WO2012174409A1 - Stabilized variant maml peptides and uses thereof - Google Patents

Stabilized variant maml peptides and uses thereof Download PDF

Info

Publication number
WO2012174409A1
WO2012174409A1 PCT/US2012/042719 US2012042719W WO2012174409A1 WO 2012174409 A1 WO2012174409 A1 WO 2012174409A1 US 2012042719 W US2012042719 W US 2012042719W WO 2012174409 A1 WO2012174409 A1 WO 2012174409A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acids
modified polypeptide
amino acid
independently
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/042719
Other languages
French (fr)
Inventor
Raymond Earle Moellering
Gregory L. Verdine
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Harvard University
Original Assignee
Harvard University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Harvard University filed Critical Harvard University
Priority to JP2014516044A priority Critical patent/JP2014520120A/en
Priority to EP12800679.8A priority patent/EP2721061A4/en
Priority to US14/127,039 priority patent/US20140256912A1/en
Publication of WO2012174409A1 publication Critical patent/WO2012174409A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/543Lipids, e.g. triglycerides; Polyamines, e.g. spermine or spermidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/55Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug
    • A61K47/551Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug one of the codrug's components being a vitamin, e.g. niacinamide, vitamin B3, cobalamin, vitamin B12, folate, vitamin A or retinoic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/005Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
    • A61K49/0056Peptides, proteins, polyamino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • Aberrant transcription factor function is a hallmark of tumor development and progression. Deregulation of these critical regulatory molecules can result from numerous genetic events including mutation, translocation or amplification of upstream regulatory proteins such as kinases (e.g. BCR-Abl, b-Raf and k-Ras), deletion or inactivating mutation of protein phosphatases (e.g. PTEN), altered growth factor-receptor signaling (e.g. VEGF-VEGFR) or direct mutation, deletion, amplification or fusion of transcription factors themselves (e.g. MYC, p53 and NOTCH l ). In each of these cases, altered signaling cascades ultimately lead to di fferential activity of one or more transcription factors and the induction of abnormal gene expression networks' .
  • upstream regulatory proteins such as kinases (e.g. BCR-Abl, b-Raf and k-Ras), deletion or inactivating mutation of protein phosphatases (e.g. PTEN), altered growth factor-receptor signaling
  • the Notch signaling pathway is a prototypical example of an oncogenic transcriptional network driven by overactive signaling through the multi-protein NOTCH transactivation complex.
  • Normal Notch signaling is integral to a variety of developmental processes, including neural precursor specification, hematopoietic stem cell maintenance and l ineage determination 2 ' 3 .
  • the tight regulation of these processes derives in large part from the extraordinar control ordinarily imposed by the cell over the duration and dosage of signals emanating from the activated Notch pathway.
  • Aberrations in Notch pathway function and control are linked with a wide variety of disorders in humans. Mutations that disrupt NOTCH protein function have been observed in numerous developmental disorders, including CADAS IL 4 , congenital aortic valve defects 5 and Allagille syndrome 6 .
  • NOTCHl was discovered on the basis of its involvement in a t(7;9) chromosomal translocation observed in patients with T- cell acute lymphoblastic leukemia (T-ALL) 1 . Subsequently, various activating mutations in NOTCH 1 have been discovered in greater than 50% of patients with IT- ALL 8 .
  • NOTCH proteins undergo two sequential proteolytic cleavage events by an ADAM family metal loprotease 20 and the ⁇ -secretase complex 21"23 , respectively.
  • Intramembrane cleavage of NOTCH receptors by ⁇ -secretase releases an intracellular domain of NOTCH (ICN), which translocates to the nucleus and forms the active NOTCH transcriptional complex (NTC) with the transcription factor CSL and co-activators of the Mastermind-like fami ly (MAML 1 -3 in humans) ( Figure l a) 24"27 ⁇ 28 .
  • ICN intracellular domain of NOTCH
  • NTC active NOTCH transcriptional complex
  • MAML 1 -3 Mastermind-like fami ly
  • WO 2008/061 1 92 describes certain cross-linked peptides derived from MAML l that were tested these for aqueous solubil ity, strength of binding to the ICN-CSL complex, and for efficient of cellular penetration.
  • SAHM 1 was found to specifically bind the 1C 1 -CSL complex and competitively inhibit binding of recombinant dnMAML l as well as full-length MAML l .
  • SAH 1 was shown to inhibit the expression of a panel of canonical Notch target genes (HESJ, MYC, DTX1).
  • SAHM 1 produces a transcriptional signature of Notch gene repression in human and murine T-ALL cells - indeed one that showed striking correspondence to that produced by treatment with a small-molecule ⁇ -secretase
  • stapled MAML l peptides Described below are stably cross-linked peptides related to a portion of human MAML l ("stapled MAML l peptides"). These cross-linked peptides contain at least two modified amino acids that together form an internal (intramolecular) cross-link between the alpha carbons of the two modified amino acids that can help to stabilize the alpha-helical secondary structure of the peptide (see U.S. Patent No. 7, 1 92, 1 73 and Verdine et al. 201 2 Methods in Enzymology 503 :3)In some cases the peptide includes four (6, 8 or 10) modified amino acids, pairs of which form an internal cross-link.
  • Such peptides have two (3, 4 or 5) internal cross-links separated by one or more, e.g., three amino acids. In some cases the peptide contains three modi fied amino acids, the middle one of which forms a cross-link (between alpha carbons) with each of the two flanking amino acids.
  • Such cross-linked peptides which also have two internal cross-links, are sometimes referred to as "stitched" peptides and are described in US 2010/01 84645.
  • a cross-linked polypeptide described herein can have improved biological activity relative to a corresponding polypeptide that is not cross-linked.
  • the cross-linked MAML l peptides can bind to the ICN 1 -CSL complex and competitively inhibit binding of recombinant MAML l or full-length MAML proteins (MAML 1 -3) to ICN 1 -CSL complexes.
  • Certain active peptides are expected to inhibit the expression of one or more Notch-regulated genes (HES1, MYC, DTX1 and others) in T-ALL cells or other cells in which Notch signaling is active, an expectation that is supported by Notch 1 -dependent reporter gene studies.
  • the internally cross-linked MAML peptides described herein can be used therapeutically, e.g., to treat a variety of cancers or Notch-dependent diseases in a subject, for example, cancers and other disorders characterized by undesirable activation of a Notch receptors or Notch- activated gene(s).
  • the cross-linked MAMLl peptides described herein are variants of a portion of human MAMLl and could include amino acid substitutions from other MAML isoforms (MAML2 and MAML3) or novel amino acid mutations.
  • the sequence of a relevant portion of human MAMLl starts at amino acid 21 of MAMLl is depicted below:
  • MAML sequences include:
  • SEQ ID NO:2 (MAML-1 ; amino acids 19-62):
  • SEQ IDNO:4 (MAML-3):
  • SEQ ID NO:5 (MAML- 1 ; includes predicted domain for binding the transcription complex):
  • SEQ ID NO:6 (MAML-2; includes predicted domain for binding the transcription complex):
  • SEQ ID NO:7 (MAML-3; includes predicted domain for binding the transcription complex):
  • SEQ ID NO: 10 (MAML-3 core) ERLRQRIEGCRRHH VN
  • SEQ ID NO: 11 (MAML-2 fragment):
  • the cross-linked peptides of the present disclosure include at least 10 contiguous amino acids of SEQ ID NOs: 12-20 wherein the side chain of two or more amino acids that are separated by three or seven amino acids is replaced by an internal cross-link.
  • the amino acids indicated below can be replaced by the corresponding alpha-methyl amino acid.
  • Leu can be alpha-methyl Leu.
  • the cross-linked peptides of the invention do not include cross-liked peptide comprising any of SEQ ID NO: 1-10 wherein in two or more amino acids separated by 3 or 6 amino acids are replaced by an internal cross-link.
  • Xaas is Leu. Trp_ or Phe;
  • Xaa 4 is Arg. Lys, Ala. Aib (aminoisobutyric acid);
  • Xaa 7 is I]e, Leu, or NorL;
  • Xaas is Glu Ala or Aib
  • Xaa 9 is Leu. Trp, Phe, or Tyr;
  • Xaaio is Cys. Phe or Val;
  • Xaai2 is Arg, Ala or Aib
  • Xaai6 is Thr or Ala or Aib
  • Xaa3 is Leu, Trp or Phe;
  • Xaaa is Arg. Lys, Ala, Aib (aminoisobutyric);
  • Xaa 7 is He, Leu, or NorL;
  • Xaas is Glu Ala or Aib
  • Xaag is Leu. Trp, Phe, or Tyr;
  • Xaaio is Cys, Phe or Val
  • Xaau is Arg, Ala or Aib
  • Xaa i 6 is Thr, Ala or Aib;
  • Xaan is Cys, Aib, Ala, or D-pentafluorophenylalanine.
  • Xaaig is Glu, Ala or Aib. Glu]Arg 2 aa 3 Xaa 4 Arg5Arg 6 Xaa 7 XaagXaa 9 aaioArgi] aai2Hisi 3 Hisi Seri 5
  • Xaa 3 is Leu, Trp or Phe;
  • Xaa is Arg, Lys, Ala or Aib Xaa 7 is He, Leu, or NorL;
  • Xaa 8 is Glu or Ala orAib
  • Xaa is Leu, Trp, Phe, or Tyr
  • Xaaio is Cys, Phe or Val
  • Xaan is Arg, Alaor Aib
  • Xaai6 is Thr or Ala orAib
  • Xaan is Cys, Aib, Ala orD-pentafluorophenylalanine.
  • Xaaig is Glu, Ala or Aib
  • Xaa2i is Tyr, 1-naphthylalanine, ⁇ , or 2-naphthylalanine.
  • the cross-linked peptide is a described above provided that: when Xaas is Leu, Xaa 7 is He, and Xaag is Leu, Xaaio is not Cys; and/or provided that when Xaa 7 is He, and Xaa 9 is Leu, and Xaaio is Cys, Xaa 3 is not Leu; and/or provided that when Xaa 3 is Leu, and Xaag is Leu, and Xaaio is Cys, Xaa7 is not He; and/or provided that when Xaa is Leu, Xaa ? is He, and Xaaio is Cys, Xaa9 is not Leu.
  • the alpha carbon of an amino acid at position N can be cross-linked to the alpha carbon of an amino acid at position N + 4 by replacing the side chains of both amino acids with an internal cross-link.
  • the alpha carbon of the amino acid at position N can be cross-linked to the alpha carbon of an amino acid at position N + 4 by replacing the side chains of both amino acids with an internal cross-link and the alpha carbon of the amino acid at position N + 8 can be cross-linked to the alpha carbon of an amino acid at position N + 1 2 by replacing the side chains of both amino acids with an internal cross-link.
  • the alpha carbon of one amino acid is cross-linked to two different amino acids
  • the alpha carbon of the amino acid at position N can be cross-linked to the alpha carbon of the amino acid at position N + 4 and the alpha carbon of the amino acid at position N + 4 can also be cross-linked to the alpha carbon of the amino acid at position N + 8.
  • preferred cross-links are: between Xaa and Xaa 8 : between Xaag and Xaa ⁇ ; between Xaa ⁇ and Xaai6; between Xaa4 and Xaag and simultaneously between Xaag and Xaai 2 (stitched peptide); and between Xaag and Xaai2 and simultaneously between Xaa ⁇ and Xaai6 (stitched peptide).
  • the present disclosure features a modified polypeptide of Formula (I),
  • and R 2 are independently H or a C] to Cio alkyl (preferably methyl), C2 to Cio alkenyl, C 2 to Cio alkynyl, arylalkyl, cycloalky lalkyl, heteroarylalk I, or heterocyclylalkyl;
  • R3 is alkylene, alkenylene or alkynylene, or [R4 -K.- R4],,; each of which is substituted with 0-6 R 5 ;
  • R4 and R 4 ' are independently alkylene, alkenylene or alkynylene (e.g., each are independently a C I , C2, C3, C4, C5, C6, C7, C8, C9 or C I O alkylene, alkenylene or alkynylene);
  • R 5 is halo, alkyl, OR «, N(R ⁇ ;) 2 , SR 6 , SOR ⁇ , S0 2 R6, C0 2 R 6! R 6 , a fluorescent moiety, or a radioisotope;
  • K is O, S, SO, S0 2 , CO, C0 2 , CONR 6 , ⁇ , aziridine, episul fide, diol,
  • R ⁇ is H, alkyl, or a therapeutic agent
  • n 2, 3, 4 or 6;
  • x is an integer from 2- 10 (preferably 3 or 6);
  • w and y are independently an integer from 0- 100;
  • z is an integer from 1 - 10 (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10);
  • each Xaa is independently an amino acid (e.g., one of the 20 naturally occurring amino acids or any naturally occurring non-naturally occurring amino acid, e.g., a D-amino acid or an alpha-alkyl amino acid (e.g., an alpha-methy!-amino acid));
  • amino acid e.g., one of the 20 naturally occurring amino acids or any naturally occurring non-naturally occurring amino acid, e.g., a D-amino acid or an alpha-alkyl amino acid (e.g., an alpha-methy!-amino acid)
  • polypeptide comprises at least 8 contiguous amino acids of any of SEQ ID NOs 1 2-20 or a variant thereof, or another polypeptide sequence described herein except that: (a) within the 8 contiguous amino acids of SEQ I D NO: 12-20 the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the linking group, R3, which connects the alpha carbons of the pair of amino acids as depicted in Formula I; and (b) the alpha carbon of the first of the pair of amino acids is substituted with R
  • sequence [Xaa]wL' [Xaa]yL" [Xaa]z, wherein L' and L" are amino acids in which the side chains have been replaced by the linking group R3, comprises at least contiguous amino acids of SEQ ID NO: 12-20.
  • the invention features a modified polypeptide of Formu
  • each Ri and R2 are independently H or a C 1 - C 10 alky 1, C2 - C 10 alkeny 1, C2 - C I O alkynyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, or heterocyclylalkyl;
  • R3 is C8 - C I 6 alkylene, C8 - C I 6 alkeny lene (preferably a C8 alkeny lene with a double bond between the 4 lh and 5 lh carbons) or C8 - C I 6 alkynylene, or [R4 - ⁇ -3 ⁇ 4] ⁇ ; each of which is substituted with 0-6 R5;
  • R4 and R4' are independently C 1 -C 10 alkylene, C2-C 10 alkeny lene or C2- C 10 alkynylene (e.g., each are independently a C 1 , C2, C3, C4, C5, C6, C7, C8, C9 or C I 0 alkylene. alkeny lene or alkynylene);
  • R 5 is halo, alkyl, OR f i, (R6) 2 , SR 6 , SOR6, S0 2 R 6 , C0 2 Rfi, R 6 , a fluorescent moiety, or a radioisotope; O
  • R-6 is H, C I -C I O alkyl, or a therapeutic agent
  • x is an integer from 2- 1 0 (preferably 3 or 6);
  • ⁇ v and y are independently an integer from 0- 100;
  • z is an integer from 1 - 10 (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10);
  • each Xaa is independently an amino acid (e.g., one of the 20 naturally occurring amino acids or any naturally occurring non-naturally occurring amino acid);
  • R7 is PEG, a tat protein, an affinity label, a targeting moiety, a fatty acid- derived acyl group, a biotin moiety, a fluorescent probe (e.g. fluorescein or rhodamine) l inked via, e.g., a thiocarbamate, carbamate, amide, amine, ether or triazole linkage;
  • a fluorescent probe e.g. fluorescein or rhodamine
  • Rs is H, OH, NH 2j NHR 8a , NR 8a R 8b ;
  • polypeptide comprises at least 14 contiguous amino acids of SEQ I D NOs 1 2-20 or a variant thereof , or another polypeptide sequence described herein except that: (a) within any of SEQ I D NOs: 12-20 the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the link ing group, R3, which connects the alpha carbons of the pair of amino acids as depicted in formula I; and (b) the alpha carbon of the first of the pair of amino acids is substituted with R
  • the peptide [Xaa]wX[Xaa]yX ' [Xaa]x, where [Xaa]w, [Xaa]y, and [Xaa]x are as defined above in Formulas I and I I and X and X' represent amino acids whose side chain has been replaced by a cross-link, can have a sequence corresponding to at least 20 contiguous amino acids of any of SEQ I D NOs: 1 2 - 20.
  • [R -K-R4] n is wherein each is independently a C2-C6 alky 1.
