)-3-(1-aminoethyl)phenol (1.188 g, 6.84 mmol) and Boc20 (1.747 mL, 7.53 mmol) in DCM (17.10 mL) was stirred at room temperature under N2 while slowly adding DIEA (1.434 mL, 8.21 mmol). The initially insoluble starting materials slowly dissolve. The solution was stirred at room temperature for 16 hours and then concentrated. The oily residue was re-dissolved in EtOAc and washed with Na2C03 saturated, followed by brine. The original aqueous layer was re-extracted with EtOAc, which was then washed with brine and combined with the previous EtOAc batch. The combined organics were dried over Na2S0 , filtered and concentrated to 2.4g crude clear yellowish oil which was purified by silica gel column chromatography (EtOAc/Heptane 0 to 30%), yielding (S)- tert-butyl 1-(3-hydroxyphenyl)ethylcarbamate as a clear colourless oil, which solidifies upon sitting (1.79 g, 7.55 mmol, 110 % yield). 1H NMR (400 MHz, CDCL3) δ 1.44 (br. s., 12 H) 4.08 - 4.18 (m, 1 H) 4.76 (br. s., 1 H) 6.72 (dd, J=7.46, 1.83 Hz, 1 H) 6.78 (br. s., 1 H) 6.88 (br. s., 1 H) 7.16 - 7.24 (m, 1 H). LCMS m/z 223.0/182.0 (the parent not observed, just the Boc fragments) (M + H)+, Rt 0.71 min. Intermediate 196: (S)-1 -(3-(cyclopentyloxy)phenyl)ethanamine hydrochloride
Figure imgf000119_0001
Step 1 : Mitsunobu A
To a solution of (S)-tert-butyl 1-(3-hydroxyphenyl)ethylcarbamate (107.5 mg, 0.453 mmol), PPh3 (238 mg, 0.906 mmol) and cyclopentanol (0.164 ml, 1.812 mmol) in THF (2 ml) at room temperature was added DEAD (0.143 ml, 0.906 mmol) dropwise under
The resulting yellow solution was stirred for 4 hours and then concentrated. The viscous yellow oil was re-dissolved in DMSO and purified by reverse phase HPLC. The combined product fractions were desalted by addition of equal amount of EtOAc and about 250mg Na2C03 in a separatory funnel. The phases were separated and the organic washed with brine, dried over MgS04, filtered and concentrated in vacuo to yield
(S)-tert-butyl 1 -(3-(cyclopentyloxy)phenyl)ethylcarbamate (75.1 mg, 0.246 mmol, 54.3 % yield) as a white solid film. LCMS m/z 291.1/250.0 (the parent not observed, just the Boc fragments) (M + H)+, Rt 1.07 min.
Step 2
(S)-tert-butyl 1 -(3-(cyclopentyloxy)phenyl)ethylcarbamate (75.1 mg, 0.246 mmol) was dissolved in 4M HCI in dioxane (1 ml, 4.00 mmol) and the resulting mixture was allowed to sit for 1 hour, then concentrated to yield (S)-1-(3-(cyclopentyloxy)phenyl)ethanamine as an HCI salt (yield assumed quantitative). LCMS m/z 206.1 (M + H)+, Rt 0.61 min. Intermediate 197: (S)-1 -(3-(cyclohexyloxy)phenyl)ethanamine hydrochloride
Figure imgf000120_0001
Step 1 : Mitsunobu B
To a solution of (S)-tert-butyl 1-(3-hydroxyphenyl)ethylcarbamate (100 mg, 0.421 mmol), cyclohexanol (0.180 ml, 1 .686 mmol) and PPh3 (221 mg, 0.843 mmol) in THF (2 ml), was added DEAD (0.133 ml, 0.843 mmol) dropwise, under at room temperature. The resulting yellow solution was stirred for 3 hours, at which point another batch of cyclohexanol (0.180 ml, 1 .686 mmol), PPh3 (221 mg, 0.843 mmol), and 10min later DEAD (0.133 ml, 0.843 mmol), was added at room temperature. The reaction mixture was stirred for 16 hours and then concentrated. The crude clear oil was re-dissolved in DMSO and purified by reverse phase HPLC. The combined product fractions were desalted by addition of equal amount of EtOAc and about 250mg Na2C03 in a separatory funnel. The phases were separated and the organic washed with brine, dried over MgS0 , filtered and concentrated in vacuo to yield (S)-tert-butyl 1-(3- (cyclohexyloxy)phenyl)ethylcarbamate (74.1 mg, 0.232 mmol, 55.0 % yield) as a clear colourless film. LCMS m/z 305.0/264.0 (the parent not observed, just the Boc fragments) (M + H)+, Rt 1 .12 min.
Step 2
(S)-tert-butyl 1 -(3-(cyclohexyloxy)phenyl)ethylcarbamate (74.1 mg, 0.232 mmol) was dissolved in 4M HCI in dioxane (1 ml, 4.00 mmol) and the resulting mixture was allowed to sit for 1 hour, then concentrated to yield (S)-1 -(3-(cyclohexyloxy)phenyl)ethanamine as an HCI salt (yield assumed quantitative). LCMS m/z 220.1 (M + H)+, Rt 0.66 min. The Intermediates in Table 4v were prepared using either the method described for the preparation of Intermediate 196 or Intermediate 197. Table 4v.
Intermediate: Name Structure LCMS
198: (S)-1 -(3- MS m/z 206.1 (M +
(cyclopentyloxy)phenyl)ethanamine H)+, Rt 0.61 min.
199: (S)-1-(3- MS m/z 220.1 (M +
(cyclohexyloxy)phenyl)ethanamine H)+, Rt 0.66 min.
200: (S)-1-(3- MS m/z 234.1 (M +
(cycloheptyloxy)phenyl)ethanamine H)+, Rt 0.73 min.
201 : (S)-1-(3- X> MS m/z 180.1 (M + isopropoxyphenyl)ethanamine H)+, Rt 0.50 min.
202: (S)-1-(3- MS m/z 194.1 (M + isobutoxyphenyl)ethanamine H)+, Rt 0.61 min.
Figure imgf000121_0001
203: (S)-1-(3-((S)-tetrahydrofuran- MS m/z 208.1 (M + 3-yloxy)phenyl)ethanamine H)+, Rt 0.41 min. 204: (1 S)-1-(3-(tetrahydro-2H- MS m/z 222.1 (M + pyran-3-yloxy)phenyl)ethanamine H)+, Rt 0.46 min.
Figure imgf000122_0001
Intermediate 205: (S)-1 -(3-phenoxyphenyl)ethanamine
Figure imgf000122_0002
Into a 20ml microwave vial was weighted 1 -(pyridin-2-yl)propan-2-one ligand (90 mg, 0.665 mmol), phenol (407 mg, 4.32 mmol), CuBr (47.7 mg, 0.332 mmol) and Cs2C03 (2166 mg, 6.65 mmol). To the mixture was added DMSO (5 ml) and (S)-1-(3- bromophenyl)ethanamine (0.5 ml, 3.32 mmol). The tube was flushed with N2, capped, and the black mixture heated in the oil bath at 90°C for 18 hours. The heterogenous mixture was diluted with EtOAc and filtered through a glass-fritted funnel, eluting with EtOAc and another 5mls of DMSO. The volatiles were then removed in vacuo and the crude brown liquid was filtered through 1 μηη PTFE filter and purified by reverse phase HPLC. The combined product fractions were desalted by addition of equal amount of EtOAc and about 250mg Na2C03 in a separatory funnel. The phases were separated and the organic washed with brine, dried over MgS04, filtered and concentrated in vacuo to yield (S)-1 -(3-phenoxyphenyl)ethanamine (361.5 mg, 1.678 mmol, 50.5 % yield) as an amber oil. LCMS m/z 214.1 (M + H)+, Rt 0.61 min.
Intermediate 206: (S)-1 -(2,3-difluorophenyl)ethanamine
Figure imgf000122_0003
Step 1
To a oven dried round bottom flask with stir bar was added 2,3-difluorobenzaldehyde (0.5 g, 3.52 mmol), (R)-2-methylpropane-2-sulfinamide (0.469 g, 3.87 mmol) and DCE (7.04 ml_). To this mixture was then added Copper (II) Sulfate (0.842 g, 5.28 mmol). Reaction mixture heated in a preheated oil bath to 55 °C for 24 hours. The reaction mixture was filtered through a celite pad washing solids with DCE. Combined filtrate was concentrated to afford a viscous yellow oil of (R,E)-N-(2,3-difluorobenzylidene)-2- methylpropane-2-sulfinamide (0.8007 g, 3.26 mmol, 93 % yield). LCMS m/z 246.1 (M + H)+, Rt 0.91 min.
Step 2
To a solution of (R,E)-N-(2,3-difluorobenzylidene)-2-methylpropane-2-sulfinamide (0.800 g, 3.26 mmol) in DCM (32.6 ml_), cooled to 0°C (water/icebath) under N2, was added 3M MeMgBr (4.35 ml_, 13.05 mmol) in diethyl ether. Reaction mixture allowed to stir for 30 min at 0 °C. Then gradually allowed to warm to room temperature and stirred for 30min at room temperature. Reaction mixture was cooled to 0 °C then quenched with the slow addition of a saturated solution of NH4CI and diluted with EtOAc. Phases partitioned aqueous phase extracted with EtOAc and the organic layers combined washed with water, brine, dried with MgS04, filtered and concentrated to afford (R)-N-((S)-1 -(2,3- difluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (0.7868 g, 3.01 mmol, 92 % yield) as yellow solid. LCMS m/z 262.0 (M + H)+, Rt 0.70 min. Step 3
To a round bottom flask containing (R)-N-((S)-1 -(2,3-difluorophenyl)ethyl)-2- methylpropane-2-sulfinamide (786.8 mg, 3.01 mmol) was added Dioxane (10.000 ml_). To this solution was added HCI in dioxane 4.0M (1 .505 ml_, 6.02 mmol) and the solution was allowed to stir 15 min at room temperature. The reaction mixture was concentrated, dissolved in Et20 10 ml, and concentrated again. Et20 was again added and resulting mixture sonnicated and a solid material was filtered and dried to afford (S)-1 -(2,3- difluorophenyl)ethanamine (0.4213 g, 2.176 mmol, 72.3 % yield) as a white crystalline HCI salt. 1 H NMR (400 MHz, D20) d ppm 1.55 (d, J=6.99 Hz, 3 H) 4.71 (q, J=6.96 Hz, 1 H) 7.10 - 7.26 (m, 3 H); LCMS m/z 158.0 (M + H)+, Rt 0.37 min.
Intermediate 207: (S)-1 -(4-(difluoromethyl)-2-fluorophenyl)ethanamine
Figure imgf000123_0001
Step 1 : Preparation of 1 -bromo-4-(difluoromethyl)-2-fluorobenzene
A mixture of 4-bromo-3-fluorobenzaldehyde (2.03 g, 10 mmol) and (diethylamino)sulfur trifluoride (DAST; 1.32 mL, 10 mmol) is heated carefully until exothermic reaction occurs, then heated at 60 °C for 15 min, and allowed to cool to room temperature. The mixture was diluted with DCM (20 mL) and poured into ice/water (30 mL). The mixture was neutralized with NaHC03 to ~pH 8. The separated aqueous layer was extracted with
DCM (20 mL). The combined organic layers were dried over Na2S04, filtered off, and concentrated under reduced pressure. The residue was purified by column chromatography [Si02, 40 g, heptane/ethyl acetate], providing 1-bromo-4- (difluoromethyl)-2-fluorobenzene (0.845 g) as a clear colorless oil.
Step 2: Preparation of 4-(difluoromethyl)-2-fluorobenzaldehyde
To a solution of 1-bromo-4-(difluoromethyl)-2-fluorobenzene (31 1 mg, 1.382 mmol) in THF (2.99 mL) was added butyllithium ( 1 .6M solution in hexanes; 0.881 mL, 1.410 mmol) over ~5 min at -78 °C. The reaction mixture was stirred for 30 min at -78 °C then DMF (0.161 mL, 2.073 mmol) was added dropwise over ~1 min. Stirring was continued for 20 min. The reaction mixture was quenched with aqueous 1 M HCI solution/MeOH (2:1 , 3 mL) and allowed to warm to room temperature. The mixture was diluted with 5 mL of water. The separated aqueous layer was with ether (5 mL). The combined organic layers were washed with 1 M aqueous NaOH solution (10 mL) and saturated brine (10 mL), dried over MgS04, filtered off and concentrated under reduced pressure. Repeated reaction with 420 mg of 1 -bromo-4-(difluoromethyl)-2-fluorobenzene and combined crude materials for purification. The crude material was purified by column chromatography [Si02, 24 g, heptane/ethyl acetate], providing 4-(difluoromethyl)-2- fluorobenzaldehyde (162.8 mg) as a yellow oil.
Step 3: Preparation of (R,E)-N-(4-(difluoromethyl)-2-fluorobenzylidene)-2- methylpropane-2-sulfinamide
To a mixture of 4-(difluoromethyl)-2-fluorobenzaldehyde (162 mg, 0.930 mmol) and (R)- 2-methylpropane-2-sulfinamide (124 mg, 1.023 mmol) in DCE (3 mL) was added copper sulfate (223 mg, 1 .396 mmol). Reaction mixture was heated in a preheated oil bath to 55 °C for 38 hours. The mixture was allowed to cool to room temperature, filtered through a pad of celites and washed with DCE. Combined filtrates were concentrated under reduced pressure to afford (R,E)-N-(4-(difluoromethyl)-2-fluorobenzylidene)-2- methylpropane-2-sulfinamide (266 mg) as a yellow oil, which was used without further purification. LCMS m/z 278.1 (M + H)+, Rt 0.98 min. Step 4: Preparation of (R)-N-((S)-1 -(4-(difluoromethyl)-2-fluorophenyl)ethyl)-2- methylpropane-2-sulfinamide
To a solution of (R,E)-N-(4-(difluoromethyl)-2-fluorobenzylidene)-2-methylpropane-2- sulfinamide (266 mg, 0.959 mmol) in DCM (9.6 mL) was added methylmagnesium bromide (3M in diethylether; 1 .20 mL) at 0 °C. The reaction mixture was allowed to stir for 30 min at 0 °C, gradually allowed to warm to room temperature and stirred for 1 hour at room temperature. The mixture was cooled to 0 °C, and carefully quenched with saturated aqueous NH4CI solution (3 mL). The separated aqueous phase was extracted with DCM. The combined organic layers were washed with brine, dried over sodium sulfate, filtered off and concentrated under reduced pressure. The crude material was purified by column chromatography [Si02, 40 g, heptane/ethyl acetate], providing (R)-N- ((S)-1-(4-(difluoromethyl)-2-fluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (160.5 mg) as a white solid. LCMS m/z 294.5 (M + H)+, Rt 0.85 min. Step 5: Preparation of (S)-1 -(4-(difluoromethyl)-2-fluorophenyl)ethanamine
To (R)-N-((S)-1-(4-(difluoromethyl)-2-fluorophenyl)ethyl)-2-methylpropane-2-sulfinamide (160 mg, 0.545 mmol) was added 4M HCI in dioxane (409 μί) to give a yellow solution. The resulting mixture was stirred at room temperature for ~1 hour. To the mixture was added slowly diethylether (-20 mL). The solids were filtered off, suspended in diethylether, filtered off and rinsed with diethylether, dried under reduced pressure providing (S)-1-(4-(difluoromethyl)-2-fluorophenyl)ethanamine (103 mg) as an off-white solid, which was used without further purification. LCMS m/z 190.1 (M + H)+, Rt 0.42 min. Intermediate 208: (S)-1 -(4-(pyrimidin-5-yloxy)phenyl)ethanamine
Figure imgf000125_0001
Step 1 : Preparation of 4-(pyrimidin-5-yloxy)benzaldehyde
To a solution of pyrimidin-5-ol (500 mg, 5.20 mmol) in DMF (5.20 mL) under argon was added 4-fluorobenzaldehyde (0.558 mL, 5.20 mmol), sodium methanesulfinate (133 mg, 1 .30 mmol), and potassium carbonate (1 .079 g, 7.81 mmol). The reaction mixture was heated at 120 °C for 3 hour. The mixture was allowed to cool to room temperature and was diluted with water (25 mL). The mixture was extracted with EtOAc (2x 25 mL). The combined organic layers were washed with brine (2x 50 mL), dried over sodium sulfate, filtered off and concentrated under reduced pressure. The residue was purified by column chromatography [Si02, 24 g, heptane/ethyl acetate], providing 4-(pyrimidin-5- yloxy)benzaldehyde (666 mg) as a yellow solid. LCMS m/z 201.0 (M + H)+, Rt 0.52 min.
Step 2: Preparation of (R,E)-2-methyl-N-(4-(pyrimidin-5- yloxy)benzylidene)propane-2-sulfinamide
A mixture of 4-(pyrimidin-5-yloxy)benzaldehyde (666 mg, 3.33 mmol), (R)-(+)-tert- butanesulfinamide (450 mg, 3.71 mmol) and copper sulfate (796 mg, 4.99 mmol) in anhydrous in dichloroethane (7.648 mL) and under argon was heated at 55 °C for -21 hours. The reaction mixture was allowed to cool to room temperature. The slurry was filtered through a celite pad, eluted with DCM (5x 10 mL). The combined filtrates were concentrated under reduced pressure and the resulting yellowish oil was purified by column chromatography [Si02, 24 g, heptane/ethyl acetate] providing (R,E)-2-methyl-N- (4-(pyrimidin-5-yloxy)benzylidene)propane-2-sulfinamide (836 mg) as a pale viscous oil. LCMS m/z 304.0 (M + H)+, Rt 0.79 min.
Step 3: Preparation of 2-methyl-N-((S)-1 -(4-(pyrimidin-5- yloxy)phenyl)ethyl)propane-2-sulfinamide
A solution of (R,E)-2-methyl-N-(4-(pyrimidin-5-yloxy)benzylidene)propane-2-sulfinamide (830 mg, 2.74 mmol) in DCM (6.72 mL) was cooled to -40 °C. To the solution was added methylmagnesium bromide (3M in diethylether; 1 .81 mL) dropwise over 10 min. Additional DCM (5 mL) were added to retain stirring. The yellow suspension was stirred at -40 °C for -30 min while warming to -20 °C. The mixture was cooled to -40 °C and additional methylmagnesium bromide (3M in diethylether; 1.8 mL) was added. The suspension was stirred for -3 hour while slowly warming to -20 °C. The mixture was cooled to --40 °C, and additional methylmagnesium bromide (3M in diethylether; 0.4mL) was added. The suspension was stirred for 30 min and allowed to warm to -10 °C. The mixture was quenched slowly over 10 min with saturated aqueous NH4CI solution (10 mL). The mixture was diluted with saturated aqueous NH4CI solution (30 mL) and water (15 mL). The separated aqueous phase was extract with DCM (2x 75 mL). The combined organic layers were washed with brine (50 mL), dried over Na2S04, filtered off and concentrated under reduced pressure. The residue was purified by column chouromatography [Si02, 40 g, heptane/ethyl acetate followed by 5% MeOH in EtOAc] providing 2-methyl-N-((S)-1 -(4-(pyrimidin-5-yloxy)phenyl)ethyl)propane-2-sulfinamide (55 mg; purity -87%) as an off-white solid. LCMS m/z 320.0 (M + H)+, Rt 0.69 min.
Step 4: Preparation of (S)-1 -(4-(pyrimidin-5-yloxy)phenyl)ethanamine To 2-methyl-N-((S)-1-(4-(pyrimidin-5-yloxy)phenyl)ethyl)propane-2-sulfinamid (55 mg, 0.172 mmol) was added 4M HCI in dioxane (800 μΙ_, 3.20 mmol) to give a white suspension. This resulting mixture was stirred at room temperature for -35 min and concentrated under reduced pressure to provide crude (S)-1-(4-(pyrimidin-5- yloxy)phenyl)ethanamine (44 mg) as its HCI salt, which was used without further purification. LCMS m/z 217.1 (M + H)+, Rt 0.37 min.
Intermediate 209: 5-chloro-6-(1 ,1 -difluoroethyl)nicotinaldehyde
Figure imgf000127_0001
Step 1 : Preparation of ethyl 5,6-dichloronicotinate
To a solution of 5,6-dichloronicotinic acid (20.01 g, 104 mmol) in EtOH (500 mL) at 20 °C was added chlorotrimethylsilane (132 mL, 1042 mmol). The reaction was stirred for 72 hours. The reaction mixture was then concentrated and diluted with EtOAc (500mL), and washed with saturated NaHC03 (2x100mL) and brine (100mL). The organic was then dried (Na2S04) and concentrated under reduced pressure to give final crude product (21.25 g). LCMS m/z 220.1 (M + H)+, Rt 0.94 min.
Step 2: Preparation of ethyl 6-acetyl-5-chloronicotinate
To a suspension of ethyl 5,6-dichloronicotinate (5.26 g, 23.90 mmol) and tetraethylammonium-chloride (1 1.88 g, 71.7 mmol) in MeCN (50 mL) was added tributyl(1-ethoxyvinyl)stannane (9.50 g, 26.3 mmol) and PdCI2(PPh3)2 (0.671 g, 0.956 mmol). The reaction was sealed, heated at 80 °C for 5 hours. A dark color clear solution resulted. The reaction mixture was then cooled to 20 °C, concentrated and diluted with EtOAc (200mL), and washed with water (50mL) and brine (50mL). The organic was then dried (Na2S04) and concentrated to give crude ethyl 5-chloro-6-(1- ethoxyvinyl)nicotinate. The residue was then dissolved in THF (100mL) and HCI (20mL, 3M in H20) was added. The reaction mixture was stirred at 20 °C for 5 hours, and saturated NaHC03 solution was added until pH=8. The mixture was then diluted with EtOAc (200mL) and water (50mL). The phases were separated and the aqueous layer was extracted with EtOAc (2x50mL). The combined organics was washed with brine (20ml_), dried (Na2SC>4) and concentrated to afford the desired product (3.56 g). LCMS m/z 228.5 (M + H)+, Rt 0.83 min.
Step 3: Preparation of ethyl 5-chloro-6-(1 ,1 -difluoroethyl)nicotinate
To a solution of ethyl 6-acetyl-5-chloronicotinate (3.01 g, 13.22 mmol) in CHCI3 (7 mL) was added DAST (5.20 mL, 39.7 mmol) and ethanol (0.061 g, 1 .32 mmol). The reaction was sealed, heated at 60 °C for 24 hours. A dark color clear solution resulted. The reaction mixture was then cooled to 20 °C, and added cautiously with cold concentrated NaHC03 aqueous solution (50mL). The aqueous layer was extracted with DCM (2x100mL). The combined organic was then dried (Na2S04) and concentrated. The residue was purified via silica gel flash chromatography (0-20percent EtOAc-Hexanes) to afford the desired product as yellow oil (2.88 g). LCMS m/z 250.1 (M + H)+, Rt 0.99 min.
Step 4: Preparation of (5-chloro-6-(1 ,1 -difluoroethyl)pyridin-3-yl)methanol
To a solution of ethyl 5-chloro-6-(1 , 1-difluoroethyl)nicotinate (2.68 g, 10.74 mmol) in Et20 (40mL) was added LiBH4 (0.351 g, 16.10 mmol), followed by dropwise addition of methanol (0.653 mL, 16.10 mmol). The reaction was refluxed at 40 °C for one hour. The reaction mixture was then cooled to 0 °C, and quenched with HCI (1 M) until pH=2 for aqueous layer. The phases were separated and the aqueous layer was extracted with DCM (3x50mL). The organic was then dried (Na2S04) and concentrated under reduced pressure to give final crude product (2.12 g). LCMS m/z 208.0 (M + H)+, Rt 0.63 min.
Step 5: Preparation of 5-chloro-6-(1 ,1 -difluoroethyl)nicotinaldehyde
To a solution of (5-chloro-6-(1 , 1 -difluoroethyl)pyridin-3-yl)methanol (2.12 g, 10.21 mmol) in DCM (100 ml) was added PCC (3.30 g, 15.32 mmol). The reaction was stirred at 20 °C for 3 hours. A dark color suspension resulted. LCMS showed clean conversion to the product. The reaction mixture was then filtered through a pad of celite, and washed with DCM (200mL). The filtrate was then concentrated to give crude product (1.78 g). LCMS m/z 224.0 (M + H20 + H)+, Rt 0.72 min.
Intermediate 210: 5-chloro-6-(2,2,2-trifluoroethoxy)nicotinaldehyde
Figure imgf000129_0001
Step 1 : Preparation of ethyl 5-chloro-6-(2,2,2-trifluoroethoxy)nicotinate
To a solution of ethyl 5,6-dichloronicotinate (6.28 g, 28.5 mmol) and 2,2,2-trifluoroethanol (2.71 ml, 37.1 mmol) in THF (90 ml) at -73oC was added NaHMDS (37.1 ml, 37.1 mmol). The reaction was stirred at -73 °C for 30 minutes, then at 0 °C for 5 hours. The reaction was quenched with 30 ml. saturated NH4CI solution. The reaction mixture was then poured into 50 ml. brine and phases were separated. The aqueous layer was extracted with DCM (2x100ml_). The combined organics were dried (Na2S04) and concentrated.
Silica gel chromatography with 100% heptane to 30% EtOAc in heptane provided final product (7.51 g). LCMS m/z 284.1 (M + H)+, Rt 1.07 min.
Step 2: Preparation of (5-chloro-6-(2,2,2-trifluoroethoxy)pyridin-3-yl)methanol
To a solution of ethyl 5-chloro-6-(2,2,2-trifluoroethoxy)nicotinate (7.51 g, 26.5 mmol) in Et20 (200ml_) was added LiBH4 (0.865 g, 39.7 mmol), followed by drop wise addition of methanol (1 .61 1 ml, 39.7 mmol). The reaction was refluxed at 40 °C for one hour. The reaction mixture was then cooled to 0 °C, and quenched with HCI (1 M) until pH=2 for aqueous layer. The phases were separated and the aqueous layer was extracted with DCM (3x200ml_). The organic was then dried (Na2S04) and concentrated under reduced pressure to give final crude product (6.31 g). LCMS m/z 242.1 (M + H)+, Rt 0.77 min.
Step 3: Preparation of 5-chloro-6-(2,2,2-trifluoroethoxy)nicotinaldehyde
To a solution of (5-chloro-6-(2,2,2-trifluoroethoxy)pyridin-3-yl)methanol (4.00 g, 16.56 mmol) in EtOAc (15 ml.) was added manganese(IV) oxide (16.93 g, 166 mmol). The reaction was heated with microwave at 120 °C for 30 minutes. The mixture was then filtered through a pad of celite, and rinsed with EtOAc. The filtrated was concentrated to give crude product (3.38 g).
The intermediates in Table 4w were prepared with procedures similar to those used to prepare Intermediate 210 and 192. Table 4w.
Figure imgf000130_0003
Intermediate 213 : (S)-3-(2-((S)-1 -(4-(chloromethyl)phenyl)ethylamino)pyrimidin-4- yl)-4-isopropyloxazolidin-2-one
Figure imgf000130_0001
To a solution of (S)-3-(2-((S)-1 -(4-(hydroxymethyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one (71 mg, 0.2 mmol) in DCM (2 mL) was added methanesulfonyl chloride (27 mg, 0.24 mmol) and DIPEA (0.070 mL, 0.4 mmol). The solution was stirred for 16 h at room temperature then washed with water and brine. After separation, the organic phase was dried over Na2S04, filtered and concentrated. The crude product was used to next step without further purification.
MS m/z 373.4 (M - H).
Intermediate 214: tert-butyl 3-(4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzyl)-3,8-diazabicyclo[4.2.0]octane-8-carboxylate
Figure imgf000130_0002
Title compound was prepared as a white solid (64 mg, 58.1 % yield), with procedures similar to those used to prepare Intermediate 128, but utilizing 4-((S)-1 -(4-((S)-4- isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-ylamino)ethyl)benzaldehyde and tert-butyl 3,8- diazabicyclo[4.2.0]octane-8-carboxylate.
1 H NMR (400 MHz, CDCI3) δ 8.17 (dd, J = 5.9, 0.9 Hz, 1 H), 7.42 (d, J = 5.7 Hz, 1 H), 7.28 - 7.23 (m, 4H), 5.39 (br s, 1 H), 5.02 (br s, 1 H), 4.62-4.59 (m, 1 H), 4.28 (t, J = 8.7 Hz, 1 H), 4.21 (dd, J = 9.0, 3.2 Hz, 2H), 3.89 (td, J = 7.7, 1 .9 Hz, 1 H), 3.54 - 3.50 (m, 2H), 3.03 (d, J = 12.2 Hz, 1 H), 2.65 - 2.60 (m, 1 H), 2.54 - 2.40 (m, 2H), 2.10 (br s, 1 H), 1 .99 - 1 .88 (m, 1 H), 1 .79 - 1.72 (m, 1 H), 1 .65 (br s, 1 H), 1 .52 (dd, J = 6.8, 1 .9 Hz, 3H), 1.38 (t, J = 7.7 Hz, 9H), 0.71 (br s, 3H), 0.66 (br s, 3H). MS m/z 569.1 (M + H). Intermediate 215: tert-butyl 1 -(4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzyl)piperidin-4-yl carbamate
Figure imgf000131_0001
Title compound was prepared as a white solid (32 mg, 59% yield), with procedures similar to those used to prepare Intermediate 128, but utilizing 4-((S)-1 -(4-((S)-4- isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-ylamino)ethyl)benzaldehyde and tert-butyl piperidin-4-ylcarbamate. MS m/z 539.4 (M + H).
Examples
Example 1 : (S)-5,5-dimethyl-4-phenyl-3-(2-((S)-1 -phenylethylamino)pyri yl)oxazolidin-2-one
Figure imgf000131_0002
A solution of (S)-3-(2-chloropyrimidin-4-yl)-5,5-dimethyl-4-phenyloxazolidin-2-one (33.9 mg, 0.1 12 mmol) and (S)-(-)-1-phenylethanamine (0.15 mL, 1 .2 mmol, 10 equiv) in DMSO (1 mL) was heated at 1 10 °C for 140 min. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 10 to 50%) provided (S)-5,5-dimethyl-4-phenyl-3-(2-((S)-1-phenylethylamino)pyrimidin-4-yl) oxazolidin-2-one (37.0 mg, white solid) in 85% yield. 1H NMR (400 MHz, CD3OD) δ 8.06 (d, J = 5.8 Hz, 1 H), 7.43 (d, J = 5.8 Hz, 1 H), 7.31 - 7.24 (m, 3 H), 7.19 - 7.1 1 (m, 5 H), 7.01 (br s 2 H), 5.48 (s, 1 H), 4.86 - 4.80 (m, 1 H), 1.65 (s, 3 H), 1.43 (d, J = 7.0 Hz, 3 H), 0.98 (s, 3 H); HRMS(B) m/z 389.1987 (M + H)+.
Alternative Procedure
Example 113: (S)-3-(2-((S)-1 -(4-hydroxyphenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
Figure imgf000132_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (42 mg, 0.17 mmol), (S)-4-(1-aminoethyl)phenol hydrochloride (107 mg, 0.616 mmol, 3.5 equiv) and /'Pr2Net (0.121 mL, 0.695 mmol, 4.0 equiv) in DMSO (1 mL) was heated at 1 10 °C for 3 h and at 130 °C for additional 2 h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 10 to 80%) provided (S)-3-(2-((S)-1-(4-hydroxyphenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one (3 mg) in 5 % yield. 1H NMR (400 MHz, CD3OD) δ 8.1 1 (d, J = 5.8 Hz, 1 H), 7.33 (d, J = 5.8 Hz, 1 H), 7.12 (d, J 8.1 Hz, 2 H), 6.72 - 6.68 (m, 2 H), 4.95 (q, J = 6.9 Hz, 1 H), 4.69 - 4.65 (m, 1 H), 4.35 - 4.28 (m, 2 H), 1 .47 (d, J = 7.1 Hz, 3 H), 0.75 (br s, 3 H), 0.62 (br s, 3 H); HRMS(B) m/z 343.1776 (M + H)+. The compounds in Table 5 were prepared using methods similar to those described for the preparation of Examples 1 and 1 13. Table 5.
Figure imgf000133_0001
ı32
Figure imgf000134_0001
Figure imgf000135_0001
Figure imgf000136_0001
Figure imgf000137_0001
Figure imgf000138_0001
Figure imgf000139_0001
Figure imgf000140_0001
Figure imgf000141_0001
Figure imgf000142_0001
Figure imgf000143_0001
Figure imgf000144_0001
Table 6. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 5.
Figure imgf000144_0002
Figure imgf000145_0001
Figure imgf000146_0001
Figure imgf000147_0001
Figure imgf000148_0001
Figure imgf000149_0001
Figure imgf000150_0001
Figure imgf000151_0001
Figure imgf000152_0001
Figure imgf000153_0001
Figure imgf000154_0001
Figure imgf000155_0001
Figure imgf000156_0001
Figure imgf000157_0001
Figure imgf000158_0001
Figure imgf000159_0001
Figure imgf000160_0001
Figure imgf000161_0001
Figure imgf000162_0001
Figure imgf000163_0001
Figure imgf000164_0001
Example 170: (4S)-4-isopropyl-3-(2-(2,2,2-trifluoro-1-phenylethylamino)pyrimidin-4- yl)oxazolidin-2-one
Figure imgf000164_0002
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (163 mg, 0.674 mmol), 2,2,2-trifluoro-1-phenylethanamine (624 mg, 3.56 mmol, 5.3 equiv) and p- toluenesulfonic acid monohydrate (321 mg, 1 .69 mmol, 2.5 equiv) in n-BuOH (3 mL) was heated at 1 10 °C for 2 h and treated with additional p-toluenesulfonic acid monohydrate (321 mg, 1 .69 mmol, 2.5 equiv), then heated at 1 10 °C for 1 ½ h. After cooling, the solid reaction mixture was treated with MeCN, sonicated and filtered. The filtrated was concentrated and purified by silica gel column chromatography (EtOAc/Heptane 0 to 30%) to give (4S)-4-isopropyl-3-(2-(2,2,2-trifluoro-1 -phenylethylamino)pyrimidin-4- yl)oxazolidin-2-one (65 mg) in 25% yield. 1H NMR (400 MHz, CD3OD) δ 8.215 (d, J = 6.1 Hz, 0.5 H), 8.212 (d, J = 6.1 Hz, 0.5 H), 7.52 (t, J = 7.1 Hz, 2 H), 7.46 (dd, J = 5.8, 3.8 Hz, 1 H), 7.43 - 7.34 (m, 3 H), 5.86 (qd, J = 8.2, 4.0 Hz, 1 H), 4.83 - 4.75 (m, 1 H), 4.42 - 4.33 (m, 2 H), 2.62 (dtd, J = 14, 7.0, 3.8 Hz, 0.5 H), 2.28 (br s, 0.5 H), 1.02 (d, J = 7.1 Hz, 1 .5 H), 0.91 (d, J = 7.1 Hz, 1 .5 H), 0.88 (d, J = 7.1 1 Hz, 1 .5 H), 0.73 (d, J = 7.1 Hz, 1 .5 H); HRMS(B) m/z 381.1545 (M + H)+.
Examples 171 and 172
Figure imgf000165_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (106 mg, 0.439 mmol) and 1 -(3-fluorophenyl)ethanamine (196 mg, 1 .41 mmol, 3.21 equiv) in DMSO (1 mL) was heated at 1 10 °C for 1 ½ h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 10 to 50%) provided (S)-3-(2-((/?)-1 -(3-fluorophenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-((S)-1-(3-fluorophenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one.
Example 171 first eluted product (28 mg) 1 H NMR (400 MHz, CD3OD) δ 8.1 1 (d, J = 5.8 Hz, 1 H), 7.36 - 7.27 (m, 2 H), 7.16 (d, J = 7.6 Hz, 1 H), 7.07 (dt, J = 10, 2.0 Hz, 1 H), 6.92 - 6.88 (m, 1 H), 4.98 - 4.93 (m, 1 H), 4.42 (br s, 1 H), 4.32 (dd, J = 9.1 , 2.8 Hz, 1 H), 4.26 (t, J = 8.7 Hz, 1 H), 2.64 (dtd, J = 14, 7.1 , 3.5 Hz, 1 H), 1 .50 (d, J = 7.0 Hz, 3 H), 0.98 (d, J = 7.1 Hz, 3 H), 0.85 (d, J = 7.0 Hz, 3 H); HRMS(B) m/z 345.1729 (M + H)+. Example 172 second eluted product (22 mg) 1H NMR (400 MHz, CD3OD) δ 8.13 (d, J = 5.7 Hz, 1 H), 7.36 (d, J = 5.8 Hz, 1 H), 7.29 (td, J = 8.1 , 6.1 Hz, 1 H), 7.13 (d, J = 7.6 Hz, 1 H), 7.06 - 7.04 (m, 1 H), 6.94 - 6.87 (m, 1 H), 5.03 (q, J = 7.1 Hz, 1 H), 4.64 (br s, 1 H), 4.34 - 4.26 (m, 2 H), 1 .79 (br s, 1 H), 1 .50 (d, J = 7.1 Hz, 3 H), 0.70 (br s, 3 H), 0.58 (br s, 3 H); HRMS(B) m/z 345.1727 (M + H)+. Examples 173 and 174
Figure imgf000166_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (90 mg, 0.37 mmol), /'Pr2NEt (0.455 mL, 2.61 mmol, 7.0 equiv) and 1-(biphenyl-4-yl)ethanamine hydrochloride (87 mg, 0.37 mmol) in DMSO (1 mL) was heated at 1 10 °C for 2 h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography
(EtOAc/Heptane 10 to 50%) provided (S)-3-(2-((R)-1-(biphenyl-4-yl)ethylamino)pyrimidin- 4-yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-((S)-1-(biphenyl-4-yl)ethylamino)pyrimidin- 4-yl)-4-isopropyloxazolidin-2-one.
Example 173 first eluted product (17 mg) 1 H NMR (400 MHz, CD3OD) δ 8.1 1 (d, J = 5.8 Hz, 1 H), 7.59 - 7.54 (m, 4 H), 7.43 - 7.28 (m, 6 H), 5.01 (q, J = 6.8 Hz, 1 H), 4.49 (br s, 1 H), 4.32 (dd, J = 9.1 , 3.0 Hz, 1 H), 4.26 (t, J = 8.6 Hz, 1 H), 2.67 (dtd, J = 14, 7.0, 3.5 Hz, 1 H), 1.55 (d, J = 7.1 Hz, 3 H), 1.01 (d, J = 7.1 Hz, 3 H), 0.86 (d, J = 7.0 Hz, 3 H); HRMS(B) m/z 403.2141 (M + H)+.