  • R7 is spermine (- (CH 2 )3NH(CH2)3NH(CH 2 ) 3 H2)
  • each Ri and R 2 are independently H or a C
  • R3 is alkylene, alkenylene or alkynylene, or [R -K-R4] n ; each of which is substituted with 0-6 R5;
  • R4 and R are independently alkylene, alkenylene or alkynylene (e.g., each are independently a C I , C2, C3, C4, C5, C6, C7, C8, C9 or C I O alkylene, alkenylene or alkynylene);
  • R 5 is halo, alkyl, OR f i, (R6) 2 , SR 6 , SOR6, S0 2 R 6 , C0 2 Ri, Rfi, a fluorescent moiety, or a radioisotope; , aziridine, episulfide, diol,
  • Re is H, alkyl, or a therapeutic agent
  • x and x' are independently an integer from 2- 10 (preferably 3 or 6;
  • each Xaa is independently an amino acid (e.g., one of the 20 naturally occurring amino acids or any naturally occurring non-naturally occurring amino acid, e.g., a D-amino acid or an alpha-alkyl amino acid (e.g., an alpha-methyl-amino acid));
  • polypeptide comprises at least 8 contiguous amino acids of any of SEQ ID NOs 12-20 or a variant thereof, or another polypeptide sequence described herein except that: (a) within the 8 contiguous amino acids of SEQ ID NO: 1 2-20 the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the linking group, R3, which connects the alpha carbons of the pair of amino acids as depicted in Formula I; and (b) the alpha carbon of the first of the pair of amino acids is substituted with Ri as depicted in formula I and the alpha carbon of the second of the pair of amino acids is substituted with 2 as depicted in Formula 1.
  • cross-l inks can have a variety of positions. Certain examples are depicted below. In these depictions “AA” represents an amino acid side chain and “L” represents the intramolecular cross-link (R3 in Formulas I-1V)
  • R3 can be a C7 alkylene or aikenylene. Where it is an aikenylene there can one or more double bonds.
  • R3 can be a C 12 or C 1 3 alkylene or aikenylene. Where it is an aikenylene there can one or more double bonds.
  • R 3 can be a C8 alkylene, aikenylene. Where it is an aikenylene there can one or more double bonds.
  • any position occupied by Gin can be Glu instead and any position occupied by G lu can be Gin instead.
  • any position occupied by Asn can be Asp instead and any position occupied by Asp can be Asn instead.
  • choice of Asn or Arg and Gin or Glu will depend on the desired charge of the stapled peptide. In many cases it is desirable for the cross-linked peptide to be neutral or have a net positive charge at physiological pH.
  • each w is independently an integer between 3 and 1 5. In some instances each y is independently an integer between 1 and 1 5.
  • Ri and i are each independently H or C
  • R i and R2 are each independently C1-C3 alkyl. In some instances, at least one of Rj and R2 are methyl. For example R i and R2 are both methyl.
  • R3 is alkyl (e.g., Cs alkyl) and x is 3. In some instances, R3 is Cn alkyl and x is 6. In some instances, R3 is alkenyl (e.g., Cs alkenyl) and x is 3.
  • the two alpha, alpha disubstituted stereocenters are both in the R configuration or S configuration (e.g., N, N+4 cross-link), or one stereocenter is R and the other is S (e.g., N, N+7 cross-link).
  • R e.g., N, N+4 cross-link
  • S e.g., N, N+7 cross-link
  • the C and C" disubstituted stereocenters can both be in the R configuration or they can both be in the S configuration, for example when x is 3.
  • x 6
  • the C' disubstituted stereocenter is in the R configuration and the C" disubstituted stereocenter is in the S configuration.
  • x 2
  • the C disubstituted stereocenter is in the R configuration and the C" disubstituted stereocenter is in the S configuration.
  • the R3 double bond may be in the E or Z stereochemical configuration. Similar configurations are possible for the carbons in Formula I I corresponding to C and C" in the formula depicted immediately above.
  • R3 is [3 ⁇ 4- ⁇ -3 ⁇ 4'] ⁇ ; and R4 and RVare independently alkylene, alkenylene or alkynylene (e.g., each are independently a C I , C2, C3, C4, C5, C6, C7, C8, C9 or C I O alkylene, alkenylene or alkynylene
  • the polypeptide includes an amino acid sequence which, in addition to the amino acids side chains that are replaced by an intermolecular crosslink, have 1 , 2, 3, 4 or 5 amino acid changes in any of SEQ I D NOs: l -21 (e.g., SEQ I D Os; 12-20).
  • the cross-link can include an alkyl, alkenyl, or alkynyl moiety (e.g., C5, C % or C M alky! or a C5, Cg or C
  • the cross-linked amino acid can be alpha disubstituted (e.g., C 1 -C3 or methyl).
  • [Xaa] y and [Xaa] w are peptides that can independently comprise at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 1 2, 1 3, 14, 1 5, 16, 1 7, 18, 1 9, 20, 25 or more contiguous amino acids (preferably 2 or 5 contiguous amino acids) of a variant MA L 1 , 2 or 3 peptide (e.g., any of SEQ ID l ⁇ 'Os: 1 2-20) and [Xaa] is a peptide that can comprise 3 or 6 contiguous amino acids of acids of a variant AML 1 , 2 or 3 peptide.
  • the peptide can comprise 8, 9, 1 0, 1 1 , 1 2, 13, 14, 1 5, 16, 1 7, 18, 19, 20, 25, 30, 35, 40, 45, 50 amino acids of a variant MAML 1 , 2 or 3 peptide.
  • the amino acids are contiguous except that one or more pairs of amino acids separated by 3 or 6 amino acids are replaced by amino acid substitutes that form a cross-link, e.g., via R3.
  • at least two amino acids can be replaced by cross-linked amino acids or cross- linked amino acid substitutes.
  • [Xaa] y -, [Xaa] x and [Xaa] y - can each comprise contiguous polypeptide sequences from the same or different variant MA L 1 , 2 and 3 peptides. The same is true for Formula I I.
  • the peptides can include 10 ( 1 1 , 12, 1 3, 14, 1 5, 16, 1 7, 1 8, 1 9, 20, 2 1 , 22, 23, 24, 25, 30, 35, 40, 45, 50 or more) contiguous amino acids of a variant AML 1 , 2 or 3 polypeptide described herein wherein the alpha carbons of two amino acids that are separated by three amino acids (or six amino acids) are linked via s. one of the two alpha carbons is substituted by R
  • the polypeptide acts as an inhibitor of Notch complex formation.
  • the polypeptide also includes a fluorescent moiety or radioisotope or a moiety that can chelate a radioisotope (e.g., mercaptoacetyltriglycine or 1 , 4. 7, 10-tetraazacyclododecane-N,N',N", N"'-tetraacetic acid (DOTA)) chelated to a radioactive isotope of Re, In or Y).
  • a radioisotope e.g., mercaptoacetyltriglycine or 1 , 4. 7, 10-tetraazacyclododecane-N,N',N", N"'-tetraacetic acid (DOTA)
  • the polypeptide includes a PEG linker, a tat protein, an affinity label, a targeting moiety, a fatty acid-derived acyl group, a biotin moiety, a fluorescent probe (e.g.
  • fluorescein or rhodamine or another bio-active molecule to recruit enzymatic machinery, including: small molecules that bind and recruit ubiquitin ligases (nutlin, SAH-p53-8); histone deacetylase proteins and complexes (SIN3 alpha-helix, SAHA) or co-activator proteins (M LL alpha-helix, VP 16 alpha- helix) or others.
  • small molecules that bind and recruit ubiquitin ligases nutlin, SAH-p53-8
  • histone deacetylase proteins and complexes SIN3 alpha-helix, SAHA
  • M LL alpha-helix, VP 16 alpha- helix co-activator proteins
  • the peptides may contain one or more asymmetric centers and thus occur as racemates and racemic mixtures, single enantiomers, individual diastereomers and diastereomeric mixtures and geometric isomers (e.g. Z or cis and E or trans) of any olefins present. All such isomeric forms of these compounds are expressly included in the present invention.
  • the compounds may also be represented in multiple tautomeric forms, in such instances, the invention expressly includes all tautomeric forms of the compounds described herein (e.g., alkylation of a ring system may result in alkylation at multiple sites, the invention expressly includes all such reaction products). All such isomeric forms of such compounds are included as are all, crystal forms.
  • the table below provides the structures of the side chains for each of the 20 common naturally-occurring amino acids. In this table the at right side of each structure is the bond to the alpha carbon.
  • Arginine R Arg HN C(NH 2 )-NH-(CH 2 )3- j Asparagine N Asn H 2 N-C(0)-CH 2 -
  • Phenylalanine F Phe Phenyl-CH 2 -
  • Threonine T Thr CH 3 -CH(OH)- henyl-NH-CH C-CH?-
  • non-essential amino acid residue is a residue that can be altered from the wild- type sequence of a polypeptide (without abolishing or substantially altering its activity.
  • An "essential” amino acid residue is a residue that, when altered from the wild-type sequence of the polypeptide, results in abol ishing or substantially abolishing the polypeptide activity.
  • a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Famil ies of amino acid residues having similar side chains have been defined in the art. These fami lies include amino acids with basic side chains (e.g., lysine, arginine, histidine). acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g..).
  • glycine asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine.
  • amino acid side chain refers to a moiety attached to the ct-carbon in an amino acids.
  • amino acid side chain for alanine is methyl
  • amino acid side chain for phenylalanine is phenylmethyl
  • amino acid side chain for cysteine is thiomethyl
  • amino acid side chain for aspartate is carboxymethyl
  • amino acid side chain for tyrosine is 4-hydroxyphenylmethyl
  • Other non-natural occurring amino acid side chains are also included, for example, those that occur in nature (e.g., an amino acid metabolite) or those that are made synthetically (e.g., an alpha di-substituted amino acid).
  • polypeptide encompasses two or more naturally occurring or synthetic amino acids linked by a covalent bond (e.g., a amide bond). Polypeptides as described herein include full length proteins (e.g., fully processed proteins) as well as shorter amino acids sequences (e.g., fragments of naturally occurring proteins or synthetic polypeptide fragments).
  • variant MA L- 1 peptide includes SEQ ID NOs: 12- 14.
  • variant MAML-2 peptide includes SEQ ID NOs: 1 5- 1 7.
  • variant A L-3 peptide includes SEQ I D NOs: 1 8-20.
  • halo refers to any radical of fluorine, chlorine, bromine or iodine.
  • alkyl refers to a hydrocarbon chain that may be a straight chain or branched chain, containing the indicated number of carbon atoms. For example, C
  • alkylene refers to a divalent alkyl (i.e., -R-).
  • alkenyl refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon double bonds in either Z or E geometric configurations.
  • the alkenyl moiety contains the indicated number of carbon atoms.
  • C2-C10 indicates that the group may have from 2 to 10 (inclusive) carbon atoms in it.
  • lower alkenyl refers to a C2-C8 alkenyl chain. In the absence of any numerical designation, "alkenyl” is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
  • alkynyl refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon triple bonds.
  • the alkynyl moiety contains the indicated number of carbon atoms.
  • C2-C10 indicates that the group may have from 2 to 10 (inclusive) carbon atoms in it.
  • lower alkynyl refers to a C2-Q alkynyl chain. In the absence of any numerical designation, “alkynyl” is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
  • aryl refers to a 6-carbon monocyclic or 1 0-carbon bicycl ic aromatic ring system wherein 0, 1. 2, 3, or 4 atoms of each ring may be substituted by a substituent. Examples of aryl groups include phenyl, naphthyl and the like.
  • arylalkyl or the term “aralkyl” refers to alkyl substituted with an aryl.
  • arylalkoxy refers to an alkoxy substituted with aryl.
  • cycloalkyl as employed herein includes saturated and partially unsaturated cyclic hydrocarbon groups having 3 to 1 2 carbons, preferably 3 to 8 carbons, and more preferably 3 to 6 carbons, wherein the cycloalkyl group additionally may be optional ly substituted.
  • Preferred cycloalkyl groups include, without l imitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl. cycloheptyl, and cyclooctyl.
  • heteroaryl refers to an aromatic 5-8 membered monocyclic, 8- 1 2 membered bicyclic, or 1 1 - 14 membered tricyclic ring system having 1 -3 heteroatoms if monocyclic, 1 -6 heteroatoms if bicyclic, or 1 -9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1 -3, 1 -6, or 1 -9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1 , 2, 3, or 4 atoms of each ring may be substituted by a substituent.
  • heteroaryl groups include pyridyl, furyl or furanyl, imidazolyl, 1 ,2,3- triazolyl, 1 ,2,4-triazolyl, benzimidazolyl, pyrimidinyl, thiophenyl or thienyl, quinolinyl, indolyl, thiazoly 1, and the like.
  • heteroarylalkyl or the term “heteroaralkyl” refers to an alkyl substituted with a heteroaryl.
  • heteroarylalkoxy refers to an alkoxy substituted with heteroaryl.
  • heterocyclyl refers to a nonaromatic 5-8 membered monocyclic, 8- 1 2 membered bicyclic, or 1 1 - 14 membered tricyclic ring system having 1 -3 heteroatoms i f monocyclic, 1 -6 heteroatoms if bicyclic, or 1 -9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1 -3, 1 -6, or 1 -9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1 , 2 or 3 atoms of each ring may be substituted by a substituent.
  • heterocyclyl groups include piperazinyl, pyrrolidinyl, dioxanyl, aziridiny I, oxiryl, thiiryl, morpholinyl, tetrahydrofuranyl, and the like.
  • substituents refers to a group “substituted” on an alkyl, cycloalkyi, aryl, heterocycl l, or heteroaryl group at any atom of that group. Suitable substituents include, without limitation, halo, hydroxy, mercapto, oxo, nitro, haloalkyl, alkyl, alkaryl, aryl, aralkyl, alkoxy, thioalkoxy, aryloxy, amino, alkoxycarbonyl, amido, carboxy, alkanesulfonyl, alkylcarbonyl, azido, and cyano groups.
  • FIG. 1 Modeling the NOTCH 1 -MAM L I -CSL ternary complex (NTC).
  • NTC NTC assembly and activation of target gene expression.
  • SAHMs Stabilized alpha-helical peptides derived from MAML 1
  • MAML 1 MAML 1
  • FIG. 1 a) Schematic of NTC assembly and activation of target gene expression.
  • SAHMs Stabilized alpha-helical peptides derived from MAML 1
  • SAHMs Stabilized alpha-helical peptides derived from MAML 1
  • MAML 1 MAML 1
  • b Molecular modeling of the NTC.
  • the dominant negative fragment of MAML 1 (dnMAML l , residues 1 3-74), AN domain of NOTCH 1 (AN l ) and CSL are showing in magenta, red and blue, respectively.
  • Residues identified as the strongest contributors to complex stability are highlighted in yellow (top residues 1 -9) and cyan (residues 10- 1 8) and are represented as sticks in dnMAML l and surfaces for ANK 1 and CSL.
  • Residues in red are the highest scoring residues for their respective protein subunit.
  • FIG. 2 Analysis of dnMAML l -RAMANK l -CSL complex formation and ALPHAscreen assay development
  • Donor bead excitation at 680 nm produces singlet oxygen, which selectively initiates a luminescent cascade in bound acceptor beads
  • Black curves represent reference-cell normalized sensogram data and red curves denote a kinetic fit to a two-step kinetic model. Binding constants derived from this fit are shown. k 0 chronological, association rate; k a n, dissociation rate; K ⁇ s. dissociation constant; RU, response units.
  • ALPHAscreen IC50 values shown represent the 95% confidence interval (C.l.) of the mean
  • Residues were incorporated into stapled peptides by conventional SPPS, followed by ring-closing olefin metathesis with Grubbs I catalyst.
  • FIG. 8 Graphical representation of reporter gene assay correlation data presented in Figure 5a.
  • U20S cells co-transfected with AEG FALNR-NOTCH l construct, CS L-Firefly luciferase reporter and RemV/a-luciferase reporter were treated with analog stapled peptides ( 1 5 ⁇ , 18 - 24 h) or DMSO vehicle alone. Shown is the normal ized mean reporter signal relative to DMSO alone for each analog peptide.
  • NTC Notch transcriptional complex
  • the polypeptides include an internal cross-link between two non-natural amino acids (i.e., two amino acids whose side chains have been replaced by the cross-link) that signi ficantly enhances the alpha helical secondary structure of the polypeptide.
  • the cross-l ink sometimes referred to as staple
  • the cross-l ink extends across the length of one or two helical turns (i.e., about 3.4 or about 7 amino acids). Accordingly, amino acids positioned at i and i+3 ; i and i+4; or i and i+7 are ideal candidates for chemical modification and cross-linking.
  • cross-links between Xaai and Xaa ⁇ , or between Xaai and Xaa, or between Xaai and Xaag are useful as are cross-links between Xaa? and Xaa 5 , or between Xaa ⁇ and Xaa 6 , or between Xaa 2 and aagi, etc.
  • the polypeptides can include more than one crosslink within the polypeptide sequence to either further stabilize the sequence or facilitate the stabi lization of longer polypeptide stretches. If the polypeptides are too long to be readily synthesized in one part, independently synthesized, cross-linked peptides can be conjoined by a technique called native chemical l igation (Bang, et al., J. Am. C em Soc. 126: 1377).
  • Described herein are stabilized alpha-helix of MA L 1 (SAH- AML 1 ) peptides that exhibit affinity for the ICN 1 -CSL complex, and, in contrast to a corresponding unmodified (non-cross-linked) MAML 1 peptide, more readily enter cells mechanism.
  • ⁇ . ⁇ -Disubstituted non-natural amino acids containing olefinic side chains of varying length can synthesized by known methods (Williams et al. 1991 J. Am. Chem. Soc. 1 1 3 :9276; Schafmeister et al. 2000 J. Am. Chem Soc. 122:5891 ).
  • dnMAML l binds a surface made up of both ANK 1 and CSL. While from P46 to the C-terminus, dnMAML l only interacts with CSL ( Figure l b, right). Table 1 lists the top 1 5 residues that contribute the most to the dnMAML l -AN I -CSL binding free energies ( Figure l b, right). We find that 10 (in bold) out of the top 1 5 hot-spot residues are located between dnMAML l (N-terminal to P46) and the ANK 1 -CSL interface, which indicates that this region more important for binding.
  • Top ranking residues outside of the N-terminal helix cluster around an interaction between a hydrophobic cleft on CSL with L59 and T56 in dnMAML l .
  • Top residues in the N-terminal helix include a cluster of arginines ( 22, R25 & R3 1 ) in dnMAML 1 that form stable salt bridges with D l 973 and E2009 in ANK 1 and E378 in CSL.
  • Other important residues in this stretch include two histidines (H34 & H33) and one tyrosine (Y4 1 ), whose van der Waals energy term dominates the free energy of binding.
  • Figure l c shows the B FED contribution of each residue in dnMAML l , where negative values indicate critical interactions and small or positive values represent unimportant or deleterious interactions, respectively.
  • NTC assembly has been studied using relatively low-throughput assays including electrophoretic-mobility shift assays 24 , isothermal titration calorimetry 49 , and various immunoprecipitation strategies. More recently, Del Bianco et al. reported the use of a FRET-based system measuring the proximity of a donor fluorophore-labeled ANK protein to an acceptor-labeled oligonucleotide upon NTC assembly, which allowed determination of relative equilibrium constants for the entire complex 45 . We also reported the use of surface plasmon resonance (SPR) and fluorescence polarization assays measuring the association of NTC components with each other and with stapled peptides 37 .
  • SPR surface plasmon resonance
  • fluorescence polarization assays measuring the association of NTC components with each other and with stapled peptides 37 .
  • ALPHAscreen technology (ALPHA meaning amplified luminescence groximity homogenous assay) employs functionalized beads approximately 200 nm in diameter to detect the association of cognate binding partners in solution 50 ' 51 .
  • Laser excitation (680 nm) of donor beads releases a flow of singlet oxygen, which due to a discrete half-life, will diffuse approximately 200 nm.
  • L29Y (SAH M 1 - 14) mutant also appeared to form this interaction with R382 in CSL as well as hydrogen-bonds with the side chain amide of N2041 and backbone carbonyls ⁇ 2040 and V2039 in AN l ( Figure 3e).
  • Overall mutations at L29 alone did not have a strong effect on peptide potency, although our modeling results indicated that L29Y and L29W mutations should improve binding, thus these mutations were explored in later combination mutant analogs.
  • I nitial combination mutants focused on determining the effect of 127 and L29 mutations in combination with the most effective point mutants separately - L23 W and C30F - and then together (Figure 4a).
  • ALPHAscreen competition experiments revealed that L23 W I27L double mutants retain a gain in activity observed for the single mutants, but were without any significant gain for the double mutant (SAH M 1 -2 1 SAH 1 -23 compared to SAHM 1 -3 1 /SAH M 1 -36). This is likely due to the fact that both residues target the same hydrophobic cleft on CSL, which perhaps will not tolerate larger combinations.
  • the L23 W/C30F mutant combination appeared to improve peptide potency in the presence of di fferent combinations of 127L and L29Y mutations (SAHM 1 -21 , SAHM 1 -3 1 and SAHM 1 -56; Figure 4d).
  • U20S cells were co-trans fected with a CSL-regulated firefly luciferase construct, a control /iemV/a-kiciferase construct and the truncated AEGFALNR-NOTC/// allele prior to treatment with analog compounds or vehicle.
  • Comparison of stapled peptide IC50 values in the ALPHAscreen assay and normalized inhibition of the NOTCH 1 -driven reporter gene signal revealed a strong correlation between biochemical and cell- based activity for the library of analogs (Figure 5a, Figure 9). This analysis indicated that more potent analogs from both the E21 -T36 and E21 -Y4 1 scaffolds were capable of nearly complete reporter repression (Figure 5b).
  • this assay represents a novel format to measure NOTCH complex formation and should be suitable for high-throughput screening of small molecules or other chemical classes.
  • Stapled peptide molecular modeling The initial structure of stapled peptide SAHM 1 was obtained based on the E2 1 -T36 dnMAML l in the human NOTCH complex 39 (PDBid: 2F8X) by mutating E28 and R32 to ligated ⁇ , ⁇ -disubstituted "S 5 " amino acids. Conformational search of "S 5 " non-natural amino acids were performed in Macromodel to generate the lowest energy conformation of SAHM 1 , which was then used as the starting coordinate for energy minimization, equilibration and 20ns molecular dynamics simulation. The parameters of partial charge calculations, force fields for non-natural amino acids and MD simulations settings were described as follows.
  • NOTCH complex modeling The X-ray crystal structure of dnMAML l -ANK 1 -CSL bound to an oligo containing the HES1 promoter sequence (PDBid: 2f8x, 3.25 ⁇ ) was used as the starting coordinates for NTC MD simulations.
  • the initial structure was processed in Protein Preparation Panel in Maestro 8.5. DNA and solvent molecules were removed from the structure. Protonation states were assigned to H is. Gin, Asn residues and were manually inspected.
  • the structure was then prepared in antechamber suite in Amber 10. In LEaP module, the ff03 force field in Amber 10 was used to simulate the system.
  • dnMAMLl BFED calculations Binding free energy decomposition (BFED) calculations are based on the average MMGBSA score of the ensemble of snapshots extracted every l Ops from the converged 5-35ns MD simulation of dnMAML l .
  • B FED calculations are carried out using MMGBSA in Amber 10.
  • MM Molecular mechanics method
  • the electrostatics component of solvation energy was calculated using Generalized Born (GB) method, while the non-polar solvation energy was estimated from the Solvent Accessible Surface Area (SASA).
  • BFED evaluates the contribution of each residue from two components (dnMAML or CSL/AN ) to the total binding free energy. So one hal f of the pairwise interaction energies, for example electrostatic interactions, are assigned to each of the two interacting atoms belonging to two residues respectively. The nonpolar contributions of each residue to the free energy of binding are proportional to the difference of the accessible surface of each residue in the free molecule and the complex.
  • SA HM analogue binding calculations The starting structures for the D simulations of SAHM analog complexes were obtained based on NOTCH complex X-ray structure (PDBid: 2F8X) by mutating respective residues of dnMAM L. The methods to explore the lowest energy conformations of the mutated peptides in the complex, calculate partial charges and set up energy minimization, equi libration and M D simulations are very similar as described above. 1 8ns MD simulations were applied for each of the SAHM analog complex. MMGBSA binding free energy calculations were performed based on the converged MD trajectories. MD trajectories were also analyzed to understand the dynamic behavior of the complex and explain how mutations affect the binding affinities.
  • hexahistidine tag (residues 9-435), RAMAN I (residues 1 761 -2127) and GST- labeled RA ANK 1 were expressed in BL21 (DE3) pLysS cells (Stratagene) and puri fied as previously described ⁇ 7 .
  • Peptide synthesis and purification- Stapled peptides were synthesized on a Tetras multi-channel automated peptide synthesizer (Thuramed) by standard Fmoc-based sol id-phase peptide synthesis (SPPS) methods. Olefin-containing "S5" and " ⁇ ,” amino acids and non-natural amino acids were purchased from Anaspec Inc.
  • Synthetic dnMAML l polypeptides were synthesized by SPPS using low-loading NovaPEG resin (EM D) on a CEM Liberty Microwave peptide synthesizer. Extended coupling time or double-coupling was used for beta-branched amino acids, stretches of hydrophobic residues and arginines. Al l couplings were perfomed at 70°C with the exception of histidine and cysteine, which were coupled at 50°C to prevent racemization.
  • Biotinylated peptides (bio-s-dnMAML l and bio-snt-dnMAM L l ) were capped with a beta-alanine spacer, a 20-atom diethylene glycol (EMD) spacer and biotin.
  • Non-labeled competitor peptides (Ac-s-dnMAML l ) were capped with an acetylated beta-alanine spacer. All peptides were cleaved, purified and quantified in the same manner as the stapled peptides.
  • ALPHAscreen competition assays were performed using Perkin Elmer 384-well optiplates and measurements were made on a Perkin Elmer Envision multi-label plate reader with ALPHAscreen capability.
  • Purified GST- AMANK 1 and CSL were dialyzed into binding buffer (20 mM Tris pH 8.4, 1 50 mM NaCI, 1 mM DTT, 1 mM EDTA and 0.05% dialyzed BSA) and kept separate for experiments. Briefly, 1 5 of 4X (of desired top concentration) stapled peptide stocks in binding buffer were added to the top row of plates containing 10 ⁇ ⁇ of binding buffer in all other wells.
  • an 8X stock of anti-GST acceptor beads 160 ⁇ g/mL ⁇ for a final concentration of 20 ⁇ g/mL was resuspended in binding buffer in the dark. 5 ⁇ L ⁇ of the acceptor bead solution was added to the wells, the plate centrifuged for 1 minute at 500 rpm and incubated for an addition 30 minutes. Finally, an 8X stock of streptavidin donor beads ( 1 60 ⁇ g/mL ⁇ for a final concentration of 20 ⁇ g mL was made in binding buffer in the dark and 5 ⁇ L ⁇ of the donor bead solution was added directly into the buffer (no centrifugation) and the 40 ⁇ L ⁇ mixture was incubated for an addition 30 minutes at room temperature in the dark. The plate was read using standard
  • Biacore-GE Surface Plasmon Resonance- A Biacore 3000 SPR-lnstrument (Biacore-GE, Upsala, Sweden) was used to measure binding of Bio-sdnMAML l , Bio-sntdnMAML l and B io-SAHM l peptides to soluble complexes of RAMAN 1 and CSL.
  • Peptides were dissolved in biacore binding buffer (20 mM Tris pH 8.4, 1 50 mM NaCI, 1 mM DTT, 1 mM EDTA and 0.05% P-20) and immobilized on a discrete flow cells of a slreptavidin-CM5 Biacore chip by injection at 1 0 ⁇ / ⁇ for 1 0 minutes.
  • Luciferase Reporter Gene Assays U20S cells were plated in white, 96-well plates (Corning) containing DMEM supplemented with 10% FBS and al lowed to accl i mate overnight.
  • Empty pcDNA3 or AEGFALNR-NOTCH l plasmids (5 ng well) were transiently co-transfected with a CSL-regulated firefly luciferase reporter construct and a constitutively active Renilla luciferase (pRLT ) control plasmid ( 10: 1 /?e/7/7/c/:Firefly plasmid ratios) using Lipofectamine 3000 (Invitrogen) 46 37 .
  • Luciferase activity was subsequently measured using a dual-luciferase assay kit (Promega) and NOTCH-dependent antagonism was measured by normalization of firefly and Renilla luci ferase signals.
  • hydrocarbon cross-links described herein can be further manipulated.
  • a double bond of a hydrocarbon alkenyl cross-link (e.g., as synthesized using a ruthenium-catalyzed ring closing metathesis (RCM)) can be oxidized (e.g., via epoxidation or dihydroxylation) to provide one of
  • Either the epoxide moiety or one of the free hydroxy! moieties can be further functionalized.
  • the epoxide can be treated with a nucleophile, which provides additional functionality that can be used, for example, to attach a tag (e.g., a radioisotope or fluorescent tag).
  • a tag e.g., a radioisotope or fluorescent tag.
  • the tag can be used to help direct the compound to a desired location in the body or track the location of the compound in the body.
  • an additional therapeutic agent can be chemically attached to the functionalized cross-link (e.g., an anti-cancer agent such as rapamycin, vinblastine, taxol, etc.).
  • Such derivitization can alternatively be achieved by synthetic manipulation of the amino or carboxy terminus of the polypeptide or via the amino acid side chain.
  • Other agents can be attached to the functionalized cross-link, e.g., an agent that facilitates entry of the polypeptide into cells.
  • the cross-link can include one or more of an ether, thioether, ester, amine, 1 ,4-triazole, 1 ,5-triazole, hydrazone or amide moiety.
  • a naturally occurring amino acid side chain can be incorporated into the cross-link.
  • a cross-link can be coupled with a functional group such as the hydroxyl in serine, the thiol in cysteine, the primary amine in lysine, the acid in aspartate or glutamate, or the amide in asparagine or glutamine - all with or without inclusion of internal crosslinking moieties (such as biselectrophile-containing alkanes with a pair of cysteines, for example).
  • a functional group such as the hydroxyl in serine, the thiol in cysteine, the primary amine in lysine, the acid in aspartate or glutamate, or the amide in asparagine or glutamine - all with or without inclusion of internal crosslinking moieties (such as biselectrophile-containing alkanes with a pair of cysteines, for example).
  • the length of the cross-l ink can be varied! For instance, a shorter length of cross-link can be used where it is desirable to provide a relatively high degree of constraint on the secondary alpha-helical structure, whereas, in some instances, it is desirable to provide less constraint on the secondary alpha-helical structure, and thus a longer cross-link may be desired.
  • cross-links spanning from amino acids i to i+3, i to i+4; and i to i+7 have been described in order to provide a cross-link that is primarily on a single face of the alpha helix, the cross-links can be synthesized to span any combinations of numbers of amino acids.
  • alpha disubstituted amino acids are used in the polypeptide to improve the stability of the alpha hel ical secondary structure.
  • alpha disubstituted amino acids are not required, and instances using mono-alpha substituents (e.g., in the cross-linked amino acids) are also envisioned.
  • Synthetic chemistry transformations and protecting group methodologies useful in synthesizing the compounds described herein are known in the art and include, for example, those such as described in R. Larock, Comprehensive Organic Transformations, VCH Publishers ( 1989); T. W. Greene and P.G.M. Wuts, Protective Groups in Organic Synthesis, 3d. Ed., John Wiley and Sons ( 1999); L. Fieser and . Fieser, Fieser and Fieser's Reagents for Organic Synthesis, John Wiley and Sons ( 1994); and L.
  • peptides of this invention can be made by chemical synthesis methods, which are well known to the ordinarily skilled artisan. See, for example, Fields et a!., Chapter 3 in Synthetic Peptides: A User's Guide, ed. Grant, W. H. Freeman & Co., New York, N.Y., 1992, p. 77. Hence, peptides can be synthesized using the automated Merrifield techniques of solid phase synthesis with the a-NH? protected by either t-Boc or Fmoc chemistry using side chain protected amino acids on, for example, an Applied Biosystems Peptide Synthesizer Model 430A or 43 1 .
  • SPPS solid phase peptide synthesis
  • the C-terminal amino acid is attached to a cross-linked polystyrene resin via an acid labile bond with a linker molecule.
  • This resin is insoluble in the solvents used for synthesis, making it relatively simple and fast to wash away excess reagents and by-products.
  • the N-terminus is protected with the Fmoc group, which is stable in acid, but removable by base. Any side chain functional groups are protected with base stable, acid labile groups.
  • peptides could be made by conjoining individual synthetic peptides using native chemical ligation. Alternatively, the longer synthetic peptides can be synthesized by well-known recombinant DNA techniques. Such techniques are provided in well-known standard manuals with detailed protocols.
  • a gene encoding a peptide of this invention the amino acid sequence is reverse translated to obtain a nucleic acid sequence encoding the amino acid sequence, preferably with codons that are optimum for the organism in which the gene is to be expressed.