Example 174 second eluted product (21 mg) 1 H NMR (400 MHz, CD3OD) δ 8.14 (d, J = 5.8 Hz, 1 H), 7.58 - 7.52 (m, 4 H), 7.42 - 7.28 (m, 6 H), 5.06 (q, J = 7.1 Hz, 1 H), 4.63 (br s, 1 H), 4.34 - 4.25 (m, 2 H), 1 .79 (br s, 1 H), 1.55 (d, J = 7.1 Hz, 3 H), 0.65 (br s, 3 H), 0.53 (br s, 3 H); HRMS(B) m/z 403.2139 (M + H)+. Examples 175 and 176
Figure imgf000167_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (96 mg, 0.40 mmol) and 1-(4-chlorophenyl)ethanamine (204 mg, 1 .31 mmol, 3.3 equiv) in DMSO (1 mL) was heated at 1 10 °C for 3 h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 10 to 50%) provided (S)-3-(2-((/?)-1 -(4-chlorophenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-((S)-1 -(4-chlorophenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one.
Example 175 first eluted product (32 mg) 1H NMR (400 MHz, CD3OD) δ 8.10 (d, J = 5.8 Hz, 1 H), 7.36 - 7.28 (m, 5 H), 4.95 (q, J = 6.7 Hz, 1 H), 4.45 (br s, 1 H), 4.35 - 4.26 (m, 2 H), 2.64 (dtt, J = 1 1 , 7.0, 3.4 Hz, 1 H), 1 .50 (d, J = 7.1 Hz, 3 H), 0.98 (d, J = 7.1 Hz, 3 H), 0.85 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 361 .1430 (M + H)+.
Example 176 second eluted product (40 mg) 1H NMR (400 MHz, CD3OD) δ 8.13 (d, J = 5.7 Hz, 1 H), 7.36 - 7.26 (m, 5 H), 5.00 (q, J = 7.1 Hz, 1 H), 4,62 (br s, 1 H), 4.34 - 4.26 (m, 2 H), 1 .77 (br s, 1 H), 1.50 (d, J = 7.1 Hz, 3 H), 0.68 (br s, 3 H), 0.59 (br s, 3 H); HRMS(B) m/z 361.1431 (M + H)+.
Examples 177 and 178
Figure imgf000167_0002
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (93 mg, 0.38 mmol) and 1 -(3,4-dichlorophenyl)ethanamine (73.1 mg, 0.385 mmol, 1 .0 equiv) in DMSO (1 mL) was heated at 1 10 °C for 1 ½ h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 10 to 50%) provided (S)-3-(2-((/?)-1 -(3,4-dichlorophenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one and (S)-3-(2-((S)-1-(3,4-dichlorophenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one.
Example 177 first eluted product (21 mg) 1H NMR (400 MHz, CD3OD) δ 8.12 (d, J = 5.8 Hz, 1 H), 7.50 (d, J = 2.0 Hz, 1 H), 7.44 (d, J = 8.2 Hz, 1 H), 7.37 (d, J = 5.8 Hz, 1 H), 7.28 (dd, J = 8.6, 2.0 Hz, 1 H), 4.94 - 4.88 (m, 1 H), 4.43 (br s, 1 H), 4.35 - 4.26 (m, 2 H), 2.68 - 2.60 (m, 1 H), 1 .50 (d, J = 7.1 Hz, 3 H), 0.99 (d, J = 7.1 Hz, 3 H), 0.85 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 395.1035 (M + H)+.
Example 178 second eluted product (28 mg) 1H NMR (400 MHz, CD3OD) δ 8.15 (d, J = 5.8 Hz, 1 H), 7.47 - 7.42 (m, 2 H), 7.37 (d, J = 5.8 Hz, 1 H), 7.25 (dd, J = 8.1 , 2.0 Hz, 1 H), 5.01 - 4.96 (m, 1 H), 4.61 (br s, 1 H), 4.34 - 4.26 (m, 2 H), 1.72 (br s, 1 H), 1 .50 (d, J = 7.1 Hz, 3 H), 0.67 (br s, 3 H), 0.60 (br s, 3 H); HRMS(B) m/z 395.1044 (M + H)+.
Examples 179 and 180
Figure imgf000168_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (86 mg, 0.36 mmol) and 1 -(3-(1 H-pyrrol-1-yl)phenyl)ethanamine (100 mg, 0.537 mmol, 1 .5 equiv) in DMSO (1 mL) was heated at 1 10 °C for 1 ½ h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 10 to 50%) provided (S)-3-(2-((R)-1 -(3-(1 H-pyrrol-1-yl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one and (S)-3-(2-((S)-1-(3-(1 H-pyrrol-1 - yl)phenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one.
Example 179 first eluted product (14 mg) 1H NMR (400 MHz, CD3OD) δ 8. 1 1 (d, J = 5.8 Hz, 1 H), 7.45 (t, J = 1 .8 Hz, 1 H), 7.39 - 7.29 (m, 3 H), 7.23 (d, J = 7.6 Hz, 1 H), 7.13 (t, J = 2.0 Hz, 2 H), 6.25 (t, J = 2.1 Hz, 2 H), 5.03 - 4.97 (m, 1 H), 4.46 (br s, 1 H), 4.31 - 4.20 (m, 2 H), 2.64 (dtd, J = 14, 7.0, 3.8 Hz, 1 H), 1.56 (d, J = 7.1 Hz, 3 H), 0.95 (d, J = 7.1 Hz, 3 H), 0.84 (d, J = 7.0 Hz, 3 H); HRMS(B) m/z 392.2092 (M + H)+.
Example 180 second eluted product (10 mg) 1H NMR (400 MHz, CD3OD) δ 8.14 (d, J = 5.7 Hz, 1 H), 7.42 (br s, 1 H), 7.38 - 7.28 (m, 3 H), 7.20 (d, J = 7.6 Hz, 1 H), 7.12 (t, J = 2.3 Hz, 2 H), 6.25 (t, J = 2.0 Hz, 2 H), 5.09 (q, J = 6.9 Hz, 1 H), 4.64 (br s, 1 H), 4.32 - 4.23 (m, 2 H), 1 .84 (br s, 1 H), 1.55 (d, J = 7.1 Hz, 3 H), 0.54 (br s, 6 H); HRMS(B) m/z 392.2090 (M + H)+.
Examples 181 and 182
Figure imgf000169_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (44 mg, 0.18 mmol) and 1-(4-(1 H-pyrrol-1 -yl)phenyl)ethanamine (33.9 mg, 0.182 mmol, 1 equiv) in DMSO (1 mL) was heated at 1 10 °C for 2 h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 10 to 50%) provided (S)-3-(2-((R)-1 -(4-(1 H-pyrrol-1-yl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one and (S)-3-(2-((S)-1-(4-(1 H-pyrrol-1 - yl)phenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one.
Example 181 first eluted product (18 mg) 1H NMR (400 MHz, CD3OD) δ 8.1 1 (d, J = 5.8 Hz, 1 H), 7.44 - 7.39 (m, 4 H), 7.35 (d, J = 5.9 Hz, 1 H), 7.13 (t, J = 2.2 Hz, 2 H), 6.24 (t, J = 2.0 Hz, 2 H), 5.02 - 4.96 (m, 1 H), 4.49 (br s, 1 H), 4.34 - 4.25 (m, 2 H), 2.66 (dtd, J = 14, 7.0, 3.3 Hz, 1 H), 1 .53 (d, J = 7.1 Hz, 3 H), 1 .00 (d, J = 7.1 Hz, 3 H), 0.86 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 392.2089 (M + H)+.
Example 182 second eluted product (9 mg) 1H NMR (400 MHz, CD3OD) δ 8.14 (d, J = 5.8 Hz, 1 H), 7.39 (s, 4 H), 7.35 (d, J = 5.9 Hz, 1 H), 7.12 (t, J = 2.2 Hz, 2 H), 6.25 (t, J = 2.0 Hz, 2 H), 5.05 (q, J = 7.1 Hz, 1 H), 4.64 (br s, 1 H), 4.34 - 4.26 (m, 2 H), 1 .87 (br s, 1 H), 1 .53 (d, J = 7.1 Hz, 3 H), 0.68 (br s, 3 H), 0.57 (br s, 3 H); HRMS(B) m/z 392.2082 (M + H)+. Examples 183 and 184
Figure imgf000170_0001
A mixture of (4S)-3-(2-((1-(3,4-dimethoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one (example 1 18) was resolved on a column (AS-H 4.6 x 100 mm) using 30% /'PrOH in C02 to give (S)-3-(2-((R)-1-(3,4- dimethoxyphenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one and (S)-3-(2- ((S)-1-(3,4-dimethoxyphenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one.
Example 183 first eluted product (13 mg) 1H NMR (400 MHz, CD3OD) δ 8.1 1 (d, J = 5.8 Hz, 1 H), 7.33 (d, J = 5.8 Hz, 1 H), 6.97 (br d, J = 1 .5 Hz, 1 H), 6.92 - 6.88 (m, 2 H), 4.96 (q, J = 6.7 Hz, 1 H), 4.61 - 4.55 (m, 1 H), 4.35 - 4.28 (m, 2 H), 3.803 (s, 3 H), 3.800 (s, 3 H), 2.63 (dtd, J = 14, 7.0, 3.5 Hz, 1 H), 1 .51 (d, J = 7.1 Hz, 3 H), 0.99 (d, J = 7.1 Hz, 3 H), 0.86 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 387.2031 (M + H)+.
Example 184 second eluted product (10 mg) 1 H NMR (400 MHz, CD3OD) δ 8.13 (d, J = 5.8 Hz, 1 H), 7.32 (d, J = 5.7 Hz, 1 H), 6.94 (br d, J = 1.1 Hz, 1 H), 6.89 - 6.84 (m, 2 H), 4.99 (q, J = 7.1 Hz, 1 H), 4.67 - 4.63 (m, 1 H), 4.36 - 4.26 (m, 2 H), 3.79 (s, 6 H), 2.01 (br s, 1 H), 1.51 (d, J = 7.1 Hz, 3 H), 0.71 (d, J = 7.1 Hz, 3 H), 0.63 (d, J = 7.0 Hz, 3 H); HRMS(B) m/z 387.2029 (M + H)+. Examples 185 and 186
Figure imgf000170_0002
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (93 mg, 0.38 mmol) and 1-(4-(piperidin-1-yl)phenyl)ethanamine (410 mg, 2.01 mmol, 5.2 equiv) in DMSO (1 mL) was heated at 1 10 °C for 2 h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/ Heptane 10 to 100%) provided (4S)-4-isopropyl-3-(2-((1-(4-(piperidin-1 -yl)phenyl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one (57 mg) in 36% yield. A mixture of (4S)-4-isopropyl-3-(2-(1-(4- (piperidin-1 -yl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one was resolved on a column (AD-H 4.6 x 100 mm) using 5 to 55% MeOH with 0.2% Et2NH in C02 to give (S)- 4-isopropyl-3-(2-((/?)-1 -(4-(piperidin-1-yl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2- one and (S)-4-isopropyl-3-(2-((S)-1-(4-(piperidin-1-yl)phenyl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one.
Example 185 first eluted product (16 mg) 1H NMR (400 MHz, CD3OD) δ 8.10 (d, J = 5.8 Hz, 1 H), 7.31 (d, J = 5.8 Hz, 1 H), 7.24 - 7.20 (m, 2 H), 6.94 - 6.91 (m, 2 H), 4.93 (q, J = 7.1 Hz, 1 H), 4.58 - 4.54 (m, 1 H), 4.34 - 4.27 (m, 2 H), 3.1 1 - 3.08 (m, 4 H), 2.63 (dtd, J = 14, 7.1 , 3.5 Hz, 1 H), 1 .73 - 1 .67 (m, 4 H), 1.60 - 1 .54 (m, 2 H), 1.49 (d, J = 7.1 Hz, 3 H), 0.98 (d, J = 7.1 Hz, 3 H), 0.86 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 410.2555 (M + H)+. Example 186 second eluted product (16 mg) 1H NMR (400 MHz, CD3OD) δ 8.1 1 (d, J = 5.8 Hz, 1 H), 7.31 (d, J = 5.8 Hz, 1 H), 7.20 - 7.16 (m, 2 H), 6.93 - 6.89 (m, 2 H), 4.98 (q, J = 6.9 Hz, 1 H), 4.69 - 4.65 (m, 1 H), 4.36 - 4.26 (m, 2 H), 3.10 - 3.07 (m, 4 H), 2.07 (br s, 1 H), 1.73 - 1.67 (m, J = 4 H), 1.60 - 1 .54 (m, 2 H), 1.48 (d, J = 7.1 Hz, 3 H), 0.75 (d, J = 7.0 Hz, 3 H), 0.63 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 410.2556 (M + H)+. Examples 187 and 188
Figure imgf000171_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (96 mg, 0.40 mmol) and 1-(1-phenyl-1 H-pyrazol-4-yl)ethanamine (387 mg, 2.97 mmol, 5.2 equiv) in DMSO (1 .5 mL) was heated at 1 10 °C for 1 ½ h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 20 to 80%) provided (S)-4-isopropyl-3-(2-((/?)-1-(1-phenyl-1 H-pyrazol-4-yl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one and (S)-4-isopropyl-3-(2-((S)-1 -(1 -phenyl-1 H-pyrazol-4- yl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one. Example 187 first eluted product (13 mg) 1H NMR (400 MHz, CD3OD) δ 8.16 (d, J = 5.8 Hz, 1 H), 8.10 (s, 1 H), 7.70 - 7.66 (m, 3 H), 7.48 - 7.43 (m, 2 H), 7.37 (d, J = 5.7 Hz, 1 H), 7.32 - 7.28 (m, 1 H), 5.20 (q, J = 6.6 Hz, 1 H), 4.75 (dt, J = 7.7, 4.0 Hz, 1 H), 4.40 - 4.33 (m, 2 H), 2.61 (dtt, J = 1 1 , 7.0, 3.6 Hz, 1 H), 1 .60 (d, J = 6.9 Hz, 3 H), 0.96 (d, J = 7.1 Hz, 3 H), 0.87 (d, J = 6.9 Hz, 3 H); HRMS(B) m/z 393.2029 (M + H)+.
Example 188 second eluted product (1 1 mg) 1H NMR (400 MHz, CD3OD) δ 8.17 (d, J = 5.8 Hz, 1 H), 8.03 (s, 1 H), 7.68 - 7.62 (m, 3 H), 7.48 - 7.43 (m, 2 H), 7.37 (d, J = 5.8 Hz, 1 H), 7.32 - 7.27 (m, 1 H), 5.19 (q, J = 7.1 Hz, 1 H), 4.74 (dt, J = 8.5, 3.6 Hz, 1 H), 4.38 - 4.29 (m, 2 H), 2.37 - 2.33 (m, 1 H), 1 .60 (d, J = 7.1 Hz, 3 H), 0.79 (d, J = 7.1 Hz, 3 H), 0.73 (s, J = 7.1 Hz, 3 H); HRMS(B) m/z 393.2039 (M + H)+.
Examples 189 and 190
Figure imgf000172_0001
A solution of (R)-3-(2-chloropyrimidin-4-yl)-4-phenyloxazolidin-2-one (97 mg, 0.35 mmol), 1 -(biphenyl-4-yl)ethanamine hydrochloride (304 mg, 1 .30 mmol, 3.7 equiv) and /'Pr2NEt (0.307 mL, 1.76 mmol, 5.0 equiv) in DMSO (1 mL) was heated at 1 10 °C for 1 ½ h and at 130 °C for 20 h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/ Heptane 10 to 50%) provided (R)-3-(2-((R)-1-(biphenyl- 4-yl)ethylamino)pyrimidin-4-yl)-4-phenyloxazolidin-2-one and (R)-3-(2-((S)-1 -(biphenyl-4- yl)ethylamino)pyrimidin-4-yl)-4-phenyloxazolidin-2-one. Example 189 first eluted product (12 mg) 1H NMR (400 MHz, CD3OD) δ 8.10 (d, J = 5.8 Hz, 1 H), 7.58 - 7.55 (m, 2 H), 7.44 - 7.37 (m, 6 H), 7.33 - 7.28 (m, 1 H), 7.24 - 7.14 (m, 6 H), 5.84 (dd, J = 8.6, 3.5 Hz, 1 H), 4.94 (q, J = 6.7 Hz, 1 H), 4.81 (t, J = 8.6 Hz, 1 H), 4.22 (dd, J = 8.8, 3.8 Hz, 1 H), 1.49 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 437.1981 (M + H)+.
Example 190 second eluted product (1 1 mg) 1H NMR (400 MHz, CD3OD) δ 8.10 (d, J = 5.8 Hz, 1 H), 7.60 - 7.54 (m, 4 H), 7.44 - 7.28 (m, 1 1 H), 5.60 (dd, J = 8.6, 4.0 Hz, 1 H), 4.77 - 4.69 (m, 2 H), 4.19 (dd, J = 8.6, 4.0 Hz, 1 H), 1.25 (d, J = 7.0 Hz, 3 H); HRMS(B) m/z 437.1971 (M + H)+.
Examples 191 and 192
Figure imgf000173_0001
(4S)-3-(2-(1 -(2,3-dihydrobenzo[b][1 ,4]dioxin-6-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one (example 130, 52 mg) was resolved on a column (IA 4.6 x 100 mm) using 40% /'PrOH in C02 to give (S)-3-(2-((R)-1-(2,3-dihydrobenzo[b][1 ,4]dioxin-6- yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-((S)-1-(2,3- dihydrobenzo[b][1 ,4]dioxin-6-yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one.
Example 191 first eluted product (7 mg) 1H NMR (400 MHz, CD3OD) δ 8.10 (d, J = 5.6 Hz, 1 H), 7.33 - 7.31 (m, 1 H), 6.82 - 6.74 (m, 3 H), 4.88 (q, J = 7.1 Hz, 1 H), 4.58 - 4.53 (m, 1 H), 4.34 - 4.28 (m, 2 H), 4.21 - 4.18 (m, 4 H), 2.63 (td, J = 7.1 , 3.5 Hz, 1 H), 1 .47 (d, J = 7.1 Hz, 3 H), 0.99 (d, J = 7.1 Hz, 3 H), 0.86 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 385.1875 (M + H)+.
Example 192 second eluted product (19 mg) 1 H NMR (400 MHz, CD3OD) δ 8.12 (d, J = 5.8 Hz, 1 H), 7.33 - 7.31 (m, 1 H), 6.78 - 6.72 (m, 3 H), 4.93 (q, J = 6.7 Hz, 1 H), 4.68 - 4.64 (m, 1 H), 4.36 - 4.27 (m, 2 H), 2.08 (br s, 1 H), 1.47 (d, J = 7.1 Hz, 3 H), 0.76 (d, J = 7.1 Hz, 3 H), 0.65 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 385.1873 (M + H)+.
Examples 193 and 194
Figure imgf000173_0002
A solution of (R)-3-(2-chloropyrimidin-4-yl)-4-phenyloxazolidin-2-one (83 mg, 0.30 mmol) and 1-(3,4-dichlorophenyl)ethanamine (260 mg, 1.37 mmol, 4.5 equiv) in DMSO (1.5 mL) was heated at 1 10 °C for 1 ½ h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtO Ac/ Heptane 0 to 40%) provided (R)-3-(2-((/?)-1-(3,4-dichlorophenyl)ethylamino)pyrimidin-4-yl)-4-phenyloxazolidin-2-one and (R)-3-(2-((S)-1-(3,4-dichlorophenyl)ethylamino)pyrimidin-4-yl)-4-phenyloxazolidin-2- one.
Example 193 first eluted product (13 mg) 1H NMR (400 MHz, CD3OD) δ 8.1 1 (d, J = 5.6 Hz, 1 H), 7.44 - 7.38 (m, 5 H), 7.35 - 7.31 (m, 1 H), 7.27 - 7.25 (m, 2 H), 7.18 (dd, J = 8.3, 2.3 Hz, 1 H), 5.53 (dd, J = 8.8, 3.8 Hz, 1 H), 4.76 (t, J = 8.8 Hz, 1 H), 4.59 - 4.53 (m, 1 H), 4.18 (dd, J = 8.8, 4.3 Hz, 1 H), 1.22 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 429.0899 (M + H)+.
Example 194 second eluted product (26 mg) 1 H NMR (400 MHz, CD3OD) δ 8.13 (d, J = 5.6 Hz, 1 H), 7.41 (d, J = 6.1 Hz, 1 H), 7.25 - 7.18 (m, 5 H), 7.09 - 7.06 (m, 2 H), 6.95 - 6.93 (m, 1 H), 5.78 (dd, J = 8.6, 3.5 Hz, 1 H), 4.89 (q, J = 6.7 Hz, 1 H), 4.79 (t, J = 8.6 Hz, 1 H), 4.18 (dd, J = 8.8, 3.8 Hz, 1 H), 1 .42 (d. J = 7.1 Hz, 3 H); HRMS(B) m/z
429.0887 (M + H)+.
Examples 195 and 196
Figure imgf000174_0001
(4S)-4-methyl-4-phenyl-3-(2-(1 -(4-(piperidin-1-yl)phenyl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one (example 141 , 51 mg) was resolved on a column (IA 4.6 x 100 mm) using 45% MeOH in C02 to give (S)-4-methyl-4-phenyl-3-(2-((S)-1-(4-(piperidin-1- yl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one and (S)-4-methyl-4-phenyl-3-(2- ((/?)-1 -(4-(piperidin-1-yl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one. Example 195 first eluted product (21.6 mg) 1H NMR (400 MHz, CDCI3) 5 8.13 (d, J = 5.8 Hz, 1 H), 7.41 (d, J = 5.8 Hz, 1 H), 7.36 - 7.33 (m, 4 H), 7.32 - 7.26 (m, 1 H), 6.88 - 6.82 (br m, 4 H), 5.01 (br s, 1 H), 4.30 (s, 2 H), 3.16 - 3.13 (m, 4 H), 2.20 (s, 3 H), 1.76 - 1.57 (br m, 6 H), 1.37 (d, J = 6.7 Hz, 3 H); HRMS(B) m/z 458.2558 (M + H)+.
Example 196 second eluted product (20.6 mg) 1H NMR (400 MHz, CDCI3) δ 8.14 (d, J = 5.8 Hz, 1 H), 7.50 - 7.27 (m, 6 H), 7.05 (d, J = 8.6 Hz, 2 H), 6.96 - 6.92 (br m, 2 H), 5.27 (br s, 1 H), 4.22 (s, 2 H), 3.21 - 3.13 (m, 4 H), 1.78 - 1 .76 (br m, 7 H), 1 .63 - 1.57 (br m, 2 H), 1 .07 (d, J = 6.1 Hz, 3 H); HRMS(B) m/z 458.2559 (M + H)+. Examples 197 and 198
Figure imgf000175_0001
4,4-dimethyl-3-(2-(1 -(4-(piperidin-1 -yl)phenyl)ethylamino)pyrimidin
(example 183, 70 mg) was resolved on a column (IA 4.6 x 100 mm) using 40% MeOH in C02 to give (S)-4,4-dimethyl-3-(2-(1-(4-(piperidin-1-yl)phenyl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one and (R)-4,4-dimethyl-3-(2-(1-(4-(piperidin-1- yl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one. Example 197 first eluted product (23.8 mg) 1H NMR (400 MHz, CDCI3) δ 8.17 (br d, J = 5.8 Hz, 1 H), 7.28 - 7.23 (m, 3 H), 6.93 (br d, J = 7.7 Hz, 2 H), 5.44 (br s, 1 H), 4.97 (br s, 1 H), 4.05 - 3.99 (m, 2 H), 3.15 - 3.12 (m, 4 H), 1.77 - 1.70 (m, 8 H), 1 .61 - 1.54 (m, 5 H), 1 .32 (br s, 2 H); HRMS(B) m/z 396.2413 (M + H)+.
Example 198 second eluted product (22.3 mg) 1H NMR (400 MHz, CDCI3) δ 8.17 (br d, J = 5.5 Hz, 1 H), 7.28 - 7.23 (m, 3 H), 6.94 (br d, J = 7.5 Hz, 2 H), 5.48 (br s, 1 H), 4.97 (br s, 1 H), 4.05 - 3.99 (m, 2 H), 3.15 - 3.12 (m, 4 H), 1.77 - 1.70 (m, 8 H), 1 .61 - 1.54 (m, 5 H), 1 .31 (br s, 2 H); HRMS(B) m/z 396.2410 (M + H)+.
Examples 199 and 200
Figure imgf000175_0002
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (98 mg, 0.41 mmol), 1-(1 -(4-fluorophenyl)-1 H-pyrazol-4-yl)ethanamine hydrochloride (502 mg, 2.08 mmol, 5.1 equiv) and /'Pr2NEt (0.637 mL, 3.65 mmol, 9.0 equiv) in DMSO (1 .5 mL) was heated at 1 10 °C for 16 h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 20 to 80%) provided (S)-3-(2-((R)-1 -(1 -(4-fluorophenyl)-1 H-pyrazol-4-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one and (S)-3-(2-((S)-1-(1-(4-fluorophenyl)-1 H-pyrazol-4- yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one.
Example 199 first eluted product (49 mg) 1H NMR (400 MHz, CD3OD) δ 8.16 (d, J = 5.8 Hz, 1 H), 8.06 (s, 1 H), 7.71 - 7.67 (m, 3 H), 7.37 (d, J = 5.9 Hz, 1 H), 7.22 - 7.16 (m, 2 H), 5.20 (q, J = 6.6 Hz, 1 H), 4.74 (dt, J = 7.6, 3.8 Hz, 1 H), 4.40 - 4.34 (m, 2 H), 2.60 (dtd, J = 14, 7.0, 3.5 Hz, 1 H), 1 .59
(d, J = 6.9 Hz, 3 H), 0.96 (d, J = 7.1 Hz, 3 H), 0.87 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 41 1 .1943 (M + H)+.
Example 200 second eluted product (27 mg) 1H NMR (400 MHz, CD3OD) δ 8.17 (d, J = 5.8 Hz, 1 H), 8.00 (s, 1 H), 7.69 - 7.66 (m, 2 H), 7.61 (s, 1 H), 7.37 (d, J = 5.9 Hz, 1 H), 7.22 - 7.16 (m, 2 H), 5.19 (q, J = 6.7 Hz, 1 H), 4.73 (dt, J = 8.1 , 3.5 Hz, 1 H), 4.39 - 4.30 (m, 2 H), 2.38 - 2.31 (m, 1 H), 1 .59 (d, J = 6.8 Hz, 3 H), 0.79 (d, J = 7.1 Hz, 3 H), 0.73 (d, J = 7.0 Hz, 3 H); HRMS(B) m/z 41 1 .1937 (M + H)+.
Examples 201 and 202
Figure imgf000176_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (93 mg, 0.38 mmol), 1-(1-(4-methoxyphenyl)-1 H-pyrazol-4-yl)ethanamine hydrochloride (514 mg, 2.03 mmol, 5.3 equiv) and /'Pr2NEt (0.605 mL, 3.46 mmol, 9.0 equiv) in DMSO (1 .5 mL) was heated at 1 10 °C for 16 h. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/Heptane 10 to 70%) provided (S)-4-isopropyl-3-(2-((R)-1-(1-(4-methoxyphenyl)-1 H-pyrazol-4-yl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one and (S)-4-isopropyl-3-(2-((S)-1-(1-(4-methoxyphenyl)-1 H-pyrazol-4- yl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one. Example 201 first eluted product (17 mg) 1H NMR (400 MHz, CD3OD) δ 8.15 (d, J = 5.8 Hz, 1 H), 7.98 (s, 1 H), 7.63 (s, 1 H), 7.58 - 7.54 (m, 2 H), 7.37 (d, J = 5.8 Hz, 1 H), 7.03 - 6.99 (m, 2 H), 5.19 (q, J = 7.1 Hz, 1 H), 4.75 (dt, J = 7.7, 4.0 Hz, 1 H), 4.40 - 4.33 (m, 2 H), 3.83 (s, 3 H), 2.61 (dtd, J = 14, 7.1 , 3.5 Hz, 1 H), 1 .59 (d, J = 7.1 Hz, 3 H), 0.96 (d, J = 7.1 Hz, 3 H), 0.87 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 423.2138 (M + H)+.
Example 202 second eluted product (18 mg) 1H NMR (400 MHz, CD3OD) δ 8.16 (d, J = 5.8 Hz, 1 H), 7.91 (s, 1 H), 7.58 - 7.53 (m, 3 H), 7.37 (d, J = 5.9 Hz, 1 H), 7.03 - 6.99 (m, 2 H), 5.18 (q, J = 6.7 Hz, 1 H), 4.76 - 4.72 (m, 1 H), 4.39 - 4.30 (m, 2 H), 3.83 (s, 3 H), 2.31 (br s, 1 H), 1 .59 (d, J = 7.1 Hz, 3 H), 0.80 (d, J = 7.1 Hz, 3 H), 0.73 (d, J = 7.1 Hz, 3 H); HRMS(B) m/z 423.214 (M + H)+.
Examples 203 and 204
Figure imgf000177_0001
4-(4-methoxyphenyl)-5,5-dimethyl-3-(2-((S)-1-phenylethylamino)pyrimidin-4- yl)oxazolidin-2-one (example 54, 62 mg) was resolved in on a column (AD-H 4.6 x 100 mm) with 30% MeOH modified with 0.2% Et2NH in C02 to give (S)-4-(4-methoxyphenyl)- 5,5-dimethyl-3-(2-((S)-1 -phenylethylamino)pyrimidin-4-yl)oxazolidin-2-one and (R)-4-(4- methoxyphenyl)-5,5-dimethyl-3-(2-((S)-1 -phenylethylamino)pyrimidin-4-yl)oxazolidin-2- one.
Example 203 first eluted product (22 mg) 1H NMR (400 MHz, CDCI3) δ 8.12 (br d, J = 5.6 Hz, 1 H), 7.53 (d, J = 5.7 Hz, 1 H), 7.37 - 7.24 (m, 5 H), 7.08 - 7.05 (m, 2 H), 6.92 - 6.89 (m, 2 H), 5.47 (br s, 1 H), 5.02 (br s, 1 H), 4.66 (br s, 1 H), 3.83 (s, 3 H), 1.50 (s, 3 H), 1 .28 (br d, J = 6.6 Hz, 3 H), 1.01 (s, 3 H); HRMS(B) m/z 419.208 (M + H)+.
Example 204 second eluted product (22.2 mg) 1H NMR (400 MHz, CDCI3) δ 8.1 1 (br d, J = 6.1 Hz, 1 H), 7.55 (d, J = 5.8 Hz, 1 H), 7.28 - 7.22 (m, 3 H), 7.08 (br s, 2 H), 7.01 (d, J = 8.6 Hz, 2 H), 6.79 (d, J = 8.6 Hz, 2 H), 5.40 (br s, 1 H), 5.30 (s, 1 H), 4.83 (br s, 1 H), 3.78 (s, 3 H), 1.66 (s, 3 H), 1 .51 (d, J = 6.8 Hz, 3 H), 1 .04 (s, 2 H); HRMS(B) m/z
419.2083 (M + H)+. Example 205
Figure imgf000178_0001
To a solution of tert-butyl 4-(4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzyl)-2,2-dimethylpiperazine-1-carboxylate (78 mg, 0.14 mmol) in DCM (1 mL) was added TFA (1 mL, 12 mmol) slowly at -78 °C. The reaction was stirred at room temperature for 1 h then was concentrated and diluted with DCM (10 mL). The solution was stirred with 3 eq. of MP-carbonate resin (3.28 mmol/g, Biotage) for 1 h at room temperature. The resin was removed by filtration and washed (2 x 5 mL) with DCM. The filtrate was concentrated and purified through HPLC to give (S)-3-(2-(((S)-1-(4-((3,3- dimethylpiperazin-1-yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one as a white solid (23 mg, 36% yield).
1 H NMR (400 MHz, MeOD) δ 8.07 (d, J = 5.8 Hz, 1 H), 7.30 (d, J = 5.8 Hz, 1 H), 7.26 - 7.18 (m, 4H), 5.00 (q, J = 6.9 Hz, 1 H), 4.62 (br s, 1 H), 4.36 - 4.16 (m, 2H), 3.36 (s, 2H), 2.81 (br t, J = 5.1 Hz, 2H), 2.30 (br s, 2H), 2.10 (br s, 2H), 1.82 (br s, 1 H), 1.45 (d, J = 7.0 Hz, 3H), 1 .08 (s, 6H), 0.67 (br s, 3H), 0.52 (br s, 3H); HRMS(B) m/z 453.2969 (M + H)+.
Example 206
Figure imgf000178_0002
A mixture of benzyl 4-(4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzyl)piperazine-1-carboxylate (190 mg, 0.34 mmol) and 10% Pd-C (40 mg, 0.038 mmol) in ethanol (3.4 ml) is stirred under 1 atmosphere pressure of hydrogen for 3 h. The mixture is filtered and concentrated to give (S)-4-isopropyl-3-(2-(((S)-1-(4- (piperazin-1-ylmethyl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one as a white solid (97 mg, 67.2% yield).
1 H NMR (400 MHz, MeOD) δ 8.08 (d, J = 5.8 Hz, 1 H), 7.30 (d, J = 5.8 Hz, 1 H), 7.28 - 7.19 (m, 4H), 5.01 (q, J = 7.0 Hz, 1 H), 4.63 (br s, 1 H), 4.37 - 4.14 (m, 2H), 3.44 (s, 2H), 2.78 (t, J = 5.0 Hz, 4H), 2.39 (br s, 4H), 1.89 (br s, 1 H), 1 .45 (d, J = 7.0 Hz, 3H), 0.68 (br s, 3H), 0.52 (br s, 3H); HRMS(B) m/z 425.2662 (M + H)+. Example 207
Figure imgf000179_0001
In a 5 mL microwave vial a solution of (S)-3-(2-((S)-1-(4- bromophenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one (86 mg, 0.21 mmol), pyridin-4-ylboronic acid (26 mg, 0.21 mmol), Sodium bicarbonate (0.21 mL, 0.42 mmol, 2 M solution) in Dioxane (1 mL) was bubbled N2 for 3 min then CI2Pd(dppf).CH2Cl2 (17 mg, 0.021 mmol) was added. The capped tube was heated to 100°C for 16 h. After cooling the reaction mixture was diluted with EtOAc (10 mL) and washed with water (10 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 10 mL). Combined organics were dried over Na2S04, filtered and concentrated. The crude material was purified through silica gel column chromatography (EtOAc in Heptane 12 to 100%) to yield (S)-4-isopropy-3-(2-(((S)-1-(4-(2-yl)phenyl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one as a white solid (27 mg, 30.5% yield).
1 H NMR (400 MHz, MeOD) δ 8.35 (d, J = 5.4 Hz, 1 H), 8.08 (d, J = 5.9 Hz, 1 H), 7.64 - 7.60 (m, 2H), 7.49 (br d, J = 1.8 Hz, 1 H), 7.43 - 7.39 (m, 3H), 7.30 (d, J = 5.8 Hz, 1 H), 5.02 (q, J = 6.8 Hz, 1 H), 4.55 (br s, 1 H), 4.27 - 4.18 (m, 2H), 2.52 (s, 3H), 1.65 (br s, 1 H), 1.49 (d, J = 7.1 Hz, 3H), 0.55 (br s, 3H), 0.43 (br s, 3H); HRMS(B) m/z 418.2227 (M + H)+.
Example 208
Figure imgf000179_0002
To a solution of tert-butyl 4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-yl((S)-1-(4- (1-methyl-1 H-pyrazol-4-yl)phenyl)ethyl)carbamate (45 mg, 0.09 mmol) in DCM (1 mL) was added TFA (1 mL, 12 mmol) slowly at -78 °C. The reaction was stirred at room temperature for 1 h then was concentrated and diluted with DCM (10 mL). The solution was washed with saturated NaHC03 solution and brine. After separation, the aqueous phase was extracted with DCM (3 x 10 mL). Combined organics were dried over Na2SC>4, filtered and concentrated to give (S)-4-isopropyl-3-(2-(((S)-1-(4-(1-methyl-1 H- pyrazol-4-yl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one as a white solid (35 mg, 97% yield).
1 H NMR (400 MHz, MeOD) δ 8.09 (d, J = 5.9 Hz, 1 H), 7.86 (s, 1 H), 7.72 (d, J = 0.8 Hz, 1 H), 7.45 - 7.41 (m, 2H), 7.30 (d, J = 5.8 Hz, 1 H), 7.25 (d, J = 7.9 Hz, 2H), 4.97 (q, J = 7.0 Hz, 1 H), 4.58 (br s, 1 H), 4.30 - 4.21 (m, 2H), 3.86 (s, 3H), 1.66 (br s, 1 H), 1 .48 (d, J = 7.0 Hz, 3H), 0.60 (br s, 3H), 0.48 (br s, 3H); HRMS(B) m/z 407.2179 (M + H)+.
Example 209
Figure imgf000180_0001
Following the above procedure for Example 208, N-(4-((S)-1 -(4-((S)-4-isopropyl-2- oxooxazolidin-3-yl)pyrimidin-2-ylamino)ethyl)phenyl)cyclohexanecarboxamide was prepared as a white solid (45 mg, 92 % yield) from tert-butyl (S)-1-(4- (cyclohexanecarboxamido)phenyl)ethyl(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin- 2-yl)carbamate.
1 H NMR (400 MHz, MeOD) δ 8.08 (d, J = 5.9 Hz, 1 H), 7.47 - 7.41 (m, 2H), 7.30 (d, J = 5.8 Hz, 1 H), 7.23 - 7.16 (m, 2H), 4.95 (q, J = 7.0 Hz, 1 H), 4.60 (br s, 1 H), 4.32 - 4.19 (m, 2H), 2.30 (tt, J = 1 1.8, 3.3 Hz, 1 H), 1 .89 - 1 .72 (m, 4H), 1.72 - 1.63 (m, 1 H), 1 .54 - 1 .39 (m, 5H), 1.39 - 1.14 (m, 4H), 0.67 (br s, 3H), 0.54 (br s, 3H); HRMS(B) m/z 452.2636 (M + H)+.
Example 210
Figure imgf000180_0002
A solution of 4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzaldehyde (35 mg, 0.1 mmol) and 2-methyloctahydropyrrolo[3,4- c]pyrrole (14 mg, 0.1 1 mmol) in MeOH (2 mL) was added acetic acid (7.2 mg, 0.12 mmol) and 5-Ethyl-2-methylpyridine borane complex (14 mg, 0.1 mmol, sigmaaldrich). The solution was stirred at 50 °C for 4 h then 5 drops of water was added. The solution was stirred at room temperature for another 2 h then diluted with EtOAc (10 mL) and washed with water (10 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 10 mL). Combined organics were dried over Na2S04, filtered and concentrated. The crude material was purified through HPLC to give (4S)-4-isopropyl-3- (2-(((1 S)-1 -(4-((5-methylhexahydropyrrolo[3,4-c]pyrrol-2(1 H)- yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one as a white solid (10 mg, 21.7% yield).
1 H NMR (400 MHz, MeOD) δ 8.07 (d, J = 5.8 Hz, 1 H), 7.29 (d, J = 5.8 Hz, 1 H), 7.25 - 7.20 (m, 4H), 5.00 (q, J = 7.0 Hz, 1 H), 4.63 (br s, 1 H), 4.31 - 4.23 (m, 2H), 3.55 - 3.48 (m, 2H), 2.68 (dh, J = 13.6, 4.3, 3.7 Hz, 2H), 2.64 - 2.48 (m, 4H), 2.36 - 2.29 (m, 4H), 2.28 (s, 4H), 1 .84 (br s, 1 H), 1.45 (d, J = 7.0 Hz, 3H), 0.68 (br s, 3H), 0.52 (br s, 3H); HRMS(B) m/z 465.2975 (M + H)+.
Example 211
Figure imgf000181_0001
A solution of 3-(2-fluoropyrimidin-4-yl)oxazolidin-2-one (89.1 mg, 0.487 mmol), 1-(3-(4- chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethanamine (1 15.9 mg, 0.518 mmol, 1.06 equiv), and DIPEA (0.20 mL, 1 .1 mmol, 2.4 equiv) in DMSO (1.5 mL) was heated at 1 10 °C for 100 min. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (MeOH in CH2Cl2 0 to 5%) provided 3-(2-(1 -(3-(4-chlorophenyl)-1 ,2,4- oxadiazol-5-yl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one (18.2 mg, white solid) in 10.3% yield.
1 H NMR (400 MHz, DMSO-d6) 8.21 (br s, 1 H), 8.00 - 7.97 (m, 2 H), 7.65 - 7.61 (m, 2 H), 7.30 (br s, 1 H), 5,28 (br s, 1 H), 4.44 - 4.38 (br m, 2 H), 4.14 - 4.08 (m, 1 H), 3.99 (br s, 0.5 H), 3.75 (br s, 0.5 H), 1 .64 (d, J = 7.0 Hz, 3 H); HRMS(B) m/z 387.0962 (M + H)+ Example 212
Figure imgf000182_0001
A solution of (S)-1-(4-phenoxyphenyl)ethanamine hydrochloride (281 mg, 1.125mmol), 3- (2-chloro-5-fluoropyrimidin-4-yl)oxazolidin-2-one (103mg, 0.379mmol) and DIPEA (0.331 ml, 1.896mmol) in DMSO was heated to 1 10°C for 1 h. LCMS showed little product. Heated for an additional 16h. LCMS still showed starting material. Added an additional 5 equivalents of DIPEA and 1 equivalent of KF. Heated to 1 10°C for 2h. LCMS shows product. The reaction mixture was diluted with EtOAc (8 mL) and washed with water (30 mL). After separation, the aqueous phase was extracted with EtOAc (3 x 8 mL). Combined organics were dried over Na2S04, filtered and concentrated. Purified by column chromatography (10% to 50% EtOAc/Heptane) to give (S)-1-(5-fluoro-2-(1-(4- phenoxyphenyl)ethylamino) pyrimidin-4-yl)-3-oxa-1-azaspiro[4.4]nonan-2-one (62mg, 0.138mmol).
1 H NMR (400 MHz, MeOD) δ 8.25 (d, J = 2.8 Hz, 1 H), 7.34 (ddd, J = 8.7, 4.9, 2.3 Hz, 4H), 7.16 - 7.04 (m, 1 H), 7.02 - 6.90 (m, 4H), 4.96 (q, J = 7.0 Hz, 1 H), 4.30 - 4.25 (m, 2H), 2.38 (dt, J = 13.1 , 8.4 Hz, 1 H), 2.02 (br s, 1 H), 1 .80 (ddd, J = 12.7, 7.3, 4.2 Hz, 1 H), 1 .71 - 1 .63 (br m, 2H), 1.61 - 1.49 (m, 3H), 1 .53 (d, J = 7.0 Hz, 3 H). HRMS(B) (M+H) 449.1984 Calc'd (M+H) 449.1989
The compounds in Table 7 were prepared using methods substantially similar to those described for the preparation of Examples 1 , 1 13, 21 1 and 212.
Table 7.
Figure imgf000182_0002
Figure imgf000183_0001
Figure imgf000184_0001
Figure imgf000185_0001
Figure imgf000186_0001
Figure imgf000187_0001
Figure imgf000188_0001
Figure imgf000189_0001
Table 8. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 7.
Figure imgf000190_0001
Figure imgf000191_0001
Figure imgf000192_0001
Figure imgf000193_0001
Figure imgf000194_0001
Figure imgf000195_0001
Figure imgf000196_0001
Figure imgf000197_0001
Figure imgf000198_0001
Figure imgf000199_0001
2.321 (s, 1 .5H), 1 .95 (br s, 0.5H), 1.58 (dd,
J = 7.0, 2.3 Hz, 3H), 1 .02 (d, J = 7.0 Hz,
1 .5H), 0.88 (d, J = 6.9 Hz, 1.5H), 0.76 (br
s, 1.5H), 0.64 (br s, 1 .5H).
284: (S)-3-(2-(((R)-1 - HRMS(B) cyclopentylethyl)amino)py m/z rimidin-4-yl)-4- 319.2133 isopropyloxazolidin-2-one (M+H )+,
RT=2.68 min.
285: (S)-3-(2-(((S)-1-(4- HRMS(B)
(dimethylamino)phenyl)et m/z hyl)amino)pyrimidin-4-yl)- 370.2227
4-isopropyloxazolidin-2- (M+H )+, one RT=2.47 min.
286: N-(3-((S)-1-((4-((S)- HRMS(B)
4-isopropyl-2- m/z oxooxazolidin-3- 384.2032 yl)pyrimidin-2-yl)amino) (M+H )+,
Ethylphenyl)acetamide RT=1.97 min
287: (S)-3-(2-(((S)-1-(1 H- HRMS(B) benzo[d]imidazol-2- m/z yl)ethyl)amino)pyrimidin-4- 367.1887 yl)-4-isopropyloxazolidin- (M+H )+
2-one RT=2.39 min.
288: (S)-3-(2-(((S)-1-(4- HRMS(B) ((4- m/z chlorophenyl)sulfonyl)phe 501.1343, nyl)ethyl)amino)pyrimidin- (M+H )+ 4-yl)-4- RT=2.68 isopropyloxazolidin-2-one min.
289: (S)-4-isopropyl-3-(2- HRMS(B) (((S)-1 -(4- m/z nitrophenyl)ethyl)amino)p 372.1672, yrimidin-4-yl)oxazolidin-2- (M+H )+, one RT=2.59 min.
290: (S)-3-(2-(((S)-1-(4- HRMS(B) aminophenyl)ethyl)amino) m/z pyrimidin-4-yl)-4- 342.1931 , isopropyloxazolidin-2-one (M+H )+,
RT=2.17 min
291 : (S)-4-isopropyl-3-(2- HRMS(B)
(((S)-1 -(5-(methylthio)- m/z
1 ,3,4-oxadiazol-2- 365.1367, yl)ethyl)amino) (M+H )+, pyrimidin-4-yl)oxazolidin- RT=1.88
2-one min.
292: (S)-4-isopropyl-3-(2- (CDCIs) δ 8.15 (d, J = 5.9 Hz, 1 H), 7.87 - HRMS(B)
(((S)-1 -(5-phenyl-1 ,3,4- 7.74 (m, 2H), 7.51 (d, J = 5.9 Hz, 1 H), 7.46 m/z thiadiazol-2-yl)ethyl) - 7.28 (m, 3H), 6.39 (b, 1 H), 5.43 (s, 1 H), 41 1.1596(