  • a synthetic gene is made, typically by synthesizing ol igonucleotides which encode the peptide and any regulatory elements, if necessary.
  • the synthetic gene is inserted in a suitable cloning vector and transfected into a host cell.
  • the peptide is then expressed under suitable conditions appropriate for the selected expression system and host.
  • the peptide is purified and characterized by standard methods.
  • the peptides can be made in a high-throughput, combinatorial fashion, e.g., using a high-throughput multiple channel combinatorial synthesizer available from Advanced Chemtech.
  • Long or complex peptides may also be made using microwave-assisted peptide synthesis, where standard solid-phase peptide synthesis methods are used in a reaction chamber enclosed in a controllable microwave apparatus. These methods permit rapid heating and cooling of the reaction environment, which can increase yields and access to otherwise difficult to synthesize peptides.
  • the modified polypeptides one or more conventional peptide bonds replaced by a different bond that may increase the stability of the polypeptide in the body.
  • C(O)-NH retro-inverso bonds
  • NH-CF reduced ⁇ amide bond
  • S-CH2 or CH 2 -S an
  • polypeptides can be further modified by: acetylation, amidation.
  • polypeptides of the invention may also be conjugated to, for example, polyethylene glycol (PEG); alky I groups (e.g., C 1 -C20 straight or branched alkyl groups); fatty acid radicals; and combinations thereof.
  • PEG polyethylene glycol
  • alky I groups e.g., C 1 -C20 straight or branched alkyl groups
  • fatty acid radicals and combinations thereof.
  • the present invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant (e.g., excessive) Notch activity or aberrant activity of a gene, gene-product or molecular signaling pathway that is regulated (positively or negatively) by Notch proteins (isoforms 1 -4), MAML proteins (isoforms 1 -3) and/or CSL.
  • Notch proteins isoforms 1 -4
  • MAML proteins isoforms 1 -3
  • CSL CSL
  • treatment is defined as the application oradministration of a therapeutic agent to a patient, or appl ication or administration of
  • a therapeutic agent to an isolated tissue or cell line from a patient, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
  • the polypeptides of the invention can be used to treat, prevent, and/or diagnose cancers and neoplastic conditions.
  • cancer cancer
  • hyperproliferative and neoplastic refer to cells having the capacity for autonomous growth, i.e., an abnonnal state or condition characterized by rapidly prol i ferating cell growth.
  • Hyperproliferative and neoplastic disease states may be categorized as pathologic, i.e., characterizing or constituting a disease state, or may be categorized as non-pathologic, i.e., a deviation from normal but not associated with a disease state. The term is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transfonned cells, tissues, or 30 organs, irrespective of histopathologic type or stage of invasiveness.
  • Pathologic hyperproliferative occur in disease states characterized by malignant tumor growth. Examples of non-pathologic hyperproliferative cells include proliferation of cells associated with wound repair.
  • cel lular proliferative and/or differcntiative disorders include cancer, e.g., carcinoma, sarcoma, or metastatic disorders.
  • the compounds i.e., the stapled polypeptides
  • the polypeptides may also be useful for treatingmucoepidermoid carcinoma and medulloblastoma.
  • proli ferative disorders include hematopoietic neoplastic disorders.
  • the term "hematopoietic neoplastic disorders" includes diseases involving
  • hyperplastic/neoplastic cells of hematopoietic origin e.g., arising
  • Exemplary disorders include: acute leukemias, e.g., erythroblastic leukemia and acute mcgakaryoblastic leukemia. Additional exemplary myeloid disorders include, but are not limited to, acute promyeloid leukemia (APML), acute myelogenous 1 5 leukemia (AML) and chronic myelogenous leukemia (CML) (reviewed in Vaickus, L. ( 1 991 ) Crit Rev. in Oncol. IHemotol. 1 1 :267-97); lymphoid
  • APML acute promyeloid leukemia
  • AML acute myelogenous 1 5 leukemia
  • CML chronic myelogenous leukemia
  • malignancies include, but are not limited to acute lymphoblastic leukemia (ALL) which includes B lineageALL and T-lineage ALL, chronic lymphocytic leukemia (eLL), prolymphocyte leukemia (PLL), multiple mylenoma, hairy cell leukemia (HLL) and Waldenstrom's macroglobulinemia (WM).
  • Additional forms of malignant lymphomas include, but are not limited to non-Hodgkin lymphoma and variants thereof, peripheral T cell lymphomas, adult T cellieukemialiymphoma (ATL), cutaneous T-ccl 1 1 ymphoma (CTCL), large granular lymphocytic leukemia (LGF), Hodgkin's disease and Reed-Sternberg disease.
  • proli ferative breast disease including, e.g, epithelial hyperplasia, sclerosing adenosis, and small duct papillomas; tumors, e.g., stromal tumors such as fibroadenoma, phyl l Odes tumor, and sarcomas, and epithelialtumors such as large duct papilloma; carcinoma of the breast including in situ (noninvasive) carcinoma that includes ductal carcinoma in situ (including Paget's disease) and lobular carcinoma in situ, and invasive (infiltrating) carcinoma including, but not limited to, invasive ductal carcinoma, invasive lobular carcinoma, medullary carcinoma, colloid (mucinous) carcinoma, tubular carcinoma, and invasive papillary carcinoma, and miscellaneous malignant neoplasms.
  • proli ferative breast disease including, e.g, epithelial hyperplasia, sclerosing adenosis, and
  • disorders in the male breast include, but are not limited to, gynecomastia and carcinoma.
  • Other proliferative disorders that could be treated include cancers or metastatic disseminated tumors of the lung, pancreas, ovaries, gastrointestinal tract, liver as wel l as melanoma and medulloblastoma.
  • the polypeptides could also be used for the treatment of any metastatic tumor on the basis of Notch-required signaling for angiogenesis (maintenance of blood supply) and cancer stem-cell like properties of metastatic cells.
  • polypeptides described herein could be used for the treatment of many noncancerous diseases associated with overactive Notch signaling, including osteoporosis, autoimmune disorders, inflammatory atherosclerosis and pulmonary hypertension. Additionally, other diseases associated with NF-kappa-B signaling, such as immunologic disorders, may be treated with the polypeptides herein.
  • polypeptides herein could be used for the treatment (in vivo or ex vivo) of tissues or cells from patients for regenerative medicine or stem cell therapy.
  • the compounds of this invention including the compounds of formulae described herein, are defined to include pharmaceutically acceptable derivatives or prodrugs thereof.
  • a "pharmaceutically acceptable derivative or prodrug” means any pharmaceutically acceptable salt, ester, salt of an ester, or other derivative of a compound of this invention which, upon administration to a recipient, is capable of providing (directly or indirectly) a compound of this invention.
  • Particularly favored derivatives and prodrugs are those that increase the
  • bioavailabi lity of the compounds of this invention when such compounds are administered to a mammal (e.g., by al lowing an oral ly administered compound to be more readily absorbed into the blood) or which enhance delivery of the parent compound to a biological compartment (e.g., the brain or lymphatic system) relative to the parent species.
  • Preferred prodrugs include derivatives where a group which enhances aqueous solubility or active transport through the gut membrane is appended to the structure of formulae described herein.
  • the compounds of this invention may be modified by appending appropriate functionalities to enhance selective biological properties.
  • modifications are known in the art and include those which increase biological penetration into a given biological compartment (e.g., blood, lymphatic system, central nervous system), increase oral availability, increase solubility to allow administration by injection, alter metabolism and alter rate of excretion.
  • Pharmaceutically acceptable salts of the compounds of this invention include those derived from pharmaceutically acceptable inorganic and organic acids and bases.
  • suitable acid salts include acetate, adipate, benzoate, benzenesulfonate. butyrate, citrate, digluconate, dodecylsulfate, formate, fumarate, glycolate, hemisul fate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide.
  • lactate maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, palmoate, phosphate, picrate, pivalate.
  • salts derived from appropriate bases include alkali metal (e.g., sodium), alkaline earth metal (e.g., magnesium), ammonium and N-(alkyl) 4 + salts.
  • alkali metal e.g., sodium
  • alkaline earth metal e.g., magnesium
  • ammonium e.g., ammonium
  • N-(alkyl) 4 + salts e.g., sodium
  • This invention also envisions the quaternization of any basic nitrogen-containing groups of the compounds disclosed herein. Water or oil-soluble or dispersible products may be obtained by such quaternization.
  • the compounds of the formulae described herein can, for example, be administered by injection, intravenously, intraarterially, subdermally, intraperitoneally, intramuscularly, or subcutaneously; or orally, buccally, nasally, transmucosal ly. topical ly, in an ophthalmic preparation, or by inhalation, with a dosage ranging from about 0.001 to about 100 mg/kg of body weight, or according to the requirements of the particular drug.
  • the methods herein contemplate administration of an effective amount of compound or compound composition to achieve the desired or stated effect.
  • the pharmaceutical compositions of this invention wil l be administered from about 1 to about 6 times per day or alternatively, as a continuous infusion.
  • Such administration can be used as a chronic or acute therapy.
  • the amount of active ingredient that may be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration.
  • a typical preparation will contain from about 5% to about 95% active compound (w/w).
  • such preparations contain from about 20% to about 80% active compound.
  • a maintenance dose of a compound, composition or combination of this invention may be administered, if necessary. Subsequently, the dosage or frequency of administration, or both, may be reduced, as a function of the symptoms, to a level at which the improved condition is retained. Patients may, however, require intermittent treatment on a long-term basis upon any recurrence of disease symptoms.
  • compositions of this invention comprise a compound of the formulae described herein or a pharmaceutically acceptable salt thereof; an additional agent including for example, morphine or codeine; and any
  • compositions of this invention comprise a compound of the formulae described herein or a pharmaceutically acceptable salt thereof; and a pharmaceutically acceptable carrier, adjuvant or vehicle.
  • the compositions delineated herein include the compounds of the formulae delineated herein, as well as additional therapeutic agents i f present, in amounts effective for achieving a modulation of disease or disease symptoms.
  • pharmaceutically acceptable carrier or adjuvant refers to a carrier or adjuvant that may be administered to a patient, together with a compound of this invention, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the compound.
  • Pharmaceutical ly acceptable carriers, adjuvants and vehicles that may be used in the pharmaceutical compositions of this invention include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug deliver)' systems (SEDDS) such as d-ct-tocopherol polyethyleneglycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric deliver ⁇ ' matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, wax
  • compositions of this invention may be administered orally, parenterally, by inhalation spray, topically, rectal ly, nasally, buccally, vaginally or via an implanted reservoir, preferably by oral administration or administration by injection.
  • the pharmaceutical compositions of this invention may contain any conventional non-toxic pharmaceutically-acceptable carriers, adjuvants or vehicles. I n some cases, the pH of the formulation may be adjusted with pharmaceutically acceptable acids, bases or buffers to enhance the stability of the formulated compound or its delivery form.
  • parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional and intracranial ' injection or in fusion techniques.
  • the pharmaceutical compositions may be in the form of a sterile injectable preparation, for example, as a sterile injectable aqueous or oleaginous suspension.
  • This suspension may be formulated according to techniques known in the art using suitable dispersing or wetting agents (such as, for example, Tween 80) and suspending agents.
  • the sterile injectable preparation may also be a steri le injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example, as a solution in 1 ,3-butanediol.
  • suitable vehicles and solvents that may be employed are mannitol, water, Ringer's solution and isotonic sodium chloride solution.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • any bland fixed oil may be employed including synthetic mono- or diglycerides.
  • Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables. as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
  • These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, or carboxymethyl cellulose or similar dispersing agents which are commonly used in the formulation of pharmaceutically acceptable dosage forms such as emulsions and or suspensions.
  • surfactants such as Tweens or Spans and/or other similar emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.
  • compositions of this invention may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, emulsions and aqueous suspensions, dispersions and solutions.
  • carriers which are commonly used include lactose and corn starch.
  • Lubricating agents such as magnesium stearate, are also typically added.
  • useful diluents include lactose and dried corn starch.
  • compositions of this invention may also be administered in the form of suppositories for rectal administration.
  • These compositions can be prepared by mixing a compound of this invention with a suitable non-irritating excipient which is solid at room temperature but liquid at the rectal temperature and therefore will melt in the rectum to release the active components.
  • suitable non-irritating excipient include, but are not limited to, cocoa butter, beeswax and polyethylene glycols.
  • compositions of this invention may be administered by nasal aerosol or inhalation.
  • Such compositions are prepared according to techniques well- known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other solubilizing or dispersing agents known in the art.
  • the compositions of this invention comprise a combination of a compound of the formulae described herein and one or more additional therapeutic or prophylactic agents
  • both the compound and the additional agent should be present at dosage levels of between about 1 to 100%, and more preferably between about 5 to 95% of the dosage normally administered in a monotherapy regimen.
  • the additional agents may be administered separately, as part of a multiple dose regimen, from the compounds of this invention. Alternatively, those agents may be part of a single dosage form, mixed together with the compounds of this invention in a single composition.
  • the stapled polypeptides can include a drug, a toxin, a derivative of polyethylene glycol; a second polypeptide; a carbohydrate, etc. Where a polymer or other agent is linked to the stapled polypeptide is can be desirable for the composition to be substantial ly homogeneous.
  • polyethelene glycol (PEG) molecules can improve the appearance of PEG.
  • PEG pharmacokinetic and pharmacodynamic properties of the polypeptide.
  • PEGylation can reduce renal clearance and can result in a more stable plasma concentration.
  • PEG is a water soluble polymer and can be represented as linked to the polypeptide as formula:
  • XO--(CH 2 CH20) favor-CH 2 CH 2 ⁇ Y
  • n 2 to 10,000 and X is H or a terminal modification, e.g., a C
  • Y is an amide, carbamate or urea linkage to an amine group (including but not limited to, the epsilon amine of lysine or the N- terminus) of the polypeptide.
  • Y may also be a maleimide linkage to a thiol group (including but not limited to, the thiol group of cysteine).
  • Other methods for link ing PEG to a polypeptide, directly or indirectly, are known to those of ordinary skil l in the art.
  • the PEG can be linear or branched.
  • Various forms of PEG including various functionalized derivatives are commercially available.
  • PEG having degradable linkages in the backbone can be used.
  • PEG can be prepared with ester linkages that are subject to hydrolysis.
  • Conjugates having degradable PEG linkages are described in WO 99/34833; WO 99/14259, and U.S. 6,348,558.
  • macromolecular polymer e.g., PEG
  • the linker is made up of from 1 to 20 amino acids linked by peptide bonds, wherein the amino acids are selected from the 20 naturally occurring amino acids. Some of these amino acids may be glycosylated, as is well understood by those in the art.
  • the 1 to 20 amino acids are selected from glycine, alanine, proline, asparagine, glutamine, and lysine.
  • a linker is made up of a majority of amino acids that are sterically unhindered, such as glycine and alanine.
  • Non-peptide linkers are also possible. For example, alkyl linkers such as
  • alkyl linkers may further be substituted by any non-sterically hindering group such as lower alkyl (e.g., C i-Ce) lower acyl, halogen (e.g., CI, Br), CN, NH 2 , phenyl, etc.
  • lower alkyl e.g., C i-Ce
  • halogen e.g., CI, Br
  • CN NH 2
  • phenyl e.g., phenyl, etc.
  • U.S. Pat. No. 5,446,090 describes a Afunctional PEG linker and its use in forming conjugates having a peptide at each of the PEG linker termini.
  • solubi l ity and/or alpha helicity can sometime be improved by modi fying the amino-terminus of the peptide to attach spermine (Muppidi et al. 201 1 Bioorg Med. Chem Lett 7412).
  • the assays described herein can be performed with individual candidate compounds or can be performed with a plurality of candidate compounds. Where the assays are performed with a plurality of candidate compounds, the assays can be performed using mixtures of candidate compounds or can be run in parallel reactions with each reaction having a single candidate compound.
  • the test compounds or agents can be obtained using any of the numerous approaches in combinatorial library methods known in the art. Other applications
  • Li, L. et al. Alagille syndrome is caused by mutations in human Jagged 1 . which encodes a ligand for Notch 1 . Nat Genet 16, 243-251 ( 1 997).
  • Presenilin- 1 and -2 are molecular targets for gamma- secretase inhibitors. J Biol Chem 275, 34086-34091 (2000).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Rheumatology (AREA)
  • Physics & Mathematics (AREA)
  • Optics & Photonics (AREA)
  • Biomedical Technology (AREA)
  • Vascular Medicine (AREA)
  • Pulmonology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Urology & Nephrology (AREA)
  • Transplantation (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

Internally cross-linked peptides derived from human MAML and derivatives thereof which exhibit affinity for the ICN1-CSL complex are described and characterized. The peptides can interfere with NOTCH signaling and are thus useful for treating various disorders, including certain cancers.

Description

Stabilized Variant MAML Peptides and Uses Thereof
BACKGROUND
Aberrant transcription factor function is a hallmark of tumor development and progression. Deregulation of these critical regulatory molecules can result from numerous genetic events including mutation, translocation or amplification of upstream regulatory proteins such as kinases (e.g. BCR-Abl, b-Raf and k-Ras), deletion or inactivating mutation of protein phosphatases (e.g. PTEN), altered growth factor-receptor signaling (e.g. VEGF-VEGFR) or direct mutation, deletion, amplification or fusion of transcription factors themselves (e.g. MYC, p53 and NOTCH l ). In each of these cases, altered signaling cascades ultimately lead to di fferential activity of one or more transcription factors and the induction of abnormal gene expression networks' . While many "driver" oncogenes have been characterized, it is ultimately these networks that contribute to the malignant phenotype and cancer progression. Despite their critical role in genetic diseases such as cancer however, transcription factors have proven to be extremely chal lenging targets for the development of traditional small molecule drugs.
The Notch signaling pathway is a prototypical example of an oncogenic transcriptional network driven by overactive signaling through the multi-protein NOTCH transactivation complex. Normal Notch signaling is integral to a variety of developmental processes, including neural precursor specification, hematopoietic stem cell maintenance and l ineage determination2'3. The tight regulation of these processes derives in large part from the exquisite control ordinarily imposed by the cell over the duration and dosage of signals emanating from the activated Notch pathway. Aberrations in Notch pathway function and control are linked with a wide variety of disorders in humans. Mutations that disrupt NOTCH protein function have been observed in numerous developmental disorders, including CADAS IL4, congenital aortic valve defects5 and Allagille syndrome6. On the other hand, genetic alterations that cause inappropriate, sustained activation of the Notch pathway are causally linked with cancer. Indeed, human NOTCHl was discovered on the basis of its involvement in a t(7;9) chromosomal translocation observed in patients with T- cell acute lymphoblastic leukemia (T-ALL) 1. Subsequently, various activating mutations in NOTCH 1 have been discovered in greater than 50% of patients with IT- ALL8. Following these seminal discoveries in T-ALL, additional genetic insults that potentiate Notch signaling have been identified in many other forms of cancer including those of the breast9, ovaries10, lungs1 1-12, pancreas13 and gastrointestinal tract as well as in melanoma 1'', multiple myeloma15 and medul!oblastoma.
Additionally, aberrant Notch signaling has recently been implicated in the pathogenesis of numerous chronic diseases beyond cancer, including inflammatory atherosclerosis16, glomerulosclerosis17, osteoporosis18 and arterial hypertension 19.
Given the extensive causal relationships between NOTCH proteins and disease, considerable interest exists in the development of pharmacologic agents that antagonize the Notch pathway. Following receptor activation, NOTCH proteins undergo two sequential proteolytic cleavage events by an ADAM family metal loprotease20 and the γ-secretase complex21"23, respectively. Intramembrane cleavage of NOTCH receptors by γ-secretase releases an intracellular domain of NOTCH (ICN), which translocates to the nucleus and forms the active NOTCH transcriptional complex (NTC) with the transcription factor CSL and co-activators of the Mastermind-like fami ly (MAML 1 -3 in humans) (Figure l a) 24"27·28. Several classes of therapeutics have been developed to inhibit NOTCH ligands29'30, the extracel lular domains of NOTCH receptors31,32 and the γ-secretase complex j3"j6.
WO 2008/061 1 92 describes certain cross-linked peptides derived from MAML l that were tested these for aqueous solubil ity, strength of binding to the ICN-CSL complex, and for efficient of cellular penetration. One such peptide, SAHM 1 was found to specifically bind the 1C 1 -CSL complex and competitively inhibit binding of recombinant dnMAML l as well as full-length MAML l . When incubated with human T-ALL cells, SAH 1 was shown to inhibit the expression of a panel of canonical Notch target genes (HESJ, MYC, DTX1). A more comprehensive investigation employing gene expression profiling and gene set enrichment analysis demonstrated that SAHM 1 produces a transcriptional signature of Notch gene repression in human and murine T-ALL cells - indeed one that showed striking correspondence to that produced by treatment with a small-molecule γ-secretase
? inhibitor (GS I). Direct blockade of NOTCH-CSL transcriptional activation was found to induce NOTCH-specific anti-proliferative effects in human T-ALL cell lines as well as in a bioluminescent murine model of T-ALL driven by a clinically observed mutant NOTCH! allele.
SUMMARY
Described below are stably cross-linked peptides related to a portion of human MAML l ("stapled MAML l peptides"). These cross-linked peptides contain at least two modified amino acids that together form an internal (intramolecular) cross-link between the alpha carbons of the two modified amino acids that can help to stabilize the alpha-helical secondary structure of the peptide (see U.S. Patent No. 7, 1 92, 1 73 and Verdine et al. 201 2 Methods in Enzymology 503 :3)In some cases the peptide includes four (6, 8 or 10) modified amino acids, pairs of which form an internal cross-link. Such peptides have two (3, 4 or 5) internal cross-links separated by one or more, e.g., three amino acids. In some cases the peptide contains three modi fied amino acids, the middle one of which forms a cross-link (between alpha carbons) with each of the two flanking amino acids. Such cross-linked peptides, which also have two internal cross-links, are sometimes referred to as "stitched" peptides and are described in US 2010/01 84645.
A cross-linked polypeptide described herein can have improved biological activity relative to a corresponding polypeptide that is not cross-linked. The cross-linked MAML l peptides can bind to the ICN 1 -CSL complex and competitively inhibit binding of recombinant MAML l or full-length MAML proteins (MAML 1 -3) to ICN 1 -CSL complexes. Certain active peptides are expected to inhibit the expression of one or more Notch-regulated genes (HES1, MYC, DTX1 and others) in T-ALL cells or other cells in which Notch signaling is active, an expectation that is supported by Notch 1 -dependent reporter gene studies. The internally cross-linked MAML peptides described herein can be used therapeutically, e.g., to treat a variety of cancers or Notch-dependent diseases in a subject, for example, cancers and other disorders characterized by undesirable activation of a Notch receptors or Notch- activated gene(s). The cross-linked MAMLl peptides described herein are variants of a portion of human MAMLl and could include amino acid substitutions from other MAML isoforms (MAML2 and MAML3) or novel amino acid mutations. The sequence of a relevant portion of human MAMLl (starts at amino acid 21 of MAMLl) is depicted below:
(SEQ ID NO:l):
GluiArg2Leu3Arg«iArg5Arg6lle7Glu8Leu9C sioArgiiArgi2Hisi3HiS]4Seri5Thri6Cysi7 GliiisAlai9Arg2oTyr2|Glu22Ala23Val24Ser25Pro26Glu27Arg28Leu29 (SEQ ID NO:l)
Other relevant MAML sequences include:
SEQ ID NO:2 (MAML-1 ; amino acids 19-62):
VMERLRRR1ELCRRHHSTCEARYEAVSPERLELERQHTFALHQR
SEQ 1D 0:3 (MAML-2):
IVERLRAR1AVCRQHHLSCEGRYERGRAESSDRERESTLQLLSL
SEQ IDNO:4 (MAML-3):
VVERLRQRIEGCRRHHVNCENRYQQAQVEQLELERRDTVSLYQR
SEQ ID NO:5 (MAML- 1 ; includes predicted domain for binding the transcription complex):
HSAVMERLRRR1ELCRRHHSTCEARYEAVSPERLELERQHTFALHQRC1Q A AKRAGKH
SEQ ID NO:6 (MAML-2; includes predicted domain for binding the transcription complex):
HSAIVERLRARIAVCRQHHLSCEGRYERGRAESSDRERESTLQLLSLVQH GQGARKAGKH
SEQ ID NO:7 (MAML-3; includes predicted domain for binding the transcription complex):
AVPKHSTVVERLRQRIEGCRRHHVNCENRYQQAQVEQLELERRDTVSLYQ RTLEQRA S
SEQ ID NO:8 (MAML-1 core) ERLRRRIELCRRHHST
SEQ ID NO:9 (MAML-2 core) ERLRARIAVCRQHHLSC
SEQ ID NO: 10 (MAML-3 core) ERLRQRIEGCRRHH VN SEQ ID NO: 11 (MAML-2 fragment):
ERL ARIAVCRQHHLSCEGRYERGRAESS SEQ ID O:21 (MA L-3 fragment):
ERLRQRIEGCRRHHVNCENRYQQAQVEQL
The cross-linked peptides of the present disclosure include at least 10 contiguous amino acids of SEQ ID NOs: 12-20 wherein the side chain of two or more amino acids that are separated by three or seven amino acids is replaced by an internal cross-link. In each case, the amino acids indicated below can be replaced by the corresponding alpha-methyl amino acid. Thus, Leu can be alpha-methyl Leu. The cross-linked peptides of the invention do not include cross-liked peptide comprising any of SEQ ID NO: 1-10 wherein in two or more amino acids separated by 3 or 6 amino acids are replaced by an internal cross-link.
GluiArg2Xaa3Xaa Arg5Arg6 aa7Xaa8Xaa XaaioArgiiXaai2Hisi3Hisi eri5
(SEQ ID NO: 12; Related to MA L-1)
Glui Arg2Xaa3XaaAla5Arg6Xaa7XaagXaa9XaaioArgiiXaai2Hisi3HisMLeui5 Xaai6Xaai7Xaai8Glyi9Arg2oXaa2iGlu22Arg23Gly2 Arg25Ala26Glu27Ser28Ser2g> (SEQ ID NO: 15; Related to MAML-2)
Gliii Arg2Xaa3Xaa4Gln5Arg5Xaa7Xaa8Xaa9XaaioArgi|Xaai2Hisi3Hisi4Val|5 Xaai6Xaai7Xaai8Asni9Arg2oXaa2iGlii22Gln23Ala24Gln25Val26Glu27Gln28Leu2 (SEQ ID NO: 18; Related to MAML-3) wherein:
Xaas is Leu. Trp_ or Phe;
Xaa4 is Arg. Lys, Ala. Aib (aminoisobutyric acid);
Xaa7 is I]e, Leu, or NorL;
Xaas is Glu Ala or Aib;
Xaa9 is Leu. Trp, Phe, or Tyr; Xaaio is Cys. Phe or Val;
Xaai2 is Arg, Ala or Aib Xaai6 is Thr or Ala or Aib;
provided that when Xaa3 is Leu, Xaa7 is He, and Xaa9 is Leu, Xaa]0 is not Cys; and provided that when Xaa7 is He, and Xaag is Leu, and Xaaio is Cys, Xaa3 is not Leu; and provided that when Xaa3 is Leu, and Xaa9 is Leu, and Xaaio is Cys, Xaa7 is not l ie; and provided that when Xaa3 is Leu, Xaa7 is He, and Xaaio is Cys, Xaa is not Leu.
Glui Arg2Xaa3Xaa4Arg5Arg6Xaa7Xaa8Xaa XaaioArgnXaai2Hisi3His i4Seri5
Xaa 16Xaa 17Xaa 18 Al a 1 Arg2oXaa21
(SEQ I D NO: 1 3; Related to MAML- 1 )
Glui Arg2Xaa3Xaa4Ala5Arg6Xaa7Xaa8Xaa9XaaioArgnXaai2Hisi3His i<iLeu i5
Xaai6Xaai7Xaai8Gly i9Arg2oXaa2i
(SEQ I D NO: 1 6; Related to MAML-2)
Glui Arg2Xaa3Xaa4Gln5Arg Xaa7Xaa8Xaa9XaaioArgn Xaai2Hisi3H isi4Val i5
Xaai6XaanXaaisAsn i Arg2oXaa2i
(SEQ ID NO: 1 9; Related to MAML-3)
Wherein:
Xaa3 is Leu, Trp or Phe;
Xaaa is Arg. Lys, Ala, Aib (aminoisobutyric);
Xaa7 is He, Leu, or NorL;
Xaas is Glu Ala or Aib;
Xaag is Leu. Trp, Phe, or Tyr;
Xaaio is Cys, Phe or Val;
Xaau is Arg, Ala or Aib;
Xaa i 6 is Thr, Ala or Aib;
Xaan is Cys, Aib, Ala, or D-pentafluorophenylalanine.;
Xaaig is Glu, Ala or Aib. Glu]Arg2 aa3Xaa4Arg5Arg6Xaa7XaagXaa9 aaioArgi] aai2Hisi3Hisi Seri5
Xaai6Xaai7Xaai8Alai9Arg2oXaa2iGlu22Ala23Val24Ser25Pro26Glu27Arg28Leu29
(SEQID O:14)
GluiArg2Xaa3Xaa4Ala5Arg6Xaa7Xaa8Xaa9XaaioArgiiXaai2Hisi3Hisi Leui5 Xaai6Xaai7Xaai8G]yi9Arg2oXaa2iGlu22Arg23Gly24Arg25Ala26Glu27Ser28Ser29 (SEQ ID NO: 17; Related to MA L-2)
GluiArg2Xaa3Xaa4Gln5Arg6Xaa7Xaa8Xaa9XaaioArgiiXaai2Hisi3Hisi ali5 Xaai6Xaai7XaaisAsni Arg2oXaa2iGln22Gln23Ala24Gln25Val26Glu27Gln28Leu29 (SEQ ID NO:20; Related to AML-3) wherein:
Xaa3 is Leu, Trp or Phe;
Xaa is Arg, Lys, Ala or Aib Xaa7 is He, Leu, or NorL;
Xaa8 is Glu or Ala orAib
Xaa is Leu, Trp, Phe, or Tyr;
Xaaio is Cys, Phe or Val;
Xaan is Arg, Alaor Aib
Xaai6 is Thr or Ala orAib
Xaan is Cys, Aib, Ala orD-pentafluorophenylalanine.;
Xaaig is Glu, Ala or Aib
Xaa2i is Tyr, 1-naphthylalanine, Τφ, or 2-naphthylalanine.
In some embodiments the cross-linked peptide is a described above provided that: when Xaas is Leu, Xaa7 is He, and Xaag is Leu, Xaaio is not Cys; and/or provided that when Xaa7 is He, and Xaa9 is Leu, and Xaaio is Cys, Xaa3 is not Leu; and/or provided that when Xaa3 is Leu, and Xaag is Leu, and Xaaio is Cys, Xaa7 is not He; and/or provided that when Xaa is Leu, Xaa? is He, and Xaaio is Cys, Xaa9 is not Leu. In the cross-linked peptides described herein the alpha carbon of an amino acid at position N can be cross-linked to the alpha carbon of an amino acid at position N + 4 by replacing the side chains of both amino acids with an internal cross-link. In the case of peptides have two internal cross links, the alpha carbon of the amino acid at position N can be cross-linked to the alpha carbon of an amino acid at position N + 4 by replacing the side chains of both amino acids with an internal cross-link and the alpha carbon of the amino acid at position N + 8 can be cross-linked to the alpha carbon of an amino acid at position N + 1 2 by replacing the side chains of both amino acids with an internal cross-link. In the case of so-called stitched peptides having two cross-links in which one amino acid participates in two cross-links, i.e., the alpha carbon of one amino acid is cross-linked to two different amino acids, the alpha carbon of the amino acid at position N can be cross-linked to the alpha carbon of the amino acid at position N + 4 and the alpha carbon of the amino acid at position N + 4 can also be cross-linked to the alpha carbon of the amino acid at position N + 8. This is usually accomplished by replacing the side chain of the amino acid at position N with a cross-link to the alpha carbon to the amino acid at position N + 4, replacing each of the side chain and the H of the amino acid a position N + 4 with cross l inks (one to the amino acid at position N and one to the amino acid at position N + 8), and replacing the side chain of the amino acid at position N + 8 with a cross-link to the alpha carbon of the amino acid at position N + 4.
In SEQ I D NO: 12 (and 1 3-20) preferred cross-links are: between Xaa and Xaa8: between Xaag and Xaa^; between Xaa^ and Xaai6; between Xaa4 and Xaag and simultaneously between Xaag and Xaai2 (stitched peptide); and between Xaag and Xaai2 and simultaneously between Xaa^ and Xaai6 (stitched peptide).