Figure imgf000201_0001
Figure imgf000202_0001
Figure imgf000203_0001
The compounds in Table 9 were prepared using methods substantially similar to those described for the preparation of Examples 1 , 1 13, and 171 through 212, including chiral separation to isolate the two diastereomers. Table 9.
Figure imgf000204_0001
Figure imgf000205_0001
Figure imgf000206_0001
Figure imgf000207_0001
Figure imgf000208_0001
Figure imgf000209_0001
Table 10. Chemical name, NMR chemical shifts, chiral separation conditions and LCMS signal for each compound listed in Table 9.
Example: Name Chiral separation conditions, peak identification and analytical data
331 & 314: 4-(4- The chiral separation was carried out with SFC (IA-H, methoxyphenyl)-5,5- 5μΜ, 20 x 50 mm) using 28% MeOH in C02 to give (R)- dimethyl-3-(2-((S)-1 -(4- 4-(4-methoxyphenyl)-5,5-dimethyl-3-(2-(((S)-1 -(4- phenoxyphenyl)ethylamin phenoxyphenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2- o)pyrimidin-4- one and (S)-4-(4-methoxyphenyl)-5,5-dimethyl-3-(2- yl)oxazolidin-2-one (((S)-1-(4-phenoxyphenyl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one.
1 st Peak 313: 1H NMR (400 MHz, CDCI3) δ 8.03 (dd, J = 5.9, 1 .6 Hz, 1 H), 7.43 (d, J = 5.7 Hz, 1 H), 7.30 - 7.22 (m, 2H), 7.20 - 7.14 (m, 2H), 7.06 - 7.00 (m, 1 H), 6.98 (d, J = 8.2 Hz, 2H), 6.94 - 6.86 (m, 4H), 6.83 - 6.76 (m, 2H), 5.24 (br s, 1 H), 5.01 (s, 1 H), 4.57 (br s, 1 H), 3.72 (s, 3H), 1 .46 (s, 3H), 1.24 - 1.09 (m, 3H), 0.92 (s, 3H); HRMS(B) m/z 51 1 .2326 (M + H) +.
2nd Peak 314 : 1H NMR (400 MHz, CDCI3) δ 8.1 1 (d, J = 5.7 Hz, 1 H), 7.51 (d, J = 5.7 Hz, 1 H), 7.38 - 7.29 (m, 2H), 7.10 (tt, J = 7.3, 1.2 Hz, 1 H), 7.06 - 6.90 (m, 6H), 6.89 - 6.82 (m, 2H), 6.82 - 6.75 (m, 2H), 5.29 (s, 1 H), 5.09 (br s, 1 H), 4.80 (br s, 1 H), 3.72 (s, 3H), 1 .63 (s, 3H), 1 .48 (d, J = 6.8 Hz, 3H), 1.01 (s, 3H); HRMS(B) m/z 51 1.2323 (M + H) +.
Figure imgf000210_0001
Figure imgf000211_0001
2-one one and (S)-3-(2-(((S)-1 -(3,5-dimethyl-1 -phenyl-1 H- pyrazol-4-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one.
1 st peak 325: 1H NMR (400 MHz, MeOD) δ 8.16 (d, J = 5.8 Hz, 1 H), 7.57 - 7.49 (m, 2H), 7.48 - 7.42 (m, 1 H), 7.42 - 7.38 (m, 3H), 5.12 (q, J = 7.0 Hz, 1 H), 4.78 (td, J = 5.6, 3.5 Hz, 1 H), 4.44 - 4.36 (m, 2H), 2.63 (td, J = 7.0, 3.6 Hz, 1 H), 2.34 (s, 3H), 2.32 (s, 3H), 1 .59 (d, J = 7.1 Hz, 3H), 1.00 (d, J = 7.0 Hz, 3H), 0.88 (d, J = 7.0 Hz, 3H). HRMS(B) (M+H) 421.2348 Calc'd (M+H) 421 .2352 2nd peak 326: 1 H NMR (400 MHz, MeOD) δ 8.18 (d, J = 5.8 Hz, 1 H), 7.56 - 7.49 (m, 2H), 7.48 - 7.41 (m, 1 H), 7.40 - 7.35 (m, 3H), 5.07 (q, J = 7.1 Hz, 1 H), 4.78 (dt, J = 7.8, 3.8 Hz, 1 H), 4.44 - 4.32 (m, 2H), 2.33 (s, 3H), 2.31 (br s, 1 H) 2.29 (s, 3H), 1 .59 (d, J = 7.1 Hz, 3H), 0.85 (br d, J = 7.0 Hz, 3H), 0.77 (br d, J = 6.9 Hz, 3H). HRMS(B) (M+H) 421.2347 Calc'd (M+H) 421.2352
327 & 328: (S)-3-(2-(1-(4- Separation was achieved by reverse HPLC (10-85%
(1 H-imidazol-1- ACN/water 0.1 % NH40H modifier) to give (S)-3-(2- yl)phenyl)ethylamino)pyri (((R)-1 -(4-(1 H-imidazol-1- midin-4-yl)-4- yl)phenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1-(4-(1 H- imidazol-1 -yl)phenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one.
1 st peak 327: 1H NMR (400 MHz, MeOD) δ 8.25 - 8.00 (m, 2H), 7.53 (d, J = 0.7 Hz, 5H), 7.38 (d, J = 5.9 Hz, 1 H), 7.15 (s, 1 H), 5.04 (q, J = 7.1 Hz, 1 H), 4.50 (br s, 1 H), 4.40 - 4.19 (m, 2H), 2.68 (pd, J = 7.0, 3.6 Hz, 1 H), 1 .57 (d, J = 7.0 Hz, 3H), 1 .02 (d, J = 7.0 Hz, 3H), 0.87 (d, J = 7.0 Hz, 3H). HRMS(B) (M+H) 393.2042 Calc'd (M+H) 393.2039
2nd peak 328: 1 H NMR (400 MHz, MeOD) δ 8.16 (d, J = 5.8 Hz, 1 H), 8.10 (t, J = 1.2 Hz, 1 H), 7.55 (t, J = 1 .4 Hz, 1 H), 7.52 (s, 4H), 7.38 (d, J = 5.8 Hz, 1 H), 7.15 (t, J = 1 .2 Hz, 1 H), 5.12 (q, J = 7.0 Hz, 1 H), 4.67 (br s, 1 H), 4.44 - 4.23 (m, 2H), 1 .84 (br s, 1 H), 1.57 (d, J = 7.0 Hz, 3H), 0.71 (br s, 3H), 0.60 (br s, 3H). HRMS(B) (M+H) 393.2026 Calc'd (M+H) 393.2039
329 & 330: (S)-3-(2-(1-(3- Chiral separation was achieved by chiral SFC column fluoro-4-(pyridin-3- chromatography (Column AD-H 5mM 20x250mm yloxy)phenyl)ethylamino)p column 15% MeOH+DEA) to give (S)-3-(2-(((R)-1-(3- yrimidin-4-yl)-4- fluoro-4-(pyridin-3-yloxy)phenyl)ethyl)amino)pyrimidin-4- isopropyloxazolidin-2-one yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1 -(3- fluoro-4-(pyridin-3-yloxy)phenyl)ethyl)amino)pyrimidin-4- yl)-4-isopropyloxazolidin-2-one.
1 st peak 329: 1H NMR (400 MHz, MeOD) δ 8.32 - 8.23 (m, 2H), 8.15 (d, J = 5.8 Hz, 1 H), 7.45 - 7.35 (m, 3H), 7.31 (dd, J = 1 1 .8, 2.0 Hz, 1 H), 7.26 (dd, J = 8.5, 2.0 Hz, 1 H), 7.19 (t, J = 8.2 Hz, 1 H), 5.15 - 4.95 (m, 1 H), 4.51 (s, 1 H), 4.41 - 4.26 (m, 2H), 2.68 (pd, J = 7.1 , 3.6 Hz, 1 H), 1.56 (d, J = 7.0 Hz, 3H), 1 .01 (d, J = 7.1 Hz, 3H), 0.88 (d, J = 6.9 Hz, 3H). HRMS(B) (M+H) 438.1935 Calc'd (M+H) 438.1941
2nd peak 330: 1 H NMR (400 MHz, MeOD) δ 8.28 (dd, J = 4.7, 1.4 Hz, 1 H), 8.26 (d, J = 2.8 Hz, 1 H), 8.17 (d, J =
Figure imgf000213_0001
1 H), 8.55 (br s, 1 H), 8.17 (br s, 1 H), 8.09 (d, J = 8.0 Hz, 1 H), 7.70 - 7.59 (m, 2H), 7.54 (br s, 1 H), 7.51 - 7.45 (m, 2H), 7.38 (d, J = 5.7 Hz, 1 H), 5.1 1 (q, J = 7.0 Hz, 1 H), 4.66 (br s, 1 H), 4.36 - 4.30 (m, 2H), 1.80 (br s, 1 H), 1 .58 (d, J = 7.0 Hz, 3H), 0.67 (br s, 3H), 0.56 (br s, 3H). HRMS(B) (M+H) 404.2079 Calc'd (M+H) 404.2086
337 & 338: (S)-4- Separation was achieved on a normal phase silica gel isopropyl-3-(2-(1-(4- column with 20 to 100% ethylacetate / heptane to give
(pyridin-4- (S)-4-isopropyl-3-(2-(((R)-1-(4-(pyridin-4- yl)phenyl)ethylamino)pyri yl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one midin-4-yl)oxazolidin-2- and (S)-4-isopropyl-3-(2-(((S)-1-(4-(pyridin-4- one yl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one.
1 st peak 337: 1H NMR (400 MHz, MeOD) δ 8.58 (br s, 2H), 8.14 (d, J = 5.9 Hz, 1 H), 7.83 - 7.66 (m, 4H), 7.60 - 7.46 (m, 2H), 7.37 (d, J = 5.8 Hz, 1 H), 5.15 - 4.96 (m, 1 H), 4.48 (br s, 1 H), 4.38 - 4.15 (m, 2H), 2.69 (ddp, J = 10.5, 7.0, 3.5 Hz, 1 H), 1.58 (d, J = 7.0 Hz, 3H), 1 .03 (d, J = 7.0 Hz, 3H), 0.88 (d, J = 6.9 Hz, 3H). HRMS(B) (M+H) 404.2068 Calc'd (M+H) 404.2086
2nd peak 338: 1 H NMR (400 MHz, MeOD) δ 8.59 (br s, 2H), 8.17 (br s, 1 H), 7.80 - 7.68 (m, 4H), 7.56 - 7.44 (m, 2H), 7.38 (d, J = 5.8 Hz, 1 H), 5.1 1 (q, J = 7.0 Hz, 1 H), 4.65 (br s, 1 H), 4.31 (dt, J = 17.1 , 9.0 Hz, 2H), 1 .76 (br s, 1 H), 1.58 (d, J = 7.1 Hz, 3H), 0.66 (br s, 3H), 0.55 (br s, 3H). HRMS(B) (M+H) 404.1939 Calc'd (M+H) 404.2086
339 & 340: (S)-4- Separation was achieved on a normal phase silica gel isopropyl-3-(2-(1-(4- column with 40 to 100% ethylacetate / heptane to give
(methyl(phenyl)amino)phe (S)-4-isopropyl-3-(2-(((R)-1-(4- nyl)ethylamino)pyrimidin- (methyl(phenyl)amino)phenyl)ethyl)amino)pyrimidin-4-
4-yl)oxazolidin-2-one yl)oxazolidin-2-one and (S)-4-isopropyl-3-(2-(((S)-1 -(4-
(methyl(phenyl)amino)phenyl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one.
1 st peak 339: 1H NMR (400 MHz, MeOD) δ 8.12 (d, J = 5.8 Hz, 1 H), 7.37 (d, J = 5.8 Hz, 1 H), 7.31 - 7.18 (m, 4H), 7.03 - 6.94 (m, 4H), 6.91 (tt, J = 7.4, 1.1 Hz, 1 H), 4.99 - 4.93 (m, 1 H), 4.57 (br s, 1 H), 4.42 - 4.27 (m, 2H), 3.28 (s, 3H), 2.68 (ddq, J = 10.5, 6.9, 3.4 Hz, 1 H), 1 .53 (d, J = 6.9 Hz, 3H), 1 .01 (d, J = 7.1 Hz, 3H), 0.88 (d, J = 7.0 Hz, 3H). HRMS(B) (M+H) 432.2390 Calc'd (M+H) 432.2400
2nd peak 340: 1 H NMR (400 MHz, MeOD) δ 8.15 (d, J = 5.8 Hz, 1 H), 7.37 (d, J = 5.8 Hz, 1 H), 7.30 - 7.18 (m, 4H), 7.02 - 6.92 (m, 4H), 6.89 (tt, J = 7.3, 1.1 Hz, 1 H), 5.04 (q, J = 7.0 Hz, 1 H), 4.77 - 4.67 (m, 1 H), 4.43 - 4.26 (m, 2H), 3.27 (s, 3H), 2.1 1 (br s, 1 H), 1 .52 (d, J = 7.0 Hz, 3H), 0.79 (br s, 3H), 0.68 (br s, 3H). HRMS(B) (M+H) 432.2386 Calc'd (M+H) 432.2400
341 & 342: S)-3-(2-(1-(3- Chiral separation was achieved by chiral SFC column fluoro-4-(4-methyl-1 H- (IC 20x250nm 45% IPA in C02, 75g/min Flow) to give pyrazol-1 - (S)-3-(2-(((R)-1 -(3-fluoro-4-(4-methyl-1 H-pyrazol-1 - yl)phenyl)ethylamino)pyri yl)phenyl)ethyl)amino)pyrimidin-4-yl)-4- midin-4-yl)-4- isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1-(3-fluoro- isopropyloxazolidin-2-one 4-(4-methyl-1 H-pyrazol-1 - yl)phenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one.
1 st peak 341 : 1H NMR (400 MHz, MeOD) δ 8.15 (d, J = 5.8 Hz, 1 H), 7.81 (dt, J = 2.9, 0.9 Hz, 1 H), 7.66 (t, J = 8.3 Hz, 1 H), 7.56 (s, 1 H), 7.40 (d, J = 5.8 Hz, 1 H), 7.36 - 7.25 (m, 2H), 5.01 (d, J = 7.5 Hz, 1 H), 4.46 (br s, 1 H), 4.38 - 4.25 (m, 2H), 2.68 (pd, J = 7.0, 3.5 Hz, 1 H), 2.17 (d, J = 0.6 Hz, 3H), 1.56 (d, J = 7.0 Hz, 3H), 1 .02 (d, J = 7.1 Hz, 3H), 0.87 (d, J = 6.9 Hz, 3H). HRMS(B) (M+H) 425.2089 Calc'd (M+H) 425.2101
2nd peak 342: 1 H NMR (400 MHz, MeOD) δ 8.17 (d, J = 5.8 Hz, 1 H), 7.80 (d, J = 2.6 Hz, 1 H), 7.66 (t, J = 8.3 Hz, 1 H), 7.56 (s, 1 H), 7.40 (d, J = 5.8 Hz, 1 H), 7.35 - 7.26 (m, 2H), 5.10 (q, J = 7.0 Hz, 1 H), 4.69 (br s, 1 H), 4.43 - 4.24 (m, 2H), 2.17 (s, 3H), 1 .80 (br s,1 H), 1.56 (d, J = 7.1 Hz, 3H), 0.73 (br s, 3H), 0.62 (br s, 3H). HRMS(B) (M+H) 425.2081 Calc'd (M+H) 424.2101
343 & 344: (S)-3-(2-(1-(4- Chiral separation was achieved by chiral SFC column (3,5-dimethyl-1 H-pyrazol- chromatography (Column IA 20x250mm column 25% 1 - MeOH, 0.2% DEA) to give (S)-3-(2-(((R)-1 -(4-(3,5- yl)phenyl)ethylamino)pyri dimethyl-1 H-pyrazol-1-yl)phenyl)ethyl)amino)pyrimidin- midin-4-yl)-4- 4-yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1- isopropyloxazolidin-2-one (4-(3,5-dimethyl-1 H-pyrazol-1- yl)phenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one.
1 st peak 343: 1H NMR (400 MHz, MeOD) δ 8.14 (d, J = 5.8 Hz, 1 H), 7.56 - 7.48 (m, 2H), 7.41 - 7.34 (m, 3H), 6.06 (s, 1 H), 5.07 - 5.02 (m, 1 H), 4.46 (br s, 1 H), 4.39 - 4.22 (m, 2H), 2.79 - 2.60 (m, 1 H), 2.26 (s, 3H), 2.24 (s, 3H), 1 .58 (d, J = 7.0 Hz, 3H), 1.02 (d, J = 7.1 Hz, 3H), 0.88 (d, J = 6.9 Hz, 3H). HRMS(B) (M+H) 421 .2332 Calc'd (M+H) 421 .2352
2nd peak 344: 1 H NMR (400 MHz, MeOD) δ 8.15 (d, J = 5.8 Hz, 1 H), 7.55 - 7.47 (m, 2H), 7.41 - 7.33 (m, 3H), 6.06 (s, 1 H), 5.17 (q, J = 7.0 Hz, 1 H), 4.74 (br s, 1 H), 4.45 - 4.19 (m, 2H), 2.26 (s, 3H), 2.25 (s, 3H), 2.07 (br s, 1 H), 1.56 (d, J = 7.0 Hz, 3H), 0.80 (br s, 3H), 0.65 (br s, 3H). HRMS(B) (M+H) 421.2335 Calc'd (M+H) 421 .2352
345 & 346: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(5- chromatography (AD-H , 5uM, 20x250 mm column , 80 methyl-1 ,3,4-oxadiazol-2- ml/min, 99 bar, eluting 10% MeOH/C02) to give (S)-4- yl)ethyl)amino)pyrimidin-4- isopropyl-3-(2-(((R)-1-(5-methyl-1 ,3,4-oxadiazol-2- yl)oxazolidin-2-one yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- 4-isopropyl-3-(2-(((S)-1-(5-methyl-1 ,3,4-oxadiazol-2- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one.
1 st peak 345: HRMS(B) m/z 333.1668 (M + H)+.
RT=1.96 min.
2nd peak 346: HRMS(B) m/z 333.1668 (M + H)+.
RT=1.58 min.
347 & 348: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(1 - chromatography (AD-H , 5uM, 20x250 mm column , 80 methyl-1 H-1 ,2,4-triazol-5- ml/min, 99 bar, eluting 10% MeOH/C02) to give (S)-4- yl)ethyl)amino)pyrimidin-4- isopropyl-3-(2-(((R)-1-(1-methyl-1 H-1 ,2,4-triazol-5- yl)oxazolidin-2-one. yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- 4-isopropyl-3-(2-(((S)-1-(1-methyl-1 H-1 ,2,4-triazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one.
1 st peak 347: HRMS(B) m/z 332.1831 (M + H)+.
RT=1.68 min.
2nd peak 348: HRMS(B) m/z 332.1833 (M + H)+.
RT=1.57 min.
349 & 350: (S)-3-(2-((1 - Chiral separation was achieved by chiral SFC column
(imidazo[2,1 - chromatography (AD-H , 5uM, 20x250 mm column , 80 b][1 ,3,4]thiadiazol-6- ml/min, 99 bar, eluting 10% MeOH/C02) to give (S)-3- yl)ethyl)amino)pyrimidin-4- (2-(((R)-1 -(imidazo[2, 1 -b][1 ,3,4]thiadiazol-6- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one. one and (S)-3-(2-(((S)-1 -(imidazo[2,1 -b][1 ,3,4]thiadiazol- 6-yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one.
1 st peak 349: HRMS(B) m/z 374.1384 (M + H)+.
RT=2.01 min.
2nd peak 350: 1 H NMR (400 MHz, CDCI3) δ 8.43 (s, 1 H), 8.12 (d, J = 5.8 Hz, 1 H), 7.60 (s, 1 H), 7.38 (d, J = 5.8 Hz, 1 H), 5.13 (s, 1 H), 4.60 (dt, J = 8.3, 3.3 Hz, 1 H), 4.33 - 4.07 (m, 2H), 2.25 (b, 1 H), 1.57 (d, J = 6.8 Hz, 3H), 0.84 - 0.52 (b, 6H). HRMS(B) m/z 373.1321 (M +), RT=1.88 min.
351 & 352: (S)-3-(2-((1 -(1 - Chiral separation was achieved by chiral SFC column ethyl-1 H-1 ,2,4-triazol-5- chromatography (AD-H , 5uM, 20x250 mm column , 80 yl)ethyl)amino)pyrimidin-4- ml/min, 99 bar, eluting 10% MeOH/C02) to give (S)-3- yl)-4-isopropyloxazolidin- (2-(((R)-1 -(1 -ethyl-1 H-1 ,2,4-triazol-5-
2-one yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one and (S)-3-(2-(((S)-1 -(1 -ethyl-1 H-1 , 2,4-triazol-5- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 351 : HRMS(B) m/z 346.1985 (M + H)+.
RT=1.89 min.
2nd peak 352: HRMS(B) m/z 346.1983 (M + H)+, RT=1.75 min.
353 & 354: (S)-3-(2-((1 -(4- Chiral separation was achieved by chiral SFC column ethyl-4H-1 ,2,4-triazol-3- chromatography (AD-H , 5uM, 20x250 mm column , 80 yl)ethyl)amino)pyrimidin-4- ml/min, 99 bar, eluting 10% MeOH/C02) to give (S)-3- yl)-4-isopropyloxazolidin- (2-(((R)-1 -(4-ethyl-4H-1 ,2,4-triazol-3-
2-one yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one and (S)-3-(2-(((S)-1 -(4-ethyl-4H-1 ,2,4-triazol-3- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 353: HRMS(B) m/z 346.1984 (M + H)+.
RT=1.80 min.
2nd peak 354:HRMS(B) m/z 346.1982 (M + H)+, RT=1.77 min.
355 & 356: (S)-3-(2-((1 - Chiral separation was achieved by chiral SFC column
(imidazo[2,1 -b]thiazol-6- chromatography (AD-H , 5uM, 20x250 mm column , 75 yl)ethyl)amino)pyrimidin-4- ml/min, 120 bar, eluting 20-30% MeOH/C02) to give yl)-4-isopropyloxazolidin- (S)-3-(2-(((R)-1-(imidazo[2,1 -b]thiazol-6-
2-one yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one and (S)-3-(2-(((S)-1 -(imidazo[2,1 -b]thiazol-6- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 355: HRMS(B) m/z 373.1436 (M + H)+.
RT=1.92 min. 2nd peak 356: HRMS(B) m/z 373.1439 (M +H)+,
RT=1.84 min.
357 & 358: N-(4-(1 -((4- Chiral separation was achieved by chiral SFC column
((S)-4-isopropyl-2- chromatography (AD-H , 5uM, 20x250 mm column , 80 oxooxazolidin-3- ml/min, 96 bar, eluting 25% MeOH/C02) to give N-(4- yl)pyrimidin-2- ((R)-1 -((4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)amino)ethyl)phenyl)met yl)pyrimidin-2- hanesulfonamide yl)amino)ethyl)phenyl)methanesulfonamide and N-(4-
((S)-1-((4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2- yl)amino)ethyl)phenyl)methanesulfonamide
1 st peak 357: HRMS(B) m/z 420.1689 (M + H)+.
RT=2.08 min.
2nd peak 358: HRMS(B) m/z 420.1687 (M +H)+, RT=1.98 min.
359 & 360: (S)-4- Separation was achieved by silica gel chromatography isopropyl-3-(2-((1 -(3- (10 to 40% EtOAc / heptane) to give (S)-4-isopropyl-3- (pyridin-2-yl)-1 ,2,4- (2-(((R)-1 -(3-(pyridin-2-yl)-1 ,2,4-oxadiazol-5- oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- yl)ethyl)amino)pyrimidin-4- 4- isopropyl-3-(2-(((S)-1-(3-(pyridin-2-yl)-1 ,2,4-oxadiazol- yl)oxazolidin-2-one 5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 359: HRMS(B) m/z 396.1784 (M + H)+.
RT=2.26 min.
2nd peak 360: HRMS(B) m/z 396.1784 (M +H)+, RT=2.20 min.
361 & 362: (S)-4- Separation was achieved by silica gel chromatography isopropyl-3-(2-((1 -(3-(p- (10 to 40% EtOAc / heptane) to give (S)-4-isopropyl-3- tolyl)-1 ,2,4-oxadiazol-5- (2-(((R)-1 -(3-(p-tolyl)-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- yl)oxazolidin-2-one 4-isopropyl-3-(2-(((S)-1 -(3-(p-tolyl)-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one.
1 st peak 361 : HRMS(B) m/z 409.1985 (M + H)+.
RT=2.88 min.
2nd peak 362: 1 H NMR (400 MHz, CDCI3) δ 8.24 (d, J = 5.8 Hz, 1 H), 8.03 (d, J = 5.9 Hz, 2H), 7.59 (d, J = 5.8 Hz, 1 H), 7.28 (d, J = 8.0 Hz, 2H), 5.41 (b, 1 H), 4.67 (dt, J = 8.2, 3.3 Hz, 1 H), 4.36 - 4.18 (m, 2H), 2.42 (s, 3H), 2.29 - 2.13 (m, 1 H), 1 .78 (d, J = 7.2 Hz, 3H), 0.81 (d, J = 7.1 Hz, 3H), 0.73 (d, J = 7.0 Hz, 3H). HRMS(B) m/z 409.1985 (M +H)+, RT=2.85 min.
363 & 364: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(4- chromatography (AD-H , 5uM, 20x250 mm column , 74
(methylsulfonyl)phenyl)eth ml/min, 100 bar, eluting 25% MeOH/C02) to give (S)-4- yl)amino)pyrimidin-4- isopropyl-3-(2-(((R)-1-(4- yl)oxazolidin-2-one (methylsulfonyl)phenyl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one and (S)-4-isopropyl-3-(2-(((S)-1-(4- (methylsulfonyl)phenyl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one
1 st peak 363: HRMS(B) m/z 405.1594 (M + H)+.
RT=2.26 min.
2nd peak 364: HRMS(B) m/z 405.1595 (M +H)+, RT=2.14 min.
365 & 366: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(3- chromatography (AD-H , 5uM, 20x250 mm column , 80 methyl-1 ,2,4-oxadiazol-5- ml/min, 100 bar, eluting 20% IPA/C02) to give (S)-4- yl)ethyl)amino)pyrimidin-4- isopropyl-3-(2-(((R)-1-(3-methyl-1 ,2,4-oxadiazol-5- yl)oxazolidin-2-one yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- 4-isopropyl-3-(2-(((S)-1-(3-methyl-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 365: HRMS(B) m/z 333.1679 (M + H)+.
RT=2.19 min.
2nd peak 366: HRMS(B) m/z 333.1680 (M +H)+, RT=2.12 min.
367 & 368: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column ethylisoxazol-5- chromatography (AD-H , 5uM, 20x250 mm column , 79 yl)ethyl)amino)pyrimidin-4- ml/min, 100 bar, eluting 20% IPA/C02) to give (S)-3-(2- yl)-4-isopropyloxazolidin- (((R)-1 -(3-ethylisoxazol-5-yl)ethyl)amino)pyrimidin-4-yl)-
2-one 4-isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1-(3- ethylisoxazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 367: HRMS(B) m/z 346.1886 (M + H)+.
RT=2.51 min.
2nd peak 368: HRMS(B) m/z 346.1882 (M +H)+, RT=2.45 min.
369 & 370: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(3- chromatography (AD-H , 5uM, 20x250 mm column , 75 propyl-1 ,2,4-oxadiazol-5- ml/min, 100 bar, eluting 20% IPA/C02) to give (S)-4- yl)ethyl)amino)pyrimidin-4- isopropyl-3-(2-(((R)-1-(3-propyl-1 ,2,4-oxadiazol-5- yl)oxazolidin-2-one yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- 4-isopropyl-3-(2-(((S)-1 -(3-propyl-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 369: HRMS(B) m/z 361.1989 (M + H)+.
RT=2.52 min.
2nd peak 370: HRMS(B) m/z 361 .1985 (M +H)+, RT=2.49 min.
371 & 372: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column cyclopropyl-1 ,2,4- chromatography (AD-H , 5uM, 20x250 mm column , 80 oxadiazol-5- ml/min, 100 bar, eluting 15% IPA/C02) to give (S)-3-(2- yl)ethyl)amino)pyrimidin-4- (((R)-1-(3-cyclopropyl-1 ,2,4-oxadiazol-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(3-cyclopropyl-1 ,2,4-oxadiazol- 5-yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 371 : HRMS(B) m/z 359.1830 (M + H)+.
RT=2.42 min.
2nd peak 372: HRMS(B) m/z 359.1833 (M +H)+, RT=2.37 min.
373 & 374: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(3- chromatography (AD-H , 5uM, 20x250 mm column , 80 isopropyl-1 ,2,4-oxadiazol- ml/min, 100 bar, eluting 20% IPA/C02) to give (S)-4- 5-yl)ethyl)amino)pyrimidin- isopropyl-3-(2-(((R)-1-(3-isopropyl-1 ,2,4-oxadiazol-5- 4-yl)oxazolidin-2-one yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- 4-isopropyl-3-(2-(((S)-1-(3-isopropyl-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 373: HRMS(B) m/z 361.1990 (M + H)+.
RT=2.58 min.
2nd peak 374: HRMS(B) m/z 361 .1987 (M +H)+, RT=2.54 min.
375 & 376: (S)-3-(2-((1 -(1 - Chiral separation was achieved by chiral SFC column ethyl-1 H-pyrazol-3- chromatography (AD-H , 5uM, 20x250 mm column , 78 yl)ethyl)amino)pyrimidin-4- ml/min, 100 bar, eluting 20% IPA/C02) to give (S)-3-(2- yl)-4-isopropyloxazolidin- (((R)-1 -(1 -ethyl-1 H-pyrazol-3-yl)ethyl)amino)pyrimidin-4-
2-one yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1-(1- ethyl-1 H-pyrazol-3-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 375: HRMS(B) m/z 345.2046 (M + H)+.
RT=2.31 min.
2nd peak 376: HRMS(B) m/z 345.2050 (M +H)+, RT=2.26 min.
377 & 378: (S)-3-(2-((1 -(2- Chiral separation was achieved by chiral column hydroxyphenyl)ethyl) chromatography (OJ-H , 4.6x250 mm column , 1 amino)pyrimidin-4-yl)-4- ml/min, eluting 25% ethanol /Heptane) to give (S)-3-(2- isopropyloxazolidin-2-one (((R)-1 -(2-hydroxyphenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1-(2- hydroxyphenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 377: HRMS(B) m/z 343.1767 (M + H)+.
RT=2.41 min.
2nd peak 378: HRMS(B) m/z 343.1767 (M +H)+, RT=2.36 min.
379 & 380: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(5- chromatography (AD-H , 5uM, 20x250 mm column , methyl-1 -phenyl-1 H-1 ,2,3- 874ml/min, 100 bar, eluting 30% IPA/C02) to give (S)- triazol-4- 4-isopropyl-3-(2-(((R)-1 -(5-methyl-1 -phenyl-1 H-1 ,2,3- yl)ethyl)amino)pyrimidin-4- triazol-4-yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one yl)oxazolidin-2-one and (S)-4-isopropyl-3-(2-(((S)-1 -(5-methyl-1 -phenyl-1 H- 1 ,2,3-triazol-4-yl)ethyl)amino)pyrimidin-4-yl)oxazolidin- 2-one
1 st peak 379: HRMS(B) m/z 408.2135 (M + H)+.
RT=2.37 min.
2nd peak 380: HRMS(B) m/z 408.2140 (M +H)+, RT=2.31 min.
381 & 382: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(3- chromatography (AD-H , 5uM, 20x250 mm column , 74 phenyl-1 ,2,4-oxadiazol-5- ml/min, 100 bar, eluting 20% -35% IPA/C02) to give yl)ethyl)amino)pyrimidin-4- (S)-4-isopropyl-3-(2-(((R)-1 -(3-phenyl-1 ,2,4-oxadiazol-5- yl)oxazolidin-2-one yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- 4-isopropyl-3-(2-(((S)-1 -(3-phenyl-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 381 : HRMS(B) m/z 395.1792 (M + H)+.
RT=2.63 min.
2nd peak 382: HRMS(B) m/z 395.1818(M +H)+, RT=2.58min.
383 & 384: (S)-3-(2-(((R)- Chiral separation was achieved by chiral SFC column
1 - (1 H-pyrrolo[2,3- chromatography (IA , 20x250 mm column , 74 ml/min, b]pyridin-5- 99 bar, eluting 45% MeOH w ith 5mM NH40H /C02) to yl)ethyl)amino)pyrimidin-4- give (S)-3-(2-(((R)-1 -(1 H-pyrrolo[2,3-b]pyridin-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2- one one and (S)-3-(2-(((S)-1 -(1 H-pyrrolo[2,3-b]pyridin-5- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 383: HRMS(B) m/z 367.1862 (M + H)+.
RT=2.10 min.
2nd peak 384: 1 H NMR (400 MHz, CDCI3) δ 8.32 (d, J = 2.2 Hz, 1 H), 8.19 (d, J = 5.8 Hz, 1 H), 7.94 (d, J = 2.1 Hz, 1 H), 7.47 (d, J = 5.8 Hz, 1 H), 7.38 (d, J = 3.5 Hz, 1 H), 6.46 (d, J = 3.5 Hz, 1 H), 5.30 - 5.08 (m, 1 H), 4.73 - 4.51 (m, 1 H), 4.28 (t, J = 8.8 Hz, 1 H), 4.19 (dd, J = 9.0, 3.1 Hz, 1 H), 1 .78 (dd, J = 31.8, 17.0 Hz, 1 H), 1 .66 (d, J = 6.9 Hz, 3H), 0.56 (s, 6H). HRMS(B) m/z
367.1870(M +H)+, RT=2.00min.
385 & 386: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(1 - chromatography (AD-H , 5uM, 20x250 mm column , 80 methyM H- ml/min, 99 bar, eluting 20% IPA/C02) to give (S)-4- benzo[d]imidazol-5- isopropyl-3-(2-(((R)-1-(1-methyl-1 H-benzo[d]imidazol-5- yl)ethyl)amino)pyrimidin-4- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- yl)oxazolidin-2-one 4- isopropyl-3-(2-(((S)-1 -(1 -methyl-1 H-benzo[d]imidazol-
5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one 1 st peak 385: HRMS(B) m/z 381.2026 (M + H)+.
RT=2.05 min.
2nd peak 386: HRMS(B) m/z 381.2022(M +H)+, RT=1.96min.
387 & 388: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(2-oxo- chromatography (AD-H , 5uM, 20x250 mm column , 80
2,3-dihydro-1 H- ml/min, 100 bar, eluting 25% IPA/C02) to give (S)-4- benzo[d]imidazol-5- isopropyl-3-(2-(((R)-1-(2-oxo-2,3-dihydro-1 H- yl)ethyl)amino)pyrimidin-4- benzo[d]imidazol-5-yl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one yl)oxazolidin-2-one and (S)-4-isopropyl-3-(2-(((S)-1-(2- oxo-2,3-dihydro-1 H-benzo[d]imidazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 387: HRMS(B) m/z 383.181 1 (M + H)+.
RT=1.90 min.
2nd peak 388: HRMS(B) m/z 383.1815(M +H)+, RT=1.85min.
389 & 390: (S)-3-(2-((1 - Chiral separation was achieved by chiral SFC column
(benzo[d]thiazol-2- chromatography (ID, 5uM, 20x250 mm column , 74 yl)ethyl)amino)pyrimidin-4- ml/min, 100 bar, eluting 35%MeOH/C02) to give (S)-3- yl)-4-isopropyloxazolidin- (2-(((R)-1 -(benzo[d]thiazol-2-yl)ethyl)amino)pyrimidin-4-
2-one yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1-
(benzo[d]thiazol-2-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 389: HRMS(B) m/z 384.1488 (M + H)+.
RT=2.44 min.
2nd peak 390: HRMS(B) m/z 384.1473(M +H)+, RT=2.36min.
391 & 392: (S)-3-(2-((1 - Chiral separation was achieved by chiral SFC column (indolizin-2- chromatography (OJ , 5uM, 20x250 mm column , 75 yl)ethyl)amino)pyrimidin-4- ml/min, 120 bar, eluting 15-55% MeOH/C02) to give yl)-4-isopropyloxazolidin- (S)-3-(2-(((R)-1 -(indolizin-2-yl)ethyl)amino)pyrimidin-4-
2-one yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1-
(indolizin-2-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 391 : HRMS(B) m/z 366.1926 (M + H)+.
RT=2.66 min.
2nd peak 392: HRMS(B) m/z 366.1918(M +H)+, RT=2.63min.
393 & 394: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(3-(2- chromatography (AD-H , 5uM, 20x250 mm column , 80 methoxyphenyl)-1 ,2,4- ml/min, 100 bar, eluting 5-55% MeOH/C02) to give (S)- oxadiazol-5- 4-isopropyl-3-(2-(((R)-1 -(3-(2-methoxyphenyl)-1 ,2,4- yl)ethyl)amino)pyrimidin-4- oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2- yl)oxazolidin-2-one one and (S)-4-isopropyl-3-(2-(((S)-1 -(3-(2- methoxyphenyl)-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 393: HRMS(B) m/z 425.1925 (M + H)+.
RT=2.57 min.
2nd peak 394: HRMS(B) m/z 425.1916(M +H)+, RT=2.52min.
395 & 396: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(3-(3- chromatography (IA, 5uM, 20x250 mm column , 74 methoxyphenyl)-1 ,2,4- ml/min, 100 bar, eluting m25% MeOH/C02) to give (S)- oxadiazol-5- 4-isopropyl-3-(2-(((R)-1 -(3-(3-methoxyphenyl)-1 ,2,4- yl)ethyl)amino)pyrimidin-4- oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2- yl)oxazolidin-2-one one and (S)-4-isopropyl-3-(2-(((S)-1 -(3-(3- methoxyphenyl)-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 395: HRMS(B) m/z 425.1924 (M + H)+.
RT=2.60 min.
2nd peak 396: 1 H NMR (400 MHz, CDCI3) δ 7.56 (dt, J = 7.7, 1 .2 Hz, 1 H), 7.49 (dt, J = 3.7, 1.8 Hz, 2H), 7.29 (t, J = 8.0 Hz, 2H), 6.96 (ddd, J = 8.3, 2.7, 0.9 Hz, 1 H), 5.34 (b, 1 H), 4.58 (dt, J = 8.2, 3.3 Hz, 1 H), 4.37 - 4.03 (m, 2H), 3.78 (s, 3H), 2.12 (b, 1 H), 1.68 (d, J = 7.1 Hz, 3H), 0.73 (d, J = 7.1 Hz, 3H), 0.65 (d, J = 7.0 Hz, 3H).
HRMS(B) m/z 425.1924(M +H)+, RT=2.54min.
397 & 398: (S)-3-(2-((1-(3- Chiral separation was achieved by chiral SFC column
(3-fluorophenyl)-1 ,2,4- chromatography (AD-H , 5uM, 20x250 mm column , 75 oxadiazol-5- ml/min, 100 bar, eluting 20% MeOH/C02) to give (S)-3- yl)ethyl)amino)pyrimidin-4- (2-(((R)-1 -(3-(3-fluorophenyl)-1 ,2,4-oxadiazol-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(3-(3-fluorophenyl)-1 ,2,4- oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 397: HRMS(B) m/z 413.1729 (M + H)+.
RT=2.66 min.
2nd peak 398: 1 H NMR (400 MHz, CDCI3) δ 7.86 (dt, J = 7.8, 1 .2 Hz, 1 H), 7.77 (ddd, J = 9.4, 2.7, 1.5 Hz, 2H), 7.60 (d, J = 5.3 Hz, 1 H), 7.46 (td, J = 8.0, 5.7 Hz, 1 H), 7.22 (tdd, J = 8.4, 2.6, 1.0 Hz, 1 H), 5.44 (b, 1 H), 4.68 (dt, J = 8.3, 3.3 Hz, 1 H), 4.44 - 4.1 1 (m, 2H), 2.18 (d, J = 8.4 Hz, 1 H), 1.78 (d, J = 7.1 Hz, 3H), 0.83 (d, J = 6.9 Hz, 3H), 0.75 (d, J = 6.9 Hz, 3H). HRMS(B) m/z
413.1732(M +H)+, RT=2.61 min.
399 & 400: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column cyclopentyl-1 ,2,4- chromatography (IA , 5uM, 20x250 mm column , 74 oxadiazol-5- ml/min, 99 bar, eluting 15% MeOH/C02) to give (S)-3- yl)ethyl)amino)pyrimidin-4- (2-(((R)-1 -(3-cyclopentyl-1 ,2,4-oxadiazol-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(3-cyclopentyl-1 ,2,4-oxadiazol- 5-yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 399: HRMS(B) m/z 387.2133 (M + H)+.
RT=2.54 min.
2nd peak 400: HRMS(B) m/z 387.21 17(M +H)+, RT=2.50min. 401 & 402: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column cyclohexyl-1 ,2,4- chromatography (IA, 5uM, 20x250 mm column , 74 oxadiazol-5- ml/min, 99 bar, eluting 30% MeOH/C02) to give (S)-3- yl)ethyl)amino)pyrimidin-4- (2-(((R)-1 -(3-cyclohexyl-1 ,2,4-oxadiazol-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(3-cyclohexyl-1 ,2,4-oxadiazol- 5-yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 401 : HRMS(B) m/z 401.2277 (M + H)+.
RT=2.71 min.
2nd peak 402: HRMS(B) m/z 401.2288(M +H)+, RT=2.68min.
403 & 404: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column (tert-butyl)-l ,2,4- chromatography (IA, 5uM, 20x250 mm column , 74 oxadiazol-5- ml/min, 100 bar, eluting 15% MeOH/C02) to give (S)-3- yl)ethyl)amino)pyrimidin-4- (2-(((R)-1 -(3-(tert-butyl)-1 ,2,4-oxadiazol-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(3-(tert-butyl)-1 ,2,4-oxadiazol- 5-yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 403: HRMS(B) m/z 375.2131 (M + H)+.
RT=2.47 min.
2nd peak 404: HRMS(B) m/z375.2130 (M +H)+, RT=2.44min.
405 & 406: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column isobutyl-1 ,2,4-oxadiazol-5- chromatography (IA, 5uM, 20x250 mm column , 74 yl)ethyl)amino)pyrimidin-4- ml/min, 100 bar, eluting 15% MeOH/C02) to give (S)-3- yl)-4-isopropyloxazolidin- (2-(((R)-1 -(3-isobutyl-1 ,2,4-oxadiazol-5- 2-one yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one and (S)-3-(2-(((S)-1 -(3-isobutyl-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 405: HRMS(B) m/z 375.2120 (M + H)+.
RT=2.45 min.
2nd peak 406: HRMS(B) m/z 375.2135 (M +H)+, RT=2.44min.
407 & 408: (S)-3-(2-((1 -(5- Chiral separation was achieved by chiral SFC column
(4-fluorophenyl)-1 ,3,4- chromatography (IA, 5uM, 20x250 mm column , 74 oxadiazol-2- ml/min, 99 bar, eluting 30% IPA/C02) to give (S)-3-(2- yl)ethyl)amino)pyrimidin-4- (((R)-1 -(5-(4-fluorophenyl)-1 ,3,4-oxadiazol-2- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(5-(4-fluorophenyl)-1 ,3,4- oxadiazol-2-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 407: HRMS(B) m/z 413.1713 (M + H)+.
RT=2.31 min.
2nd peak 408: HRMS(B) m/z 413.1721 (M +H)+, RT=2.25min.
409 & 410: (S)-3-(2-((1 - Chiral separation was achieved by chiral SFC column
(benzo[d]oxazol-2- chromatography (IA, 5uM, 20x250 mm column , 74 yl)ethyl)amino)pyrimidin-4- ml/min, 99 bar, eluting 25% MeOH/C02) to give (S)-3- yl)-4-isopropyloxazolidin- (2-(((R)-1 -(benzo[d]oxazol-2-yl)ethyl)amino)pyrimidin-4-
2-one yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-(((S)-1- (benzo[d]oxazol-2-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
Figure imgf000223_0001
2nd peak 420: HRMS(B) m/z 316.1535 RT=2.39 min.
421 & 422: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(3- chromatography (IA column (75 ml/min, 120 bar, 20 x (pyridin-4-yl)-1 ,2,4- 250 mm) eluting 15-25% MeOH/C02) to give (S)-4- oxadiazol-5- isopropyl-3-(2-(((R)-1-(3-(pyridin-4-yl)-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)- yl)oxazolidin-2-one 4- isopropyl-3-(2-(((S)-1-(3-(pyridin-4-yl)-1 ,2,4-oxadiazol-