[0001 ] [0002] In one aspect, the present disclosure features a modified polypeptide of Formula (I),
Figure imgf000010_0001
Formula (1)
or a pharmaceutically acceptable salt thereof,
wherein;
each R| and R2 are independently H or a C] to Cio alkyl (preferably methyl), C2 to Cio alkenyl, C2 to Cio alkynyl, arylalkyl, cycloalky lalkyl, heteroarylalk I, or heterocyclylalkyl;
R3 is alkylene, alkenylene or alkynylene, or [R4 -K.- R4],,; each of which is substituted with 0-6 R5;
R4 and R4'are independently alkylene, alkenylene or alkynylene (e.g., each are independently a C I , C2, C3, C4, C5, C6, C7, C8, C9 or C I O alkylene, alkenylene or alkynylene);
R5 is halo, alkyl, OR«, N(R<;)2, SR6, SOR^, S02R6, C02R6! R6, a fluorescent moiety, or a radioisotope;
O
K is O, S, SO, S02, CO, C02, CONR6, ^ , aziridine, episul fide, diol,
["""""^NH
amino alcohol or n¾¾:N ;
R^ is H, alkyl, or a therapeutic agent;
n is 2, 3, 4 or 6;
x is an integer from 2- 10 (preferably 3 or 6);
w and y are independently an integer from 0- 100;
z is an integer from 1 - 10 (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10); and
each Xaa is independently an amino acid (e.g., one of the 20 naturally occurring amino acids or any naturally occurring non-naturally occurring amino acid, e.g., a D-amino acid or an alpha-alkyl amino acid (e.g., an alpha-methy!-amino acid));
wherein the polypeptide comprises at least 8 contiguous amino acids of any of SEQ ID NOs 1 2-20 or a variant thereof, or another polypeptide sequence described herein except that: (a) within the 8 contiguous amino acids of SEQ I D NO: 12-20 the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the linking group, R3, which connects the alpha carbons of the pair of amino acids as depicted in Formula I; and (b) the alpha carbon of the first of the pair of amino acids is substituted with R| as depicted in formula 1 and the alpha carbon of the second of the pair of amino acids is substituted with R2 as depicted in Formula I . Thus, the sequence [Xaa]wL' [Xaa]yL" [Xaa]z, wherein L' and L" are amino acids in which the side chains have been replaced by the linking group R3, comprises at least contiguous amino acids of SEQ ID NO: 12-20. another aspect, the invention features a modified polypeptide of Formu
Figure imgf000011_0001
Formula (I I)
or a pharmaceutically acceptable salt thereof,
wherein;
each Ri and R2 are independently H or a C 1 - C 10 alky 1, C2 - C 10 alkeny 1, C2 - C I O alkynyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, or heterocyclylalkyl;
R3 is C8 - C I 6 alkylene, C8 - C I 6 alkeny lene (preferably a C8 alkeny lene with a double bond between the 4lh and 5lh carbons) or C8 - C I 6 alkynylene, or [R4 -Κ-¾]η; each of which is substituted with 0-6 R5;
R4 and R4' are independently C 1 -C 10 alkylene, C2-C 10 alkeny lene or C2- C 10 alkynylene (e.g., each are independently a C 1 , C2, C3, C4, C5, C6, C7, C8, C9 or C I 0 alkylene. alkeny lene or alkynylene);
R5 is halo, alkyl, ORfi, (R6)2, SR6, SOR6, S02R6, C02Rfi, R6, a fluorescent moiety, or a radioisotope; O
is O, S, CO, C02, CONR*, , aziridine, episulfide, diol. amino alcohol, or
Figure imgf000012_0001
R-6 is H, C I -C I O alkyl, or a therapeutic agent;
x is an integer from 2- 1 0 (preferably 3 or 6);
\v and y are independently an integer from 0- 100;
z is an integer from 1 - 10 (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10); and
each Xaa is independently an amino acid (e.g., one of the 20 naturally occurring amino acids or any naturally occurring non-naturally occurring amino acid);
R7 is PEG, a tat protein, an affinity label, a targeting moiety, a fatty acid- derived acyl group, a biotin moiety, a fluorescent probe (e.g. fluorescein or rhodamine) l inked via, e.g., a thiocarbamate, carbamate, amide, amine, ether or triazole linkage;
Rs is H, OH, NH2j NHR8a, NR8aR8b;
wherein the polypeptide comprises at least 14 contiguous amino acids of SEQ I D NOs 1 2-20 or a variant thereof , or another polypeptide sequence described herein except that: (a) within any of SEQ I D NOs: 12-20 the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the link ing group, R3, which connects the alpha carbons of the pair of amino acids as depicted in formula I; and (b) the alpha carbon of the first of the pair of amino acids is substituted with R| as depicted in Formula II and the alpha carbon of the second of the pair of amino acids is substituted with R2 as depicted in Formula I I . Thus, the peptide [Xaa]wX[Xaa]yX ' [Xaa]x, where [Xaa]w, [Xaa]y, and [Xaa]x are as defined above in Formulas I and I I and X and X' represent amino acids whose side chain has been replaced by a cross-link, can have a sequence corresponding to at least 20 contiguous amino acids of any of SEQ I D NOs: 1 2 - 20. Thus, the sequence
[Xaa]wL' [Xaa]yL" [Xaa]z, wherein L' and L" are amino acids in which the side chains have been replaced by the linking group R3, comprises at least contiguous amino acids of SEQ 1 D O: 12-20. In some embodiments [R -K-R4]n is
Figure imgf000013_0001
wherein each is independently a C2-C6 alky 1. In some embodiments R7 is spermine (- (CH2)3NH(CH2)3NH(CH2)3 H2)
Also included are peptides having formula IV:
Figure imgf000013_0002
Formula IV
or a pharmaceutically acceptable salt thereof,
wherein;
each Ri and R2 are independently H or a C| to C|0 alkyl (preferably methyl), C2 to Cio alkenyl, C2 to C]0 alkynyl, arylalkyl, cycloalkylalkyl, heteroarylalkyi, or heterocyclylalkyl;
R3 is alkylene, alkenylene or alkynylene, or [R -K-R4]n; each of which is substituted with 0-6 R5;
R4 and R are independently alkylene, alkenylene or alkynylene (e.g., each are independently a C I , C2, C3, C4, C5, C6, C7, C8, C9 or C I O alkylene, alkenylene or alkynylene);
R5 is halo, alkyl, ORfi, (R6)2, SR6, SOR6, S02R6, C02Ri, Rfi, a fluorescent moiety, or a radioisotope; , aziridine, episulfide, diol,
Figure imgf000013_0003
Re is H, alkyl, or a therapeutic agent;
x and x' are independently an integer from 2- 10 (preferably 3 or 6;
preferably both are 3 or one is 3 and the other is 6 or one is 3 and the other is 6); w and y are independently an integer from 0- 1 00; and each Xaa is independently an amino acid (e.g., one of the 20 naturally occurring amino acids or any naturally occurring non-naturally occurring amino acid, e.g., a D-amino acid or an alpha-alkyl amino acid (e.g., an alpha-methyl-amino acid));
wherein the polypeptide comprises at least 8 contiguous amino acids of any of SEQ ID NOs 12-20 or a variant thereof, or another polypeptide sequence described herein except that: (a) within the 8 contiguous amino acids of SEQ ID NO: 1 2-20 the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the linking group, R3, which connects the alpha carbons of the pair of amino acids as depicted in Formula I; and (b) the alpha carbon of the first of the pair of amino acids is substituted with Ri as depicted in formula I and the alpha carbon of the second of the pair of amino acids is substituted with 2 as depicted in Formula 1.
As noted above, the cross-l inks can have a variety of positions. Certain examples are depicted below. In these depictions "AA" represents an amino acid side chain and "L" represents the intramolecular cross-link (R3 in Formulas I-1V)
Figure imgf000015_0001

Figure imgf000016_0001

Figure imgf000017_0001
In the case of Formula 1 or Formula I I, the following embodiments are among those disclosed.
In cases where x = 2 (i.e., N + 3 linkage), R3 can be a C7 alkylene or aikenylene. Where it is an aikenylene there can one or more double bonds. In cases where x = 6 (i.e., i + 7 linkage), R3 can be a C 12 or C 1 3 alkylene or aikenylene. Where it is an aikenylene there can one or more double bonds. In cases where x = 3 (i.e., i + 4 linkage), R3 can be a C8 alkylene, aikenylene. Where it is an aikenylene there can one or more double bonds. In the stapled peptides, any position occupied by Gin can be Glu instead and any position occupied by G lu can be Gin instead. Similarly, any position occupied by Asn can be Asp instead and any position occupied by Asp can be Asn instead. In some cases, choice of Asn or Arg and Gin or Glu will depend on the desired charge of the stapled peptide. In many cases it is desirable for the cross-linked peptide to be neutral or have a net positive charge at physiological pH.
In some instances, each w is independently an integer between 3 and 1 5. In some instances each y is independently an integer between 1 and 1 5. In some instances, Ri and i are each independently H or C| -C6 alkyl. In some instances, R i and R2 are each independently C1-C3 alkyl. In some instances, at least one of Rj and R2 are methyl. For example R i and R2 are both methyl. In some instances R3 is alkyl (e.g., Cs alkyl) and x is 3. In some instances, R3 is Cn alkyl and x is 6. In some instances, R3 is alkenyl (e.g., Cs alkenyl) and x is 3. In some instances x is 6 and R3 is Cn alkenyl. In some instances, R3 is a straight chain alkyl, alkenyl, or alkynyl. I n some instances R3 is -CH2-CH2-CH2-CH=CH-CH2-CH2-CH2-. In some instances R3 is -CH2- CH2- CH2- CH2-CH2-CH2-CH=CH-CH2-CH2-CH2-. In some instances R3 is -CH2- CH2- CH2- CH=CH-CH2- CH2-CH2-CH2-CH2-CH2-.
In certain instances, the two alpha, alpha disubstituted stereocenters (alpha carbons) are both in the R configuration or S configuration (e.g., N, N+4 cross-link), or one stereocenter is R and the other is S (e.g., N, N+7 cross-link). Thus, where Formula I is depi
Figure imgf000018_0001
the C and C" disubstituted stereocenters can both be in the R configuration or they can both be in the S configuration, for example when x is 3. When x is 6, the C' disubstituted stereocenter is in the R configuration and the C" disubstituted stereocenter is in the S configuration. When x is 2, the C disubstituted stereocenter is in the R configuration and the C" disubstituted stereocenter is in the S configuration. The R3 double bond may be in the E or Z stereochemical configuration. Similar configurations are possible for the carbons in Formula I I corresponding to C and C" in the formula depicted immediately above.
I n some instances R3 is [¾-Κ-¾']η; and R4 and RVare independently alkylene, alkenylene or alkynylene (e.g., each are independently a C I , C2, C3, C4, C5, C6, C7, C8, C9 or C I O alkylene, alkenylene or alkynylene
I n some instances, the polypeptide includes an amino acid sequence which, in addition to the amino acids side chains that are replaced by an intermolecular crosslink, have 1 , 2, 3, 4 or 5 amino acid changes in any of SEQ I D NOs: l -21 (e.g., SEQ I D Os; 12-20).
The cross-link can include an alkyl, alkenyl, or alkynyl moiety (e.g., C5, C% or C M alky! or a C5, Cg or C| 1 alkenyl, or C5, Cg or C| 1 alkynyl). The cross-linked amino acid can be alpha disubstituted (e.g., C 1 -C3 or methyl). [Xaa]y and [Xaa]w are peptides that can independently comprise at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 1 2, 1 3, 14, 1 5, 16, 1 7, 18, 1 9, 20, 25 or more contiguous amino acids (preferably 2 or 5 contiguous amino acids) of a variant MA L 1 , 2 or 3 peptide (e.g., any of SEQ ID l\'Os: 1 2-20) and [Xaa] is a peptide that can comprise 3 or 6 contiguous amino acids of acids of a variant AML 1 , 2 or 3 peptide.
The peptide can comprise 8, 9, 1 0, 1 1 , 1 2, 13, 14, 1 5, 16, 1 7, 18, 19, 20, 25, 30, 35, 40, 45, 50 amino acids of a variant MAML 1 , 2 or 3 peptide. The amino acids are contiguous except that one or more pairs of amino acids separated by 3 or 6 amino acids are replaced by amino acid substitutes that form a cross-link, e.g., via R3. Thus, at least two amino acids can be replaced by cross-linked amino acids or cross- linked amino acid substitutes. Thus, where formula I is depicted as
Figure imgf000020_0001
[Xaa]y-, [Xaa]x and [Xaa]y- can each comprise contiguous polypeptide sequences from the same or different variant MA L 1 , 2 and 3 peptides. The same is true for Formula I I.
The peptides can include 10 ( 1 1 , 12, 1 3, 14, 1 5, 16, 1 7, 1 8, 1 9, 20, 2 1 , 22, 23, 24, 25, 30, 35, 40, 45, 50 or more) contiguous amino acids of a variant AML 1 , 2 or 3 polypeptide described herein wherein the alpha carbons of two amino acids that are separated by three amino acids (or six amino acids) are linked via s. one of the two alpha carbons is substituted by R| and the other is substituted by R2 and each is linked via peptide bonds to additional amino acids.
I n some instances the polypeptide acts as an inhibitor of Notch complex formation. In some instances, the polypeptide also includes a fluorescent moiety or radioisotope or a moiety that can chelate a radioisotope (e.g., mercaptoacetyltriglycine or 1 , 4. 7, 10-tetraazacyclododecane-N,N',N", N"'-tetraacetic acid (DOTA)) chelated to a radioactive isotope of Re, In or Y). In some instances, R| and R? are methyl; R3 is C8 alkyl, Cn alkyl, Cg alkenyl, CM alkenyl, C% alkynyl, or Cn alkynyl; and x is 2, 3, or 6. In some instances, the polypeptide includes a PEG linker, a tat protein, an affinity label, a targeting moiety, a fatty acid-derived acyl group, a biotin moiety, a fluorescent probe (e.g. fluorescein or rhodamine) or another bio-active molecule to recruit enzymatic machinery, including: small molecules that bind and recruit ubiquitin ligases (nutlin, SAH-p53-8); histone deacetylase proteins and complexes (SIN3 alpha-helix, SAHA) or co-activator proteins (M LL alpha-helix, VP 16 alpha- helix) or others. Also described herein is a method of treating a subject including administering to the subject any of the compounds described herein. In some instances, the method also includes administering an additional therapeutic agent, e.g., a chemotherapeutic agent.
The peptides may contain one or more asymmetric centers and thus occur as racemates and racemic mixtures, single enantiomers, individual diastereomers and diastereomeric mixtures and geometric isomers (e.g. Z or cis and E or trans) of any olefins present. All such isomeric forms of these compounds are expressly included in the present invention. The compounds may also be represented in multiple tautomeric forms, in such instances, the invention expressly includes all tautomeric forms of the compounds described herein (e.g., alkylation of a ring system may result in alkylation at multiple sites, the invention expressly includes all such reaction products). All such isomeric forms of such compounds are included as are all, crystal forms.
Amino acids containing both an amino group and a carboxyl group bonded to a carbon referred to as the alpha carbon. Also bonded to the alpha carbon is a hydrogen and a side-chain. Suitable amino acids include, without limitation, both the D- and L- isomers of the 20 common naturally occurring amino acids found in peptides (e.g., A, R, N, C, D, Q, E, G, H, 1, L, K, M, F, P, S, T, W, Y, V (as known by the one letter abbreviations)) as well as the naturally occurring and unnatural ly occurring amino acids prepared by organic synthesis or other metabolic routes. The table below provides the structures of the side chains for each of the 20 common naturally-occurring amino acids. In this table the at right side of each structure is the bond to the alpha carbon.
Single Three
Am ino acid Structure of side chain
Letter Letter
1 Alanine A Ala CH3-
Arginine R Arg HN=C(NH2)-NH-(CH2)3- j Asparagine N Asn H2N-C(0)-CH2-
1 Aspartic acid D Asp HO(0)C-CH2- j Cysteine C Cys HS-CH2-
Glutamine Q Gin H2N-C(0)-(CH2)2- j Glutamic acid E Glu HO(0)C-(CH2)2- i Glycine ! G Gly H- I N=CH-NH-CH=C-CFL-
' H istidine H j H is
1 1
j Isoleucine j I l ie CH3-CH2-CH(CH3)- j Leucine L Leu (CH3)2-CH-CH2-
1 Lysine K Lys H2N-(CH2)4- f* Methionine M Met CH3-S-(CH2)2-
Phenylalanine F Phe Phenyl-CH2-
-N-(CH,)3-CH-
Proline P Pro
1 1
Serine S Ser HO-CH2-
Threonine T Thr CH3-CH(OH)- henyl-NH-CH=C-CH?-
Tryptophan w P
Trp
1 1
Tyrosine Y Tyr 4-OH-Phenyl-CH2-
Valine V Val CH3-CH(CH2)-
A "non-essential" amino acid residue is a residue that can be altered from the wild- type sequence of a polypeptide (without abolishing or substantially altering its activity. An "essential" amino acid residue is a residue that, when altered from the wild-type sequence of the polypeptide, results in abol ishing or substantially abolishing the polypeptide activity.
A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Famil ies of amino acid residues having similar side chains have been defined in the art. These fami lies include amino acids with basic side chains (e.g., lysine, arginine, histidine). acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g.. glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
The symbol " - "when used as part of a molecular structure refers to a single bond or a trans or cis double bond.
The term "amino acid side chain" refers to a moiety attached to the ct-carbon in an amino acids. For example, the amino acid side chain for alanine is methyl, the amino acid side chain for phenylalanine is phenylmethyl, the amino acid side chain for cysteine is thiomethyl, the amino acid side chain for aspartate is carboxymethyl, the amino acid side chain for tyrosine is 4-hydroxyphenylmethyl, etc. Other non- naturally occurring amino acid side chains are also included, for example, those that occur in nature (e.g., an amino acid metabolite) or those that are made synthetically (e.g., an alpha di-substituted amino acid).
The term "polypeptide" encompasses two or more naturally occurring or synthetic amino acids linked by a covalent bond (e.g., a amide bond). Polypeptides as described herein include full length proteins (e.g., fully processed proteins) as well as shorter amino acids sequences (e.g., fragments of naturally occurring proteins or synthetic polypeptide fragments). The term "variant MA L- 1 peptide" includes SEQ ID NOs: 12- 14. The term "variant MAML-2 peptide" includes SEQ ID NOs: 1 5- 1 7. The term "variant A L-3 peptide" includes SEQ I D NOs: 1 8-20.
The term "halo" refers to any radical of fluorine, chlorine, bromine or iodine. The term "alkyl" refers to a hydrocarbon chain that may be a straight chain or branched chain, containing the indicated number of carbon atoms. For example, C |-C IO indicates that the group may have from 1 to 10 (inclusive) carbon atoms in it. In the absence of any numerical designation, "alkyl" is a chain (straight or branched) having 1 to 20 (inclusive) carbon atoms in it. The term "alkylene" refers to a divalent alkyl (i.e., -R-).
The term "alkenyl" refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon double bonds in either Z or E geometric configurations. The alkenyl moiety contains the indicated number of carbon atoms. For example, C2-C10 indicates that the group may have from 2 to 10 (inclusive) carbon atoms in it. The term "lower alkenyl" refers to a C2-C8 alkenyl chain. In the absence of any numerical designation, "alkenyl" is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
The term "alkynyl" refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon triple bonds. The alkynyl moiety contains the indicated number of carbon atoms. For example, C2-C10 indicates that the group may have from 2 to 10 (inclusive) carbon atoms in it. The term "lower alkynyl" refers to a C2-Q alkynyl chain. In the absence of any numerical designation, "alkynyl" is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
The term "aryl" refers to a 6-carbon monocyclic or 1 0-carbon bicycl ic aromatic ring system wherein 0, 1. 2, 3, or 4 atoms of each ring may be substituted by a substituent. Examples of aryl groups include phenyl, naphthyl and the like. The term "arylalkyl" or the term "aralkyl" refers to alkyl substituted with an aryl. The term "arylalkoxy" refers to an alkoxy substituted with aryl.
The term "cycloalkyl" as employed herein includes saturated and partially unsaturated cyclic hydrocarbon groups having 3 to 1 2 carbons, preferably 3 to 8 carbons, and more preferably 3 to 6 carbons, wherein the cycloalkyl group additionally may be optional ly substituted. Preferred cycloalkyl groups include, without l imitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl. cycloheptyl, and cyclooctyl. The term "heteroaryl" refers to an aromatic 5-8 membered monocyclic, 8- 1 2 membered bicyclic, or 1 1 - 14 membered tricyclic ring system having 1 -3 heteroatoms if monocyclic, 1 -6 heteroatoms if bicyclic, or 1 -9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1 -3, 1 -6, or 1 -9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1 , 2, 3, or 4 atoms of each ring may be substituted by a substituent. Examples of heteroaryl groups include pyridyl, furyl or furanyl, imidazolyl, 1 ,2,3- triazolyl, 1 ,2,4-triazolyl, benzimidazolyl, pyrimidinyl, thiophenyl or thienyl, quinolinyl, indolyl, thiazoly 1, and the like. The term "heteroarylalkyl" or the term "heteroaralkyl" refers to an alkyl substituted with a heteroaryl. The term
"heteroarylalkoxy" refers to an alkoxy substituted with heteroaryl.
The term "heterocyclyl" refers to a nonaromatic 5-8 membered monocyclic, 8- 1 2 membered bicyclic, or 1 1 - 14 membered tricyclic ring system having 1 -3 heteroatoms i f monocyclic, 1 -6 heteroatoms if bicyclic, or 1 -9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1 -3, 1 -6, or 1 -9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1 , 2 or 3 atoms of each ring may be substituted by a substituent.
Examples of heterocyclyl groups include piperazinyl, pyrrolidinyl, dioxanyl, aziridiny I, oxiryl, thiiryl, morpholinyl, tetrahydrofuranyl, and the like.
The term "siibstituents" refers to a group "substituted" on an alkyl, cycloalkyi, aryl, heterocycl l, or heteroaryl group at any atom of that group. Suitable substituents include, without limitation, halo, hydroxy, mercapto, oxo, nitro, haloalkyl, alkyl, alkaryl, aryl, aralkyl, alkoxy, thioalkoxy, aryloxy, amino, alkoxycarbonyl, amido, carboxy, alkanesulfonyl, alkylcarbonyl, azido, and cyano groups.
The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims. DESCRIPTION OF DRAWINGS
Figure 1 | Modeling the NOTCH 1 -MAM L I -CSL ternary complex (NTC). a) Schematic of NTC assembly and activation of target gene expression. Stabilized alpha-helical peptides derived from MAML 1 (SAHMs) mimicking the N-terminal hel ix of MAML 1 target the AN 1 -CSL interface and prevent target gene activation, b) Molecular modeling of the NTC. Left - RMSD (A) of the NTC along the 35 ns MD simulation. Right - Decomposition of individual residue binding energies in the NTC by MMGBSA in Amber 10. The dominant negative fragment of MAML 1 (dnMAML l , residues 1 3-74), AN domain of NOTCH 1 (AN l ) and CSL are showing in magenta, red and blue, respectively. Residues identified as the strongest contributors to complex stability are highlighted in yellow (top residues 1 -9) and cyan (residues 10- 1 8) and are represented as sticks in dnMAML l and surfaces for ANK 1 and CSL. Bottom- Average (Ave, kcal/mol) binding free energy for residues highlighted in the NTC structure. Residues in red are the highest scoring residues for their respective protein subunit. c) Binding free energy (kcal/mol) for al l residues in the contact region of dnMAML l (residues 16-70) as determined by B FED. d) Mastermind homolog sequence alignment. Residues 20-41 of human MAM L 1 are aligned with sequences from H. sapiens, M. m sculus, D. melanogaster, X. laevis, C. elegans and D. rerio. Orange, residues conserved among all species; Green, conserved substitutions; blue, semi-conserved substitutions, e&f) Left - Backbone RMSD (A) of the unmodified MAML 1 (21 -36) peptide (e) and SAHM 1 (f) along a 20 ns MD simulation. Right - Overlay of MAML 1 (2 1 -36) peptide (e) and SAHM 1 (f) snapshots extracted every 1 ns from 20 ns MD simulation trajectories, g) Left- Schematic of computational structure-activity relationships workflow for BFED calculations for SAHM point-mutants. Right- Calculated MMGBSA AAG values for SAHM peptides containing the indicated point mutation are shown relative to the unmodi fied MAML 1 (E21 -T36) peptide (WT).
Figure 2 | Analysis of dnMAML l -RAMANK l -CSL complex formation and ALPHAscreen assay development, a) Schematic of the ALPHAscreen proximity assay. Incubation of a synthetic, biotinylated-dnMAML l peptide with equimolar GST-RA AN 1 and CSL protein leads to the formation of the active NTC in solution and proximal association of streptavidin-coated donor beads with anti-GST- conjugated acceptor beads. Donor bead excitation at 680 nm produces singlet oxygen, which selectively initiates a luminescent cascade in bound acceptor beads, b) Synthetic, biotinylated dnMAML l (Bio-sdnMA L l , residues 16-70) was synthesized with an N-terminal diethylene glycol linker and biotin tag. The chromatogram and mass spectrum of the HPLC-purified peptide is shown, c-e) SPR binding of immobilized Bio-sdnMAML l (c), Bio-nts-dnMAML l (d) and Bio- SAHM 1 (e) to dilutions of soluble, equimolar RAMANK 1 and CSL. Black curves represent reference-cell normalized sensogram data and red curves denote a kinetic fit to a two-step kinetic model. Binding constants derived from this fit are shown. k0„, association rate; kan, dissociation rate; K<s. dissociation constant; RU, response units. Titration matrix of Bio-sdnMAML l and GST-RAMANK 1 -CSL binding partners, g) ALPHAscreen signals under optimal conditions (40 nM of Bio- sdnMAML l , GST-RAMANK 1 and CSL) yielded robust binding only in the presence of all NTC partners, h) Unlabeled dnMAML l and SAHM 1 peptides competed with Bio-sdnMAM L l for GST-RAMANK 1 -CSL binding relative to DMSO control. Competitive ALPHAscreen assays for previously reported unmodified and stapled SAHM peptides. Data are shown as mean ± s.e.m. of duplicate or triplicate measurements for matrix titrations (f) and peptide competition assays (h), respectively.
Figure 3 | Design and biochemical characterization of SAHM analog peptides, a) Panet of SAH M analogs used in MD simulations containing point mutations at positions 23, 27, 29 and 30. b) ALPHAscreen competition assay screen of point- mutant analogs as well as previously characterized peptides ( 1 μΜ) to compete with Bio-sdnMAML l for GST-RAMANK 1 -CSL binding relative to DMSO. c-g) MD snapshots of high-scoring SAHM poin mutants containing the C30F (C), L29W (D), L29Y (E), I27NL (F) and L23F (G) point mutations. Relevant contacts are highlighted and discussed in the text, h & i) Views of additional contacts to the AN 1 domain (red) and CSL (blue) mediated by C37-Y41. (green) and E42-L49 (orange) residues of dnMAML l in the human NTC X-ray structure (PDB Accession: 2F8X). ALPHAscreen competition values shown represent the mean ± s.e.m.
Figure 4 | Biochemical characterization and SAR of SAHM analog peptides, a) Structures and ALPHAscreen NTC competition assay IC50 values of analog peptides containing natural mutation combinations in the E21 -T36 scaffold, b) Structures and ALPHAscreen NTC competition assay IC50 values of analog peptides containing natural mutation combinations in the E21 -Y41 and E21 -L49 extended stapled peptide scaffolds, c) Structures and ALPHAscreen NTC competition assay IC50 values of analog stapled peptides containing non-natural amino acids. The blue 'W residues in the stitched peptides SAHM 1 -29 and SAHM 1 -30 correspond to a bis- pentenyl glycine derivative (see Suppl. Fig. 3). Competition curves (Right) represent the mean ± s.e.m. of duplicate experiments fitted to a three-parameter sigmoidal dose-response curve in Prizm 5. ALPHAscreen IC50 values shown represent the 95% confidence interval (C.l.) of the mean, d) MD snapshot of SAHM 1 -56 (magenta ribbon view) bound to the ANK l -CSL complex (white surface view) with the L23 W, L29Y and C30F mutant side chains highlighted and shown as sticks, e) Overlaid MD snapshots of the E21 -L49 scaffold analog SAHM 1 -80 bound to the AN l -CSL complex before (green) and after (blue and magenta ribbon view) MD energy minimization, d) MD snapshot of SAHM 1 -62 (green ribbon view) bound to the ANK l -CSL complex (white surface view) with the L23W, L29Y, C30F, C37Ff and Y41 Npi mutant side chains and hydrocarbon staple highlighted and shown as sticks.
Figure 5 | SAHM analogs inhibit NOTCH 1 -dependent transcription and T-ALL cell prol i feration, a) Correlation plot of ALPHAscreen IC50 values and normalized inhibition of a NOTCH 1 -driven CSL-luciferase reporter ( 1 5 μΜ, 1 8 h, relative to DMSO control) for all SAH M analog peptides, b) Dose-dependent inhibition of the NOTCH 1 -driven dual-luciferase reporter assay by SAHM 1 and optimized peptides from the E21 -T36 and E21 -Y41 SAHM scaffolds, c) Effect of SAHM analog peptides on the proliferation of human T-ALL cell lines previously shown to be sensitive (HPB-ALL and SUPT- 1 ) or predominantly resistant (Jurkat) to NOTCH 1 inhibition. Cells were treated with SAHM analogs (20 μΜ) or DMSO vehicle for 72 h and normalized viability was determined by measuring cellular ATP content with the Cell Titer Glo assay, d) Effect of SAHM 1 analogs as in (c) at 10 and 20 μΜ for 72 h. Data represent mean ± s.e.m. from triplicate experiments.
Figure 6 | Olefin-containing "Ss" and "55" amino acids used for synthesis of single turn /', i+4 stapled peptides and two-turn stitched /', i+4+4 stabilized peptides.
Residues were incorporated into stapled peptides by conventional SPPS, followed by ring-closing olefin metathesis with Grubbs I catalyst.
Figure 7 | Structures of bio-sdnMAML l (a), Ac-sdnMAML l (b) and bio-nt- sdnMAML l (c).
Figure 8 | Graphical representation of reporter gene assay correlation data presented in Figure 5a. U20S cells co-transfected with AEG FALNR-NOTCH l construct, CS L-Firefly luciferase reporter and RemV/a-luciferase reporter were treated with analog stapled peptides ( 1 5 μΜ, 18 - 24 h) or DMSO vehicle alone. Shown is the normal ized mean reporter signal relative to DMSO alone for each analog peptide.
DETAILED DESCRIPTION
Described below is a molecular dynamics (MD) computational model of the Notch transcriptional complex (NTC). This model was used to explore the global stability of the NTC and the contributions of all residues involved in the protein-protein interfaces of dnMAML l , AN 1 and CSL. Also described below is the use of these models in combination with biochemical assays measuring NTC complex formation, iterative medicinal chemistry approaches and cell-based assays to design cross- l inked MAML 1 peptides, including one that are more potent than SAHM .
Described below are various internally cross-linked alpha helical domain polypeptides related to human MAML 1 (and MAML-2 and MAML-3). The polypeptides include an internal cross-link between two non-natural amino acids (i.e., two amino acids whose side chains have been replaced by the cross-link) that signi ficantly enhances the alpha helical secondary structure of the polypeptide. Generally, the cross-l ink (sometimes referred to as staple) extends across the length of one or two helical turns (i.e., about 3.4 or about 7 amino acids). Accordingly, amino acids positioned at i and i+3 ; i and i+4; or i and i+7 are ideal candidates for chemical modification and cross-linking. Thus, for example, where a peptide has the sequence .. .Xaai , aa2, Xaa3, Xaa4, Xaa5, Xaa6, Xaa7, Xaas, Xaag. .. (wherein indicates the optional presence of additional amino acids), cross-links between Xaai and Xaa^, or between Xaai and Xaa,, or between Xaai and Xaag are useful as are cross-links between Xaa? and Xaa5, or between Xaa^ and Xaa6, or between Xaa2 and aagi, etc. The polypeptides can include more than one crosslink within the polypeptide sequence to either further stabilize the sequence or facilitate the stabi lization of longer polypeptide stretches. If the polypeptides are too long to be readily synthesized in one part, independently synthesized, cross-linked peptides can be conjoined by a technique called native chemical l igation (Bang, et al., J. Am. C em Soc. 126: 1377).