5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 421 : HRMS(B) m/z 395.1706 RT=1.75 min. 2nd peak 422: HRMS(B) m/z 395.1706 RT=2.25 min.
423 & 424: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column
(2-chlorophenyl)-1 ,2,4- chromatography (IA column (75 ml/min, 120 bar, 20 x oxadiazol-5- 250 mm) eluting 15-25% MeOH/C02) to give (S)-3-(2- yl)ethyl)amino)pyrimidin-4- (((R)-1 -(3-(2-chlorophenyl)-1 ,2,4-oxadiazol-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(3-(2-chlorophenyl)-1 ,2,4- oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 423: HRMS(B) m/z 428.1364 RT=3.01 min. 2nd peak 424: HRMS(B) m/z 428.1364 RT=2.79 min.
425 & 426: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column (4-chlorophenyl)-1 ,2,4- chromatography (IA column (75 ml/min, 120 bar, 20 x oxadiazol-5- 250 mm) eluting 15-25% MeOH/C02) to give (S)-3-(2- yl)ethyl)amino)pyrimidin-4- (((R)-1 -(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(3-(4-chlorophenyl)-1 ,2,4- oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 425: HRMS(B) m/z 428.1364 RT=2.65 min. 2nd peak 426: 1 H NMR (400 MHz, MeOD) δ 8.22 (d, J =
5.8 Hz, 1.0H), 8.08 - 7.97 (m, 2.07 H), 7.63 - 7.40 (m,
3.09 H), 5.41 (q, J = 7.2 Hz, 1.04 H), 4.75 - 4.63 (m, 0.97 H), 4.33 (d, J = 6.3 Hz, 2.18 H), 1.76 (d, J = 7.2 Hz, 3.31 H), 1.07 - 0.85 (m, 0.95 H), 0.70 (d, J = 38.0 Hz, 5.81 H). HRMS(B) m/z 428.1364
427: (S)-4-isopropyl-3-(2- Chiral separation was achieved by chiral SFC column ((1-(3-(pyridin-3-yl)-1 ,2,4- chromatography (IA column (75 ml/min, 120 bar, 20 x oxadiazol-5- 250 mm) eluting 15-25% MeOH/C02) to give (S)-4- yl)ethyl)amino)pyrimidin-4- isopropyl-3-(2-(((R)-1-(3-(pyridin-3-yl)-1 ,2,4-oxadiazol-5- yl)oxazolidin-2-one yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one and (S)-
4- isopropyl-3-(2-(((S)-1-(3-(pyridin-3-yl)-1 ,2,4-oxadiazol-
5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
2nd peak 427: HRMS(B) m/z 395.1706 RT=2.24 min.
428 & 429: (S)-3-(2-((1 -(1 - Chiral separation was achieved by chiral SFC column ethyl-1 H-pyrazol-5- chromatography (AD column (75 g/min, 120 bar, 20 x yl)ethyl)amino)pyrimidin-4- 250 mm) eluting 25% I PA/0.2% DEA/C02) to give (S)- yl)-4-isopropyloxazolidin- 3-(2-(((R)-1 -(1 -ethyl-1 H-pyrazol-5- 2-one yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one and (S)-3-(2-(((S)-1 -(1 -ethyl-1 H-pyrazol-5- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one
1 st peak 428: HRMS(B) m/z 345.2005 (M+H) RT=2.28 min.
2nd peak 429: HRMS(B) m/z 345.2044 (M+H) RT=2.21 min.
Figure imgf000225_0001
1 st peak 437: HRMS(B) m/z 333.1259 RT=1.88 min.
2nd peak 438: HRMS(B) m/z 333.1259 RT=1.98 min.
439 & 440: (S)-4- Chiral separation was achieved by chiral SFC column isopropyl-3-(2-((1 -(3-(4- chromatography (Al column (70 g/min, 120 bar, 20 x methoxyphenyl)-1 ,2,4- 250 mm) eluting 20% I PA/0.2% DEA/C02) to give (S)- oxadiazol-5- 4-isopropyl-3-(2-(((R)-1 -(3-(4-methoxyphenyl)-1 ,2,4- yl)ethyl)amino)pyrimidin-4- oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2- yl)oxazolidin-2-one one and (S)-4-isopropyl-3-(2-(((S)-1-(3-(4- methoxyphenyl)-1 ,2,4-oxadiazol-5- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one
1 st peak 438: HRMS(B) m/z 425.1921 (M+H) RT=2.49 min.
2nd peak 439: HRMS(B) m/z 425.1923 (M+H) RT=2.42 min.
441 & 442: (S)-3-(2-((1 -(3- Chiral separation was achieved by chiral SFC column
(4-fluorophenyl)-1 ,2,4- chromatography (Al column (70 g/min, 120 bar, 20 x oxadiazol-5- 250 mm) eluting 25% I PA/0.2% DEA/C02) to give (S)- yl)ethyl)amino)pyrimidin-4- 3-(2-(((R)-1 -(3-(4-fluorophenyl)-1 ,2,4-oxadiazol-5- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(3-(4-fluorophenyl)-1 ,2,4- oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 441 : HRMS(B) m/z 413.1719 (M+H) RT=2.58 min.
2nd peak 442: HRMS(B) m/z 413.1719 (M+H) RT=2.52 min.
443: (S)-3-(2-(((S)-1-(5-(4- Chiral separation was achieved by chiral SFC column chlorophenyl)-1 ,2,4- chromatography (ID-H column (80 g/min, 120 bar, 20 x oxadiazol-3- 250 mm) eluting 30% MeOH/C02) to give (S)-3-(2- yl)ethyl)amino)pyrimidin-4- (((R)-1 -(5-(4-chlorophenyl)-1 ,2,4-oxadiazol-3- yl)-4-isopropyloxazolidin- yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-
2-one one and (S)-3-(2-(((S)-1 -(5-(4-chlorophenyl)-1 ,2,4- oxadiazol-3-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
2nd peak 443: 1 H NMR (400 MHz, MeOD) δ 8.25 - 8.03 (m, 6H), 7.71 - 7.55 (m, 4H), 7.44 (d, J = 5.7 Hz, 2H), 5.26 (d, J = 5.6 Hz, 2H), 4.71 (d, J = 7.9 Hz, 2H), 4.46 - 4.26 (m, 4H), 3.37 (s, 1 H), 2.66 (heptd, J = 7.0, 3.3 Hz, 2H), 1 .69 (d, J = 7.1 Hz, 6H), 1.17 (d, J = 6.2 Hz, 1 H), 1 .04 (d, J = 7.1 Hz, 6H), 0.88 (d, J = 6.9 Hz, 6H).
HRMS(B) m/z 428.1364 RT=2.77 min.
444 & 445: (S)-3-(2-(1-(5- Separation was achieved by silica gel chromatography (4-fluoro-3- (10 to 100% EtOAc / heptane) to give (S)-3-(2-((R)-1 - methylphenyl)pyridin-2- (5-(4-fluoro-3-methylphenyl)pyridin-2- yl)ethylamino)pyrimidin-4- yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- yl)-4-isopropyloxazolidin- one and (S)-3-(2-((S)-1-(5-(4-fluoro-3- 2-one methylphenyl)pyridin-2-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 444: HRMS(B) m/z 436.2126 (M + H)+,
RT=2.78min
2nd peak 445: 1 H NMR (400 MHz, CDCI3) δ 8.75 (dd, J = 2.3, 0.9 Hz, 1 H), 8.23 (d, J = 5.8 Hz, 1 H), 7.78 (dd, J = 8.1 , 2.4 Hz, 1 H), 7.49 (d, J = 5.7 Hz, 1 H), 7.41 - 7.27 (m, 3H), 7.12 (dd, J = 9.4, 8.4 Hz, 1 H), 5.95 (d, J = 6.5 Hz, 1 H), 5.16 (br s, 1 H), 4.66 (br s, 1 H), 4.34 - 4.19 (m,
Figure imgf000227_0001
Figure imgf000228_0001
Figure imgf000229_0001
Example 459
Figure imgf000229_0002
A solution of (S)-(4-(1-aminoethyl)phenyl)methanol hydrochloride (4.0301 g, 21 .47 mmol, purchased from NetChem), (S)-3-(2-fluoropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (5.3648 g, 23.82 mmol, 1 .1 1 equiv) and DIPEA (38.0 mL, 218 mmol, 10.1 equiv) in DMSO (40 mL) was heated at 1 10 °C for 135 min. The reaction mixture was diluted with EtOAc (200 mL) and washed with water (200 mL). After separation, the aqueous phase was washed with EtOAc (2 x 150 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (EtOAc/heptane 30 to 100%) provided (S)-3-(2-((S)-1 -(4-(hydroxymethyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one (6.42 g) in 84% yield.
1 H NMR (400 MHz, CD3OD) δ 8.13 (d, J = 5.8 Hz, 1 H), 7.36 - 7.28 (m, 5 H), 5.06 (q, J = 7.0 Hz, 1 H), 4.68 (br s, 1 H), 4.58 (s, 2 H), 4.37 - 4.29 (m, 2 H), 1.80 (br s, 1 H), 1 .52 (d, J = 7.1 Hz, 3 H), 0.74 (br s, 3 H), 0.61 (br s, 3 H); MS m/z 355.1 (M - H)
Example 460
Figure imgf000229_0003
S)-3-(2-((S)-1-(3-fluoro-4-(hydroxymethyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one was prepared using a method similar to that described for the preparation of Example 459. 1H NMR (400 MHz, CDCI3) δ 8.15 (d, J = 5.9 Hz, 1 H), 7.51 - 7.49 (m, 1 H), 7.37 (t, J = 7.7 Hz, 1 H), 7.1 1 (d, J = 7.8 Hz, 1 H), 7.01 (d, J = 1 1 , Hz, 1 H), 6.09 (br s, 1 H), 5.00 (br s, 1 H), 4.73 (s, 2 H), 4.61 - 4.55 (m, 1 H), 4.30 ( t, J = 8.7 Hz, 1 H), 4.25 - 4.21 (m, 1 H), 3.00 (s, 1 H), 1.89 (br s, 1 H), 1.54 (d, J = 7.1 Hz, 3 H), 0.67 (br s, 6 H); MS m/z 375.0 (M + H)
Example 461
Figure imgf000230_0001
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (50mg, 0.165mmol), 2,2,2-trifluoro-1-phenylethanamine (160mg, 0.913mmol) and pTsOH (78mg, 0.412mmol)in 2-BuOH was heated at 1 10°C for 2.5h. LCMS shows starting material as well as product. Another 78mg of pTsOH was added followed by 98mg of 2,2,2-trifluoro- 1 -phenylethanamine and heated at 1 10C for 1 .5h. Mostly product some SM.
After cooling down mixture solidified. Added acetonitrial and sonicated. Filtered off solids (pTsOH salt of 2, 2, 2-trifluoro-1 -phenylethanamine). The mother liquor was concentrated and purified by column chromatography (0-40% EtOAc/Hept followed by reverse HPLC (XBridge C18 5uM 10-85% ACN/Water over 12 minutes with 0.01 %NH4OH modifier) to give (4R)-5,5-dimethyl-4-phenyl-3-(2-(2,2,2-trifluoro-1 -phenylethylamino)pyrimidin-4- yl)oxazolidin-2-one (28mg, 0.063mmol).
1 H NMR (400 MHz, MeOD) δ 8.20 (d, J = 5.8 Hz, 1 H), 7.58 (dd, J = 1 1.4, 5.8 Hz, 1 H), 7.51 (br d, J = 6.8 Hz, 1 H), 7.40 (dtd, J = 15.9, 9.2, 4.5 Hz, 5H), 7.33 - 7.22 (m, 3H), 7.10 (br s, 1 H), 5.50 (s, 0.5H), 5.38 (s, 0.5H), 5.29 (br s, 1 H), 1.70 (s, 1.5H), 1 .64 (s, 1 .5H), 1 .04 (s, 1.5H), 1 .03 (s, 1.5H). HRMS(B) (M+H) 443.1682 Calc'd (M+H) 443.1695
Example 462 & 463
Figure imgf000230_0002
A solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (163 mg, 0.674 mmol), 2,2,2-trifluoro-1-phenylethanamine (624 mg, 3.56 mmol, 5.3 equiv) and p- toluenesulfonic acid monohydrate (321 mg, 1 .69 mmol, 2.5 equiv) in n-BuOH (3 mL) was heated at 1 10 °C for 2 h and treated with additional p-toluenesulfonic acid monohydrate (321 mg, 1 .69 mmol, 2.5 equiv), then heated at 1 10 °C for 1 ½ h. After cooling, the solid reaction mixture was treated with MeCN, sonicated and filtered. The filtrated was concentrated and purified by silica gel column chromatography (EtOAc/Heptane 0 to 30%) to give (4S)-4-isopropyl-3-(2-(2,2,2-trifluoro-1 -phenylethylamino)pyrimidin-4- yl)oxazolidin-2-one (65 mg) in 25% yield. HRMS(B) m/z 381.1545 (M + H)+. Anal. RP- HPLC tR = 4.31//4.46 min (1 .0 mL/min flow rate with gradient from 5% to 15% acetonitrile with 0.05% formic acid in 5.00 min and then 15% to 95% acetonitrile with 0.05% formic acid from 5.00 min to 9.50 min, aqueous phase modified with 0.1 % formic acid. Silica gel column chromatography separated the two diastereomers (S)-4-isopropyl- 3-(2-((R)-2,2,2-trifluoro-1-phenylethylamino)pyrimidin-4-yl)oxazolidin-2-one and (S)-4- isopropyl-3-(2-((S)-2,2,2-trifluoro-1 -phenylethylamino)pyrimidin-4-yl)oxazolidin-2-one. 1 st Peak : 1H NMR (400 MHz, MeOD) δ 8.23 (d, J = 5.8 Hz, 1 H), 7.62 - 7.53 (m, 2H), 7.50 (d, J = 5.8 Hz, 1 H), 7.42 (qt, J = 5.0, 2.2 Hz, 3H), 5.93 - 5.86 (m, 1 H), 4.80 (dt, J = 7.5, 3.9 Hz, 1 H), 4.48 - 4.33 (m, 2H), 2.65 (ddp, J = 10.4, 7.0, 3.4 Hz, 1 H), 1.05 (d, J = 7.0 Hz, 3H), 0.89 (d, J = 7.0 Hz, 3H).
2nd Peak: 1H NMR (400 MHz, MeOD) δ 8.23 (d, J = 5.8 Hz, 1 H), 7.55 (dd, J = 7.3, 2.1 Hz, 2H), 7.49 (d, J = 5.8 Hz, 1 H), 7.45 - 7.32 (m, 3H), 5.92 - 5.86 (m, 1 H), 4.86 - 4.82 (m, 1 H), 4.44 - 4.38 (m, 2H), 2.26 (br s, 1 H), 0.94 (d, J = 7.0 Hz, 3H), 0.74 (br s, 3H).
Example 464
Figure imgf000231_0001
A solution of (S)-3-(2-fluoropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (1055 mg, 4.68 mmol), 1-(5-(4-fluoro-3-methylphenyl)pyrimidin-2-yl)ethanamine (1300 mg, 5.62 mmol, 1 .2 equiv) and diisopropylethylamine (908mg, 7.03mmol, 1.5 equiv) in DMSO (20 mL) was heated at 1 10 °C for 1 h. The reaction mixture was poured into water (60 mL) and extracted with EtOAc (2x50 mL). Combined organics were washed with water (40mL), brine (40mL), dried over Na2S04, filtered and concentrated directly onto silica gel. Silica gel chromatography provided the mixed distereomers of (S)-3-(2-(1 -(5-(4-fluoro-3- methylphenyl)pyrimidin-2-yl)ethylamino) pyrimidin-4-yl)-4-isopropyloxazolidin-2-one (560mg). Chiral separation was carried out with SFC (ID, 5μηι, 20 x 250 mm) using 35% MeOH in C02 to give (S)-3-(2-((S)-1-(5-(4-fluoro-3-methylphenyl)pyrimidin-2- yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one and (S)-3-(2-((R)-1 -(5-(4-fluoro- 3-methylphenyl)pyrimidin-2-yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one.
Example 464 first eluted product (302 mg) 1H NMR (400 MHz, CDCI3) δ 8.87 (s, 2H), 8.23 (d, J = 5.8 Hz, 1 H), 7.49 (d, J = 5.7 Hz, 1 H), 7.43 - 7.30 (m, 2H), 7.21 - 7.1 1 (m, 1 H), 6.26 (br s, 1 H), 5.31 (br s, 1 H), 4.75 (dt, J = 7.9, 3.3 Hz, 1 H), 4.39 - 4.24 (m, 2H), 2.38 (s, 3H), 2.09 (br s, 1 H), 1 .66-1.62 (m, 3H), 0.90 (dd, J = 9.8, 6.0 Hz, 3H), 0.78 (br s, 3H). HRMS(B) m/z 437.2093 (M + H)+.
Example 465
Figure imgf000232_0001
A solution of (S)-4-isopropyl-3-(2-((S)-1 -(piperidin-4-yl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one (225mg, 0.675mmol), 4-fluorobenzene-1-sulfonyl chloride (146mg, 0.750mmol) and DIPEA (1 ml) in CH2CI2 was stirred at room temperature for 2h.
The reaction mixture was diluted with CH2CI2 and washed with water. Aqueous layer was extracted with CH2CI2- Combined organics were washed with brine, dried over
Na2S04, filtered and concentrated. The residue was purified by column chromatography to give (S)-3-(2-((S)-1-(1 -(4-fluorophenylsulfonyl)piperidin-4-yl)ethylamino)pyrimidin-4-yl)- 4-isopropyloxazolidin-2-one (4.5mg, 0.009mmol).
1 H NMR (400 MHz, MeOD) δ 8.45 (d, J = 6.0 Hz, 1 H), 8.23 - 8.15 (m, 2H), 7.73 - 7.63 (m, 3H), 5.13 (dt, J = 7.4, 3.7 Hz, 1 H), 4.78 - 4.69 (m, 2H), 4.26 (p, J = 6.7 Hz, 1 H), 4.17 (dddd, J = 1 1.8, 6.4, 4.7, 2.3 Hz, 2H), 2.89 (ddq, J = 10.7, 7.1 , 3.5 Hz, 1 H), 2.69 (tdd, J = 1 1.6, 8.9, 2.6 Hz, 2H), 2.27 - 2.1 1 (m, 2H), 1.82 (dddt, J = 1 1 .9, 9.0, 5.8, 2.9 Hz, 1 H), 1 .77 - 1 .64 (m, 2H), 1 .52 (d, J = 6.8 Hz, 3H), 1.30 (d, J = 7.1 Hz, 3H), 1 .21 (d, J = 6.9 Hz, 3H). HRMS(B) (M+H) 492.2069 Calc'd (M+H) 492.2081
The following examples were prepared using methods substantially similar to those described for Example 465: Example 466
Figure imgf000233_0001
Purified by column chromatography (20% to 100% EtOAc/Hept), followed by reverse phase preparative chromatography (C18 column, 10-85% ACN/Water 0.1% NH40H modifier over 12 min.) to give (S)-3-(2-((S)-1-(1-(4-fluorobenzoyl)piperidin-4- yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one (12mg, 0.026mmol).
1H NMR (400 MHz, MeOD) δ 8.12 (d, J = 5.8 Hz, 1H), 7.51 - 7.41 (m, 2H), 7.36 (d, J = 5.8 Hz, 1H), 7.25-7.15 (m, 2H), 4.82 (td, J = 5.9, 3.6 Hz, 1H), 4.68 (br s, 1H), 4.41 (d, J = 5.7 Hz, 2H), 3.98 (p, J = 6.7 Hz, 1H), 3.78 (br s, 1H), 3.12 (br s, 1H), 2.82 (br s, 1H), 2.60 (pd, J = 7.1, 6.5, 3.7 Hz, 1H), 1.92 (br s, 1H), 1.80 (dtd, J = 15.3, 9.4, 7.0, 3.6 Hz, 2H), 1.31 (br s, 2H), 1.22 (d, J = 6.8 Hz, 3H), 0.99 (d, J = 7.1 Hz, 3H), 0.88 (d, J = 6.9 Hz, 3H). HRMS(B) (M+H) 456.2384 Calc'd (M+H) 456.2411
Example 467
Figure imgf000233_0002
Purified by column chromatography (MeOH/CH2Cl20 to 20%) to give (S)-4-isopropyl-3- (2-((S)-1-(1-(tetrahydro-2H-pyran-4-carbonyl)piperidin-4-yl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one (15mg, 0.034mmol).
1H NMR (400 MHz, MeOD) δ 8.12 (d, J = 5.8 Hz, 1H), 7.36 (d, J = 5.8 Hz, 1H), 4.81 (td, J = 5.6, 3.3 Hz, 1H), 4.59 (br s, 1H), 4.41 (d, J = 5.7 Hz, 2H), 4.13 (br s, 1H), 3.96 (ddd, J = 11.6, 4.3, 2.2 Hz, 3H), 3.51 (tq, J = 11.8, 2.8 Hz, 2H), 3.15 - 2.89 (m, 2H), 2.69 - 2.48 (m, 2H), 1.99 - 1.68 (m, 5H), 1.61 (ddt, J = 10.7, 4.0, 2.3 Hz, 2H), 1.35 - 1.23 (m, 1H), 1.21 (d, J = 6.7 Hz, 3H), 1.19- 1.09 (m, 1H), 0.98 (dd, J = 7.0, 1.5 Hz, 3H), 0.88 (d, J = 7.0 Hz, 3H). HRMS(B) (M+H) 446.2748 Calc'd (M+H) 446.2767 Example 468
Figure imgf000234_0001
Purified by column chromatography (50% to 100% EtOAc/Heptane follwed by 0% to 20% MeOH/CH2Cl2) to give (S)-4-isopropyl-3-(2-((S)-1-(1-(morpholine-4-carbonyl)piperidin-4- yl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one (21 mg, 0.047mmol).
1H NMR (400 MHz, MeOD) 58.11 (d, J = 5.8 Hz, 1H), 7.36 (d, J = 5.8 Hz, 1H), 4.81 (td, J = 5.8, 3.4 Hz, 1H), 4.41 (d, J = 5.7 Hz, 2H), 3.95 (p, J = 6.8 Hz, 1H), 3.84 - 3.70 (m, 2H), 3.68 - 3.65 (m, 4H), 3.26 - 3.23 (m, 4H), 2.80 (tt, J = 12.9, 3.1 Hz, 2H), 2.60 (ddq, J = 10.4, 7.0, 3.5 Hz, 1H), 1.88 - 1.73 (m, 2H), 1.67 (ddt, J = 18.5, 10.4, 3.5 Hz, 1H), 1.37 - 1.23 (m, 2H), 1.21 (d, J = 6.8 Hz, 3H), 0.99 (d, J = 7.1 Hz, 3H), 0.88 (d, J = 7.0 Hz, 3H). HRMS(B) (M+H) 447.2690 Calc'd (M+H) 447.2720
Example 469
Figure imgf000234_0002
Purified by column chromatography to give (S)-3-(2-((S)-1-(1-(cyclohexanecarbonyl) piperidin-4-yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one
1H NMR (400 MHz, MeOD) δ 8.12 (d, J = 5.7 Hz, 1H), 7.36 (d, J = 5.6 Hz, 1H), 4.80 (dt, J = 5.8, 2.9 Hz, 1H), 4.59 (br s, 1H), 4.40 (d, J = 5.6 Hz, 2H), 4.18-4.03 (m, 1H), 3.95 (p, J = 6.8 Hz, 1H), 3.05 (ddd, J = 14.1, 10.1, 6.6 Hz, 1H), 2.58 (td, J = 25.1, 23.5, 13.0 Hz, 3H), 1.97 - 1.63 (m, 8H), 1.54 - 1.08 (m, 7H), 1.21 (d, J = 6.8 Hz, 3H), 0.98 (d, J = 6.8 Hz, 3H), 0.88 (d, J = 6.9 Hz, 3H). HRMS(B) (M+H) 444.2953 Calc'd (M+H) 444.2975 Examples 470
Figure imgf000235_0001
A solution of (S)-3-(2-(((S)-1 -(4-aminophenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one (100 mg, 0.30 mmol), benzenesulfonyl chloride (65 mg, 0.36 mmol, 1 .2 equiv) and pyridine (35 mg, 0.45 mmol, 1.5 equiv) in DCM (5 ml.) was stirred at room temperature for 15 h. The reaction mixture was quenched with MeOH, the solvent was removed to yield the crude product, which was purified by silica gel column chromatography (EA:MeOH=1 :0 to 9:1 ), the solvent was removed to afford the pure product (46.8mg, white solid ) in a 31.5% yield. N-(4-((S)-1-((4-((S)-4-isopropyl-2- oxooxazolidin-3-yl)pyrimidin-2-yl)amino)ethyl)phenyl)benzenesulfonamide. 1H NMR (400 MHz, CDCI3) δ 8.18 - 7.90 (m, 2H), 7.74 (d, J = 7.8 Hz, 2H), 7.45 (t, J = 7.4 Hz, 1 H), 7.39 - 7.35 (m, 2H), 7.10 (d, J = 8.1 Hz, 2H), 6.96 (d, J = 8.0 Hz, 2H), 6.41 (s, 1 H), 4.99 - 4.79 (m, 1 H), 4.62 - 4.39 (m, 1 H), 4.28 - 3.99 (m, 2H), 1 .91 - 1 .65 (b, 1 H), 1.40 (d, J = 7.0 Hz, 3H), 0.53 (b, J = 21 .1 Hz, 6H). HRMS(B) m/z 482.1847 (M + H)+. RT=2.60 min.
Examples 471
Figure imgf000235_0002
A solution of (triethoxymethyl)benzene (360 mg, 1 .6 mmol, 5.0 equiv. in 5 ml. of benzene and 0.5 ml. of glacial AcOH) was added to (S)-2-((4-((S)-4-isopropyl-2- oxooxazolidin-3-yl)pyrimidin-2-yl)amino)propanehydrazide (99 mg, 0.30 mmol, 1 .0 equiv.), the reaction mixture was stirred at reflux for 1 .5 hours, the solvent was removed to yield the crude product. Silica gel column chromatography (ethyl acetate in heptane 10 to 90%) to yield (S)-4-isopropyl-3-(2-(((S)-1 -(5-phenyl-1 ,3,4-oxadiazol-2- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one (21 .2 mg, white solid) in 15.9% yield. HRMS(B) m/z 395.1820, (M+H )+, RT=2.42 min Examples 472
Figure imgf000236_0001
To a solution of (S)-4-isopropyl-3-(2-(((S)-1 -(5-(methylthio)-1 ,3,4-oxadiazol-2-yl)ethyl) amino)pyrimidin-4-yl)oxazolidin-2-one (102 mg, 0.28 mmol in 1.5 ml of CH3COOH ), was added a solution of KMn04 (66.4 mg, 0.42 mmol, 1.5 eq in 2.5 ml of water) dropwise. The solution was stirred at room temperature for 25 min, the mixture was decolorized with sodium bisulfite, the resulting solution was extracted with DCM, washed with sat. NaHC03, dried over Na2S04, the solvent was removed to yield the pure desired product as a white solid. (S)-4-isopropyl-3-(2-(((S)-1-(5-(methylsulfonyl)-1 ,3,4-oxadiazol-2- yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one (83 mg, white solid) in 71 % yield. HRMS(B) m/z 397.1281 (M + H)+. RT=1.80 min.
Example 473 & 474
Figure imgf000236_0002
1 -(1 H-Pyrrolo[2,3-b]pyridin-5-yl)-ethanone (75 mg, 0.468 mmol), ammonium acetate (722 mg, 9.36 mmol, 20.0 eq) and sodium cyanoborodeuteride (131 mg, 1 .999 mmol, 4.25 eq) were combined in propan-2-ol (5 ml) and heated under infrared irradiation at 130°C for 4 min. The reaction was diluted with EtOAc (15 ml) and water (15 ml) and treated with 6M NaOH solution (1 ml) to -10 pH. The product, 1 -deutero-1-(1 H-pyrrolo[2,3-b]pyridin-5- yl)ethanamine, was carried to the next step without further purification.
A solution of 3-(2-fluoropyrimidin-4-yl)oxazolidin-2-one (99 mg, 0.441 mmol), 1 -deutero- 1 -(1 H-pyrrolo[2,3-b]pyridin-5-yl)ethanamine ( 72 mg, 0.441 mmol, 1.0 equiv), and DIEA (0.154 mL, 0.882 mmol, 2.0 equiv) in DMSO (1 mL) was heated at 130 °C for 120 min. The reaction mixture was diluted with EtOAc (20 mL) and washed with water (10 mL) and concentrated in vacuo. Resolution of (4S)-3-(2-((1-deutero-1-(1 H-pyrrolo[2,3- b]pyridin-5-yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one via chiral SFC chromatography on a Al column (75 g/min, 120 bar, 20 x 250 mm) eluting 40-50% MeOH/0.2% DEA/C02 (v/v) to give (4S)-3-(2-(((R)-1 -deutero-1 -(1 H-pyrrolo[2,3-b]pyridin- 5-yl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one and (4S)-3-(2-(((S)-1- deutero-1-(1 H-pyrrolo[2,3-b]pyridin-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
1 st peak 473
1H NMR (400 MHz, CDCI3) δ 10.10 (s, 1 H), 8.33 (d, J = 2.2 Hz, 1 H), 8.21 (d, J = 5.7 Hz, 1 H), 7.92 (d, J = 2.3 Hz, 1 H), 7.46 (d, J = 5.7 Hz, 1 H), 7.35 (dd, J = 3.5, 2.0 Hz, 1 H), 6.47 (dd, J = 3.4, 1.7 Hz, 1 H), 5.82 (s, 1 H), 1 .66 - 1.58 (m, 3H), 4.59 (dt, J = 7.7, 3.2 Hz, 1 H), 4.28 (t, J = 8.8 Hz, 1 H), 4.19 (dd, J = 9.2, 3.1 Hz, 1 H), 3.51 (s, 1 H), 1 .78 (d, J = 28.5 Hz, 2H), 1.30 - 1.15 (m, 1 H), 0.57 (s, 6H). LCMS m/z 368.1 (M+H) RT=2.36 min.
2nd peak 474
LCMS m/z 368.1 (M+H) RT=2.66 min.
Example 475
Figure imgf000237_0001
A solution of 3-(2-fluoropyrimidin-4-yl)oxazolidin-2-one (100 mg, 0.444 mmol), (3-(p- tolyl)-1 ,2,4-oxadiazol-5-yl)methanamine ( 84 mg, 0.444 mmol, 1 .0 equiv), and TEA (0.186 mL, 1.332 mmol, 3.0 equiv) in butan-1-ol (2 mL) was heated at 100 °C for 90 min. Addition of propan-1 -ol (1 ml) and heated at 150 °C for 60 min. The reaction mixture was concentrated in vacuo. Flash column (silica, 24 g) eluting w/ 0 - 30% EtOAc/DCM afforded (S)-4-lsopropyl-3-{2-[(3-p-tolyl-[1 ,2,4]oxadiazol-5-ylmethyl)-amino]- pyrimidin-4-yl}-oxazolidin-2-one (95 mg, white foam) in 54.2% yield. HRMS(B) m/z 394.1753 2.38 Min. Example 476
Figure imgf000238_0001
To a solution of 4-{(S)-1-[4-((S)-4-lsopropyl-2-oxo-oxazolidin-3-yl)-pyrimidin-2-ylamino]- ethyl}-piperidine-1-carboxylic acid benzyl ester (22 mg) in methanol (5 ml.) was added palladium hydroxide on carbon (7 mg, 0.05 mmol). The reaction was then stirred at room temperature for 16 hours. The reaction is then filtered and then concentrated under vacuum. The crude material was then purified using reverse phase C18 ODB column water-acetonitrile 0.1 % TFA modifier to give (S)-4-isopropyl-3-[2-((S)-1-piperidin-4-yl- ethylamino)-pyrimidin-4-yl]-oxazolidin-2-one (1 1 mg) in 70% yield.
HRMS(B) m/z 333.2165 (M + H)+; RT.: 1.09 min.
Example 477
Figure imgf000238_0002
A solution of (S)-4-lsopropyl-3-[2-((S)-1-piperidin-4-yl-ethylamino)-pyrimidin-4-yl]- oxazolidin-2-one (28 mg, 0.084 mmol) in THF (2 ml.) was added cyclobutanone (14 mg, 0.20 mmol) and sodium triacetoxyborohydride (28 mg, 0.13 mmol). The reaction was stirred at room temperature for 18 hours. The solvent is then removed under vacuum. The crude material was then purified using reverse phase C18 ODB column water- acetonitrile 0.1 % TFA modifier to give (S)-3-{2-[(S)-1 -(1 -Cyclobutyl-piperidin-4-yl)- ethylamino]-pyrimidin-4-yl}-4-isopropyl-oxazolidin-2-one (20 mg) in 62% yield.
HRMS(B) m/z 388.2717 (M + H)+; RT.: 2.32 min.
Example 478
Figure imgf000238_0003
A solution of (S)-4-lsopropyl-3-[2-((S)-1-piperidin-4-yl-ethylamino)-pyrimidin-4-yl]- oxazolidin-2-one (20 mg, 0.060 mmol) in THF (2 mL) was added cyclobutanone (10 mg, 0.17 mmol) and sodium triacetoxyborohydride (20 mg, 0.09 mmol). The reaction was stirred at room temperature for 18 hours. The solvent is then removed under vacuum. The crude material was then purified using reverse phase C18 ODB column water- acetonitrile 0.1 % TFA modifier to give (S)-4-lsopropyl-3-{2-[(S)-1 -(1 -isopropyl-piperidin-4- yl)-ethylamino]-pyrimidin-4-yl}-oxazolidin-2-one (20 mg) in 62% yield.
HRMS(B) m/z 376.2705 (M + H)+; RT.: 1.24 min. Example 479
Figure imgf000239_0001
To a solution of S)-4-lsopropyl-3-[2-((S)-1-piperidin-4-yl-ethylamino)-pyrimidin-4-yl]- oxazolidin-2-one (20 mg, 0.48 mmol) in dichloromethane (1 mL) and DMF (1 mL) was added HATU (23 mg, 0.06 mmol) and DIPEA (0.03 mL, 0.18 mmol) The reaction was stirred at room temperature for 18 hours. The solvent is then removed under vacuum. The crude material was then purified using reverse phase C18 ODB column water- acetonitrile 0.1 % TFA modifier to give (S)-4-lsopropyl-3-(2-{(S)-1 -[1-(pyridine-4- carbonyl)-piperidin-4-yl]-ethylamino}-pyrimidin-4-yl)-oxazolidin-2-one (2 mg) in 8% yield. HRMS(B) m/z 438.2379 (M + H)+; RT.: 1.82 min.
Example 480
Figure imgf000239_0002
To a solution of S)-4-lsopropyl-3-[2-((S)-1-piperidin-4-yl-ethylamino)-pyrimidin-4-yl]- oxazolidin-2-one (16 mg, 0.48 mmol) in dichloromethane (1 mL) and DMF (1 mL) was added HATU (20 mg, 0.05 mmol) and DiPEA (0.03 mL, 0.15 mmol) The reaction was stirred at room temperature for 18 hours. The solvent is then removed under vacuum. The crude material was then purified using reverse phase C18 ODB column water- acetonitrile 0.1 % TFA modifier to give (S)-4-lsopropyl-3-(2-{(S)-1 -[1-(pyridine-4- carbonyl)-piperidin-4-yl]-ethylamino}-pyrimidin-3-yl)-oxazolidin-2-one (2 mg) in 8% yield. HRMS(B) m/z 438.2379 (M + H)+; RT.: 1.83 min.
Example 481 & 482
Figure imgf000240_0001
To a solution of (S)-4-lsopropyl-3-[2-((S)-1 -methyl-prop-2-ynylamino)-pyrimidin-4-yl]- oxazolidin-2-one (60 mg, 0.22 mmol) and benzyl azide (30 mg, 0.23 mmol) in water (0.5 ml.) and DMSO (3 ml.) was added copper sulfate pentahydrate (56 mg, 0.23 mmol) and L-ascorbic acid sodium salt (45 mg, 0.23 mmol). The reaction was stirred for 48 hours at room temperature. The reaction mixture was diluted with EtOAc (75 ml.) and washed with water (15 ml.) and 1 N solution sodium bicarbonate (15 ml.) . The organic layer was dried over MgS04, filtered and concentrated. The crude material was then purified on reverse phase using a C18 columnn water-acetonitrile TFA as a modifier, which also effected separation of the two diastereomer products (S)-3-{2-[(S)-1 -(1 -benzyl-1 H- [1 ,2,3]triazol-4-yl)-ethylamino]-pyrimidin-4-yl}-4-isopropyl-oxazolidin-2-one and (S)-3-{2- [(R)-1-(1-benzyl-1 H-[1 ,2,3]triazol-4-yl)-ethylamino]-pyrimidin-4-yl}-4-isopropyl-oxazolidin- 2-one
First Peak 481 : HRMS(B) m/z 407.2070 (M + H)+; RT.: 2.26 min.
Second Peak 482: HRMS(B) m/z 407.2070 (M + H)+; RT.: 2.32 min.
Example 483 & 484
Figure imgf000240_0002
To a solution of (S)-4-lsopropyl-3-[2-((S)-1 -methyl-prop-2-ynylamino)-pyrimidin-4-yl]- oxazolidin-2-one (82 mg, 0.30 mmol) and azidobenzene (36 mg, 0.30 mmol) in water (0.5 ml.) and DMSO (3 ml.) was added copper sulfate pentahydrate (75 mg, 0.23 mmol) and L-ascorbic acid sodium salt (60 mg, 0.23 mmol). The reaction was stirred for 48 hours at room temperature. The reaction mixture was diluted with EtOAc (75 mL) and washed with water (15 mL) and 1 N solution sodium bicarbonate (15 mL) . The organic layer was dried over MgS04, filtered and concentrated. The crude material was then purified on reverse phase using a C18 columnn water-acetonitrile TFA as a modifier , which also effected separation of the two diastereomer products (S)-4-isopropyl-3-{2- [(S)-1 -(1 -phenyl-1 H-[1 ,2,3]triazol-4-yl)-ethylamino]-pyrimidin-4-yl}-oxazolidin-2-one and (S)-4-isopropyl-3-{2-[(R)-1 -(1-phenyl-1 H-[1 ,2,3]triazol-4-yl)-ethylamino]-pyrimidin-4-yl}- oxazolidin-2-one
First Peak 483: HRMS(B) m/z 393.1913 (M + H)+; RT.: 2.31 min.
Second Peak 484: HRMS(B) m/z 393.1913 (M + H)+; RT.: 2.40 min.
Example 485
Figure imgf000241_0001
To a room temperature solution of 3-(2-chloro-5-fluoropyrimidin-4-yl)-5,5- dimethyloxazolidin-2-one (30 mg, 0.122 mmol) in DMSO (300 μί) was treated with DIPEA (68 μΙ_, 0.366 mmol) followed by addition of (S)-1 -(2-fluoro-4- (trifluoromethyl)phenyl)ethanamine (41.4 mg, 0.2 mmol). The reaction was sealed, heated at 95°C for -18 hr. . Purification by reverse phase HPLC provided the trifluoroacetate salt of (S)-3-(5-fluoro-2-(1-(2-fluoro-4-(trifluoromethyl) phenyl) ethylamino)pyrimidin-4-yl)-5,5-dimethyloxazolidin-2-one. (6.0 mg, white solid). 1H NMR (400 MHz, METHANOL-^) δ ppm 1 .44 - 1.58 (m, 12 H) 3.50 - 3.74 (m, 1 H) 3.88 (d, J=9.8 Hz 1 H) 5.29 (d, J=7.04 Hz, 1 H) 7.38 - 7.45 (m, 2 H) 7.6 (t, J=8.22 Hz 1 H) 8.16 (d, J=3.13 Hz, 1 H); HRMS(A) m/z 417.1360 (M + H)+, Rt 2.29 min.
The compounds in Table 1 1 were prepared using methods similar to those described for the preparation of Example 485. Table 11.
Figure imgf000242_0001
Figure imgf000243_0001
Table 12. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 1 1 .
Example: Name 1H NMR (400 MHz) ppm LCMS
486: 3-(5-fluoro-2-((S)-1- (CD3OD) 1 .41 - 1 .58 (m, 8 H) 3.55 (br. s., 1 HRMS(A) (2-fluoro-4- H) 3.74 - 3.80 (m, 1 H) 4.17 (dd, J=9.59, m/z
(trifluoromethyl)phenyl)eth 7.63 Hz, 1 H) 5.26 - 5.33 (m, 1 H) 7.39 - 403.1 198 ylamino)pyrimidin-4-yl)-5- 7.45 (m, 2 H) 7.60 (t, J=7.83 Hz, 1 H) 8.15 (M + H)+, methyloxazolidin-2-one (d, J=3.52 Hz, 1 H) Rt 2.20
min
487: (S)-6-(5-fluoro-2-(1 - (CD3OD) 0.90 (m, 2 H) 1.18 - 1.27 (m, 2 H) HRMS(A) (2-fluoro-4- 1 .53 (d, J=7.04 Hz, 3 H) 4.21 (d, J=9.39 m/z
(trifluoromethyl)phenyl)eth Hz, 1 H) 5.30 (d, J=7.04 Hz, 1 H) 7.38 - 415.1204 ylamino)pyrimidin-4-yl)-4- 7.45 (m, 2 H) 7.60 (t, J=7.83 Hz 1 H) 8.17 (M + H)+, oxa-6- (d, J=3.52 Hz, 1 H) Rt 2.31 azaspiro[2.4]heptan-5-one min
488: (S)-3-(2-(1-(5-chloro- (CD3OD) 8.22 (d, J=3.13 Hz, 1 H) 8.08 (d, HRMS(A) 6-(2,2,2- J=1.96 Hz, 1 H) 7.84 (d, J=1 .96 Hz, 1 H) m/z trifluoroethoxy)pyridin-3- 5.26 - 5.27 (m, 1 H) 4.90 (q, 464.1 125 yl)ethylamino)-5- J=8.61 Hz, 3 H) 4.13 - 4.22 (m, 2 H) 1 .47 - (M + H)+, fluoropyrimidin-4-yl)-4,4- 1 .59 (m, 9 H) Rt 2.28 dimethyloxazolidin-2-one min
489: (S)-3-(2-(1-(5-chloro- (CD3OD) 8.51 (d, J=1 .57 Hz, 1 H) 8.23 (d, HRMS(A) 6-(1 , 1- J=2.35 Hz, 1 H) 7.93 (d, J=1.56 Hz, 1 H) m/z difluoroethyl)pyridin-3- 4.99 (q, J=6.52 Hz, 1 H) 2.02 (t, 458.1573 yl)ethylamino)-5- J=18.78 Hz, 3 H) 1.57 (d, J=7.43 Hz, 3 H) (M + H)+, f I u oropy ri m id i n-4-y I )- 1 .34 - 1 .42 (m, 12 H) Rt 2.02 4,4,5,5- min tetramethyloxazolidin-2- one
490: (S)-3-(2-(1-(5-chloro- (CD3OD) 8.50 (d, J=1 .17 Hz, 1 H) 8.24 (d, HRMS(A) 6-(1 , 1- J=2.35 Hz, 1 H) 7.93 (d, J=1.57 Hz, 1 H) m/z difluoroethyl)pyridin-3- 4.99 (q, J=6.65 Hz, 1 H) 4.12 - 430.1265 yl)ethylamino)-5- 4.21 (m, 2 H) 2.01 (t, J=18.78 Hz, 3 H) (M + H)+, fluoropyrimidin-4-yl)-4,4- 1 .57 (d, J=7.04 Hz, 3 H) 1 .47 (s, 6 H) Rt 2.05 dimethyloxazolidin-2-one min
491 : (S)-3-(2-(1 -(3-(4- (CD3OD) 8.27 (br. s., 1 H) 8.00 (d, J=8.61 HRMS(A) chlorophenyl)-1 ,2,4- Hz, 3 H) 7.52 (d, J=8.61 Hz, 4 H) 5.29 (d, m/z oxadiazol-5- J=7.04 Hz, 1 H) 1 .73 (s, 3 H) 1 .44 (s, 3 H) 461.1512 yl)ethylamino)-5- 1 .38 (s, 3 H) 1.28 (s, 3 H) (M + H)+, f I u oropy ri m id i n-4-y I )- Rt 2.37
4,4,5,5- min tetramethyloxazolidin-2- one
492: 3-(2-((S)-1 -(3-(4- (CD3OD) 8.27 (d, J=1 .57 Hz, 1 H) 8.00 (d, HRMS(A) chlorophenyl)-1 ,2,4- J=8.61 Hz, 2 H) 7.52 (d, J=8.61 Hz, 2 H) m/z oxadiazol-5- 5.29 (m, 1 H) 4.44(m, 1 H) 1 .73 (d, J=7.43 477.1349 yl)ethylamino)-5- Hz, 3 H) 1.44 (br. s., 3 H) 1.26 - 1.35 (m, 6 (M + H)+, fluoropyrimidin-4-yl)-4,4,5- H) Rt 2.3 min trimethyloxazolidin-2-one
(1 :1 mixture of
diastereomers)
493: (S)-3-(2-(1 -(3-(4- (CD3OD) 8.28 (d, J=2.35 Hz, 1 H) 8.00 (d, HRMS(A) chlorophenyl)-1 ,2,4- J=8.61 Hz, 2 H) 7.51 (d, J=8.61 Hz, 2 H) m/z oxadiazol-5- 5.29 (m, 1 H) 4.1 1 -4.24 (m, 2 H) 1 .73 (d, 433.1201 yl)ethylamino)-5- J=7.04 Hz, 3 H) 1 .53 (s, 3 H) 1 .30 (br.s., 3 (M + H)+, fluoropyrimidin-4-yl)-4,4- H) Rt 2.21 dimethyloxazolidin-2-one min
494: (4S)-4-isopropyl-5- (CD3OD) 8.1 1 (d, J=6.26 Hz, 1 H) 7.71 (d, HRMS(A) methyl-3-(2-((S)-1- J=7.43 Hz, 1 H) 7.29 - 7.40 (m, 4 H) 7.22 - m/z phenylethylamino)pyrimidi 7.28 (m, 1 H) 5.23 (br. s., 1 H) 341.1985 n-4-yl)oxazolidin-2-one 4.82 - 4.91 (m, 1 H) 4.78 (br. s., 1 H) 2.01 (M + H)+,
(1 :1 mixture of (br. s., 1 H) 1 .59 (d, J=7.04 Hz, 3 H) 1 .54 Rt 1 .78 diastereomers) (d, J=6.65 Hz, 3 H) 0.76 (br. s., 6 H) min
495: (4S)-3-(5-fluoro-2- (CD3OD) 7.87 (d, J=3.13 Hz, 1 H) 6.95 - HRMS(A) ((S)-1- 7.02 (m, 2 H) 6.91 (t, J=7.63 Hz, 2 H) 6.75 m/z phenylethylamino)pyrimidi - 6.85 (m, 1 H) 4.52 - 4.61 (m, 2H) 4.00 (br. 359.1891 n-4-yl)-4-isopropyl-5- s., 1 H) 1.49 (br. s., 1 H) 1 .1 1 (dd, J=9.59, (M + H)+, methyloxazolidin-2-one 6.85 Hz, 6 H) 0.38 (d, J=4.30 Hz, 6 H) Rt 2.19 (1 :1 mixture of min diastereomers)
496: (S)-4,4,5,5- (CD3OD) 8.08 (d, J=6.26 Hz, 1 H) 7.28 - HRMS(A) tetramethyl-3-(2-(1 - 7.40 (m, 5 H) 7.18 - 7.25 (m, 1 H) 5.05 (q, m/z phenylethylamino)pyrimidi J=7.04 Hz, 1 H) 1 .55 - 1 .62 (m, 6H) 1.37 341.1984 n-4-yl)oxazolidin-2-one (s, 3 H) 1 .32 (s, 3 H) (M + H)+,
Rt 1 .73 min
497: (S)-3-(5-fluoro-2-(1 - (CD3OD) 8.18 (d, J=2.74 Hz, 1 H) 7.30 - HRMS(A) phenylethylamino)pyrimidi 7.39 (m, 2 H) 7.23 - 7.30 (m, 2 H) 7.12 - m/z n-4-yl)-4,4,5,5- 7.21 (m, 1 H) 4.90 (q, J=6.91 Hz, 1 H) 1.50 359.1891 tetramethyloxazolidin-2- (d, J=7.04 Hz, 3 H) 1.42 (s, 3 H) 1.36 (s, 3 (M + H)+, one H) 1 .33 (s, 3 H) Rt 2.16 min
498: 4,4,5-trimethyl-3-(2- (CD3OD) 8.09 (d, J=6.65 Hz, 1 H) 7.53 (d, HRMS(A) ((S)-1- J=7.04 Hz, 1 H) 7.45 (d, J=7.04 Hz, 1 H) m/z phenylethylamino)pyrimidi 7.30 - 7.40 (m, 8 H) 7.20 - 7.28(m, 2 H) 327.1826 n-4-yl)oxazolidin-2-one 5.09 (t, J=7.04 Hz, 2 H) 4.27 - 4.42 (m, 2 (M + H)+, (1 :1 mixture of H) 1 .52 - 1 .69 (m, 12 H) 1.32 (dd, J=1 1 .15, Rt 1 .66 diastereomers) 6.46 Hz, 6 H) 0.82 - 1.20 (m, 6 H) min
499: 3-(5-fluoro-2-((S)-1- (CD3OD) 8.18 (d, J=2.74 Hz, 1 H) 7.30 - HRMS(A) phenylethylamino)pyrimidi 7.37 (m, 2 H) 7.24 - 7.30 (m, 2 H) 7.1 1 - m/z n-4-yl)-4,4,5- 7.21 (m, 1 H) 4.87 - 4.97 (m, 1 H) 4.31 - 345.1735 trimethyloxazolidin-2-one 4.46 (m, 1 H) 1 .50 (d, J=7.04 Hz, 3 H) 1.41 (M + H)+,
(1 :1 mixture of (d, J=10.96 Hz, 3 H) 1.29 (dd, J=6.46, 3.33 Rt 2.09 diastereomers) Hz, 3 H) 0.84 - 1.16 (br. s, 3 H) min
500: (S)-3-(5-fluoro-2-(1 - (CD3OD) 8.19 (d, J=2.35 Hz, 1 H) 7.30 - HRMS(A) phenylethylamino)pyrimidi 7.37 (m, 2 H) 7.24 - 7.30 (m, 2 H) 7.13 - m/z n-4-yl)-4,4- 7.21 (m, 1 H) 4.91 (q, J=7.30 Hz, 1 H) 4.12 331.1573 dimethyloxazolidin-2-one (q, J=8.22 Hz, 2 H) 1.45 - 1.55 (m, 6 H) (M + H)+,
1 .08 (br. s., 3 H) Rt 1 .98 min
501 : (4S)-3-(2-((S)-1 -(5- 1H NMR (400 MHz, CD3OD) δ ppm 8.14 HRMS(A) chloro-6-(2,2,2- (d, J=6.65 Hz, 1 H) 8.10 (d, J=1.96 Hz, 1 m/z trifluoroethoxy)pyridin-3- H) 7.86 (d, J=2.35 Hz, 1 H) 7.57 (d, J=6.26 474.1523 yl)ethylamino)pyrimidin-4- Hz, 1 H) 5.17 (d, J=6.65 Hz, 1 H) 4.92 (q, (M + H)+, yl)-4-isopropyl-5- J=8.87 Hz, 1 H) 4.80 - 4.84 (m, 1 H) 2.04 Rt 2.18 methyloxazolidin-2-one (br. s., 2 H) 1 .55 (dd, J=15.85, 6.85 Hz, 6 min (1 :1 mixture of H) 0.79 (br.s., 6 H)
diastereomers)
502: (S)-3-(2-(1-(5-chloro- (CD3OD) 8.07 - 8.16 (m, 1 H) 7.89 (d, HRMS(A) 6-(2,2,2- J=1.96 Hz, 1 H) 7.32 (d, J=6.26 Hz, 1 H) m/z trifluoroethoxy)pyridin-3- 5.08 (q, J=6.78 Hz, 1 H) 1 .55 - 1 .65 (m, 8 474.1534 yl)ethylamino)pyrimidin-4- H) 1 .37 (d, J=1 1.35 Hz, 6 H) 1 .20 (d, (M + H)+, yl)-4,4,5,5- J=1 1 .35 Hz, 3 H) Rt 2.16 tetramethyloxazolidin-2- min one
503: 3-(2-((S)-1-(5-chloro- (CD3OD) 8.47 (d, J=5.87 Hz, 1 H) 8.1 1 (d, HRMS(A) 6-(2,2,2- J=2.35 Hz, 3H) 7.99 (d, J=6.26 Hz, 1 H) m/z trifluoroethoxy)pyridin-3- 7.88 (d, J=1.96 Hz, 3 H) 7.39 (d,J=6.26 Hz, 460.1375 yl)ethylamino)pyrimidin-4- 2 H) 7.32 (d, J=6.65 Hz, 2 H) 5.04 - 5.13 (M + H)+, yl)-4,4,5- (m, 1 H) 4.87 - 4.98 (m, 2 H) 4.45 (d, Rt 2.08, trimethyloxazolidin-2-one J=6.65 Hz, 1 H) 4.35 (dd, J=13.69, 6.65 2.1 1 min (1 :2 mixture of Hz, 2 H) 1.67(d, J=4.70 Hz, 9 H) 1 .59 (d,
diastereomers) J=7.04 Hz, 12 H) 1.39 (d, J=6.65 Hz, 3 H)
1 .33 (t, J=6.06 Hz, 6 H) 0.99 - 1.27 (m, 9
H)
504: (S)-3-(2-(1-(5-chloro- (CD3OD) 8.09 - 8.17 (m, 1 H) 7.88 (d, HRMS(A) 6-(2,2,2- J=2.35 Hz, 1 H) 7.38 (d, J=6.26 Hz, 1 H) m/z trifluoroethoxy)pyridin-3- 4.91 (q, J=8.61 Hz, 1 H) 4.06 - 4.16(m, 2 446.1219 yl)ethylamino)pyrimidin-4- H) 1 .71 (m, 5 H) 1 .58 (d, J=7.04 Hz, 3 H) (M + H)+, yl)-4,4-dimethyloxazolidin- 1 .28 (br. s., 3 H) Rt 2.01 2-one min
505: (S)-3-(2-(1 -(2,5- (CD3OD) 8.15 (d, J=3.13 Hz, 1 H) 6.92 - HRMS(A) difluoro-4- 7.08 (m, 2 H) 5.21 (q, J=6.78 Hz, 1 H) 4.44 m/z isopropylphenyl)ethylamin - 4.58 (m, 2 H) 4.10 - 4.22 (m, 1 H) 3.96 (m, 381.1544 o)-5-fluoropyrimidin-4- 1 H) 3.07 - 3.23 (m, 1 H) 1 .48 (d, J=7.04 (M + H)+, yl)oxazolidin-2-one Hz, 5 H) 1.21 (m, 6 H) Rt 2.26 min
506: (S)-3-(2-(1 -(4-bromo- (CD3OD) 8.15 (d, J=3.52 Hz, 1 H) 7.39 (dd, HRMS(A) 2,5- J=9.00, 5.48 Hz, 1 H) 7.24 (dd, J=9.19, m/z difluorophenyl)ethylamino) 6.46 Hz, 1 H) 5.19 (q, J=7.04 Hz, 1 H) 4.44 417.018
-5-fluoropyrimidin-4- - 4.58 (m, 2 H) 4.09 - 4.23 (m, 1 H) 3.94 (M + H)+, t yl)oxazolidin-2-one (br. s., 1 H) 1 .48 (d, J=7.04 Hz, 3 H) 2.07 min
507: (S)-3-(2-(1 -(3-(4- (CD3OD) 8.09 (d, J=6.26 Hz, 1 H) 7.91 (d, HRMS(A) chlorophenyl)-1 ,2,4- J=8.61 Hz, 2 H) 7.43 (d, J=8.61 Hz, 3 H) m/z oxadiazol-5- 5.35 (q, J=7.30 Hz, 1 H) 3.97 -4.09 (m, 2 415.1287 yl)ethylamino)pyrimidin-4- H) 1 .69 (d, J=7.43 Hz, 3 H) 1.62 (s, 3 H) (M + H)+, yl)-4,4-dimethyloxazolidin- 1 .14 - 1 .45 (m, 3 H) Rt 2.14 2-one min Example 508
Figure imgf000247_0001
A solution of 3-(2,6-dichloropyrimidin-4-yl)-4,4-dimethyloxazolidin-2-one (70.0 mg, 0.267 mmol), (S)-(-)-1-phenylethanamine (0.034 mL, 0.267 mmol, 1.0 equiv), and N-ethyl-N- isopropylpropan-2-amine (0.070 mL, 0.401 mmol, 1 .5 equiv) in DMSO (1.5 mL) was heated at 85 °C for 2-4 h. Purification by reverse phase HPLC provided the trifluoroacetate salt of (S)-3-(6-chloro-2-(1 -phenylethylamino)pyrimidin-4-yl)-4,4- dimethyloxazolidin-2-one (20.0 mg, white solid) in 16% yield. 1 H NMR (300 MHz, CDCI3) δ 7.36 (s, 1 H), 7.33 - 7.31 (m, 4H),7.26 - 7.21 (m, 1 H), 5.48 (br m, 1 H), 4.02 - 3.94 (m, 2H), 1 .65 (s, 3H), 1 .55 (d, J = 6.9 Hz, 3H), 1.26 (s, 3H); HRMS(A) m/z 347.1274 (M + H)+, Rt 2.32 min.
The compounds in Table 13 were prepared using methods similar to those described for the preparation of Example 508.
Table 13.
509 510 51 1
Figure imgf000247_0002
512 513
Figure imgf000248_0001
Table 14. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 13.
Figure imgf000248_0002
Example 514:
Figure imgf000249_0001
A solution of (S)-3-(2-(1-(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethylamino)-6- fluoropyrimidin-4-yl)-4,4-dimethyloxazolidin-2-one (29.0 mg, 0.053 mmol) and 1 N aqueous hydrochloric acid (0.70 mL) in 1 ,4-dioxane (0.7 mL) was heated at 100 °C for 4 h. After cooling to room temperature, the reaction mixture was diluted with dichloromethane (10 mL), washed with saturated aqueous sodium bicarbonate solution (10 mL), dried over Na2S04, filtered and concentrated. Purification by reverse phase
HPLC provided the trifluoroacetate salt of (S)-3-(2-(1 -(3-(4-chlorophenyl)-1 ,2,4- oxadiazol-5-yl)ethylamino)-6-hydroxypyrimidin-4-yl)-4,4-dimethyloxazolidin-2-one (16 mg, white solid) in 55% yield. 1 H NMR (400 MHz, CDCI3) δ 8.00 (d, J = 8.5 Hz, 2H), 7.46 (d, J = 8.5 Hz, 2H), 6.71 (br s, 1 H), 5.33 (br m, 1 H), 4.02 - 3.99 (m, 2H), 1.83 (d, J = 7.1 Hz, 3H), 1 .68 (s, 3H), 1.31 (s, 3H); HRMS(A) m/z 431 .1245 (M + H)+, Rt 1.80 min. Example 515
Figure imgf000249_0002
Step 1
To round bottom flask containing (R)-N-((S)-1 -(2-fluoro-4-(1- methylcyclopropyl)phenyl)ethyl)-2-methylpropane-2-sulfinamide (87 mg, 0.29 mmol) was added dioxane (2 mL). To this solution was added hydrochloric acid in dioxane (4.0M, 0.15 ml, 0.59 mmol) and the solution allowed to stir 10 min at room temperature. Volatiles were removed. Et20 (10 mL) was added and the reaction mixture sonnicated. The volatiles were removed again. Et20 (10 ml) was again added and the suspension sonnicated. Solid material was collected and washed with Et20 to afford an HCI salt of (S)-1-(2-fluoro-4-(1 -methylcyclopropyl)phenyl)ethanamine (42 mg, 0.18 mmol, 63 % yield) as a white solid. LCMS m/z 194.1 (M + H)+, Rt 0.60 min.
Step 2
To a microwave vial with stir bar was added (S)-3-(2-chloropyrimidin-4-yl)-4- isopropyloxazolidin-2-one (30 mg, 0.12 mmol) and DMSO (1 mL). To this reaction mixture was added (S)-1-(2-fluoro-4-(1 -methylcyclopropyl) phenyl)ethanamine (51 mg, 0.22 mmol) and DIEA (0.09 ml, 0.50 mmol). The vial was capped and the reaction mixture was heated in a preheated oil bath at 1 10 °C for 18 hr. Solution was purified by reverse phase HPLC. Product fractions combined, frozen and lyophilized to afford (S)- 3-(2-((S)-1-(2-fluoro-4-(1 -methylcyclopropyl) phenyl) ethylamino) py ri m id i n-4-y I )-4- isopropyloxazolidin-2-one (3.3 mg, 6.3 mol, 5 % yield) as a TFA salt. 1H NMR (400 MHz, CD3OD) δ 0.58 (br. s., 3 H) 0.77 (td, J=5.23, 1 .76 Hz, 5 H) 0.80 - 0.86 (m, 2 H) 1.38 (s, 3 H) 1 .57 (d, J=6.94 Hz, 3 H) 4.34 - 4.41 (m, 2 H) 4.67 (br. s., 1 H) 5.33 (d, J=7.97 Hz, 1 H) 6.95 - 7.05 (m, 2 H) 7.22 (t, J=7.97 Hz, 1 H) 7.67 (d, J=6.85 Hz, 1 H) 8.14 (d, J=6.65 Hz, 1 H). LCMS m/z 399.4 (M + H)+, Rt 0.93 min. HRMS(A) m/z 399.2202 (M + H)+, Rt 2.23 min.
The compounds in Table 15 were prepared using methods similar to those described for the preparation of Examples 515.
Table 15.
Figure imgf000250_0001
Figure imgf000251_0001
Figure imgf000252_0001
Figure imgf000253_0001
Table 16. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 15.
Table 16.
Example: Name 1H NMR (400 MHz) δ ppm LCMS
516: (S)-3-(2-((S)-1-(6- (DMSO) 0.46 (br. s., 3 H) 0.63 (br. s., 3 H) HRMS(A) tert-butylpyridin-3-yl) 1 .35 (s, 9 H) 1.50 (d, J=6.99 Hz, 3 H) 4.34 m/z ethylamino)pyrimidin-4-yl)- (d, J=7.92 Hz, 2 H) 4.59 (br. s., 1 H) 5.14 384.2410
4-isopropyloxazolidin-2- (br. s., 1 H) 7.32 (d, J=5.92 Hz, 1 H) 7.70 (M + H)+, one (br. s., 1 H) 8.03 (br. s., 1 H) 8.24 (br. s., 2 Rt 1 .34
H) 8.59 (br. s., 1 H)
517: (S)-3-(2-((S)-1-(6- (DMSO) 0.55 (br. s., 6 H) 1.25 - 1.38 (s, 9 HRMS(A) tert-butylpyridin-3- H) 1 .47 (d, J=7.04 Hz, 3 H) 4.26 (br. s., 1 m/z yl)ethylamino)-5- H) 4.45 - 4.59 (m, 2 H) 4.98 (br. s., 1 H) 402.2314 f I u oropy ri m id i n-4-y I )-4- 7.66 (br. s., 1 H) 8.1 1 (br. s., 2 H) 8.41 (br. (M + H)+, isopropyloxazolidin-2-one s., 1 H) 8.60 (br. s., 1 H) Rt 1 .45
518: (S)-4-isopropyl-3-(2- HRMS(A) ((S)-1-(4-(1 -methyl m/z cyclopropyl) 381.2295 phenyl)ethylamino)pyrimid (M + H)+, in-4-yl)oxazolidin-2-one Rt 2.10
519: (S)-3-(2-((S)-1-(4- (DMSO) 0.49 (br. s., 3 H) 0.68 (br. s., 3 H) HRMS(A) (1 ,5-dimethyl-1 H-pyrazol- 1 .48 (d, J=7.04 Hz, 6 H) 2.33 (s, 3 H) 3.76 m/z
4- (s, 3 H) 4.63 (br. s., 1 H) 4.75 - 4.82 (m, 1 421.2362 yl)phenyl)ethylamino)pyri H) 5.03 (br. s., 2 H) 7.30 - 7.37 (m, 4 H) (M + H)+, midin-4-yl)-4- 7.50 (s, 1 H) 8.22 (br. s., 1 H) 8.36 (br. s., Rt 1 .58 isopropyloxazolidin-2-one 1 H) 520: (S)-3-(2-((S)-1-(2- (DMSO) 0.40 (br. s., 3 H) 0.57 (br. s., 3 H) HRMS(A) fluoro -4-(trifluoromethyl) 1 .40 (br. s., 1 H) 1.47 (d, J=7.04 Hz, 3 H) m/z phenyl)ethylamino)pyrimid 4.24 - 4.37 (m, 2 H) 4.49 (br. s., 1 H) 5.23 413.1602 in-4-yl)-4- (br. s., 1 H) 7.30 (d, J=5.82 Hz, 1 H) 7.48 - (M + H)+, isopropyloxazolidin-2-one 7.59 (m, 2 H) 7.65 (d, J=10.56 Hz, 1 H) Rt 2.16
8.21 (d, J=18.58 Hz, 2 H)
521 : (S)-3-(2-((S)-1-(4- (CD3OD) 0.61 (br. s., 3 H) 0.64 - 0.69 (m, 3 HRMS(A) cyclopropyl-2- H) 0.77 (br. s., 3 H) 0.96 - 1.04 (m, 2 H) m/z fluorophenyl)ethylamino)p 1 .57 (d, J=6.99 Hz, 3 H) 1 .88 - 1 .95 (m, 1 385.2042 yrimidin-4-yl)-4- H) 4.39 (d, J=5.97 Hz, 2 H) 4.69 (br. s., 1 (M + H)+, isopropyloxazolidin-2-one H) 5.33 (br. s., 1 H) 6.82 (dd, J=12.08, Rt 2.06
1 .71 Hz, 1 H) 6.88 (d, J=7.97 Hz, 1 H) 7.19
(t, J=8.31 Hz, 1 H) 7.70 (d, J=6.90 Hz, 1 H)
8.14 (d, J=7.04 Hz, 1 H)
522: (S)-3-(2-((S)-1-(6- (CD3OD) 0.65 - 0.83 (m, 6 H) 1 .14 - 1 .20 HRMS(A) cyclopropylpyridin-3- (m, 2 H) 1 .37 - 1 .43 (m, 2 H) 1 .64 (d, m/z yl)ethylamino)pyrimidin-4- J=7.09 Hz, 3 H) 2.26 - 2.37 (m, 1 H) 4.36 - 368.2097 yl)-4-isopropyloxazolidin- 4.39 (m, 2 H) 4.68 (br. s., 1 H) 5.25 (q, (M + H)+,
2-one J=6.75 Hz, 1 H) 7.57 (d, J=8.51 Hz, 1 H) Rt 1 .12
7.63 (br. s., 1 H) 8.18 (d, J=5.92 Hz, 1 H)
8.33 (d, J=7.24 Hz, 1 H) 8.57 (d, J=2.10
Hz, 1 H)
523: (S)-4-isopropyl-3-(2- (CD3OD) 0.59 - 0.84 (m, 6 H) 1 .08 - 1 .15 HRMS(A) ((S)-1-(6-(1- (m, 2 H) 1 .22 - 1 .28 (m, 2 H) 1 .56 (s, 3 H) m/z methylcyclopropyl)pyridin- 1 .64 (d, J=7.09 Hz, 3 H) 4.35 - 4.39 (m, 2 382.2247
3- yl)ethylamino)pyrimidin- H) 4.69 (br. s., 1 H) 5.21 - 5.32 (m, 1 H) (M + H)+,
4- yl)oxazolidin-2-one 7.62 (br. s., 1 H) 7.79 (d, J=8.46 Hz, 1 H) Rt 1 .30
8.18 (d, J=6.1 1 Hz, 1 H) 8.33 (d, J=7.14
Hz, 1 H) 8.57 (d, J=2.20 Hz, 1 H)
524: (S)-3-(2-((S)-1-(4-(1- (CD3OD) 0.60 (br. s., 3 H) 0.78 (br. s., 3 H) HRMS(A) ethoxycyclopropyl)-2- 0.92 - 0.98 (m, 2 H) 1 .15 (t, J=7.07 Hz, 3 m/z fluorophenyl)ethylamino)p H) 1 .19 - 1 .26 (m, 2 H) 1 .59 (d, J=6.99 Hz, 429.2310 yrimidin-4-yl)-4- 3 H) 1 .78 (br. s., 1 H) 3.43 (q, J=7.09 Hz, 2 (M + H)+, isopropyloxazolidin-2-one H) 4.40 (d, J=5.72 Hz, 2 H) 4.70 (d, J=3.91 Rt 2.08
Hz, 1 H) 5.38 (br. s., 1 H) 7.06 (s, 1 H)
7.07 - 7.12 (m, 1 H) 7.31 (t, J=7.95 Hz, 1
H) 7.73 (d, J=7.04 Hz, 1 H) 8.15 (d, J=6.90
Hz, 1 H)
525: (S)-4-isopropyl-3-(2- (DMSO) 0.47 (br. s., 3 H) 0.69 (br. s., 3 H) HRMS(B)
((S)-1-(4-(1-methyl-1 H- 1 .45 (d, J=6.99 Hz, 3 H) 1 .81 (br. s., 1 H) m/z pyrazol-4- 3.84 (s, 3 H) 4.33 (d, J=13.45 Hz, 2 H) 407.2179 yl)phenyl)ethylamino)pyri 4.62 (br. s., 1 H) 4.99 (br. s., 1 H) 7.24 - (M + H)+, midin-4-yl)oxazolidin-2- 7.33 (m, 3 H) 7.46 (d, J=8.27 Hz, 2 H) 7.79 Rt one (d, J=0.73 Hz, 1 H) 8.06 (s, 1 H) 8.18 (br. 2.44min s., 1 H)
526: (S)-3-(2-((S)-1-(2- (CD3OD) 0.59 (br. s., 3 H) 0.78 (br. s., 3 H) HRMS(A) fluoro-4- 1 .23 (dd, J=6.90, 1.03 Hz, 6 H) 1.58 (d, m/z isopropylphenyl)ethylamin J=6.99 Hz, 3 H) 2.91 (dt, J=13.78, 6.93 Hz, 387.2207
Figure imgf000255_0001
Figure imgf000256_0001
Figure imgf000257_0001
Example 547
Figure imgf000258_0001
A solution of (S)-3-(2-((S)-1 -(4-(chloromethyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one (75 mg, 0.2 mmol) and 5,6,7,8-tetrahydroimidazo[1 ,2- a]pyrazine (25 mg, 0.2 mmol) in DMSO (2 mL) was heated at 80 °C for 16 h. The reaction mixture was diluted with EtOAc (20 mL) and washed with water (20 mL). After separation, the aqueous phase was washed with EtOAc (2 x 15 mL). Combined organics were dried over Na2S04, filtered and concentrated. Silica gel column chromatography (MeOH in CH2CI2 0 to 10%) provided (S)-3-(2-((S)-1-(4-((5,6-dihydroimidazo[1 ,2- a]pyrazin-7(8H)-yl)methyl)phenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one (58 mg, white solid) in 62.8% yield.
1 H NMR (400 MHz, MeOD) δ 8.12 (d, J = 6.0 Hz, 1 H), 7.34 (d, J = 5.9 Hz, 1 H), 7.33 (s, 4H), 6.99 (d, J = 1 .3 Hz, 1 H), 6.89 (d, J = 1 .4 Hz, 1 H), 5.07 (q, J = 7.0 Hz, 1 H), 4.68 (br s, 1 H), 4.37 - 4.25 (m, 2H), 4.02 (t, J = 5.5 Hz, 2H), 3.72 (s, 2H), 3.63 (s, 2H), 2.90 (td, J = 5.4, 2.6 Hz, 2H), 1.84 (br s, 1 H), 1.51 (d, J = 7.0 Hz, 3H), 0.72 (br s, 3H), 0.57 (br s, 3H); HRMS m/z 462.2606 (M + H)+.
The following compounds were prepared using methods similar to those described for the preparation of Example 205.
Example 548
Figure imgf000258_0002
(4S)-3-(2-((1 S)-1-(4-(3,8-diazabicyclo[4.2.0]octan-3- ylmethyl)phenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one.
1 H NMR (400 MHz, MeOD) δ 8.12 - 8.08 (m, 1 H), 7.37 - 7.22 (m, 5H), 5.10 - 5.01 (m, 1 H), 4.66 (br s, 1 H), 4.37 - 4.23 (m, 2H), 3.92 - 3.89 (m, 1 H), 3.63 - 3.54 (m, 1 H), 3.54 - 3.47 (m, 1 H), 3.24 - 3.20 (m, 1 H), 3.1 1 - 2.95 (m, 1 H), 2.95 - 2.73 (m, 1 H), .2.67 - 2.59 (m, 2H), 2.49 (ddd, J = 16.2, 12.8, 5.3 Hz, 1 H), 2.20 - 2.08 (m, 1 H), 1.99 - 1 .68 (m, 3H), 1 .50 (d, J = 7.0 Hz, 3H), 0.72 (br s, 1 H), 0.56 (br s, 1 H) ; HRMS m/z 451.2810 (M + H)+.
Example 549
Figure imgf000259_0001
(S)-3-(2-((S)-1 -(4-((4-aminopiperidin-1-yl)methyl)phenyl)ethylamino)pyrimi
isopropyloxazolidin-2-one.
1 H NMR (400 MHz, MeOD) d 8.12 (d, J = 5.8 Hz, 1 H), 7.34 (d, J = 5.8 Hz, 1 H), 7.27 (q, J = 8.2 Hz, 4H), 5.05 (q, J = 7.0 Hz, 1 H), 4.67 (s, 1 H), 4.38 - 4.25 (m, 2H), 3.48 (s, 2H), 2.86 (br d, J = 1 1.8 Hz, 2H), 2.71 (tt, J = 10.9, 4.2 Hz, 1 H), 2.05 (tt, J = 12.0, 2.5 Hz, 2H), 1 .90 - 1.75 (m, 3H), 1.54 - 1.37 (m, 5H), 0.72 (br s, 4H), 0.55 (br s, 3H); HRMS m/z 439.2805 (M + H)+.
The following compounds were prepared using methods similar to those described for the preparation of Example 210.
Example 550
Figure imgf000259_0002
(S)-3-(2-((S)-1-(4-((4-hydroxy-4-methylpiperidin-1 -yl)methyl)phenyl)ethylamino)pyrimidin- 4-yl)-4-isopropyloxazolidin-2-one.
1 H NMR (400 MHz, MeOD) δ 8.12 (d, J = 5.7 Hz, 1 H), 7.34 (d, J = 5.9 Hz, 1 H), 7.27 (t, J = 6.6 Hz, 4H), 5.06 (q, J = 6.8 Hz, 1 H), 4.67 (br s, 1 H), 4.37 - 4.25 (m, 2H), 3.51 (d, J = 3.2 Hz, 2H), 2.52 (br s, 2H), 2.44 (br s, 2H), 1.81 (br s, 1 H), 1.59 (br s, 4H), 1 .50 (d, J = 7.0 Hz, 3H), 1 .19 (s, 3H), 0.72 (br s, 3H), 0.56 (br s, 3H); HRMS m/z 454.2816 (M + H)+. Example 552
Figure imgf000260_0001
(S)-3-(2-((S)-1-(4-((3,3-difluoropiperidin-1 -yl)methyl)phenyl)ethylamino)pyrim
isopropyloxazolidin-2-one.
1 H NMR (400 MHz, MeOD) δ 8.12 (d, J = 5.8 Hz, 1 H), 7.35 (d, J = 5.8 Hz, 1 H), 7.28 (q, J = 8.2 Hz, 4H), 5.06 (q, J = 7.0 Hz, 1 H), 4.67 (br s, 1 H), 4.39 - 4.25 (m, 2H), 3.55 (d, J = 2.2 Hz, 2H), 2.56 (t, J = 1 1.5 Hz, 2H), 2.51 - 2.40 (m, 2H), 1.91 - 1 .81 (m, 3H), 1.78 - 1 .70 (m, 2H), 1.50 (d, J = 7.0 Hz, 3H), 0.71 (br s, 3H), 0.56 (br s, 3H) ; HRMS m/z 460.2537 (M + H)+.
Example 553
Figure imgf000260_0002
(S)-3-(2-((S)-1 -(4-(4,7-diazaspiro[2.5]octan-7-ylmethyl)phenyl)ethylamino)pyrimidin-4-y 4-isopropyloxazolidin-2-one
1 H NMR (400 MHz, MeOD) δ 8.12 (d, J = 5.8 Hz, 1 H), 7.34 (d, J = 5.8 Hz, 1 H), 7.32 - 7.24 (m, 4H), 5.06 (q, J = 7.0 Hz, 1 H), 4.68 (br s, 1 H), 4.37 - 4.26 (m, 2H), 3.49 (s, 2H), 2.89 (t, J = 5.0 Hz, 2H), 2.47 (br s, 2H), 2.28 (br s, 2H), 1.86 (br s, 1 H), 1 .49 (d, J = 7.0 Hz, 3H), 0.72 (br s, 3H), 0.64 - 0.49 (m, 5H), 0.45 (t, J = 3.2 Hz, 2H) ; HRMS m/z 451 .2809 (M + H)+.
Example 554
Figure imgf000260_0003
(S)-3-(2-((S)-1 -(4-(4,7-diazaspiro[2.5]octan-4-ylmethyl)^^
4-isopropyloxazolidin-2-one.
1 H NMR (400 MHz, MeOD) δ 8.1 1 (d, J = 5.8 Hz, 1 H), 7.33 (d, J = 5.8 Hz, 1 H), 7.24 (q, J = 8.3 Hz, 4H), 5.03 (q, J = 7.0 Hz, 1 H), 4.67 (br s, 1 H), 4.37 - 4.25 (m, 2H), 3.85 (s, 2H), 2.85 - 2.65 (m, 6H), 1.87 (br s, 1 H), 1 .48 (d, J = 7.0 Hz, 3H), 0.85 - 0.63 (m, 5H), 0.63 - 0.46 (m, 5H) ; HRMS m/z 451 .2810 (M + H)+.
Example 555
Figure imgf000261_0001
(S)-4-isopropyl-3-(2-((S)-1 -(4-((3,3,4,4-tetrafluoropyrrolidin-1-yl)methyl)phenyl) ethylamino)pyrimidin-4-yl)oxazolidin-2-one.
HRMS m/z 482.2161 (M + H)+; RT=2.78 min.
Example 556
Figure imgf000261_0002
(S)-3-(2-((S)-1-(4-((4-acetylpiperazin-1 -yl)methyl)phenyl)ethylamino)pyrimidin-4-y isopropyloxazolidin-2-one.
HRMS m/z 467.2752 (M + H)+; RT=1 .92 min. Example 557
Figure imgf000261_0003
(S)-4,6-difluoro-N-(1-phenylethyl)pyrimidin-2-amine (48.8 mg, 0.21 mmol) was added to NaH (95 %, 6.1 mg, 0.25 mmol, 1.2 equiv) in DMF (2 mL) at 0 °C. After 5 min, (S)-4- isopropyl-2-oxazolidinone (27.9 mg, 0.22 mmol, 1.0 equiv) was added. The reaction was stirred for 10 min at 0 °C and then warmed to room temperature. After 4h, the reaction mixture was quenched with water and poured into dilute brine (1 :1 sat. brine:water) and EtOAc. The aqueous phase was extracted with EtOAc and the combined organic layers were washed with diluted brine. The organic layer was dried over Na2S04, filtered and concentrated to a pink oil. Purification by reverse phase HPLC followed by lyopholization of the fractions containing product provided (S)-3-(6-fluoro-2-(((S)-1- phenylethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one as a white solid (22.5 mg TFA salt) in 31 % yield. 1H NMR (400 MHz, CD3OD) δ 7.27 - 7.39 (m, 4H), 7.17 - 7.26 (m, 1 H), 6.92 (s, 1 H), 5.05 (q, J = 7.04 Hz, 1 H), 4.63 (br. s., 1 H), 4.19 - 4.41 (m, 2H), 1.77 (br. s., 1 H), 1.51 (d, J = 7.04 Hz, 3H), 0.44 - 0.78 (m, 6H); LCMS m/z 345.1 (M + H)+., Rt 1 .00 min; UPLC Rt 5.038 min.
The compounds in Table 17 were prepared using methods similar to those described for the preparation of Example 557.
Table 17.
558
Figure imgf000262_0001
Table 18: Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 17.
Example: Name 1H NMR (400 ΜΗζ) δ ρρΓΠ LCMS
558: (S)-5,5-dimethyl-4- (CDsOD) 8.06 (d, J = 5.8 Hz, 1 H), 7.43 (d, HRMS(A) phenyl-3-(2-((S)-1- J = 5.8 Hz, 1 H), 7.31 - 7.24 (m, 3 H), 7.19 m/z
phenylethylamino)pyrimidi - 7.1 1 (m, 5 H), 7.01 (br s 2 H), 5.48 (s, 1 389.1987 n-4-yl)oxazolidin-2-one H), 4.86 - 4.80 (m, 1 H), 1 .65 (s, 3 H), 1.43 (M + H)+
(d, J = 7.0 Hz, 3 H), 0.98 (s, 3 H) Example 559
Figure imgf000263_0001
A mixture of (R)-3-(2-chloropyrimidin-4-yl)-4-phenyloxazolidin-2-one (55.3 mg, 0.20 mmol), (S)-l-cyclopropylethylamine (40 μΙ_, 0.26 mmol, 1.3 equiv) and /'Pr2Net (0.20 mL, 1 .15 mmol, 5.7 equiv) in NMP (1 mL) was heated in the microwave at 180 °C for 20min. The reaction mixture was filtered and purified by reverse phase HPLC to give (R)-3-(2- (((S)-1 -cyclopropylethyl)amino)pyrimidin-4-yl)-4-phenyloxazolidin-2-one as a white solid (8.8 mg) in 10 % yield. 1H NMR (400 MHz, CD3OD) δ 7.72 (d, J = 6.26 Hz, 1 H), 7.29 - 7.43 (m, 6H), 5.76 (dd, J = 4.1 1 , 8.80 Hz, 1 H), 4.28 (dd, J = 4.30, 8.61 Hz, 1 H), 3.06 - 3.19 (m, 1 H), 1 .39 (dd, J = 3.52, 6.65 Hz, 1 H), 0.88 - 0.97 (m, 1 H), 0.83 (br. s., 3H), 0.53 - 0.62 (m, 1 H), 0.50 (dt, J = 4.1 1 , 8.51 Hz, 1 H), 0.33 (qd, J = 4.78, 9.54 Hz, 1 H), 0.26 (td, J = 4.60, 9.59 Hz, 1 H); HRMS(A) m/z 325.1667 (M + H)+, Rt 1.54 min; UPLC 2.807 min.
The compounds in Table 19 were prepared using methods similar to those described for the preparation of Example 559.
Table 19.
Figure imgf000263_0002
Table 20. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 19.
Figure imgf000264_0001
Example 563
Figure imgf000264_0002
A mixture of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (43.2 mg, 0.18 mmol), (1 S)-1 -[4-(2-Methylpropoxy)phenyl]ethan-1 -amine (84.0 mg, 0.37 mmol, 2.0 equiv) and /'Pr2Net (0.30 mL, 1.72 mmol, 4.7 equiv) in NMP (1 mL) was heated at 105 °C for 24 h. The reaction mixture was filtered and purified by reverse phase HPLC to give (S)-3-(2-(((S)-1 -(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one as a white solid (5.3 mg, TFA salt) in 4 % yield. 1H NMR (400 MHz, CD3OD) δ 7.68 (d, J = 6.65 Hz, 1 H), 7.25 (d, J = 8.61 Hz, 2H), 6.90 (d, J = 8.61 Hz, 2H), 4.41 (d, J = 5.87 Hz, 2H), 3.74 (d, J = 6.26 Hz, 2H), 1 .96 - 2.15 (m, 1 H), 1 .58 (d, J = 7.04 Hz, 3H), 1 .03 (d, J = 6.65 Hz, 6H); HRMS(A) m/z 399.2399 (M + H)+, Rt 2.60 min; UPLC 4.223 min. The compounds in Table 21 were prepared using methods similar to those described for the preparation of Example 563. Table 21.
Figure imgf000265_0002
Table 22. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 21 .
Figure imgf000265_0003
Example 566
Figure imgf000265_0001
To a microwave vial with stir bar was added (S)-3-(2-chloropyrimidin-4-yl)-4- isopropyloxazolidin-2-one (24.96 mg, 0.103 mmol) in DMSO (1653 μί). To this reaction mixture was added (S)-1-(2,3-difluorophenyl)ethanamine (40 mg, 0.207 mmol) and DIEA (144 μί, 0.826 mmol). The vial capped and heated at 1 10 °C over the weekend. The solution was filtered, then purified by reverse phase HPLC. Product fractions combined, frozen and lyopholyzed to afford ((S)-3-(2-((S)-1-(2,3-difluorophenyl)ethylamino) pyrimidin-4-yl)-4-isopropyloxazolidin-2-one (10.2 mg, 0.021 mmol, 10.26 % yield) as a TFA salt. 1H NMR (400 MHz, CD3OD) δ ppm 0.59 (br. s., 3 H) 0.75 (br. s., 3 H) 1.59 (d, J=6.99 Hz, 3 H) 1 .69 (br. s., 1 H) 4.37 (d, J=5.67 Hz, 2 H) 4.66 (br. s., 1 H) 5.40 (d, J=7.38 Hz, 1 H) 7.06 - 7.23 (m, 3 H) 7.70 (d, J=6.90 Hz, 1 H) 8.14 (d, J=6.46 Hz, 1 H); LCMS m/z 363.3 (M + H)+, Rt 0.77 min.; HRMS(A) m/z 363.1642 (M + H)+, Rt 1 .89 min.
Example 567
Figure imgf000266_0001
(S)-3-(2-(1-(2,3-difluorophenyl)ethylamino)-5-fluoropyrimidm^ was prepared using a method similar to that described for the preparation of Example 566. 1H NMR (400 MHz, CD3OD) δ ppm 1.50 (d, J=7.04 Hz, 3 H) 3.91 (br. s., 1 H) 4.09 - 4.20 (m, 1 H) 4.42 - 4.56 (m, 2 H) 5.26 (q, J=6.68 Hz, 1 H) 6.99 - 7.12 (m, 2 H) 7.16 (t, J=7.48 Hz, 1 H) 8.13 (d, J=3.37 Hz, 1 H). HRMS(A) m/z 339.1075 (M + H)+, Rt 1 .86 min.
Example 568
2-fluoro-N-(frans-4-hydroxycyclohexyl)-4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin yl)pyrimidin-2-ylamino)ethyl)benzamide
Figure imgf000266_0002
Step 1 : Preperation of (S)-4-(1-(tert-butoxycarbonylamino)ethyl)-2-fluorobenzoic acid:
To (S)-4-(1-aminoethyl)-2-fluorobenzoic acid (900 mg, 4.10 mmol) was added, DCM (1 1 ml), Hunig's Base (2.147 ml, 12.29 mmol) and BOC-Anhydride (1 .998 ml, 8.61 mmol). Then NMP (1 1 .00 ml) was added to help solubility. The reaction was sonicated for 10 minutes and was stirred at room temperature for 22 hours, followed by LCMS. The DCM was mostly concentrated off. Then to the crude reaction was added 120 ml of water and basified with 10 ml of 5M NaOH. The basic aqueous solution was extracted with 2 x 50 ml of (15% ethyl acetate in heptane) solution. Then to the basic aqueous solution (with the product) was added 150 ml of ethyl acetate and with stirring acidified with 2M aqueous HCI solution to about pH 3. Then the ethyl acetate was extracted, saved and the acidic water extracted again with 100 ml of ethyl acetate. The organic layers were combined and washed with 0.5M aqueous HCI solution 1 x 40 ml, with water 3 x 40 ml, and concentrated to constant mass to give 1 104 mg of (S)-4-(1 -(tert- butoxycarbonylamino)ethyl)-2-fluorobenzoic acid, used as is. LCMS m/z BOC pattern of 269.0 (M+H-15 fragment) and weak 228.0 (M+H-56 fragment) compared to expected 284.0 (M + H)+, Rt 0.72 min. Step 2: Preperation of tert-butyl (S)-1-(3-fluoro-4-(frans-4- hydroxycyclohexylcarbamoyl)phenyl)ethylcarbamate:
To (S)-4-(1-(tert-butoxycarbonylamino)ethyl)-2-fluorobenzoic acid (40.8 mg, 0.144 mmol) was added NMP (0.5 ml), frans-4-aminocyclohexanol (41 .5 mg, 0.360 mmol), Hunig's Base (0.101 ml, 0.576 mmol) and HATU (1 10 mg, 0.288 mmol) The reaction was stirred at room temperature for 6 hours, followed by LCMS. To the reaction was added 0.5 ml of NMP, filtered, purified by prep LC and lyophilized to give 33 mg of tert-butyl (S)-1 -(3- fluoro-4-(frans-4-hydroxycyclohexylcarbamoyl)phenyl)ethylcarbamate as the TFA Salt. LCMS m/z 381.1 (M + H)+, Rt 0.70 min. Step 3: Preperation of 4-((S)-1-aminoethyl)-2-fluoro-N-(frans-4- hydroxycyclohexyl)benzamide:
To tert-butyl (S)-1 -(3-fluoro-4-(frans-4- hydroxycyclohexylcarbamoyl)phenyl)ethylcarbamate (33 mg, 0.087 mmol) was added, HCI 4M in Dioxane (2 mL, 8.00 mmol) and MeOH (0.2 ml). The reaction was stirred at room temperature for 1 hour, followed by LCMS. The solvent was concentrated off to residue to give 4-((S)-1 -aminoethyl)-2-fluoro-N-(frans-4-hydroxycyclohexyl)benzamide in quantitative yield (0.087 mmol) as HCI salt. LCMS m/z 281 .1 (M + H)+, Rt 0.33 min.
Step 4: Preperation of 2-fluoro-N-(frans-4-hydroxycyclohexyl)-4-((S)-1 -(4-((S)-4- isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-ylamino)ethyl)benzamide:
To 4-((S)-1-aminoethyl)-2-fluoro-N-((1 r,4S)-4-hydroxycyclohexyl)benzamide (0.024 g, 0.087 mmol) was added (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (0.034 g, 0.139 mmol), DMSO (0.6 ml) and Hunig's Base (0.053 ml, 0.305 mmol). The reaction was heated at 100-105 °C for 16 hours or until done by LCMS. The reaction was let cool, 0.5 ml of DMSO added, filtered, purified by prep LC and lyophilized to give 10.1 mg of 2-fluoro-N-(frans-4-hydroxycyclohexyl)-4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzamide as the TFA Salt. LCMS m/z 486.2 (M + H) +, Rt 0.57 min.
1 H NMR (400 MHz, CD3OD) δ ppm 8.13 (d, J = 6.7 Hz, 1 H), 7.70 (d, J = 6.7 Hz, 1 H), 7.64 (t, J = 7.8 Hz, 1 H), 7.13 - 7.28 (m, 2H), 5.16 (br. s., 1 H), 4.67 (br. s., 1 H), 4.37 (d, J = 5.5 Hz, 2H), 3.82 (br. s., 1 H), 3.53 (d, J = 3.9 Hz, 1 H), 1 .97 (dd, J = 5.1 , 3.1 Hz, 4H), 1 .57 (d, J = 7.0 Hz, 3H), 1.38 (t, J = 8.6 Hz, 4H), 0.50 - 0.88 (m, 6H); HRMS(A) m/z 486.2523 (M + H)+.
Example 569
(S)-3-(2-((S)-1 -(6-(4-fluorophenoxy)pyridin-3-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
Figure imgf000268_0001
To (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (28 mg, 0.1 16 mmol) was added (S)-1-(6-(4-fluorophenoxy)pyridin-3-yl)ethanamine (46.7 mg, 0.174 mmol), DMSO (0.6 ml) and Hunig's Base (0.071 ml, 0.406 mmol). The reaction was heated at 105-1 10 °C for 24 hours or until done by LCMS. The reaction was let cool, 0.5 ml of DMSO was added, filtered, purified by prep LC and lyophilized to give 7.1 mg of (S)-3-(2-((S)-1-(6-(4- fluorophenoxy)pyridin-3-yl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one as the TFA Salt. LCMS m/z 438.2 (M + H) +, Rt 0.82 min.
1 H NMR (400 MHz, CD3OD) δ ppm 8.04 (d, J = 6.3 Hz, 1 H), 8.01 (d, J = 2.0 Hz, 1 H), 7.73 (dd, J = 8.6, 2.3 Hz, 1 H), 7.53 (d, J = 6.3 Hz, 1 H), 6.94 - 7.10 (m, 4H), 6.84 (d, J = 8.6 Hz, 1 H), 5.05 (d, J = 7.0 Hz, 1 H), 4.61 (d, J = 3.9 Hz, 1 H), 4.28 (d, J = 5.5 Hz, 2H), 1 .49 (d, J = 7.0 Hz, 3H), 0.51 - 0.78 (m, 6H); HRMS(A) m/z 438.1946 (M + H)+.
Example 570
(S)-3-(2-((S)-1 -(3-fluoro-4-(piperidine-1 -carbonyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one
Figure imgf000269_0001
To (S)-(4-(1 -aminoethyl)-2-fluorophenyl)(piperidin-1 -yl)methanone (0.019 g, 0.076 mmol) was added (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (0.028 g, 0.1 14 mmol), NMP (0.5 ml) and Hunig's Base (0.033 ml, 0.190 mmol). The reaction was heated at 105-1 10 °C for 16 hours or until done by LCMS. The reaction was let cool, 0.5 ml of NMP was added, filtered, purified by prep LC and lyophilized to give 4.0 mg of (S)- 3-(2-((S)-1-(3-fluoro-4-(piperidine-1-carbonyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one as TFA Salt. LCMS m/z 456.1 (M + H) +, rt 0.74 min.
1 H NMR (400 MHz, CD3OD) δ ppm 8.13 (d, J = 6.7 Hz, 1 H), 7.69 (d, J = 7.0 Hz, 1 H), 7.30 - 7.38 (m, 1 H), 7.23 - 7.28 (m, 1 H), 7.20 (d, J = 10.6 Hz, 1 H), 5.18 (br. s., 1 H), 4.63 - 4.74 (m, 1 H), 4.33 - 4.42 (m, 2H), 3.61 - 3.79 (m, 2H), 1.61 - 1 .76 (m, 5H), 1 .57 (d, J = 7.0 Hz, 3H), 1.51 (br. s., 2H), 0.77 (br. s., 3H), 0.62 (br. s., 3H); HRMS(A) m/z 456.2416 (M + H)+. Example 571
(S)-3-(5-fluoro-2-((S)-1 -(3-fluoro-4-(piperidine-1-carbonyl)phenyl)ethylamino)pyrimidin-4- yl)-4-isopropyloxazolidin-2-one
Figure imgf000269_0002
To (S)-(4-(1 -aminoethyl)-2-fluorophenyl)(piperidin-1 -yl)methanone (0.019 g, 0.076 mmol) was added (S)-3-(2-chloro-5-fluoropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (0.030 g, 0.1 14 mmol), NMP (0.5 ml) and Hunig's Base (0.033 ml, 0.190 mmol). The reaction was heated at 105-1 10 °C for 8 hours or until done by LCMS. The reaction was let cool, 0.5 ml of NMP added, filtered, purified by prep LC and lyophilized to give 4.5 mg of (S)-3-(5- fluoro-2-((S)-1 -(3-fluoro-4-(piperidine-1-carbonyl)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one as TFA Salt. LCMS m/z 474.2 (M + H) +, Rt 0.91 min.
1 H NMR (400 MHz, CD3OD) δ ppm 8.21 (d, J = 2.7 Hz, 1 H), 7.22 - 7.33 (m, 2H), 7.17 (d, J = 1 1 .0 Hz, 1 H), 4.97 (q, J = 7.0 Hz, 1 H), 4.59 (br. s., 1 H), 4.47 (t, J = 8.8 Hz, 1 H), 4.20 - 4.32 (m, 1 H), 3.68 (br. s., 2H), 1.57 - 1.75 (m, 5H), 1.48 (d, J = 7.0 Hz, 5H), 0.69 (br. s., 3H), 0.62 (br. s., 3H) ; HRMS(A) m/z 474.2330 (M + H)+.
Example 572
N-cyclohexyl-2-fluoro-4-((S)-1-(5-fluoro-4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin- 2-ylamino)ethyl)benzamide
Figure imgf000270_0001
To (S)-4-(1-aminoethyl)-N-cyclohexyl-2-fluorobenzamide (16 mg, 0.061 mmol) was added (S)-3-(2-chloro-5-fluoropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (31 .4 mg, 0.121 mmol), NMP (0.5 ml) and Hunig's Base (0.032 ml, 0.182 mmol). The reaction was heated at 125 °C for 4 hours or until done by LCMS. The reaction was let cool, 0.5 ml of NMP added, filtered, purified by prep LC and lyophilized to give 2.5 mg of N-cyclohexyl- 2-fluoro-4-((S)-1 -(5-fluoro-4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzamide as the TFA Salt. LCMS m/z 488.2 (M + H) +, Rt 0.99 min.
1 H NMR (400 MHz, CD3OD) δ ppm 8.21 (br. s., 1 H), 7.62 (t, J = 7.8 Hz, 1 H), 7.24 (dd, J = 8.0, 1.4 Hz, 1 H), 7.16 (d, J = 12.1 Hz, 1 H), 4.39 - 4.54 (m, 2H), 4.23 (t, J = 7.2 Hz, 1 H), 3.83 (t, J = 10.4 Hz, 1 H), 1 .86 - 1 .97 (m, 2H), 1.76 (d, J = 12.9 Hz, 2H), 1.64 (d, J = 12.9 Hz, 1 H), 1.48 (d, J = 7.0 Hz, 3H), 1 .12 - 1.42 (m, 6H), 0.61 (br. s., 6H); HRMS(A) m/z 488.2484 (M + H)+
Example 573
N-cyclohexyl-2-fluoro-4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzamide
Figure imgf000270_0002
To (S)-4-(1-aminoethyl)-N-cyclohexyl-2-fluorobenzamide (16 mg, 0.061 mmol) was added (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (29.3 mg, 0.121 mmol), NMP (0.5 ml) and Hunig's Base (0.032 ml, 0.182 mmol). The reaction was heated at 125 °C for 4 hours or until done by LCMS. The reaction was let cool, 0.5 ml of NMP added, filtered, purified by prep LC and lyophilized to give 5.6 mg of N-cyclohexyl-2-fluoro-4- ((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2-ylamino)ethyl)benzamide as the TFA Salt. LCMS m/z 470.2 (M + H)+, Rt 0.83 min.
1 H NMR (400 MHz, CD3OD) δ ppm 8.12 (br. s., 1 H), 7.57 - 7.73 (m, 2H), 7.13 - 7.27 (m, 2H), 5.15 (br. s., 1 H), 4.66 (br. s., 1 H), 4.36 (d, J = 5.5 Hz, 2H), 3.76 - 3.94 (m, 1 H), 1.87 - 1.99 (m, 2H), 1.77 (d, J = 12.9 Hz, 2H), 1 .65 (d, J = 13.7 Hz, 1 H), 1.57 (d, J = 7.0 Hz, 3H), 1 .12 - 1 .50 (m, 6H), 0.73 (br. s., 3H), 0.62 (br. s., 3H); HRMS(A) m/z 470.2572 (M + H)+
Example 574
(S)-4-lsopropyl-3-(2-(((S)-1 -(4-(pyrimidin-5-yloxy)phenyl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one
Figure imgf000271_0001
To the solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (43 mg, 0.169 mmol) in NMP (0.7 mL) was added (S)-1 -(4-(pyrimidin-5-yloxy)phenyl)ethanamine (41 mg, 0.169 mmol) and DIEA (88 μί, 0.507 mmol). The brown reaction mixture was stirred at 1 10 °C for 2 days. The reaction mixture was diluted with ethyl acetate and aqueous sodium bicarbonate solution. The separated organic layer was washed with saturated aqueous sodium bicarbonate solution, water and brine. The organic phase was dried over sodium sulfate, filtered off and concentrated under reduced pressure. The residue was purified by reverse phase column chromatography [C-18] to provide (S)-4-isopropyl-3-(2-(((S)-1 -(4-(pyrimidin-5-yloxy)phenyl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one (7 mg) as its trifluoroacetic acid salt.
MS m/z 421 .3 (M + H)+, Rt 0.68 min.
HRMS(A) m/z 421.1996 (M + H)+, Rt 1 .54 min.
Example 575
4-Phenyl-3-(2-((S)-1-phenylethylamino)pyrimidin-4-yl)-1 ,8-dioxa-3-azaspiro[4.5]decan-2- one
Figure imgf000272_0001
A mixture of crude 3-(2-chloropyrimidin-4-yl)-4-phenyl-1 ,8-dioxa-3-azaspiro[4.5]decan-2- one (330 mg, 0.954 mmol), (S)-l-phenylethanamine (810 mg, 6.68 mmol), Hunig's base (1.17 ml_, 6.68 mmol) in DMA (3.5 ml.) was heated in a sealed tube at 80 °C for -16 hours. The mixture was allowed to cool to room temperature, diluted with DMSO and purified by reverse phase HPLC. Selected fractions were combined and lyophilized, providing 4-phenyl-3-(2-((S)-1-phenylethylamino)pyrimidin-4-yl)-1 ,8-dioxa-3- azaspiro[4.5]decan-2-one as its trifluoroacetic acid salt as a white solid. LCMS m/z 431 .2 (M + H)+, Rt 0.83 min.
The solid was dissolved in ethyl acetate/saturated aqueous NaHC03 solution. The separated organic layer was washed with saturated aqueous NaHC03 solution (2x), brine, dried over sodium sulfate, filtered off and concentrated under reduced pressure providing 4-phenyl-3-(2-((S)-1-phenylethylamino)pyrimidin-4-yl)-1 ,8-dioxa-3- azaspiro[4.5]decan-2-one (120 mg).
Examples 576 & 577
(S)-4-phenyl-3-(2-((S)-1-phenylethylamino)pyrimidin-4-yl)-1 ,8-dioxa-3- azaspiro[4.5]decan-2-one and (R)-4-phenyl-3-(2-((S)-1-phenylethylamino)pyrimidin-4-yl)- 1 ,8-dioxa-3-azaspiro[4.5]decan-2-one
Figure imgf000272_0002
120 mg of 4-phenyl-3-(2-((S)-1-phenylethylamino)pyrimidin-4-yl)-1 ,8-dioxa-3- azaspiro[4.5]decan-2-one were dissolved in EtOH (10 ml_).
Analytical separation:
Column: CHIRALPAK AD-H (5 urn) 100 x 4.6 mm (Daicel Chemical Industries, LTD.). Solvent: n-heptane : ethyl alcohol = 70 : 30 Flow rate: 1 .0 mL/min; detection: UV = 220 nm.
Fraction 1 : Retention time: 5.84 min.
Fraction 2: Retention time: 10.18 min. Preparative separation:
Column: CHIRALPAK AD-prep (10 urn) 2 x 25 cm.
Solvent: n-heptane : ethyl alcohol = 70 : 30
Flow rate: 20 mL/min; 530 psi; injection: 4 mL; detection: UV = 210 nm.
Fractions were concentrated under reduce pressure. The residue was dissolved in acetonitrile and filtered through a syringe filter, diluted with water and lyophilized.
Example 576: Peak 1 : white powder. Yield: 52.0 mg; de = 99% (UV, 220 nm).
LCMS m/z 431.3 (M + H)+, Rt 0.81 min.
Example 577: Peak 2: white powder. Yield: 47.8 mg; de = 99% (UV, 220 nm).
LCMS m/z 431.3 (M + H)+, Rt 0.81 min.
Examples 578 and 579
(R)-8-phenyl-7-(2-((S)-1-phenylethylamino)pyrimidin-4-yl)-2,5-dioxa-7- azaspiro[3.4]octan-6-one and
(S)-8-phenyl-7-(2-((S)-1 -phenylethylamino)pyrimidin-4-yl)-2,5-dioxa-7-azaspiro[3.4]octan- 6-one were prepared using methods similar to those described for the preparation of Example 576 & 577.
Table 23.
Chiral column Chiral column
Example Structure for for quality Retention No. separation/ control/ time
conditions conditions
AD-H column;
578 (Peak AD column; heptane:EtOH
5.4 min 1 ) 56 mg/ 75:25;
6 mL EtOH; 1 mL/min
heptane:EtOH
75:25; AD-H column;
579 (Peak 20 mL/min, heptane:EtOH
8.9 min 2) 400 psi 75:25;
1 mL/min The compounds in Table 24 were prepared using methods similar to those described for the preparation of Example 569
Table 24.
Figure imgf000274_0001
Table 25. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 24.
Figure imgf000274_0002
Examples 583 & 584
(S)-4-isopropyl-3-(2-((R)-1 , 1 , 1 -trifluoropropan-2-ylamino)pyrimidin-4-yl)oxazolidin-2-one (S)-4-isopropyl-3-(2-((S)-1 , 1 , 1 -trifluoropropan-2-ylamino)pyrimidin-4-yl)oxazolidin-2-one
Figure imgf000275_0001
To a solution of (S)-3-(2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (40 mg, 0.166 mmol) in 2-butanol was added 1 , 1 ,1 -trifluoropropan-2-amine (74.9 mg, 0.662 mmol) and para-toluenesulfonic acid monohydrate (74.9 mg, 0.662 mmol). The mixture was heated under argon in a sealed vial for ~7 days at 1 15 °C. Independently, to a solution of (S)-3- (2-chloropyrimidin-4-yl)-4-isopropyloxazolidin-2-one (100 mg, 0.414 mmol) in 2-butanol was added 1 , 1 , 1-trifluoropropan-2-amine (187 mg, 1 .655 mmol) and para-toluenesulfonic acid monohydrate (157 mg, 0.828 mmol). The mixture was heated under argon in a sealed vial at 1 15 °C for ~4 days. The two reaction mixtures was combined and concentrated under reduced pressure. The residue was diluted with DMSO and water (-10 vol.% of DMSO), filtered through a syringe filter and purified by reverse phase HPLC. Selected fractions were collected and lyophilized providing two isomers as white solids as their trifluoroacetic acid salts.
1 st Peak 583: Yield: 29.1 mg.
1 H NMR (400 MHz, CD3OD) δ ppm 0.90 (d, J=7.04 Hz, 3 H) 0.98 - 1.02 (m, 3 H) 1.45 (d, J=7.04 Hz, 3 H) 2.59 (dtd, J=13.89, 6.95, 6.95, 3.52 Hz, 1 H) 4.43 - 4.47 (m, 2 H) 4.76 - 4.83 (m, 2 H) 7.70 (d, J=5.87 Hz, 1 H) 8.20 (d, J=6.26 Hz, 1 H)
LCMS m/z 319.3 (M + H)+, Rt 0.73 min. HRMS(A) m/z 319.1391 (M + H)+, Rt 1.89 min 2nd Peak 584: Yield: 38.5 mg.
1 H NMR (400 MHz, CD3OD) δ ppm 0.87 (d, J=7.04 Hz, 3 H) 0.98 (d, J=7.04 Hz, 3 H) 1 .45 (d, J=7.04 Hz, 3 H) 2.48 - 2.60 (m, 1 H) 4.40 - 4.49 (m, 2 H) 4.88 - 4.95 (m, 2 H) 7.69 (d, J=5.87 Hz, 1 H) 8.20 (d, J=6.65 Hz, 1 H)
LCMS m/z 319.3 (M + H)+, Rt 0.73 min. HRMS(A) m/z 319.1385 (M + H)+, Rt 1.88 min
Example 585
(4S)-4-phenyl-3-(2-(1 , 1 ,1 -trifluoropropan-2-ylamino)pyrimidin-4-yl)oxazolidin-2-one
Figure imgf000276_0001
A mixture of (S)-3-(2-chloropyrimidin-4-yl)-4-phenyloxazolidin-2-one (40 mg, 0.145 mmol), 1 , 1 , 1-trifluoropropan-2-amine (82 mg, 0.725 mmol), Hunig's Base (0.038 ml_, 0.218 mmol) in DMSO (0.4 ml.) was heated under argon at 1 15 °C for ~3 days. Then mixture was allowed to cool to room temperature. The mixture was diluted with DMSO and water (-10 vol.% of DMSO), filtered through a syringe filter and purified by reverse phase HPLC. Selected fractions were collected and lyophilized providing (4S)-4-phenyl- 3-(2-(1 , 1 , 1-trifluoropropan-2-ylamino)pyrimidin-4-yl)oxazolidin-2-one (ratio of two isomers: 7/3) as white solid as its trifluoroacetic acid salt. LCMS m/z 353.2 (M + H)+, Rt 0.78 min. HRMS(A) m/z 353.1231 (M + H)+, Rt 1 .92/1 .96 min.
Example 586
(S)-3-(2-((S)-1 -cyclopropylethylamino)-5-fluoropyrimidin-4-yl)-4-phenyloxazolidin-2-one
Figure imgf000276_0002
A mixture of (S)-3-(2-chloro-5-fluoropyrimidin-4-yl)-4-phenyloxazolidin-2-one (40 mg, 0.136 mmol), (S)-l-cyclopropylethanamine (34.8 mg, 0.409 mmol), Hunig's Base (0.1 19 ml_, 0.681 mmol) in DMSO (0.4 ml.) was heated under argon at 105-1 15 °C for -18 hrs (alternative: 120-135 °C for -90 min). Then mixture was allowed to cool to room temperature. The mixture was diluted with DMSO and water (-10 vol.% of DMSO), filtered through a syringe filter and purified by reverse phase HPLC. Selected fractions were collected and lyophilized providing (S)-3-(2-((S)-1 -cyclopropylethylamino)-5- fluoropyrimidin-4-yl)-4-phenyloxazolidin-2-one (26 mg) as a white solid as its trifluoroacetic acid salt.
1 H NMR (400 MHz, CD3OD) δ ppm -0.14 - -0.05 (m, 1 H) 0.01 - 0.08 (m, 1 H) 0.23 - 0.31 (m, 1 H) 0.36 - 0.44 (m, 1 H) 0.78 - 0.86 (m, 1 H) 1.19 (d, J=6.65 Hz, 3 H) 3.05 - 3.14 (m, 1 H) 4.25 - 4.32 (m, 1 H) 4.89 - 4.90 (m, 1 H) 5.77 (t, J=8.61 Hz, 1 H) 7.32 - 7.39 (m, 5 H) 8.15 (d, J=3.52 Hz, 1 H).
LCMS m/z 343.1 (M + H)+, Rt 0.88 min. HRMS(A) m/z 343.1577 (M + H)+, Rt 2.09 min
The compounds in Table 26 were prepared using methods similar to those described for the preparation of Example 586.
Table 26.
Figure imgf000277_0001
Table 27. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 26.
Example: Name 1H NMR (400 MHz) 8 ppm LCMS
587: (S)-3-(2-((S)-1- (CD3OD) -0.55 - -0.27 (m, 1 H), -0.01 (m, MS m/z cyclopropylethylamino)pyr J=9.00, 4.30 Hz, 1 H), 0.12 - 0.32 (m, 1 H) 325.2 (M imidin-4-yl)-4- 0.35 - 0.50 (m, 1 H) 0.64 - 0.93 (m, 1 H) + H)+; Rt- phenyloxazolidin-2-one 1 .28 (d, J=1.00 Hz, 3 H) 2.77 - 3.00 (m, 1 0.77 min.
H) 4.26 (dd, J=1 .00 Hz, 1 H) 4.76 - 4.95 HRMS(A) (m, 1-2 H; overlay with solvent) 5.75 (dd, m/z
J=1.00 Hz, 1 H) 7.17 - 7.52 (m, 5 H) 7.78 325.1664 (d, J=1 .00 Hz, 1 H) 8.08 (d, J=7.04 Hz, 1 (M + H)+; H) Rt-1.53
min
588: (S)-4-(biphenyl-4-yl)- (CD3OD) 0.01 (m, J=4.30 Hz, 1 H) 0.14 - MS m/z 3-(2-((S)-1 - 0.26 (m, 1 H) 0.33 - 0.45 (m, 1 H) 0.73 - 401.3 (M cyclopropylethylamino)pyr 0.85 (m, 1 H) 1 .28 (d, J=6.65 Hz, 3 H) 2.91 + H)+; Rt- imidin-4-yl)oxazolidin-2- - 3.02 (m, 1 H) 4.32 (dd, J=9.00, 4.30 Hz, 1 0.89 min. one H) 4.89 - 4.96 (m, 1 H) 5.81 (dd, J=9.00, HRMS(A)
4.30 Hz, 1 H) 7.34 - 7.42 (m, 3 H) 7.45 (t, m/z
J=7.63 Hz, 2 H) 7.59 - 7.64 (m, 2 H) 7.67 401.1988 (m, J=8.20 Hz, 2 H) 7.79 (d, J=7.04 Hz, 1 (M + H)+; H) 8.10 (d, J=7.04 Hz, 1 H) Rt-1.89
min
589: (S)-3-(2-(1 - (CD3OD) 0.17 - 0.24 (m, 1 H) 0.31 (dq, HRMS(A) cyclopropylethylamino)-5- J=9.34, 4.71 Hz, 1 H) 0.41 - 0.55 (m, 2 H) m/z fluoropyrimidin-4-yl)- 0.93 - 1 .04 (m, 1 H) 1 .26 (d, J=6.65 Hz, 3 464.1 125 4,4,5,5- H) 1 .42 (s, 6 H) 1 .49 (s, 6 H) 3.34 - 3.42 (M + H)+, tetramethyloxazolidin-2- (m, 1 H) 8.17 (d, J=3.13 Hz, 1 H) MS m/z Rt 2.28 one 323.6 (M + H)+; Rt-0.89 min. HRMS m/z min
323.1891 (M + H)+; Rt-2.10 min
The compounds in Table 28 were prepared using methods similar to those described for the preparation of Example 568
Table 28.
Figure imgf000278_0001
IJ77
Figure imgf000279_0001
Figure imgf000280_0001
Table 29. Chemical name, NMR chemical shifts and LCMS signal for each compound listed in Table 28.
Figure imgf000280_0002
Figure imgf000281_0001
Figure imgf000282_0001
Biological Data
Mutant IDH1 biochemical assay: LC-MS detection of 2-HG.
Mutant IDH1 R132H catalytic activity was monitored using the quantitative liquid chromatography/mass spectrometry (LC-MS) detection of 2-HG, a product of the NADPH-dependent alpha-KG reduction reaction.
More specifically, the biochemical reactions were performed at room temperature in 384-well Greiner flat-bottom plates (Costar, Cat. No. 781201 ) using a final reaction volume of 30 μΙ_ and the following assay buffer conditions: 50 mM HEPES pH 7.4, 10 mM MgCI2, 50 mM KCI, 1 mM DTT, 0.02% BSA, 5 uM NADPH and 100 uM alpha-KG.
The final reaction mixture contained 3.3% DMSO and inhibitors with concentrations ranging 0.02 - 50 μΜ. The IDH1 enzyme was used at a final concentration of 0.25 nM. Following 45 minutes incubation, the reaction mixtures were quenched by the addition of 10 μΙ_ of 16% formic acid containing 800 nM of 5-carbon labeled 13C-2-HG). The protein was then precipitated by the addition of 2.5 volumes of acetonitrile followed by centrifugation (3000 x g, 20 minutes). The concentration of 2-HG in the resulting supernatants was measured by LC-MS (see below).
LC-MS method. Reaction mixture supernatants were submitted to chromatographic separation on a BiobasicAX column (2.1 mm x 20 mm, 5 μηη particle, Thermo Scientific Inc.). The chromatographic mobile phases were A) 25 mM ammonium biocarbonate and B) acetonitrile (0.1 % ammonium hydroxide). Nicotinamide was eluted at 1 ml/min using a 85-5% B gradient over 0.9 minutes (Agilent 1200SL LC system, Thermofisher LX-4 autosampler) and analyzed by multiple reaction monitoring (MRM) on a API4000 QTrap mass spectrometer (ABSciex, Framingham, MA) in the positive electrospray ionization (ESI+) mode. The mass transition for 2-HG and 13C-2-HG were 147^129 and 152^134, respectively. The relative responses (2-HG/13C-2-HG) were measured at varied inhibitor concentrations and used to calculate inhibitory IC50 values (normalized IC50 regression curves).
R132 protein expression and purification.
IDH1 R132H was cloned into the pET47b vector using the restriction sites Xmal/Xhol which yields an in frame, N-terminal His6 site cleavable with Prescission protease. This plasmid was transformed into Rosetta™ 2(DE3) (Novagen) cells. In shake flasks, 8L of cells were grown in Terrific Broth (Teknova) (plus kanamycin 50μg/mL and chloramphenicol 34μg/mL) at 37°C to an OD6oo of 0.8 and protein expression was induced by addition of IPTG to a concentration of 0.20mM. The cells were subsequently grown for 18 hours at 18°C. His6-IDH1 (R132H) Uncut protein
MAHHHHHHSAALEVLFQGPGMSKKISGGSWEMQGDEMTRIIWELIKEKLIFPYVELDL HSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGT IRNILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFWPGPGKVEITYTPSD GTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKK YDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDV QSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIF AWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNT FEFMDKLGENLKIKLAQAKL (stop) (SEQ ID NO: 1 ) IDH1 (R132H) Prescission Cut Protein (N-term gpg is cloning artifact)
GPGMSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVT KDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIP RLVSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGG VAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYK SQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTS VLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKE LAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA KL (stop) (SEQ ID NO: 2)
Purification
The cells were homogenized in Lysis Buffer with protease inhibitors (complete
EDTA-free protease inhibitor tablets (Roche), 1 tablet per 50ml_ of buffer), DNAse, and to 200 μΜ PMSF and lysed in a Microfluidizer. After lysis, Triton X-100 was added to 0.1 % and stirred at 4°C for 30 minutes.
The cleared lysate was loaded onto 2 x 5ml_ HisTrap FF crude columns (GE), washed extensively with Lysis Buffer until the A2so stabilized and eluted with Ni Elution Buffer. Peak eluted fractions were concentrated to 30mL, EDTA was added to 1 mM and GST-Prescission protease was added to 3U/100μg of protein. The sample was dialyzed against 2L Dialysis Buffer I (MWCO 50kDa) for 6 hours at 4°C then dialyzed against 2L of Dialysis Buffer II for at least 6 more hours. GST-Prescission cleaved sample was rocked with Glutathione Agarose Beads, spun down and then the supernatant was loaded through a 5mL HisTrap HP column and the flow through was collected.
Flow through was then diluted with ice cold 20mM Tris pH 7.4 and 1 mM TCEP until the conductivity dropped to less than 5 mS/cm (a roughly three fold dilution). This sample was then flowed through a HiTrap Q column and the flow through was concentrated to 10mL and loaded onto an equilibrated 26/60 Superdex 200 column using SEC Buffer as the mobile phase. Peak fractions were collected, concentrated and aliquoted.
Lysis Buffer: 50mM Tris pH=7.4, 500mM NaCI, 20mM Imidazole, and 1 mM TCEP Ni Elution Buffer: 50mM Tris pH=7.4, 150mM NaCI, 200mM Imidazole, and 1 mM
TCEP
Dialysis Buffer I: 20mM Tris pH=7.4, 150mM NaCI, 1 mM TCEP, and 50mM Imidazole
Dialysis Buffer N:20mM Tris pH=7.4, 150mM NaCI, and 1 mM TCEP
SEC Buffer: 20mM Tris pH=7.4, 150mM NaCI, and 1 mM TCEP
The results of the mutant IDH1 biochemical assay (mIDH R132H) are given in Table 30. Some of the examples were run in the assay multiple times and therefore the IC 0 values are expressed as a range of activity. Fluorescence biochemical assay
The IDH1 (R132H) mutant catalyzes the reduced form of NADP+ (NADPH) and oketoglutarate (a-KG) to form nicotinamide adenine dinucleotide phosphate (NADP+) and R (-)-2-hydroxyglutarate (2HG). The reaction can be monitored kinetically by following the oxidation of NADPH to NADP+ which is measured using fluorescence, excitation at 355 nm and emission at 530 nm. Reactions were monitored using the Perkin-Elmer Envision, Model 2101 . More specifically, the biochemical reactions were performed at room temperature in 384-well Greiner flat-bottom plates (Cat. No. 781076) using a final reaction volume of 20 μΙ_ and the following assay buffer conditions: 50 mM HEPES pH 7.5, 10 mM MgCI2, 1 mM DTT, 0.02% BSA, 0.02% Tween-20, 10 μΜ NADPH and 100 μΜ α-KG. The final reaction mixture contained 2.5% DMSO and test compounds with concentrations ranging 0.0000008 - 25 μΜ. The IDH 1 (R132H) enzyme was used at a final concentration of 10 nM. Curve fitting for dose response IC50 determinations was done in the Helios module of the software package DAVID. The 4- parameter logistic model was used: y = min + ((max - min) / 1 + (x / IC5o)slo e)
Table 30. Results of the LC-MS and fluorescence biochemical assays.
Example Number LC-MS Fluorescence
biochemical biochemical
assay ΙΟ50 (μΜ) assay IC50 (μΜ)
1 0.084 - 0.236
2 >50
3 0.086 - 0.575 0.091 -0.501
4 4.612
5 0.410-0.600
6 12.175
7 2.527
8 13.01 1
9 6.444
10 0.355-0.419
1 1 0.770 - 4.552
12 1.990 - 2.391 9.55
13 18.344 - 29.100
14 2.333 - 2.814 15 5.383
16 >50
17 7.625
18 >50
19 >50
20 >50
21 4.169
22 19.671
23 0.502 -0.591
24 3.564
25 18.182- >50
26 >50
27 2.486-2.730
28 4.427-4.625
29 4.630- 11.566
30 1.072
31 1.721
32 9.797
33 3.483
34 7.588
35 0.222 - 0.273
36 17.576
37 4.595
38 >50
39 8.806
40 20.34
41 0.291 -0.581
42 0.584
43 7.686
44 0.125
45 >50
46 0.234
47 7.481
48 2.090-2.601 1.91
49 2.803
50 0.076-0.100 51 19.457
52 23.847
53 3.852
54 0.141
55 3.494
56 9.502
57 1.393-3.153 7.58
58 >50
59 0.575
60 0.052 0.094
61 12.729
62 0.117-0.178
63 0.085-0.124
64 6.79
65 0.25
66 0.073
67 5.342
68 6.302
69 0.127-0.390
70 0.195-0.230
71 20.503
72 37.361
73 0.316
74 2.569
75 1.338 4.27
76 8.008
77 11.26
78 28.611
79 0.09
80 0.679
81 0.103
82 0.163-0.217
83 0.238 - 0.462
84 0.075
85 1.061 17.9
86 9.767 87 0.126 0.245
88 0.148-0.344
89 0.203 0.308
90 0.272 0.275
91 2.875
92 0.211 -0.544 0.598
93 0.405-0.905
94 4.487
95 0.655 0.571
96 >50
97 0.195 0.166
98 0.628
99 0.184
100 0.169
101 2.382
102 0.401
103 3.184
104 0.207
105 0.352 0.352
106 1.918
107 3.445
108 >50
109 0.542 0.939
110 0.188 0.284
111 0.125
112 7.768
113 1.925
114 0.697 1.14
115 0.092 0.126
116 2.038
117 0.163-0.217
118 1.302-2.152
119 0.117 0.149
120 0.258-0.847
121 0.081-0.448
122 0.157-0.379 123 0.112 0.162
124 0.081 -0.298 0.791
125 1.012
126 0.118
127 0.158 0.215
128 0.565
129 0.467
130 0.549-0.615
131 14.319
132 31.016
133 7.115
134 3.102
135 11.6
136 6.455
137 3.14
138 1.061
139 1.252 2.5
140 0.089 0.114-0.181
0.095
■i A 0.390-0.512
143 >50
144 >50
145 6.807
146 11.362
147 6.445
148 3.544
149 0.647
150 0.53 0.538
151 1.363
152 0.385 0.598
153 0.759 0.582
154 0.049 0.091
155 0.04
156 0.232 0.248
157 >50
158 0.873 1.41 159 0.287
160 6.078
161 6.502
162 0.009-0.035 0.020-0.043
163 0.149
164 0.067 0.0339
165 0.183 0.143
166 0.637 1.56
167 0.254
168 0.102
169 0.195
170 1.083
171 6.161
172 0.245 - 0.274
173 2.908
174 0.056 - 0.1 18 0.283
175 8.156
176 0.125 0.138
177 4.333
178 0.097 0.0687
179 5.973
180 0.194
181 10.232
182 0.309-0.370
183 36.818
184 0.696
185 6.066
186 0.04
187 3.899
188 0.089 0.17
189 0.1 17
190 2.134
191 6.969
192 0.221 0.294
193 0.097
194 4.333 195 5.748
196 0.083
197 15.05
198 0.173 0.179
199 2.435
200 0.08 0.0665
201 0.927
202 0.025 0.0541
203 1.856
204 0.062 0.0955
205 0.199 0.219
206 1.458 0.81
207 0.069 0.0169
208 0.085 0.108-0.183
209 0.088 0.0881
210 0.576 0.343
21 1 0.439
212 0.132 0.024
213 2.913
214 0.298 0.791
215 0.390 0.419
216 0.031 0.0206
217 0.177 - 0.206 0.079-0.146
218 1.373 0.625
219 0.613
220 0.529 0.247
221 0.098 0.0476
222 0.505 0.296
223 0.293 0.14
224 <0.022 0.0166
225 0.026 0.0173
226 0.1 14 0.0832
227 0.065 0.0339
228 0.067 0.0463
229 0.1 13 0.0662
230 0.072 0.0415 231 0.327 0.242
232 0.251 0.755
233 0.147 0.0684
234 > 50 > 25
235 0.039 0.0141
236 0.372 0.338
237 0.877 0.219
238 9.8
239 0.038 0.073
240 0.030 0.0506
241 0.155 0.213
242 0.048 0.242
243 0.260 - 0.914 1.21-1 .6
244 0.863 0.774
245 0.184 0.103
246 0.497 - 0.589 0.236-0.316
247 1.373 1.79
248 0.687 0.842
249 0.585 0.616
250 0.031 0.0468
251 0.064 0.0878
252 0.033 0.0608
253 0.559
254 0.656 1.12
255 10.369
256 0.197
257 0.242 - 0.282 0.221 -0.27
258 0.378
259 2.569
260 0.186
261 0.040 0.0639
262 0.058 0.0991
263 0.679
264 0.108
265 <0.022 0.0232
266 0.152 267 3.308
268 20.567
269 0.467
270 0.463
271 0.100 0.108
272 1.717 2.28
273 0.202 0.143
274 0.104 0.0524
275 0.261 0.273
276 0.298 0.175
277 0.094 0.0899
278 0.241 0.29
279 0.312
280 7.823
281 <0.022
282 0.180
283 0.538 0.635
284 2.023 1.38
285 0.390 0.375
286 1.807 2.54
287 34.794 > 25
288 0.053 0.269
289 0.316 0.19
290 2.222 0.414-0.975
291 4.64
292 0.049 0.0645
293 2.696
294 0.095 0.648
295 0.342 0.252
296 0.085
297 0.848
298 0.188 1.04
299 4.052 10.4
300 1.639 1.84
301 0.0887
302 0.131 303 0.326
304 2.107
305 0.065 0.0413
306 4.043 12.5
307 0.225
308 0.259 0.703
309 0.868 1.66
310 36.281 > 25
31 1 4.139
312 0.051 0.024
313 0.073 0.0799
314 1.31 1 1.59
315 5.916
316 0.131
317 0.050
318 5.007
319 0.705
320 2.410
321 1.214
322 0.026 0.0666
323 17.1
324 0.483
325 15.718 18.5-21.4
326 0.1 15 0.268-0.369
327 19.2
328 0.329 - 1 .144 0.558-0.843
329 2.164 5.62
330 0.026 0.0545
331 6.083 7.65
332 0.052 - 0.072 0.0693
333 0.128 0.335
334 0.646
335 6.53
336 0.236
337 7.22
338 0.148 0.145 339 3.101 4.4
340 <0.022 0.0276
341 2.13
342 0.029 0.0278
343 4.08
344 0.265
345 > 50
346 32.256
347 > 50
348 > 50
349 4.010 24.2
350 0.583 0.731
351 > 50
352 > 50
353 > 50
354 > 50
355 33.589 > 25
356 1.642 4.53
357 13.229
358 0.864 1.53
359 > 50 > 25
360 3.035 4.37-1 1.9
361 0.781 0.736
362 0.063 0.0621
363 14.441 23.3
364 0.964 1.06
365 > 50 > 25
366 2.602 20.2-21.7
367 20.809 > 25
368 0.706 0.862
369 > 50 > 25
370 6.649 3.01
371 25.036 > 25
372 4.19
373 39.696 > 25
374 1.617 1.89-2.42 375 > 50 > 25
376 2.321 3.27-4.33
377 >25
378 4.19
379 > 25
380 0.839
381 20
382 0.203 0.349
383 5.16
384 0.068 0.107
385 22.5
386 4.74
387 20.6
388 4.37
389 1.83
390 0.140 0.213
391 2.35-5.33
392 0.694 0.355-0.697
393 12.1
394 0.268 0.34
395 9.36
396 0.189 0.224
397 7.14
398 0.094 - 0.123 0.189
399 > 25
400 0.648
401 19
402 0.362 0.39
403 > 25
404 0.964
405 21 .1
406 1.82
407 6.39
408 0.237 0.349
409 1.35
410 0.340 - 0.440 0.098-0.521 41 1 2.907
412 0.190
413 21 .616
414 6.026 - 7.675 5.47-8.32
415 26.674
416 1.592
417 20.287
418 0.808
419 2.833
420 > 50
421 27.999 > 25
422 2.136 3.81
423 7.595 14.8
424 0.162 0.491 -0.747
425 0.909 2.45
426 <0.022 - 0.038 0.019-0.058
427 1.229 2.09
428 > 50 > 25
429 6.407 9.78
430 0.133 0.0908
431 0.568 0.81 1
432 0.040 0.0448
433 6.675 5.31
434 0.153 2.19-3.96
435 > 25
436 0.291 0.364-0.373
437 2.69-3.18
438 > 25
439 6.155
440 0.125 0.105-0.122
441 4.229 1.63-10.6
442 0.136 0.225
443 0.063 - 0.077 0.0414
444 0.040 0.0266
445 2.526 2.46
446 0.079 - 0.081 0.039 447 3.876
448 0.034 0.0373
449 5.43
450 0.062 0.0518
451 0.207 0.386
452 0.063 - 0.065 0.134
453 1 1 .400 14.5
454 0.401 0.601
455 6.218 > 25
456 0.082 0.041
457 <0.022 0.013
458 0.069 0.0588
459 0.991 1.16
460
461 2.275
462 1.924 2.87
463 > 50
464 <0.022 0.020-0.055
465 0.164
466 0.665 0.821
467 9.82
468 3.03-1 1.8
469 0.077 0.185-0.198
470 0.075 0.172
471 0.925 0.78
472 14.8
473 0.0986
474 7.1
475 0.341 0.355
476 > 50
477 > 50
478 > 50
479 > 50
480 > 50
481 0.780 2.52
482 >50 >25 483 0.096 0.202
484 5.160 21 .3
485 2.12
486 0.873
487 1
488 0.31 1 0.437
489 4.15
490 2.61
491 0.821
492 0.249
493 0.067 0.139
494 1.649 0.595
495 0.712 0.734
496 0.751 0.723
497 1.13
498 5.27
499 2.39
500 1.45
501 0.494
502 0.305
503 0.546 0.96
504 0.268 0.243
505 0.275
506 0.46
507 0.0773
508 0.553 0.484
509 0.553 0.484
510 0.0294
51 1 0.062
512 0.450 0.38
513 0.0336
514
515 0.0287
516 0.082 0.0592
517 1.58
518 0.0785 519 0.123 0.363
520 0.080 0.053-0.321
521 0.23
522 0.745
523 0.165
524 0.026 0.021 1
525 0.085 0.108-0.183
526 0.088 0.0427
527 0.0851
528 0.077 0.0613
529 0.1 17 0.0622
530 <0.022 0.00835
531 0.00812
532 0.0727
533 0.307 0.227
534 0.188 0.331
535 0.183
536 0.104
537 0.400 0.257
538 0.416 0.268
539 2.66
540 0.878 0.573
541 0.266 0.0899
542 0.090 0.0877
543 > 25
544 0.075 0.0477
545 0.0943
546 0.059 0.0423
547 0.158 0.146
548 0.184
549 1.840
550 0.791 0.276
552 <0.022 0.0199
553 0.521 0.41
554 0.075 0.217
555 <0.022 556 <0.072
557 0.246 0.237
558 0.283
559 17.6
560 25
561 0.552
562 0.364
563 0.04
564 0.0501
565 0.309
566 0.135 0.13
567 5.41
568 0.086 - 0.141 0.067-0.161
569 0.0575
570 0.0446
571 0.0742
572 0.0781
573 0.00786
574 0.204 0.324
575 1.91
576 2.37
577 1.65
578 1.07
579 0.91 1 0.591
580 0.153 0.193
581 0.260 0.432
582 0.204
583 > 25
584 10.6
585 6.7
586 2.797 1.02
587 1.95
588 0.764 0.85
589 2.92
590 <0.022 0.006-0.009
591 <0.022 0.018 592 0.138 0.077
593 0.077 0.036
594 0.257 0.178
595 0.121 0.053
596 0.161 0.154
597 0.457 0.741
598 0.519 0.715
599 0.155 0.265
600 0.488 0.729
601 0.042 0.042
602 0.049 0.034
603 0.244 0.336
604 0.1 12 0.161
IDH Cellular Assay
The IDH cellular assay consists of two side-by-side comparator assays: 1 ) 2HG oncometabolite detection assay using LC-MS (See Mutant IDH1 biochemical assay for LC-MS detection details) and 2) Cell proliferation assay to monitor off-target killing of cells and to normalize 2HG level change. IDH1 cellular screens were run with the HCT- 1 16 cell line (express endogenous level of IDHI mut R132H, available from Horizon Discoveries X-Man isogenic human cell lines, catalog # HD104-013). The cells were grown in DMEM (LONZA Cat# 12-540F) with 10% Fetal bovine serum (Gibco cat# 10099) and 1 X non-essential amino acids (NEAA LONZA cat# 13-1 14E). Panel assays were run periodically to test compound activity in cell lines with different endogenous mutations - HT1080 (IDHI mut R132C, EMEM + 10% FBS), SNU-1079 (IDHI mut R132C, RPMI + 10%FBS + 1 % sodium pyruvate), and SW1353 (IDH2mut R172S, RPMI + 10%FBS + 1 % sodium pyruvate).
The assay process is as follows:
Day 1 : cells were seeded in 384-well plates (Corning Cat# 3707) in triplicates for both the cell proliferation and 2HG assay, and incubated at 37C, 95% Rh, 5% C02 overnight. Day 2: compounds were serially diluted 1 :3 (10 point dilution from 10mM solutions in DMSO) and delivered to the cell assay plates via acoustic dispenser, with final concentration ranging from 30uM to 1.5nM. The plates were returned to the incubator after treatment and incubated for 48 hours.
Day 4 Proliferation assay: CTG (cell titer-glo, Promega part # G755B) was added to the assay plates and luminescence signal was read on the plate reader. Day 4 2HG assay : Extraction sample preparation consisted of aspirating all media from the assay plates, adding 70 ul of 90% methanol in water, dry ice incubation for 15 minutes, centrifuging at 2000 rpm for 30 min to ensure all particulates have settled, and transferring 30 ul of the supernatant into LC-MS ready plates. LC-MS analysis follows.
Certain compounds of the invention have been tested in the IDH Cellular Assay.

Claims

CLAIMS What is claimed is:
1 . A compound of formula
Figure imgf000304_0001
wherein:
R ' and R2 are each independently hydrogen, deuterium, halo, hydroxyl, NH2, aryl, heteroaryl, or optionally substituted C-1.4 alkyl,
wherein said C-1.4 alkyl is optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, and NH2;
R^a is hydrogen, deuterium, C-| .g alkyl, phenyl, or benzyl and
R3b is hydrogen, deuterium, or C-| .g alkyl; or R^a and R3b are joined together forming an optionally substituted 3-7 membered cycloalkyi ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyi and heterocyclic rings are each optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, N H2, and C-1.3 alkyl;
R4a is hydrogen, C-| .g alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene,
wherein said phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.4 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-| .g alkyl,
C3_g cycloalkyi, phenyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy,
-COORb, -S02Rb, -NHC(0)Rb, and -NRbRb and
R4b is hydrogen, deuterium, or C-1.3 alkyl; or R^a and R4b are joined together forming an optionally substituted 3-7 membered cycloalkyi ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyi and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl,
provided that only one of R^A and R3b and R^A and R4b are joined together forming a ring;
R^a is hydrogen or deuterium;
R5D js hydrogen, deuterium, methyl, ethyl, CD3, CF3, CH2F, or CHF2 and
R6 is optionally substituted C-|.g alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclic, or optionally substituted C3.-10 cycloalkyi, wherein said C-|.g alkyl is optionally substituted with one substituent selected from the group consisting of hydroxyl, C-1.3 alkoxy and -ORA,
wherein said aryl, heteroaryl, heterocyclic and C3.-10 cycloalkyi are optionally substituted with one to three substituents each independently selected from the group consisting of: halo; hydroxyl; cyano; nitro; C-1.4 alkoxy; C-1.3 haloalkyi; C-1.3 haloalkoxy;
C-| _5 alkyl; C3_g cycloalkyi optionally substituted with one to three substituents each independently selected from the group consisting of: hydroxyl, cyano, C-1.3 alkyl, C-1.3 alkoxy, and C-1.3 haloalkyi; phenyl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-| _3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-|.g alkyl, C3_g cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy, -COORB, -SC>2RB, -NHC(0)RB, and
NRBRB; 5-6 membered heteroaryl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, C-1.3 alkyl, C-1.3 alkoxy; 5-6 membered heterocyclic optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-| _3 alkyl; -CH2RA; -ORA; -C(0)RA; -NRARB; -COORA; -S02RA;
-S02RB; -NHC(0)RA; -NHC(0)RB; -C(0)NRARB ; -C(0)N HRB; and -S02NRBRB; or R5b and are joined together forming an optionally substituted C3.7 cycloalkyi group
Figure imgf000306_0001
or an optionally substituted group of formula (a): (a),
wherein n is 1 , 2, or 3 and
said C3.7 cycloalkyi and group of formula (a) are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-| .g alkyl, 03.5 cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, benzyloxy, -COORb, -S02Rb, -NHC(0)Rb, and -NRbRD; each Ra is independently optionally substituted phenyl, optionally substituted heteroaryl, optionally substituted heterocyclic, or optionally substituted C3.7 cycloalkyi,
wherein said phenyl and heteroaryl are optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl,
wherein said heterocyclic is optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-1.4 alkyl, C3.5 cycloalkyi, -C(0)Rb, and -NRbRb and
wherein said C3.7 cycloalkyi is optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-| _3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl; and each Rb is independently hydrogen or C-| .g alkyl; or a pharmaceutically acceptable salt thereof.
2. The compound according to claim 1 of the formula (I I I)
Figure imgf000307_0001
(III); or a pharmaceutically acceptable salt thereof.
3. The compound according to claim 2 of the formula (IV)
Figure imgf000307_0002
(IV); or a pharmaceutically acceptable salt thereof.
4. The compound according to claim 3 wherein R^a and R3b are both hydrogen; or a pharmaceutically acceptable salt thereof.
5. The compound according to claim 4 wherein R^a js hydrogen and R^b is hydrogen, methyl, ethyl, or CF3; or a pharmaceutically acceptable salt thereof.
6. The compound according to claim 5 wherein R^b js methyl; or a pharmaceutically acceptable salt thereof.
7. The compound according to claim 6 wherein is hydrogen, fluoro or chloro and R^ is hydrogen, fluoro, chloro, or methyl; or a pharmaceutically acceptable salt thereof.
8. The compound according to claim 7 wherein and R^ are both hydrogen; or a pharmaceutically acceptable salt thereof.
9. The compound according to claim 8 wherein R^a js hydrogen, C-|.g alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene, wherein said phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-| .g alkyl,
C3_g cycloalkyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy,
-COORb, -S02Rb,- NHC(0)Rb, and- NRbRb and
R4b is hydrogen or C-1.3 alkyl; or a pharmaceutically acceptable salt thereof.
10. The compound according to claim 9 wherein R4b is hydrogen or methyl; or a pharmaceutically acceptable salt thereof.
1 1 . The compound according claim 10 wherein R^b is hydrogen; or a pharmaceutically acceptable salt thereof.
12. The compound according to claim 1 1 R^a is hydrogen, methyl, ethyl, isopropyl, phenyl, 4-fluorophenyl, 4-methoxyphenyl, biphenyl, benzyl, or pyridinyl; or a
pharmaceutically acceptable salt thereof.
13. The compound according to claim 12 wherein R^a is isopropyl; or a
pharmaceutically acceptable salt thereof.
14. The compound according to any one of claims 1 -13 wherein R^ is methyl, C .10 cycloalkyl, optionally substituted phenyl, optionally substituted pyridinyl, optionally substituted pyrimidinyl, optionally substituted pyridazinyl, optionally substituted pyrazinyl, optionally substituted triazolyl, optionally substituted pyrazolyl, optionally substituted thiazolyl, optionally substitued 1 ,3,4-oxadiazolyl, optionally substituted 1 ,2,4-oxadiazolyl, optionally substitued isoxazolyl, thienyl, oxazolyl, quinolinyl, optionally substituted benzimidazolyl, benzthiazolyl, benzoxazolyl, tetrazolo[1 ,5-a]pyridinyl, imidazo[2, 1 - b][1 ,3,4]thiadiazolyl, optionally substituted piperidinyl, optionally substituted piperazinyl, tetrahydrofuranyl, tetrahydropyranyl, optionally substituted tetrahydro-thiopyran 1 , 1 - dioxide, 1 H-pyrrolo[2,3-b]pyridinyl, 2,3-dihydro-benzo[1 ,4]dioxinyl, 5,6,7,8-tetrahydro- [1 ,2,4]trazolo[4,3-a]pyrazinyl, 4,5,6,7-tetrahydro-benzothiazolyl, indolizinyl, cyclopropyl, cyclopentyl, or cyclohexyl, wherein said phenyl, pyridinyl, pyrimidinyl, pyridazinyl, pyrazinyl, triazolyl, pyrazolyl, thiazolyl, 1 ,3,4-oxadiazolyl, 1 ,2,4-oxadiazolyl, isoxazolyl, benzimidazolyl, piperidinyl, piperazinyl, and tetrahydro-thiopyran 1 , 1 -dioxide are each optionally substituted with one or two substituents as defined in formula (I).
15. The compound according to claim 14 wherein is optionally substituted with one or two substituents each independently selected from the group consisting of: halo; hydroxy; nitro; C-1.4 alkoxy; C-1.3 haloalkyl; C-1.3 haloalkoxy; C-| .g alkyl; 03.5 cycloalkyl optionally substituted with one substituent selected from the group consisting of: cyano, C-| _3 alkyl, and C-1.3 alkoxy; phenyl optionally substituted with one or two substituents each independently selected from the group consisting of: fluoro, chloro, methyl, cyano, and methoxy; and 5-6 membered heteroaryl optionally substituted with one or two methyl groups; or a pharmaceutically acceptable salt thereof.
16. The compound according to claim 15 wherein is optionally substituted 1 ,3,4- oxadiazolyl or optionally substituted 1 ,2,4-oxadiazolyl; or a pharmaceutically acceptable salt thereof.
17. The compound according to claim 14 wherein is substituted with one -Ch^R3,
-C(0)Ra, -NHC(0)Ra, -NHC(0)Rb, -C(0)NHRa, C(0)NHRb, -ORa, -NRaRb, -SC>2NRbRb -SC>2Ra or -S02Rb group; or a pharmaceutically acceptable salt thereof.
18. The compound according to claim 17 wherein Ra is
(a) phenyl optionally substituted with one or two substituents each independently selected from the group consisting of fluoro, chloro and bromo;
(b) optionally substituted 5-6 membered heteroaryl;
(c) C5.7 cycloalkyl optionally substituted with one or two substituents each independently selected from the group consisting of fluoro, hydroxy, methyl, and C-1.3 haloalkoxy; or
(d) a heterocyclic group selected from the group consisting of: piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, tetrahydro-thiopyran 1 , 1 -dioxide, 1 ,4- diazepanyl, 4,7-diaza-spiro[2.5]octanyl, 3,8-diaza-bicyclo[3.2.1 ]octanyl, 3,8-diaza- bicyclo[4.2.0]octanyl, octahydro-pyrrolo[1 ,2-a]pyrazinyl, octahydro-pyrido[1 ,2-a]pyrazinyl, octahydro-pyrrolo[3,4-c]pyrrolyl, and 5,6,7,8-tetrahydro-imidazo[1 ,2-a]pyrazinyl each of which is optionally substituted with one to three substituents each independently selected from the group consisting of: hydroxy, fluoro, amino, dimethylamino, C-1.3 haloalkoxy,
C-| _3 alkyl, and C3.5 cycloalkyl; or a pharmaceutically acceptable salt thereof.
19. The compound according to claim 18 wherein is optionally substituted phenyl; or a pharmaceutically acceptable salt thereof.
20. The compound according to claim 19 wherein the phenyl is substituted with one -CH2 a, -C(0)Ra, or -C(0)NHRa group in the para position; or a pharmaceutically acceptable salt thereof.
21. The compound according to claim 2 of the formula (V)
Figure imgf000310_0001
wherein R^a js phenyl and R^b is hydrogen; or a pharmaceutically acceptable salt there
22. The compound according to claim 1 selected from the group consisting of:
(S)-4-isopropy-3-(2-(((S)-1 -(4-(2-yl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one; N-(4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)phenyl)cyclohexanecarboxamide;
(S)-3-(2-(((S)-1 -(3-fluoro-4-((4-methylpiperazin-1 - yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one;
(S)-4-isopropyl-3-(2-(((S)-1 -(4-((3,3,4-trimethylpiperazin-1- yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one;
2-fluoro-N-(4-hydroxy-4-methylcyclohexyl)-4-((S)-1-((4-((S)-4-isopropyl-2-oxooxazolidin- 3-yl)pyrimidin-2-yl)amino)ethyl)benzamide;
(S)-3-(2-((S)-1-(4-((4-amino-4-methylpiperidin-1-yl)methyl)phenyl)ethylamino)pyrimidin-4- yl)-4-isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1 -(4-((4-(dimethylamino)piperidin-1 -yl)methyl)phenyl)ethylamino)pyrimidin- 4-yl)-4-isopropyloxazolidin-2-one;
(S)-4-isopropyl-3-(2-((S)-1 -(4-((4-methylpiperazin-1 - yl)methyl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one;
(S)-4-isopropyl-4-methyl-3-(2-((S)-1-(4-((4-methylpiperazin-1- yl)methyl)phenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one;
(S)-4-isopropyl-3-(2-((S)-1 -(6-phenylpyridin-3-yl)ethylamino)pyrimidin-4-yl)oxazolidin-2- one; (S)-3-(2-((S)-1 -(4-benzoylphenyl)ethylamino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-^ (S)-4-isopropyl-3-(2-(((S)-1-(5-phenyl-1 ,3,4-thiadiazol-2-yl)ethyl) amino) pyrimidin-4- yl)oxazolidin-2-one;
(4S)-4-isopropyl-3-(2-(1 -(5-phenylpyrimidin-2-yl)ethylamino)pyrimidin-4-yl)oxazolidi one;
3- (5-fluoro-2-((1 -(5-(4-fluoro-3-methylphenyl)pyridin-2-yl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one;
(S)-4-isopropyl-3-(2-(((S)-1-(1-(3-methoxyphenyl)-1 H-pyrazol-4-yl)ethyl)amino)pyrimidin-
4- yl)oxazolidin-2-one;
(S)-3-(2-(((S)-1 -(5-(4-fluorophenyl)-1 ,3,4-oxadiazol-2-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-4-isopropyl-3-(2-(((S)-1 -(3-(m-tolyl)-1 ,2,4-oxadiazol-5-yl)ethyl)amino)pyrimidin-4- yl)oxazolidin-2-one;
(S)-3-(2-(((S)-1 -(3-(4-fluorophenyl)-1 ,2,4-oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(5-(4-fluoro-2-methylphenyl)pyrim^
isopropyloxazolidin-2-one;
(S)-4-lsopropyl-3-{2-[(3-p-tolyl-[1 ,2,4]oxadiazol-5-ylmethyl)-amino]-pyrimidin-4-yl}- oxazolidin-2-one;
(S)-4-isopropyl-3-(2-((S)-1-(4-(1-methyl-1 H-pyrazol-4-yl)phenyl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one;
(S)-3-(2-((S)-1 -(2-fluoro-4-isopropylphenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(4-isobutoxy-3-methylphenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2- one;
(S)-3-(5-fluoro-2-(((S)-1-(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
2-fluoro-N-(frans-4-hydroxycyclohexyl)-4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzamide;
(S)-3-(5-fluoro-2-((S)-1 -(3-fluoro-4-(piperidine-1-carbonyl)phenyl)ethylamino)pyrimidin-4- yl)-4-isopropyloxazolidin-2-one;
N-cyclohexyl-2-fluoro-4-((S)-1-(5-fluoro-4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin- 2-ylamino)ethyl)benzamide; N-cyclohexyl-2-fluoro-4-((S)-1-(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzamide; and
(S)-3-(5-fluoro-2-((S)-1 -(2-fluoro-4-(trifluoromethy^
isopropyloxazolidin-2-one; or a pharmaceutically acceptable salt thereof.
23. The compound according to claim 1 selected from the group consisting of:
(S)-3-(2-(((S)-1 -(3-fluoro-4-((3,3,4-trimethylpiperazin-1- yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(4-((4,4-difluoropiperidin-1 -yl)methyl)phenyl)ethyl)amino)pyrimidin-4-yl)- 4-isopropyloxazolidin-2-one;
(S)-3-(5-fluoro-2-(1 -(4-phenoxyphenyl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one;
(S)-3-(2-((S)-1-(4-(4-fluorophenoxy)phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(4-(((2S,6R)-2,6-dimethylmorpholino)methyl)phenyl)ethylamino)pyrimidin- 4-yl)-4-isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(5-(4-chlorophenyl)-1 ,2,4-oxadiazol-3-yl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(5-(4-fluoro-3-methylphenyl)pyridin-2-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1 -(5-(4-fluorophenoxy)pyrimidin-2-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1-(5-(4-fluorophenoxy)pyrazin-2-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
(S)-4-isopropyl-3-(2-((S)-1 -(5-(3-(trifluoromethyl)phenyl)pyrimidin-2- yl)ethylamino)pyrimidin-4-yl)oxazolidin-2-one; and
(S)-3-(2-((S)-1-(5-(4-fluoro-3-methylphenyl)pyrimidin-2-yl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one; or a pharmaceutically acceptable salt thereof.
24. The compound according to claim 1 selected from the goup consisting of:
(S)-3-(2-(1-(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethylamino)-5-fluoropyrimidin-4-yl)- 4,4-dimethyloxazolidin-2-one;
(S)-3-(6-chloro-2-(1 -(3-(4-chlorophenyl)-1 ,2,4-oxadiazol-5-yl)ethylamino)pyrimidin-4- yl)oxazolidin-2-one;
(S)-3-(2-((S)-1 -(2-fluoro-4-(1 -methylcyclopropyl) phenyl) ethylamino) pyrimidin-4-yl)-4- isopropyloxazolidin-2-one; (S)-3-(2-((S)-1 -(2-fluoro -4-(trifluoromethyl) phenyl)ethylamino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one;
2-chloro-N-cyclopentyl-4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3-yl)pyrimidin-2- ylamino)ethyl)benzamide;
(S)-3-(2-((S)-1 -(4-((3,3-difluoropiperidin-1 -yl)methyl)phenyl)ethylamino)pyrimi isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1 -(4-(4,7-diazaspiro[2.5]octan-4-ylmethyl)ph
4-isopropyloxazolidin-2-one;
(S)-3-(2-((S)-1 -(4-((4-acetylpiperazin-1 -yl)methyl)phenyl)e ^
isopropyloxazolidin-2-one;
(S)-3-(2-(((S)-1 -(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4-isopropyloxazolidin-^^ one;
(S)-3-(5-fluoro-2-(((S)-1 -(4-isobutoxyphenyl)ethyl)amino)pyrimidin-4-yl)-4- isopropyloxazolidin-2-one; and
2-fluoro-N-(trans-4-hydroxycyclohexyl)-4-((S)-1 -(4-((S)-4-isopropyl-2-oxooxazolidin-3- yl)pyrimidin-2-ylamino)ethyl)benzamide; or a pharmaceutically acceptable salt thereof.
25. The compound according to claim 1 wherein
each R1 and R^ is independently hydrogen, deuterium, halo, hydroxyl, NH2, aryl, heteroaryl, or optionally substituted C-1.4 alkyl,
wherein said C-1.4 alkyl is optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, and NH2;
R3a is hydrogen, deuterium, C-| .g alkyl, phenyl, or benzyl and
R3b is hydrogen, deuterium, or C-| .g alkyl; or
R3a and R3b are joined together forming an optionally substituted 3-7 membered cycloalkyl ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyl and heterocyclic rings are each optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, N H2, and C-1.3 alkyl;
R4a is hydrogen, C-| .g alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene,
wherein said phenyl, benzyl, and heteroaryl rings are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-|.g alkyl, C3-6 cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy, COORb, S02Rb, NHC(0)Rb, and NRbRb and
R4b is hydrogen, deuterium, or C-1.3 alkyl; or
R^a and R4b are joined together forming an optionally substituted 3-7 membered cycloalkyi ring or an optionally substituted 4-7 membered heterocyclic ring,
wherein said cycloalkyi and heterocyclic rings are optionally substituted with one or two substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C-1.3 alkyl,
provided that only one of R^a and R3D and R^a and R^b are joined together forming a ring;
R^a is hydrogen or deuterium;
R5b js hydrogen, deuterium, methyl, ethyl, CD3, CF3, CH2F, or CHF2 and
R6 is optionally substituted C-| .g alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclic, or optionally substituted C .10 cycloalkyi, wherein said C-|.g alkyl is optionally substituted with one substituent selected from the group consisting of hydroxyl, C-1.3 alkoxy and -ORa;
wherein said aryl, heteroaryl, heterocyclic and C .10 cycloalkyi are optionally substituted with one to three substituents each independently selected from the group consisting of: halo; hydroxyl; cyano; nitro; C-1.3 alkoxy; C-1.3 haloalkyi; C-1.3 haloalkoxy;
C-| _5 alkyl; 03.5 cycloalkyi; phenyl optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C-| _3 alkoxy, C-1.3 haloalkyi, C-1.3 haloalkoxy, C-| .g alkyl, 03.5 cycloalkyi, 5-6 membered heteroaryl, 5-6 membered heterocyclic, phenoxy, COORb, SC>2Rb, NHC(0)Rb, and
NRbRb; 5-6 membered heteroaryl; 5-6 membered heterocyclic optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, oxo, NH2, and C<|_3 alkyl; -CH2Ra; -ORa; -C(0)Ra; -NRaRb; -COORa;
-S02Ra; NHC(0)Ra; and -S02NRbRb; 0r R5b and are joined together forming an optionally substituted C3.7 cycloalkyl group
Figure imgf000315_0001
or an optionally substituted group of formula (a): (a),
wherein n is 1 , 2, or 3 and
said C3.7 cycloalkyl and group of formula (a) are optionally substituted with one to three substituents each independently selected from the group consisting of: halo, hydroxyl, cyano, nitro, C1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, C-|.g alkyl, 03.5 cycloalkyl, 5-6 membered heteroaryl, 5-6 membered heterocyclic, benzyloxy, COORb, S02Rb, NHC(0)Rb, and NRbRb; each Ra is independently optionally substituted phenyl, optionally substituted heteroaryl, or optionally substituted 4-7 membered heterocyclic,
wherein said phenyl and heteroaryl are optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, cyano, nitro, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl,
wherein said 4-7 membered heterocyclic is optionally substituted with one to three substituents each independently selected from the group consisting of halo, hydroxyl, oxo, C-1.3 alkoxy, C-1.3 haloalkyl, C-1.3 haloalkoxy, and C-1.3 alkyl; and each Rb is independently hydrogen or C-|.g alkyl; or a pharmaceutically acceptabble salt thereof.
26. The compound according to claim 25 wherein
R1 is hydrogen, fluoro, chloro, or methyl;
R2 is hydrogen;
R33 is hydrogen, methyl, or phenyl;
R3b is hydrogen or methyl;
R4a is hydrogen, C-1.4 alkyl, optionally substituted phenyl, optionally substituted benzyl, optionally substituted heteroaryl, or methylene-dibenzene;
R^b js hydrogen or methyl;
R5a is H; and R5b is hydrogen, methyl, ethyl, or CF3; or a pharmaceutically acceptable salt thereof.
27. The compound according to claim 26 wherein wherein is isopropyl, optionally substituted aryl, optionally substituted pyrazolyl, optionally substituted pyridinyl, 2,3- dihydrobenzofuranyl, 2,3-dihydrobenzo[b][1 ,4]dioxinyl, or optionally substituted C .10 cycloalkyl; or a pharmaceutically acceptable salt thereof.
28. A pharmaceutical composition comprising a compound according to claim 1 , or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient.
29. A method for the treatment of a disease or disorder associated with a mutant IDH protein having a neomorphic activity comprising administration of a therapeutically effective amount of a compound according to claim 1 , or a pharmaceutically acceptable salt thereof, to subject in need of thereof.
30. A method for the treatment of a disease or disorder associated with a mutant IDH protein having a neomorphic activity comprising administration of a therapeutically effective amount of a compound according to claim 1 , or a pharmaceutically acceptable salt thereof, and another therapeutic agent to subject in need of thereof.
PCT/IB2012/055133 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh WO2013046136A1 (en)

Priority Applications (21)

Application Number Priority Date Filing Date Title
MX2014003752A MX342326B (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh.
EP12784701.0A EP2771337B1 (en) 2011-09-27 2012-09-26 3-(pyrimidin-4-yl)-oxazolidin-2-ones as inhibitors of mutant idh
AU2012313888A AU2012313888B2 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
KR1020147010827A KR20140069235A (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
UAA201403086A UA111503C2 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
EA201490696A EA025183B1 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
SG11201400989TA SG11201400989TA (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
CUP2014000036A CU24269B1 (en) 2011-09-27 2012-09-26 3- PIRIMIDIN- 4-IL- OXAZOLIDIN- 2- INHIBITING WAVES OF THE MUTANT HDI
US14/347,481 US8957068B2 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
AP2014007602A AP3907A (en) 2011-09-27 2012-09-26 3-Pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
ES12784701.0T ES2645968T3 (en) 2011-09-27 2012-09-26 3- (pyrimidin-4-yl) -oxazolidin-2-ones as mutant HDI inhibitors
JP2014532533A JP6026544B2 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
BR112014007310A BR112014007310A2 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as mutant idh inhibitors
NZ624040A NZ624040B2 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
CA2849995A CA2849995A1 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
CN201280058052.3A CN103958506B (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
ZA2014/02144A ZA201402144B (en) 2011-09-27 2014-03-24 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
MA36849A MA35452B1 (en) 2011-09-27 2014-03-25 3-pyrimidin-4-yl-oxazolidin-2-ones as mutant idh inhibitors
TNP2014000128A TN2014000128A1 (en) 2011-09-27 2014-03-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
CR20140143A CR20140143A (en) 2011-09-27 2014-03-27 3-PIRMIDIN-4-IL-OXAZOLIDIN-2-ONAS AS INHIBITORS OF THE MUTANT HDI
IL231786A IL231786A (en) 2011-09-27 2014-03-27 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161539553P 2011-09-27 2011-09-27
US61/539,553 2011-09-27

Publications (1)

Publication Number Publication Date
WO2013046136A1 true WO2013046136A1 (en) 2013-04-04

Family

ID=47178237

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2012/055133 WO2013046136A1 (en) 2011-09-27 2012-09-26 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh

Country Status (31)

Country Link
US (1) US8957068B2 (en)
EP (1) EP2771337B1 (en)
JP (1) JP6026544B2 (en)
KR (1) KR20140069235A (en)
CN (1) CN103958506B (en)
AP (1) AP3907A (en)
AR (1) AR088175A1 (en)
AU (1) AU2012313888B2 (en)
BR (1) BR112014007310A2 (en)
CA (1) CA2849995A1 (en)
CL (1) CL2014000746A1 (en)
CO (1) CO6920291A2 (en)
CR (1) CR20140143A (en)
CU (1) CU24269B1 (en)
DO (1) DOP2014000058A (en)
EA (1) EA025183B1 (en)
ES (1) ES2645968T3 (en)
GE (1) GEP20166432B (en)
GT (1) GT201400057A (en)
IL (1) IL231786A (en)
MA (1) MA35452B1 (en)
MX (1) MX342326B (en)
NI (1) NI201400026A (en)
PE (1) PE20141581A1 (en)
SG (1) SG11201400989TA (en)
TN (1) TN2014000128A1 (en)
TW (1) TWI547493B (en)
UA (1) UA111503C2 (en)
UY (1) UY34352A (en)
WO (1) WO2013046136A1 (en)
ZA (1) ZA201402144B (en)

Cited By (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014141104A1 (en) * 2013-03-14 2014-09-18 Novartis Ag 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
US8865894B2 (en) 2012-02-24 2014-10-21 Novartis Ag Oxazolidin-2-one compounds and uses thereof
WO2015127172A1 (en) * 2014-02-20 2015-08-27 Agios Pharmaceuticals, Inc. Therapeutically active compounds and their methods of use
CN105209460A (en) * 2013-03-14 2015-12-30 诺华股份有限公司 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
US9296733B2 (en) 2012-11-12 2016-03-29 Novartis Ag Oxazolidin-2-one-pyrimidine derivative and use thereof for the treatment of conditions, diseases and disorders dependent upon PI3 kinases
WO2016052697A1 (en) * 2014-10-01 2016-04-07 第一三共株式会社 Isoxazole derivative as mutated isocitrate dehydrogenase 1 inhibitor
WO2016062770A1 (en) * 2014-10-23 2016-04-28 Bayer Pharma Aktiengesellschaft 1-cyclohexyl-2-phenylaminobenzimidazoles as midh1 inhibitors for the treatment of tumors
WO2016089833A1 (en) 2014-12-05 2016-06-09 Merck Sharp & Dohme Corp. Novel tricyclic compounds as inhibitors of mutant idh enzymes
JP2016523976A (en) * 2013-07-11 2016-08-12 アジオス ファーマシューティカルズ， インコーポレイテッド 2,4- or 4,6-diaminopyrimidine compounds as IDH2 mutant inhibitors for the treatment of cancer
JP2016523935A (en) * 2013-07-11 2016-08-12 アジオス ファーマシューティカルズ， インコーポレイテッド Therapeutically active compounds and methods of use thereof
JP2016525130A (en) * 2013-07-25 2016-08-22 アギオス ファーマシューティカルス，インコーポレーテッド Therapeutically active compounds and uses thereof
JP2016526561A (en) * 2013-07-11 2016-09-05 アジオス ファーマシューティカルズ， インコーポレイテッド Therapeutically active compounds and methods of their use
WO2017005674A1 (en) * 2015-07-07 2017-01-12 Bayer Pharma Aktiengesellschaft 2-aryl- and 2-arylalkyl-benzimidazoles as midh1 inhibitors
WO2017019429A1 (en) * 2015-07-27 2017-02-02 Eli Lilly And Company 7-phenylethylamino-4h-pyrimido[4,5-d][1,3]oxazin-2-one compounds and theit use as mutant idh1 inhibitors
WO2017016992A1 (en) * 2015-07-27 2017-02-02 Bayer Pharma Aktiengesellschaft Inhibitor of the mutated isocitrate dehydrogenase idh1 r132h
JP2017518326A (en) * 2014-06-17 2017-07-06 キエージ・フアルマチエウテイチ・エツセ・ピ・ア Indolizine derivatives as phosphoinositide 3-kinase inhibitors
WO2017140758A1 (en) 2016-02-19 2017-08-24 Debiopharm International S.A. Derivatives of 2-amino-4-(2-oxazolidinon-3-yl)-pyrimidine fused with a five-membered heteroaromatic ring in 5,6-position which are useful for the treatment of various cancers
JP2017528492A (en) * 2014-09-19 2017-09-28 フォーマ セラピューティクス，インコーポレイテッド Quinolinone pyrimidine compositions as mutant isocitrate dehydrogenase inhibitors
WO2017213910A1 (en) 2016-06-06 2017-12-14 Eli Lilly And Company Mutant idh1 inhibitors
US9862703B2 (en) 2014-09-22 2018-01-09 National Health Research Institutes Heterocyclic compounds and use thereof
WO2018111707A1 (en) * 2016-12-16 2018-06-21 Eli Lilly And Company 7-phenylethylamino-4h-pyrimido[4,5-d][1,3]oxazin-2-one compounds as mutant idh1 and idh2 inhibitors
WO2018118793A1 (en) * 2016-12-19 2018-06-28 Isocure Biosciences Inc. Inhibitors of mutant isocitrate dehydrogenases and compositions and methods thereof
US10047078B2 (en) 2016-02-05 2018-08-14 National Health Research Institutes Aminothiazole compounds
US10703746B2 (en) 2014-12-22 2020-07-07 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Mutant IDH1 inhibitors useful for treating cancer
US10807976B2 (en) 2015-04-21 2020-10-20 Forma Therapeutics, Inc. Quinolinone five-membered heterocyclic compounds as mutant-isocitrate dehydrogenase inhibitors
WO2020216071A1 (en) 2019-04-23 2020-10-29 上海仕谱生物科技有限公司 Dimeric or polymeric form of mutant idh inhibitor
US10889567B2 (en) 2014-09-19 2021-01-12 Forma Therapeutics, Inc. Pyridin-2(1H)-one quinolinone derivatives as mutant-isocitrate dehydrogenase inhibitors
US11013734B2 (en) 2018-05-16 2021-05-25 Forma Therapeutics, Inc. Treating patients harboring an isocitrate dehydrogenase-1 (IDH-1) mutation
US11013733B2 (en) 2018-05-16 2021-05-25 Forma Therapeutics, Inc. Inhibiting mutant isocitrate dehydrogenase 1 (mlDH-1)
US11247987B2 (en) 2017-10-06 2022-02-15 Forma Therapeutics, Inc. Inhibiting ubiquitin specific peptidase 30
US11311527B2 (en) 2018-05-16 2022-04-26 Forma Therapeutics, Inc. Inhibiting mutant isocitrate dehydrogenase 1 (mIDH-1)
US11376246B2 (en) 2018-05-16 2022-07-05 Forma Therapeutics, Inc. Inhibiting mutant IDH-1
US11535618B2 (en) 2018-10-05 2022-12-27 Forma Therapeutics, Inc. Fused pyrrolines which act as ubiquitin-specific protease 30 (USP30) inhibitors
EP3941908A4 (en) * 2019-03-22 2023-05-17 Yumanity Therapeutics, Inc. Compounds and uses thereof
US11723905B2 (en) 2018-05-16 2023-08-15 Forma Therapeutics, Inc. Solid forms of ((s)-5-((1-(6-chloro-2-oxo-1,2-dihydroquinolin-3-yl)ethyl)amino)-1-methyl-6-oxo-1,6-dihydropyridine-2-carbonitrile
US11746115B2 (en) 2021-08-13 2023-09-05 Eli Lilly And Company Solid forms of 7-[[(1S)-1-[4-[(1S)-2-cyclopropyl-1-(4-prop-2-enoylpiperazin-1-yl)ethyl]phenyl]ethyl]amino]-1-ethyl-4H-pyrimido[4,5-d][1,3]oxazin-2-one
US11873298B2 (en) 2017-10-24 2024-01-16 Janssen Pharmaceutica Nv Compounds and uses thereof
US11970486B2 (en) 2016-10-24 2024-04-30 Janssen Pharmaceutica Nv Compounds and uses thereof
US12049466B2 (en) 2018-05-17 2024-07-30 Forma Therapeutics, Inc. Fused bicyclic compounds useful as ubiquitin-specific peptidase 30 inhibitors
US12098146B2 (en) 2019-01-24 2024-09-24 Janssen Pharmaceutica Nv Compounds and uses thereof

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9474779B2 (en) 2012-01-19 2016-10-25 Agios Pharmaceuticals, Inc. Therapeutically active compositions and their methods of use
EP2822944A1 (en) * 2012-03-05 2015-01-14 Amgen, Inc. Oxazolidinone compounds and derivatives thereof
US20150031627A1 (en) 2013-07-25 2015-01-29 Agios Pharmaceuticals, Inc Therapeutically active compounds and their methods of use
SG11201601682RA (en) 2013-09-06 2016-04-28 Aurigene Discovery Tech Ltd 1,2,4-oxadiazole derivatives as immunomodulators
CN106659765B (en) 2014-04-04 2021-08-13 德玛医药 Use of dianhydrogalactitol and analogs or derivatives thereof for treating non-small cell lung cancer and ovarian cancer
US10005734B2 (en) 2014-09-19 2018-06-26 Forma Therapeutics, Inc. Pyridin-2(1H)-one quinolinone derivatives as mutant-isocitrate dehydrogenase inhibitors
JP6751081B2 (en) 2014-09-19 2020-09-02 フォーマ セラピューティクス，インコーポレイテッド Pyridinylquinolinone derivatives as mutant isocitrate dehydrogenase inhibitors
CN114213356A (en) 2015-03-10 2022-03-22 奥瑞基尼探索技术有限公司 1,2, 4-oxadiazole and thiadiazole compounds as immunomodulators
MX2017011612A (en) * 2015-03-10 2018-03-23 Aurigene Discovery Tech Ltd 3-substituted-1,2,4-oxadiazole and thiadiazole compounds as immunomodulators.
US10294206B2 (en) 2015-04-21 2019-05-21 Forma Tm2, Inc. Fused-bicyclic aryl quinolinone derivatives as mutant-isocitrate dehydrogenase inhibitors
TWI681959B (en) * 2015-06-09 2020-01-11 日商第一三共股份有限公司 Isoxazole derivatives as inhibitors of variant isocitrate dehydrogenase 1
CN107216312B (en) * 2016-03-22 2023-08-01 上海海和药物研究开发股份有限公司 Compound with mutant IDH inhibitory activity, preparation method and application thereof
WO2019061324A1 (en) 2017-09-29 2019-04-04 Curis Inc. Crystal forms of immunomodulators
SG11202003081WA (en) 2017-10-11 2020-05-28 Aurigene Discovery Tech Ltd Crystalline forms of 3-substituted 1,2,4-oxadiazole
WO2019087087A1 (en) 2017-11-03 2019-05-09 Aurigene Discovery Technologies Limited Dual inhibitors of tim-3 and pd-1 pathways
EP3706798A1 (en) 2017-11-06 2020-09-16 Aurigene Discovery Technologies Limited Conjoint therapies for immunomodulation
CN110407855A (en) * 2018-04-26 2019-11-05 上海嗣新生物科技有限公司 2- aminopyrimidine piperidine derivatives and its preparation method and application
US10980788B2 (en) 2018-06-08 2021-04-20 Agios Pharmaceuticals, Inc. Therapy for treating malignancies
KR102584855B1 (en) * 2018-06-26 2023-10-05 케이피씨 파마슈티컬스 인코포레이티드 Benzimidazole derivatives and their use as IDH1 inhibitors
US20220259203A1 (en) * 2019-07-10 2022-08-18 Aucentra Therapeutics Pty Ltd Derivatives of 4-(imidazo[l,2-a]pyridin-3-yl)-n-(pyridinyl)pyrimidin- 2-amine as therapeutic agents
EP4319766A1 (en) * 2021-04-08 2024-02-14 Memorial Sloan Kettering Cancer Center Nadk2 inhibition in cancer and fibrotic disorders

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001002369A2 (en) 1999-07-02 2001-01-11 Agouron Pharmaceuticals, Inc. Indazole compounds and pharmaceutical compositions for inhibiting protein kinases, and methods for their use
WO2001060816A1 (en) * 2000-02-17 2001-08-23 Amgen Inc. Kinase inhibitors
WO2002010192A2 (en) 2000-08-01 2002-02-07 Novartis Ag Somatostatin analogues
WO2002066470A1 (en) 2001-01-12 2002-08-29 Amgen Inc. Substituted alkylamine derivatives and methods of use
WO2008080937A1 (en) * 2006-12-28 2008-07-10 Basf Se 2-substituted pyrimidines i in therapy
WO2008081910A1 (en) 2006-12-28 2008-07-10 Banyu Pharmaceutical Co., Ltd. Novel aminopyrimidine derivatives as plk1 inhibitors
WO2010090290A1 (en) * 2009-02-06 2010-08-12 日本新薬株式会社 Aminopyrazine derivative and medicine

Family Cites Families (112)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB581334A (en) 1943-09-29 1946-10-09 Francis Henry Swinden Curd New pyrimidine compounds
JPS4921148B1 (en) 1970-12-28 1974-05-30
JPS4921149A (en) 1972-06-15 1974-02-25
AT340933B (en) 1973-08-20 1978-01-10 Thomae Gmbh Dr K PROCESS FOR THE PRODUCTION OF NEW PYRIMIDE DERIVATIVES AND THEIR ACID ADDITIONAL SALTS
DE2341925A1 (en) 1973-08-20 1975-03-06 Thomae Gmbh Dr K 2,4, (opt.5-), 6-substd. pyriminidines as antithrombic agents - e.g. 6-methyl-5-nitro-2-piperazino-4-thiomorpolino-pyrimidine
US4994386A (en) 1987-07-13 1991-02-19 Pharmacia Diagnostics, Inc. Production of HBLV virus in the HSB-2 cell line
US4929726A (en) 1988-02-09 1990-05-29 Georgia State University Foundation, Inc. Novel diazines and their method of preparation
EP0330263A1 (en) 1988-02-25 1989-08-30 Merck & Co. Inc. Piperazinylalkylpyrimidines as hypoglycemic agents
GB9012311D0 (en) 1990-06-01 1990-07-18 Wellcome Found Pharmacologically active cns compounds
ATE139117T1 (en) 1990-07-03 1996-06-15 Mitsui Petrochemical Ind PYRIMIDINE COMPOUND AND ITS PHARMACEUTICALLY ACCEPTABLE SALT
WO1996032384A1 (en) 1995-04-13 1996-10-17 Taiho Pharmaceutical Co., Ltd. Novel 4,6-diarylpyrimidine derivatives and salts thereof
JP3734907B2 (en) 1996-12-19 2006-01-11 富士写真フイルム株式会社 Development processing method
KR100563514B1 (en) 1997-07-24 2006-03-27 젠야쿠코교가부시키가이샤 Heterocyclic compounds and antitumor agent containing the same as active ingredient
JPH11158073A (en) 1997-09-26 1999-06-15 Takeda Chem Ind Ltd Adenosine a3 antagonist
US6440965B1 (en) 1997-10-15 2002-08-27 Krenitsky Pharmaceuticals, Inc. Substituted pyrimidine derivatives, their preparation and their use in the treatment of neurodegenerative or neurological disorders of the central nervous system
US6150362A (en) 1997-12-12 2000-11-21 Henkin; Jack Triazine angiogenesis inhibitors
SI0930302T1 (en) 1998-01-16 2003-10-31 F. Hoffmann-La Roche Ag Benzosulfone derivatives
DE69919707T2 (en) 1998-06-19 2005-09-01 Chiron Corp., Emeryville GLYCOGEN SYNTHASE KINASE 3 INHIBITORS
US7045519B2 (en) 1998-06-19 2006-05-16 Chiron Corporation Inhibitors of glycogen synthase kinase 3
US6495558B1 (en) 1999-01-22 2002-12-17 Amgen Inc. Kinase inhibitors
AU768201B2 (en) 1999-01-22 2003-12-04 Amgen, Inc. Kinase inhibitors
WO2001000214A1 (en) 1999-06-30 2001-01-04 Merck & Co., Inc. Src kinase inhibitor compounds
CA2376957A1 (en) 1999-06-30 2001-01-04 Merck & Co., Inc. Src kinase inhibitor compounds
AU5636900A (en) 1999-06-30 2001-01-31 Merck & Co., Inc. Src kinase inhibitor compounds
DE60005355T2 (en) 1999-07-15 2004-07-01 Pharmacopeia, Inc. BRADIKININ B1 RECEPTOR ANTAGONISTS
JP2001089452A (en) 1999-09-22 2001-04-03 Sankyo Co Ltd Pyrimidine derivative
AU2001242629B2 (en) 2000-03-29 2005-08-11 Cyclacel Limited 2-substituted 4-heteroaryl-pyrimidines and their use in the treatment of proliferative disorders
DE60144322D1 (en) 2000-04-27 2011-05-12 Astellas Pharma Inc CONDENSED HETEROARYL DERIVATIVES
EP1277741A4 (en) 2000-04-28 2003-05-07 Tanabe Seiyaku Co Cyclic compounds
WO2002000647A1 (en) 2000-06-23 2002-01-03 Bristol-Myers Squibb Pharma Company Heteroaryl-phenyl substituted factor xa inhibitors
CN100506801C (en) 2000-09-06 2009-07-01 诺华疫苗和诊断公司 Inhibitors of glycogen synthase kinase 3
CN100355750C (en) 2000-09-15 2007-12-19 沃泰克斯药物股份有限公司 Pyrazole compounds useful as protein kinase inhibitors
SE0004053D0 (en) 2000-11-06 2000-11-06 Astrazeneca Ab N-type calcium channel antagonists for the treatment of pain
ATE326462T1 (en) 2000-12-21 2006-06-15 Vertex Pharma PYRAZOLE COMPOUNDS AS PROTEIN KINASE INHIBITORS
WO2002062766A2 (en) 2001-02-07 2002-08-15 Millennium Pharmaceuticals, Inc. Melanocortin-4 receptor binding compounds and methods of use thereof
US20030130264A1 (en) 2001-02-16 2003-07-10 Tularik Inc. Methods of using pyrimidine-based antiviral agents
JP2004531571A (en) 2001-05-25 2004-10-14 ベーリンガー インゲルハイム ファーマシューティカルズ インコーポレイテッド Carbamate and oxamide compounds as inhibitors of cytokine production
HUP0402352A2 (en) 2001-06-19 2005-02-28 Bristol-Myers Squibb Co. Pyrimidine derivatives for use as phosphodiesterase (pde)7 inhibitors and pharmaceutical compositions containing them
US6603000B2 (en) 2001-07-11 2003-08-05 Boehringer Ingelheim Pharmaceuticals, Inc. Synthesis for heteroarylamine compounds
WO2003030909A1 (en) 2001-09-25 2003-04-17 Bayer Pharmaceuticals Corporation 2- and 4-aminopyrimidines n-substtituded by a bicyclic ring for use as kinase inhibitors in the treatment of cancer
AU2003218215A1 (en) 2002-03-15 2003-09-29 Vertex Pharmaceuticals, Inc. Azolylaminoazines as inhibitors of protein kinases
ATE433973T1 (en) 2002-03-15 2009-07-15 Vertex Pharma AZOLYLAMINOAZINES AS INHIBITORS OF PROTEIN KINASES
EP1485100B1 (en) 2002-03-15 2010-05-05 Vertex Pharmaceuticals Incorporated Azinylaminoazoles as inhibitors of protein kinases
US6846928B2 (en) 2002-03-15 2005-01-25 Vertex Pharmaceuticals Incorporated Compositions useful as inhibitors of protein kinases
US20040082627A1 (en) 2002-06-21 2004-04-29 Darrow James W. Certain aromatic monocycles as kinase modulators
AU2003275242B2 (en) 2002-09-27 2010-03-04 Merck Sharp & Dohme Corp. Substituted pyrimidines
US20040171073A1 (en) 2002-10-08 2004-09-02 Massachusetts Institute Of Technology Compounds for modulation of cholesterol transport
US7223870B2 (en) 2002-11-01 2007-05-29 Pfizer Inc. Methods for preparing N-arylated oxazolidinones via a copper catalyzed cross coupling reaction
ES2375111T3 (en) 2002-11-21 2012-02-24 Novartis Ag PYRIMIDINES 2,4,6-TRISUSTITUIDAS AS INHIBITORS OF FOSFOTIDILINOSITOL (PI) 3-QUINASA AND ITS USE IN THE TREATMENT OF C�? NCER.
CA2519677A1 (en) 2003-03-24 2004-10-07 Merck & Co., Inc. Biaryl substituted 6-membered heterocycles as sodium channel blockers
US20050014753A1 (en) 2003-04-04 2005-01-20 Irm Llc Novel compounds and compositions as protein kinase inhibitors
AU2004230928B2 (en) 2003-04-09 2010-12-02 Exelixis, Inc. Tie-2 modulators and methods of use
CA2531490A1 (en) 2003-07-15 2005-02-03 Neurogen Corporation Substituted pyrimidin-4-ylamina analogues as vanilloid receptor ligands
EP1644358A2 (en) 2003-07-16 2006-04-12 Neurogen Corporation Biaryl piperazinyl-pyridine analogues
PE20050952A1 (en) 2003-09-24 2005-12-19 Novartis Ag DERIVATIVES OF ISOQUINOLINE AS INHIBITORS OF B-RAF
EP1675830A4 (en) * 2003-09-30 2008-08-20 Scios Inc Heterocyclic amides and sulfonamides
CA2561895A1 (en) 2004-04-13 2005-10-27 Icagen, Inc. Polycyclic pyrimidines as potassium ion channel modulators
GB0415364D0 (en) 2004-07-09 2004-08-11 Astrazeneca Ab Pyrimidine derivatives
GB0415365D0 (en) 2004-07-09 2004-08-11 Astrazeneca Ab Pyrimidine derivatives
MY145822A (en) 2004-08-13 2012-04-30 Neurogen Corp Substituted biaryl piperazinyl-pyridine analogues
CA2587642C (en) 2004-11-30 2013-04-09 Amgen Inc. Substituted heterocycles and methods of use
AU2005317176A1 (en) 2004-12-13 2006-06-22 Neurogen Corporation Piperazinyl-pyridine analogues
CN101080401A (en) 2004-12-13 2007-11-28 神经能质公司 Substituted biaryl analogues
KR101478933B1 (en) 2004-12-28 2015-01-02 키넥스 파마슈티컬즈, 엘엘씨 Compositions and methods of treating cell proliferation disorders
WO2006078992A2 (en) 2005-01-19 2006-07-27 Neurogen Corporation Heteroaryl substituted piperazinyl-pyridine analogues
US20100130473A1 (en) 2005-02-25 2010-05-27 Marc Geoffrey Hummersone Compounds
AR053712A1 (en) 2005-04-18 2007-05-16 Neurogen Corp HETEROARILOS SUBSTITUTED, ANTAGONISTS OF CB1 (RECEIVER 1 CANABINOID)
GB2431156A (en) 2005-10-11 2007-04-18 Piramed Ltd 1-cyclyl-3-substituted- -benzenes and -azines as inhibitors of phosphatidylinositol 3-kinase
AU2007204208A1 (en) 2006-01-11 2007-07-19 Astrazeneca Ab Morpholino pyrimidine derivatives and their use in therapy
JO2660B1 (en) 2006-01-20 2012-06-17 نوفارتيس ايه جي PI-3 Kinase inhibitors and methods of their use
CA2675558A1 (en) 2007-02-06 2008-08-14 Novartis Ag Pi 3-kinase inhibitors and methods of their use
US7957951B2 (en) 2007-03-16 2011-06-07 Robert Bosch Gmbh Address translation system for use in a simulation environment
EP2074118A2 (en) 2007-07-09 2009-07-01 AstraZeneca AB Trisubstituted pyrimidine derivatives for the treatment of proliferative diseases
WO2009066084A1 (en) 2007-11-21 2009-05-28 F. Hoffmann-La Roche Ag 2 -morpholinopyrimidines and their use as pi3 kinase inhibitors
AU2009221164B2 (en) 2008-03-05 2012-07-26 Novartis Ag Use of pyrimidine derivatives for the treatment of EGFR dependent diseases or diseases that have acquired resistance to agents that target EGFR family members
EP2474323A3 (en) 2008-03-26 2012-10-10 Novartis AG Imidazoquinolines and pyrimidine derivatives as potent modulators of vegf-driven angiogenic processes
JP2011515462A (en) 2008-03-27 2011-05-19 アウククランド ウニセルビセス リミテッド Substituted pyrimidines and triazines and their use in cancer therapy
JP5277256B2 (en) 2008-04-09 2013-08-28 田辺三菱製薬株式会社 Pyrimidine, pyridine and triazine derivatives as maxi-K channel openers
GB0815369D0 (en) 2008-08-22 2008-10-01 Summit Corp Plc Compounds for treatment of duchenne muscular dystrophy
JP2012506898A (en) 2008-10-31 2012-03-22 ノバルティス アーゲー Combination of phosphatidylinositol-3-kinase (PI3K) inhibitor and mTOR inhibitor
GB2465405A (en) 2008-11-10 2010-05-19 Univ Basel Triazine, pyrimidine and pyridine analogues and their use in therapy
WO2010068863A2 (en) 2008-12-12 2010-06-17 Cystic Fibrosis Foundation Therapeutics, Inc. Pyrimidine compounds and methods of making and using same
JP5747440B2 (en) 2009-02-06 2015-07-15 住友化学株式会社 Hydrazide compound and its use for pest control
WO2010105243A1 (en) 2009-03-13 2010-09-16 Agios Pharmaceuticals, Inc. Methods and compositions for cell-proliferation-related disorders
WO2010120994A2 (en) 2009-04-17 2010-10-21 Wyeth Llc Ureidoaryl-and carbamoylaryl-morpholino- pyrimidine compounds, their use as mtor kinase and pi3 kinase inhibitors, and their synthesis
ES2417355T3 (en) 2009-05-19 2013-08-07 Dow Agrosciences Llc Compounds and methods for fungal control
AR080945A1 (en) 2009-07-07 2012-05-23 Pathway Therapeutics Inc PIRIMIDINIL AND 1,3,5-TRIAZINIL BENZIMIDAZOLES AND ITS USE IN THERAPY AGAINST CANCER
US8609676B2 (en) 2009-08-04 2013-12-17 Merck Sharp & Dohme, Corp. 4, 5, 6-trisubstituted pyrimidine derivatives as factor IXa inhibitors
AR077999A1 (en) 2009-09-02 2011-10-05 Vifor Int Ag ANTIGONISTS OF PYRIMIDIN AND TRIAZIN-HEPCIDINE
CN102625708A (en) 2009-09-09 2012-08-01 阿维拉制药公司 Pi3 kinase inhibitors and uses thereof
JP5967827B2 (en) * 2009-12-09 2016-08-10 アジオス ファーマシューティカルズ， インコーポレイテッド Therapeutically active compounds for the treatment of cancer characterized by having an IDH variant
GB201004200D0 (en) 2010-03-15 2010-04-28 Univ Basel Spirocyclic compounds and their use as therapeutic agents and diagnostic probes
AR081626A1 (en) 2010-04-23 2012-10-10 Cytokinetics Inc AMINO-PYRIDAZINIC COMPOUNDS, PHARMACEUTICAL COMPOSITIONS THAT CONTAIN THEM AND USE OF THE SAME TO TREAT CARDIAC AND SKELETIC MUSCULAR DISORDERS
AR081331A1 (en) 2010-04-23 2012-08-08 Cytokinetics Inc AMINO- PYRIMIDINES COMPOSITIONS OF THE SAME AND METHODS FOR THE USE OF THE SAME
WO2011133920A1 (en) 2010-04-23 2011-10-27 Cytokinetics, Inc. Certain amino-pyridines and amino-triazines, compositions thereof, and methods for their use
WO2011143160A2 (en) 2010-05-10 2011-11-17 The Johns Hopkins University Metabolic inhibitor against tumors having an idh mutation
JP6081354B2 (en) 2010-07-16 2017-02-15 アジオス ファーマシューティカルズ， インコーポレイテッド Therapeutically active compositions and methods of their use
WO2012044727A2 (en) 2010-10-01 2012-04-05 Novartis Ag Manufacturing process for pyrimidine derivatives
SG10201708237SA (en) 2010-10-18 2017-11-29 Cerenis Therapeutics Holding Sa Compounds, compositions and methods useful for cholesterol mobilisation
GB201106829D0 (en) 2011-04-21 2011-06-01 Proximagen Ltd Heterocyclic compounds
JP2014505107A (en) 2011-02-11 2014-02-27 デイナ ファーバー キャンサー インスティチュート，インコーポレイテッド Methods for inhibiting hamartoma tumor cells
CN102827073A (en) 2011-06-17 2012-12-19 安吉奥斯医药品有限公司 Therapeutically active compositions and application methods thereof
JP2014527542A (en) 2011-09-01 2014-10-16 ノバルティス アーゲー PI3K inhibitor for use in the treatment of bone cancer or for preventing metastatic dissemination of primary cancer cells into bone
WO2013052395A1 (en) 2011-10-06 2013-04-11 Merck Sharp & Dohme Corp. 1,3-substituted azetidine pde10 inhibitors
UY34632A (en) 2012-02-24 2013-05-31 Novartis Ag OXAZOLIDIN- 2- ONA COMPOUNDS AND USES OF THE SAME
EP2849756A1 (en) 2012-05-16 2015-03-25 Novartis AG Dosage regimen for a pi-3 kinase inhibitor
JP2015518888A (en) 2012-06-06 2015-07-06 ノバルティス アーゲー Combination of a 17-alpha-hydroxylase (C17,20-lyase) inhibitor and a specific PI-3K inhibitor for the treatment of tumor diseases
KR20210049187A (en) 2012-08-16 2021-05-04 노파르티스 아게 Combination of pi3k inhibitor and c-met inhibitor
WO2014064058A1 (en) 2012-10-23 2014-05-01 Novartis Ag Improved process for manufacturing 5-(2,6-di-4-morpholinyl-4-pyrimidinyl)-4-trifluoromethylpyridin-2-amine
US9296733B2 (en) 2012-11-12 2016-03-29 Novartis Ag Oxazolidin-2-one-pyrimidine derivative and use thereof for the treatment of conditions, diseases and disorders dependent upon PI3 kinases
CN103483345B (en) 2013-09-25 2016-07-06 中山大学 PI3K inhibitors of kinases, the pharmaceutical composition comprising it and application thereof
CN103694218B (en) 2013-12-05 2016-04-27 中山大学 Pyrimidine compound, PI3K inhibitor, the pharmaceutical composition comprising PI3K inhibitor and application

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001002369A2 (en) 1999-07-02 2001-01-11 Agouron Pharmaceuticals, Inc. Indazole compounds and pharmaceutical compositions for inhibiting protein kinases, and methods for their use
WO2001060816A1 (en) * 2000-02-17 2001-08-23 Amgen Inc. Kinase inhibitors
WO2002010192A2 (en) 2000-08-01 2002-02-07 Novartis Ag Somatostatin analogues
WO2002066470A1 (en) 2001-01-12 2002-08-29 Amgen Inc. Substituted alkylamine derivatives and methods of use
WO2008080937A1 (en) * 2006-12-28 2008-07-10 Basf Se 2-substituted pyrimidines i in therapy
WO2008081910A1 (en) 2006-12-28 2008-07-10 Banyu Pharmaceutical Co., Ltd. Novel aminopyrimidine derivatives as plk1 inhibitors
WO2010090290A1 (en) * 2009-02-06 2010-08-12 日本新薬株式会社 Aminopyrazine derivative and medicine

Non-Patent Citations (19)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 20th ed.,", 1985, MACK PUBLISHING COMPANY
"Remington's Pharmaceutical Sciences", MACK PUBLISHING COMPANY
"The Handbook of Pharmaceutical Additives", GOWER PUBLISHING LIMITED
"The Handbook of Pharmaceutical Excipients", AMERICAN PHARMACEUTICAL ASSOCIATION AND THE PHARMACEUTICAL PRESS
AMARY ET AL., NATURE GENETICS, 2011
BALSS, ACTA NEUROPATHOL., 2008
DENG, TRENDS MOL. MED., vol. 16, 2010, pages 387
E. L. ELIEL; S. H. WILEN; L. N. MANDER: "Stereochemistry of Organic Compounds", 1994, WILEY-INTERSCIENCE
GAAL ET AL., J. CLIN. ENDOCRINOL. METAB., 2010
HAYDEN ET AL., CELL CYCLE, 2009
KRANENDIJK, M., SCIENCE, vol. 330, 2010, pages 336
L. DENG, NATURE, vol. 462, 2009, pages 739
L. SELLNER, EUR. J. HAEMATOL., vol. 85, 2011, pages 457
P.S. WARD, CANCER CELL, vol. 17, 2010, pages 225
PANSURIYA ET AL., NATURE GENETICS, 2011
S. GROSS, J. EXP. MED., vol. 207, no. 2, 2010, pages 339
STAHL; WERMUTH: "Handbook of Pharmaceutical Salts: Properties, Selection, and Use", 2002, WILEY-VCH
T. SHIBATA ET AL., AM. J. PATHOL., vol. 178, no. 3, 2011, pages 1395
T. W. GREENE; P. G. M. WUTS: "Protective Groups in Organic Synthesis, Third edition,", 1999, WILEY

Cited By (90)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8865894B2 (en) 2012-02-24 2014-10-21 Novartis Ag Oxazolidin-2-one compounds and uses thereof
US9458177B2 (en) 2012-02-24 2016-10-04 Novartis Ag Oxazolidin-2-one compounds and uses thereof
US9296733B2 (en) 2012-11-12 2016-03-29 Novartis Ag Oxazolidin-2-one-pyrimidine derivative and use thereof for the treatment of conditions, diseases and disorders dependent upon PI3 kinases
US10202371B2 (en) 2012-11-12 2019-02-12 Novartis Ag Oxazolidin-2-one-pyrimidine derivatives and the use thereof as phosphatidylinositol-3-kinase inhibitors
US9434719B2 (en) 2013-03-14 2016-09-06 Novartis Ag 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
WO2014141104A1 (en) * 2013-03-14 2014-09-18 Novartis Ag 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
CN105209460A (en) * 2013-03-14 2015-12-30 诺华股份有限公司 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
US20160039802A1 (en) * 2013-03-14 2016-02-11 Novartis Ag 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
US10112931B2 (en) 2013-03-14 2018-10-30 Novartis Ag 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
EA028033B1 (en) * 2013-03-14 2017-09-29 Новартис Аг 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
US9688672B2 (en) 2013-03-14 2017-06-27 Novartis Ag 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
JP2016523935A (en) * 2013-07-11 2016-08-12 アジオス ファーマシューティカルズ， インコーポレイテッド Therapeutically active compounds and methods of use thereof
JP2016526561A (en) * 2013-07-11 2016-09-05 アジオス ファーマシューティカルズ， インコーポレイテッド Therapeutically active compounds and methods of their use
JP2016523976A (en) * 2013-07-11 2016-08-12 アジオス ファーマシューティカルズ， インコーポレイテッド 2,4- or 4,6-diaminopyrimidine compounds as IDH2 mutant inhibitors for the treatment of cancer
JP2016525130A (en) * 2013-07-25 2016-08-22 アギオス ファーマシューティカルス，インコーポレーテッド Therapeutically active compounds and uses thereof
WO2015127172A1 (en) * 2014-02-20 2015-08-27 Agios Pharmaceuticals, Inc. Therapeutically active compounds and their methods of use
JP2017518326A (en) * 2014-06-17 2017-07-06 キエージ・フアルマチエウテイチ・エツセ・ピ・ア Indolizine derivatives as phosphoinositide 3-kinase inhibitors
US11498913B2 (en) 2014-09-19 2022-11-15 Forma Therapeutics, Inc. Pyridin-2(1H)-one quinolinone derivatives as mutant-isocitrate dehydrogenase inhibitors
JP2017528492A (en) * 2014-09-19 2017-09-28 フォーマ セラピューティクス，インコーポレイテッド Quinolinone pyrimidine compositions as mutant isocitrate dehydrogenase inhibitors
US10889567B2 (en) 2014-09-19 2021-01-12 Forma Therapeutics, Inc. Pyridin-2(1H)-one quinolinone derivatives as mutant-isocitrate dehydrogenase inhibitors
US9862703B2 (en) 2014-09-22 2018-01-09 National Health Research Institutes Heterocyclic compounds and use thereof
US9926298B2 (en) 2014-09-22 2018-03-27 National Health Research Institutes Heterocyclic compounds and use thereof
CN106795146A (en) * 2014-10-01 2017-05-31 第三共株式会社 As the inhibitor isoxazole derivativeses of saltant type isocitric dehydrogenase 1
WO2016052697A1 (en) * 2014-10-01 2016-04-07 第一三共株式会社 Isoxazole derivative as mutated isocitrate dehydrogenase 1 inhibitor
JPWO2016052697A1 (en) * 2014-10-01 2017-04-27 第一三共株式会社 Isoxazole derivatives as mutant isocitrate dehydrogenase 1 inhibitors
AU2015325279B2 (en) * 2014-10-01 2020-02-27 Daiichi Sankyo Company, Limited Isoxazole derivative as mutant isocitrate dehydrogenase 1 inhibitor
JP6087033B2 (en) * 2014-10-01 2017-03-01 第一三共株式会社 Isoxazole derivatives as mutant isocitrate dehydrogenase 1 inhibitors
KR102440429B1 (en) 2014-10-01 2022-09-05 다이이찌 산쿄 가부시키가이샤 Isoxazole derivative as mutated isocitrate dehydrogenase 1 inhibitor
CN106795146B (en) * 2014-10-01 2020-06-26 第一三共株式会社 Isoxazole derivatives as inhibitors of mutant isocitrate dehydrogenase 1
US10040791B2 (en) 2014-10-01 2018-08-07 Daiichi Sankyo Company, Limited Isoxazole derivative as mutant isocitrate dehydrogenase 1 inhibitor
KR20170068501A (en) * 2014-10-01 2017-06-19 다이이찌 산쿄 가부시키가이샤 Isoxazole derivative as mutated isocitrate dehydrogenase 1 inhibitor
RU2692782C2 (en) * 2014-10-01 2019-06-27 Дайити Санкио Компани, Лимитед Isoxazole derivative as inhibitor of mutant isocitrate dehydrogenase 1
WO2016062770A1 (en) * 2014-10-23 2016-04-28 Bayer Pharma Aktiengesellschaft 1-cyclohexyl-2-phenylaminobenzimidazoles as midh1 inhibitors for the treatment of tumors
US10137110B2 (en) 2014-10-23 2018-11-27 Bayer Pharma Aktiengesellschaft 1-cyclohexyl-2-phenylaminobenzimidazoles as mIDH1 inhibitors for the treatment of tumors
CN107108554B (en) * 2014-10-23 2020-11-06 德国癌症研究中心 1-cyclohexyl-2-phenylaminobenzimidazole as MIDH1 inhibitor for treating tumors
CN107108554A (en) * 2014-10-23 2017-08-29 拜耳医药股份有限公司 It is used for the phenyl amino benzimidazole of 1 cyclohexyl 2 for treating tumour as MIDH1 inhibitor
EP3226690A4 (en) * 2014-12-05 2018-06-20 Merck Sharp & Dohme Corp. Novel tricyclic compounds as inhibitors of mutant idh enzymes
US10086000B2 (en) 2014-12-05 2018-10-02 Merck Sharp & Dohme Corp. Tricyclic compounds as inhibitors of mutant IDH enzymes
WO2016089833A1 (en) 2014-12-05 2016-06-09 Merck Sharp & Dohme Corp. Novel tricyclic compounds as inhibitors of mutant idh enzymes
US10703746B2 (en) 2014-12-22 2020-07-07 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Mutant IDH1 inhibitors useful for treating cancer
US10807976B2 (en) 2015-04-21 2020-10-20 Forma Therapeutics, Inc. Quinolinone five-membered heterocyclic compounds as mutant-isocitrate dehydrogenase inhibitors
US10179123B2 (en) 2015-07-07 2019-01-15 Bayer Pharma Aktiengesellschaft 2-aryl- and 2-arylalkyl-benzimidazoles as mIDH1 inhibitors
WO2017005674A1 (en) * 2015-07-07 2017-01-12 Bayer Pharma Aktiengesellschaft 2-aryl- and 2-arylalkyl-benzimidazoles as midh1 inhibitors
US10253041B2 (en) 2015-07-27 2019-04-09 Eli Lilly And Company 7-phenylethylamino-4H-pyrimido[4,5-d][1,3]oxazin-2-one compounds and their use as mutant IDH1 inhibitors
CN107810181B (en) * 2015-07-27 2021-06-22 德国癌症研究公共权益基金会 Inhibitors of mutant isocitrate dehydrogenase IDH 1R 132H
AU2016300980B2 (en) * 2015-07-27 2020-12-24 Deutsches Krebsforschungszentrum, Stiftung Des Öffentlichen Rechts Inhibitor of the mutated isocitrate dehydrogenase IDH1 R132H
US10344004B2 (en) 2015-07-27 2019-07-09 Bayer Pharma Aktiengesellschaft Inhibitor of the mutated isocitrate dehydrogenase IDH1 R132H
WO2017019429A1 (en) * 2015-07-27 2017-02-02 Eli Lilly And Company 7-phenylethylamino-4h-pyrimido[4,5-d][1,3]oxazin-2-one compounds and theit use as mutant idh1 inhibitors
CN107849059B (en) * 2015-07-27 2020-04-28 伊莱利利公司 7-phenylethylamino-4H-pyrimido [4,5-D ] [1,3] oxazin-2-one compounds and their use as inhibitors of mutant IDH1
WO2017016992A1 (en) * 2015-07-27 2017-02-02 Bayer Pharma Aktiengesellschaft Inhibitor of the mutated isocitrate dehydrogenase idh1 r132h
CN107810181A (en) * 2015-07-27 2018-03-16 拜耳制药股份公司 The isocitric dehydrogenase IDH1 R132H of mutation inhibitor
CN107849059A (en) * 2015-07-27 2018-03-27 伊莱利利公司 7 phenylethylcarbamate 4H pyrimidos [4,5 D] [the assimilation compound of 1,3] oxazines 2 and its purposes as mutant IDH1 inhibitor
US10047078B2 (en) 2016-02-05 2018-08-14 National Health Research Institutes Aminothiazole compounds
WO2017140758A1 (en) 2016-02-19 2017-08-24 Debiopharm International S.A. Derivatives of 2-amino-4-(2-oxazolidinon-3-yl)-pyrimidine fused with a five-membered heteroaromatic ring in 5,6-position which are useful for the treatment of various cancers
WO2017213910A1 (en) 2016-06-06 2017-12-14 Eli Lilly And Company Mutant idh1 inhibitors
US10696665B2 (en) 2016-06-06 2020-06-30 Eli Lilly And Company Mutant IDH1 inhibitors
US11970486B2 (en) 2016-10-24 2024-04-30 Janssen Pharmaceutica Nv Compounds and uses thereof
AU2020260493B2 (en) * 2016-12-16 2021-09-09 Eli Lilly And Company 7-phenylethylamino-4H-pyrimido[4,5-d][1,3]oxazin-2-one compounds as mutant IDH1 and IDH2 inhibitors
EA036112B1 (en) * 2016-12-16 2020-09-29 Эли Лилли Энд Компани 7-PHENYLETHYLAMINO-4H-PYRIMIDO[4,5-d][1,3]OXAZIN-2-ONE COMPOUNDS AS MUTANT IDH1 AND IDH2 INHIBITORS
WO2018111707A1 (en) * 2016-12-16 2018-06-21 Eli Lilly And Company 7-phenylethylamino-4h-pyrimido[4,5-d][1,3]oxazin-2-one compounds as mutant idh1 and idh2 inhibitors
EP3763717A1 (en) * 2016-12-16 2021-01-13 Eli Lilly And Co. Pyrido[4,3-d][1,3]oxazin-2-one and pyrimido[4,5-d][1,3]oxazin-2-one compounds as mutant idh1 and idh2 inhibitors
US11001596B2 (en) 2016-12-16 2021-05-11 Eli Lilly And Company 7-phenylethylamino-4H-pyrimido[4,5-d][1,3]oxazin-2-one compounds as mutant IDH1 and IDH2 inhibitors
US11649247B2 (en) 2016-12-16 2023-05-16 Eli Lilly And Company 7-phenylethylamino-4H-pyrimido[4,5-d][1,3]oxazin-2-one compounds as mutant IDH1 and IDH2 inhibitors
US11629156B2 (en) 2016-12-16 2023-04-18 Eli Lilly And Company 7-phenylethylamino-4H-pyrimido[4,5-d][1,3]oxazin-2-one compounds as mutant IDH1 and IDH2 inhibitors
AU2017378060B2 (en) * 2016-12-16 2020-09-03 Eli Lilly And Company 7-phenylethylamino-4H-pyrimido[4,5-d][1,3]oxazin-2-one compounds as mutant IDH1 and IDH2 inhibitors
KR102276022B1 (en) 2016-12-16 2021-07-13 일라이 릴리 앤드 캄파니 7-phenylethylamino-4H-pyrimido[4,5-D][1,3]oxazin-2-one compounds as mutant IDH1 and IDH2 inhibitors
KR20190077539A (en) * 2016-12-16 2019-07-03 일라이 릴리 앤드 캄파니 7-phenylethylamino-4H-pyrimido [4,5-D] [1,3] oxazin-2-one as a mutant IDH1 and IDH2 inhibitor
WO2018118793A1 (en) * 2016-12-19 2018-06-28 Isocure Biosciences Inc. Inhibitors of mutant isocitrate dehydrogenases and compositions and methods thereof
US11149032B2 (en) 2016-12-19 2021-10-19 Isocure Biosciences Inc. Inhibitors of mutant isocitrate dehydrogenases and compositions and methods thereof
EP3555079A4 (en) * 2016-12-19 2020-08-19 Isocure Biosciences Inc. Inhibitors of mutant isocitrate dehydrogenases and compositions and methods thereof
AU2017379796B2 (en) * 2016-12-19 2021-10-21 Isocure Biosciences Inc. Inhibitors of mutant isocitrate dehydrogenases and compositions and methods thereof
US11247987B2 (en) 2017-10-06 2022-02-15 Forma Therapeutics, Inc. Inhibiting ubiquitin specific peptidase 30
US11873298B2 (en) 2017-10-24 2024-01-16 Janssen Pharmaceutica Nv Compounds and uses thereof
US12053463B2 (en) 2018-05-16 2024-08-06 Forma Therapeutics, Inc. Solid forms of ((s)-5-((1-(6-chloro-2-oxo-1,2-dihydroquinolin-3-yl)ethyl)amino)-1-methyl-6-oxo-1,6-dihydropyridine-2-carbonitrile
US11723905B2 (en) 2018-05-16 2023-08-15 Forma Therapeutics, Inc. Solid forms of ((s)-5-((1-(6-chloro-2-oxo-1,2-dihydroquinolin-3-yl)ethyl)amino)-1-methyl-6-oxo-1,6-dihydropyridine-2-carbonitrile
US11376246B2 (en) 2018-05-16 2022-07-05 Forma Therapeutics, Inc. Inhibiting mutant IDH-1
US11963956B2 (en) 2018-05-16 2024-04-23 Forma Therapeutics, Inc. Inhibiting mutant isocitrate dehydrogenase 1 (mIDH-1)
US11311527B2 (en) 2018-05-16 2022-04-26 Forma Therapeutics, Inc. Inhibiting mutant isocitrate dehydrogenase 1 (mIDH-1)
US11013733B2 (en) 2018-05-16 2021-05-25 Forma Therapeutics, Inc. Inhibiting mutant isocitrate dehydrogenase 1 (mlDH-1)
US11576906B2 (en) 2018-05-16 2023-02-14 Forma Therapeutics, Inc. Inhibiting mutant IDH-1
US11013734B2 (en) 2018-05-16 2021-05-25 Forma Therapeutics, Inc. Treating patients harboring an isocitrate dehydrogenase-1 (IDH-1) mutation
US11738018B2 (en) 2018-05-16 2023-08-29 FORMA Therapeuetics, Inc. Inhibiting mutant isocitrate dehydrogenase 1 (mIDH-1)
US12049466B2 (en) 2018-05-17 2024-07-30 Forma Therapeutics, Inc. Fused bicyclic compounds useful as ubiquitin-specific peptidase 30 inhibitors
US11814386B2 (en) 2018-10-05 2023-11-14 Forma Therapeutics, Inc. Fused pyrrolines which act as ubiquitin-specific protease 30 (USP30) inhibitors
US11535618B2 (en) 2018-10-05 2022-12-27 Forma Therapeutics, Inc. Fused pyrrolines which act as ubiquitin-specific protease 30 (USP30) inhibitors
US12098146B2 (en) 2019-01-24 2024-09-24 Janssen Pharmaceutica Nv Compounds and uses thereof
EP3941908A4 (en) * 2019-03-22 2023-05-17 Yumanity Therapeutics, Inc. Compounds and uses thereof
EP3964508A4 (en) * 2019-04-23 2022-12-21 Epitas Biosciences (Shanghai) Co., Ltd. Dimeric or polymeric form of mutant idh inhibitor
WO2020216071A1 (en) 2019-04-23 2020-10-29 上海仕谱生物科技有限公司 Dimeric or polymeric form of mutant idh inhibitor
US11746115B2 (en) 2021-08-13 2023-09-05 Eli Lilly And Company Solid forms of 7-[[(1S)-1-[4-[(1S)-2-cyclopropyl-1-(4-prop-2-enoylpiperazin-1-yl)ethyl]phenyl]ethyl]amino]-1-ethyl-4H-pyrimido[4,5-d][1,3]oxazin-2-one

Also Published As

Publication number Publication date
MX2014003752A (en) 2014-08-22
SG11201400989TA (en) 2014-04-28
BR112014007310A2 (en) 2017-04-04
EA201490696A1 (en) 2014-08-29
JP2014528951A (en) 2014-10-30
MX342326B (en) 2016-09-26
AU2012313888B2 (en) 2016-03-31
IL231786A (en) 2017-06-29
NI201400026A (en) 2015-01-13
EP2771337A1 (en) 2014-09-03
DOP2014000058A (en) 2014-06-01
EP2771337B1 (en) 2017-08-02
TW201321375A (en) 2013-06-01
AR088175A1 (en) 2014-05-14
AU2012313888A1 (en) 2014-05-15
PE20141581A1 (en) 2014-11-14
GT201400057A (en) 2017-09-28
TN2014000128A1 (en) 2015-07-01
CU20140036A7 (en) 2014-07-30
EA025183B1 (en) 2016-11-30
CA2849995A1 (en) 2013-04-04
JP6026544B2 (en) 2016-11-16
UY34352A (en) 2013-04-30
UA111503C2 (en) 2016-05-10
US20140235620A1 (en) 2014-08-21
GEP20166432B (en) 2016-02-10
IL231786A0 (en) 2014-05-28
CL2014000746A1 (en) 2014-10-03
CR20140143A (en) 2014-10-16
KR20140069235A (en) 2014-06-09
CN103958506A (en) 2014-07-30
MA35452B1 (en) 2014-09-01
ES2645968T3 (en) 2017-12-11
ZA201402144B (en) 2017-09-27
AP2014007602A0 (en) 2014-04-30
US8957068B2 (en) 2015-02-17
AP3907A (en) 2016-11-23
CU24269B1 (en) 2017-08-08
CN103958506B (en) 2017-02-22
TWI547493B (en) 2016-09-01
NZ624040A (en) 2016-01-29
AU2012313888A8 (en) 2014-07-24
CO6920291A2 (en) 2014-04-10

Similar Documents

Publication Publication Date Title
EP2771337B1 (en) 3-(pyrimidin-4-yl)-oxazolidin-2-ones as inhibitors of mutant idh
US10112931B2 (en) 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant IDH
EP2970242B1 (en) 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh
US11591336B2 (en) Substituted pyrazolo[3,4-b]pyrazines as SHP2 phosphatase inhibitors
WO2014147586A1 (en) 1-(2-(ethylamino)pyrimidin-4-yl)pyrrolidin-2-ones as inhibitors of mutant idh
CA2828824A1 (en) Thiazolopyrimidine compounds
EP2970313A1 (en) Substituted 7-azabicycles and their use as orexin receptor modulators
NZ624040B2 (en) 3-pyrimidin-4-yl-oxazolidin-2-ones as inhibitors of mutant idh

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12784701

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2849995

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2014532533

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014000746

Country of ref document: CL

Ref document number: 14347481

Country of ref document: US

Ref document number: 12014500682

Country of ref document: PH

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 231786

Country of ref document: IL

Ref document number: 14065647

Country of ref document: CO

Ref document number: 000427-2014

Country of ref document: PE

Ref document number: MX/A/2014/003752

Country of ref document: MX

Ref document number: CR2014-000143

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: A201403086

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 20147010827

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2012784701

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 201490696

Country of ref document: EA

Ref document number: 13450

Country of ref document: GE

Ref document number: 2012784701

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2012313888

Country of ref document: AU

Date of ref document: 20120926

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014007310

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014007310

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140327