Described herein are stabilized alpha-helix of MA L 1 (SAH- AML 1 ) peptides that exhibit affinity for the ICN 1 -CSL complex, and, in contrast to a corresponding unmodified (non-cross-linked) MAML 1 peptide, more readily enter cells mechanism. α.α-Disubstituted non-natural amino acids containing olefinic side chains of varying length can synthesized by known methods (Williams et al. 1991 J. Am. Chem. Soc. 1 1 3 :9276; Schafmeister et al. 2000 J. Am. Chem Soc. 122:5891 ). For peptides where an i linked to i+7 staple is used (two turns of the helix stabilized) either one S5 amino acid and one R8 is used or one S8 amino acid and one R5 amino acid is used. R8 is synthesized using the same route, except that the starting chiral auxiliary confers the R-alkyl-stereoisomer. Also, 8-iodooctene is used in place of 5- iodopentene. Inhibitors are synthesized on a solid support using solid-phase peptide synthesis (SPPS) on MBHA resin. Methods for preparing cross-linked peptides in which a single amino acid participates in two cross-links are described in US 2010/1 84645, hereby
incorporated by reference.
Molecular Dynamics Simulation of the NTC
MD simulation of the NTC (dnMAML l -ANK l -CSL) converged after around 5 ns, as evidenced by the relative stabi lization of the complex RMSD after this time point (Figure l b, left). The protein-peptide binding interaction is composed of a number of weak interactions between pairs of residues in dnMAML l and the shal low groove at the interface of ANK l -CSL (Figure l b, right). The residues that contribute the most to the binding free energy of an interaction, so called "hot-spots" in the protein- peptide interface, are spatial ly clustered in some protein-protein interactions (e.g. the p53-MDM2 interface) and are more diffuse along a larger binding interface in others. Our screen of dnMAML l stapled peptide fragments and published mutagenesis experiments indicate that a majority of the critical contacts are contained in the N-terminal helix, however the extent to which the binding energy is distributed through the interface is largely unknown. I n an effort to identi fy the energy contribution of each residue in dnMAML l to NTC complex stability, we employed a computational binding free-energy decomposition (BFED) analysis. A simi lar method is computational alanine scanning (CAS), which computes the change in free energy upon mutating a given residue to alanine. Mutation to alanine can induce significant conformational changes and thus perturb the binding system, which cannot be accounted for by CAS. On the other hand, the BFED method calculates both backbone and side chain energy contributions and does not introduce the perturbation of alanine mutation. We thus applied BFED method to our system based on the snapshots extracted from the converged MD trajectory (5-35 ns).
From the N-terminus to P46, which introduces a kink to an otherwise continuous helix, dnMAML l binds a surface made up of both ANK 1 and CSL. While from P46 to the C-terminus, dnMAML l only interacts with CSL (Figure l b, right). Table 1 lists the top 1 5 residues that contribute the most to the dnMAML l -AN I -CSL binding free energies (Figure l b, right). We find that 10 (in bold) out of the top 1 5 hot-spot residues are located between dnMAML l (N-terminal to P46) and the ANK 1 -CSL interface, which indicates that this region more important for binding. Top ranking residues outside of the N-terminal helix cluster around an interaction between a hydrophobic cleft on CSL with L59 and T56 in dnMAML l . Top residues in the N-terminal helix include a cluster of arginines ( 22, R25 & R3 1 ) in dnMAML 1 that form stable salt bridges with D l 973 and E2009 in ANK 1 and E378 in CSL. Other important residues in this stretch include two histidines (H34 & H33) and one tyrosine (Y4 1 ), whose van der Waals energy term dominates the free energy of binding. Previous experiments reported that the dual R25E/R22E dnMAM L l mutant or D 1 973R ANK l mutant prevented the formation of the NTC complex by gel shift assays43. Furthermore, we have previously reported that a stapled peptide, SAH 1 -D 1 , containing R22E/R26E mutations showed diminished activity in numerous assaysj7. In agreement with these findings, our calculations revealed R25 and D 1 973 (colored in red in Figure l b) as the most important residues in dnMAML l and ANK l , respectively. The model also predicted M380 (colored in red in Figure 1 b) as the key residue in CSL, which interacts with 127, C30, R3 1 and H34 in dnMAML l .
Figure l c shows the B FED contribution of each residue in dnMAML l , where negative values indicate critical interactions and small or positive values represent unimportant or deleterious interactions, respectively. These calculations recapitulate the results of our reported stapled peptide screen, with the majority of critical contacts contained in the stretch from E21 to T36 used to generate SAH 1 . The high concentration of binding energy contribution in this region provides an explanation for the high degree of conservation in this peptide stretch of Mastermind orthologues from numerous species (Figure I d). Importantly, these calculations also highlight numerous residues that are involved in binding but may be underutilized, which in this stretch of dnMAML l include L23, 127, L29 and C30. Mutation of these residues to natural or non-natural amino acids has the potential to generate more potent and specific stapled peptide inhibitors of the NOTCH complex.
Molecular dynamics simulation of unmodified and stapled MAML peptides We next sought to develop a molecular dynamics model that accurately depicted stapled peptides and could be used to inform the design of SAHM analogues targeting the NTC. Multiple published reports have employed MD simulations to study stapled peptides, however these have primarily been concerned with the effect of the hydrocarbon staple on peptide stabil ity and helicity47,48. We are unaware of any reports that have successfully employed MD simulation to quantitatively inform stapled peptide binding and develop SAR parameters for analogs. To first evaluate the degree to which the E21 -T36 dnMAML l peptide [MAML 1 (21 -36)] remains helical in our calculations, we performed MD simulations on the corresponding helical structure extracted from the NOTCH complex. We also made the corresponding stapled peptide analogue (SAHM l ) by mutating E28 and R32 to the -> +4 l igated α,α-disubstituted "Ss" amino acids (Figure 6). 20 ns MD simulations were carried out for MAM L 1 (2 1 -36) and SAHM l in explicit solvent using similar parameters as the NTC simulations. The MD trajectories revealed that MAML 1 (21 - 36) loses its a-helical structure after approximately 6-9 ns (Figure l e) while SAH M 1 retains most of its helical content along the entire 20 ns MD simulation with a little chaos in the C-terminal serine-threonine stretch (Figure I f). During the simulation of MAML 1 (21 -36), the salt bridge between E28 & R32 is disrupted and the backbone hydrogen bonds were lost, which caused the peptide to unfold. Conversely, the central hydrocarbon staple in SAHM l conserved the helical turn in the middle of the peptide while E21 made transient salt bridges with either R24 or R25. These qualitative results are in agreement with previous circular dichroism measurements comparing the helicity of MAML 1 (2 1 -36) and SAH M 137.
Simulations and BFED calculations of SAHM l analogues with ANK 1 -CSL
Guided by these MD models, we next aimed to determine whether improved SAH M l analogues could be designed. Analogue peptides containing the non-natural amino acid linker were built based on the initial X-ray structure (PDBid: 2f8x) and M D simulations were run by replacing dnMAML l with SAHM l analogues. The mutated natural/non-natural residues (including the staples) were built in Maestro 8.5. Parameters for the creation of non-natural residues are detailed in Experimental Methods. Conformational searches of each new NOTCH complex with the mutated amino acids were performed using Macromodel followed by energy minimization. Mixed torsional/low mode Monte Carlo in Macromodel was applied by allowing the mutated residues to move freely and restraining the surrounding residues within 4A by a constant of 200 () and keeping other residues fixed. The conformation with the lowest energy was used as the starting structure for MD simulation with the same parameter settings used for the NTC simulations. 16 ns MD simulations were carried out for each new complex with different SAHM 1 analogues. Snapshots were extracted along the converged MD trajectories and MMGBSA scores were calculated to compare the relative binding affinities of SAHM 1 analogues to the ANK 1 -CSL complex.
The results of the aforementioned NTC MD simulations indicated that residues L23, 127, L29 & C30 do not contribute as strongly to dnMAML 1 binding free energy, which suggested that these residues might be mutated to make stronger interactions with ANK 1 -CSL. To test this premise, we designed a focused library of analog peptides containing hydrophobic point mutations at these positions. Analysis of MD trajectories and MMGBSA scores for each peptide was used to determine whether each mutation was favorable or not and which were the best mutation(s) for each position. MMGBSA scores were calculated relative to the unmodified MAML 1 (21 - 36) peptide and are shown in Figure l g. Notably, mutations of C30 and L23 to larger aromatic side chains (phenylalanine and tryptophan, respectively) appeared to have the greatest effect on the MMG BSA score. Mutations to L29 and 127 had positive effects in some cases (L29F/Y/W, I27L) and were deleterious in others (L291, 127F/W). Overall, these calculations supported the notion that optimized interactions could be imparted through these mutations. Thus we endeavored to develop robust biochemical assays measuring NTC assembly and to then test this series of analogs. The structural rationale for the effects of these mutations will be discussed below and compared alongside the results of biochemical studies.
ALPHAscreen assay development and NTC biochemistry
The biophysics of NTC assembly has been studied using relatively low-throughput assays including electrophoretic-mobility shift assays24, isothermal titration calorimetry49, and various immunoprecipitation strategies. More recently, Del Bianco et al. reported the use of a FRET-based system measuring the proximity of a donor fluorophore-labeled ANK protein to an acceptor-labeled oligonucleotide upon NTC assembly, which allowed determination of relative equilibrium constants for the entire complex45. We also reported the use of surface plasmon resonance (SPR) and fluorescence polarization assays measuring the association of NTC components with each other and with stapled peptides37. To date however, there are no high- throughput assays reported that quantitatively measure dnMAML l -NOTCH-CSL complex formation. Here we introduce a robust, homogenous assay for measuring the binding of dnMAML l to NOTCH-CSL heterodimers using ALPHAscreen technology. The ALPHAscreen technology (ALPHA meaning amplified luminescence groximity homogenous assay) employs functionalized beads approximately 200 nm in diameter to detect the association of cognate binding partners in solution50'51. Laser excitation (680 nm) of donor beads releases a flow of singlet oxygen, which due to a discrete half-life, will diffuse approximately 200 nm. Acceptor beads that have been proximally localized through a binding interaction will utilize singlet oxygen in a luminescent cascade releasing an emission at lower wavelength (520-620 nm). As shown in Figure 2a, this assay was configured to detect the association of a synthetic biotinylated dnMAML l peptide with a complex of CSL and GST-labeled RAMANK 1 (the RAM and ANK domains constitute the minimal subunits of ICN for CSL binding). To enable this assay format, we first developed methods to synthesize and purify fully synthetic dnMAML l polypeptides (sdnMAM L l , residues 16-70), which by conventional methods is beyond the size limits of solid-phase peptide synthesis (SPPS, Figure 2b). The use of microwave- assisted peptide synthesis and a slightly altered SPPS protocol readily afforded the biotinylated sdnMAML l peptide (bio-sdnMAML l , and others with alternative N- terminal modifications) at greater than 95% purity by LCMS analysis (Figure 2b, Figure 7).
SPR was used to measure the binding kinetics between the immobilized bio- sdnMAML l peptide and equimolar RAMANK 1 -CSL complexes, which confirmed high-affinity binding (Ko = 0.04 μΜ, Figure 2c). To our knowledge, these experiments represent the first reported affinity for dnMAM L l to any component of the NTC. To determine whether the N-terminal helix alone retains the ability to bind RAMANK 1 -CSL, as our previous results and MD calculations would suggest, we also measured the affinity of bio-nt-sdnMAML l (residues 16-45) by SPR (Figure 2d, Figure 6). The N-terminal dnMAML l peptide was found to bind RAMANK I - CSL (KD = 0.4 μΜ), although not as strongly as bio-sdnMAML l or bio-SAHM 1 (KD = 0. 1 μΜ, Figure 2d,e).
To determine the optimal conditions for the NTC ALPHAscreen assay, a titration matrix of various GST-RAMAN 1 -CSL and bio-sdnMAML l concentrations was tested. These experiments revealed dose-dependent increases in the luminescent signal up to a maximum of approximately 45,000 c.p.s. with binding components in the range of 10- 100 hM (Figure 2f)- Importantly, a characteristic "hook effect" was observed at higher concentrations of protein, representing the point where the GST- labeled protein surpasses the binding capacity of the ALPHAscreen beads and becomes inhibitory. Under optimal conditions and binding partner concentrations (40 nM of all partners), this assay was shown to produce excellent signal-to-noise ratios (~30-fold) and was specific to the presence of all binding partners (Figure 2g). Titration of unlabeled Ac-sdnMAML l peptide or AcW-SAHM l into a pre- incubated complex of bio-sdnMAML l -GSTRAMANK 1 -CSL resulted in dose- dependent dissociation of the complex and signal decrease (Figure 2h). Taken together, these results support the generation of a. robust, high-throughput biochemical assay for the interrogation of NTC assembly, which is ideally suited for screening NTC inhibitors.
SAHM analogue SAR studies
To correlate the relevance of our MD calculations, the series of point-mutant SAHM analogues presented in Figure l g was synthesized and profiled by competitive ALPHAscreen (Figure 3a). In general, the observed inhibitory activities were in good agreement with the MD predictions. Peptides substituted at C30 with either Val or Phe showed greater complex inhibition compared to SAHM 1 , while the C30L compound was less potent (Figure 3b). These results mirrored our calculations and visual inspection of MD snapshots with the C30F mutant (SAHM 1 -3) revealed stable interactions between F30 and 356, L388 and N349 in CSL. Additionally, F30 also induces a loop in ANK 1 to move toward CSL, creating an interaction with A2007 (Figure 3c). The cavity around L29 is quite large and polar and inspection of MD snapshots did not reveal any obvious effects for L29I or L29F mutations, however L29F did improve the GBSA score. Mutation of L29 to tryptophan (SAH M 1 -6), appeared to promote hydrophobic interactions with the side chains of A2007 & L2006 and the backbone of N2041 in ANK l . R382 in CSL also moved closer to W29 to form a potential cation-pi interaction (Figure 3d). The L29Y (SAH M 1 - 14) mutant also appeared to form this interaction with R382 in CSL as well as hydrogen-bonds with the side chain amide of N2041 and backbone carbonyls ΟΓ 2040 and V2039 in AN l (Figure 3e). Overall mutations at L29 alone did not have a strong effect on peptide potency, although our modeling results indicated that L29Y and L29W mutations should improve binding, thus these mutations were explored in later combination mutant analogs.
Mutation of 127 to leucine (SAHM 1 -7) resulted in increased inhibitory activity relative to SAHM 1 (Figure 3b). Conversely, mutation of 127 to the methionine isostere norleucine (NL) or phenylalanine was not found to significantly improve potency while mutation to the larger amino acid tryptophan was deleterious for NTC inhibition. These data are consistent with our computational calculations in principle, however MD snapshots predicted that the I27NL mutant would be more potent than its leucine isomer (Figure l g). MD snapshots revealed that both the leucine and norleucine side chains more effectively engaged a hydrophobic pocket on CSL surrounded by V354, M356, M380 and V390, leading to improved
MMGBSA scores (Figure 3f). The largest improvements to MMGBSA score and competitive ALPHAscreen potency were generated by mutations of L23. In our MD simulations, introduction of L23F or L23W into SAHM 1 was found to induce a conformational change in a flexible loop containing residues N349 to M356 in CSL. Translation of this flexible region improved contacts to the L23F/W as wel l as 127 and R24 in MD snapshot containing mutant peptides (Figure 3g). Likewise, increased hydrophobic bulk at this position resulted in iterative decreases in ALPHAscreen competition (SAHM l - 1 1 to SAHM 1 - 1 3), with SAHM 1 - 13 being the most potent single mutant relative to SAHM 1 (Figure 3b). Overall these results represented a general agreement between the mutant-NTC M D simulation and biochemical potency against NTC formation, thus validating the use of our stapled peptide-NTC MD model as a strategy for the design of analogue inhibitors.
In addition to designing analog peptides derived from the E2 1 -T36 region of dnMAML l , our BFED calculations (Figure 2b,c) indicated that C-terminal extension of the SAHM 1 scaffold might generate more potent and specific stapled peptides. Specifically, extension to Y41 (SAHM 1 -24) was expected to add interactions from C37, E38, R40 and Y 1 in dnMAML l (Figure 3h). Extension to L49 (SAHM 1 -75) would further add potential contacts from E42, V44, E47 and L49, capping the AN 1 domain (Figure 3i). These extended scaffold peptides were included in further rounds of optimization with the SAHM 1 scaffold by incorporating favorable point mutations into multiple positions simultaneously. I nitial combination mutants focused on determining the effect of 127 and L29 mutations in combination with the most effective point mutants separately - L23 W and C30F - and then together (Figure 4a). ALPHAscreen competition experiments revealed that L23 W I27L double mutants retain a gain in activity observed for the single mutants, but were without any significant gain for the double mutant (SAH M 1 -2 1 SAH 1 -23 compared to SAHM 1 -3 1 /SAH M 1 -36). This is likely due to the fact that both residues target the same hydrophobic cleft on CSL, which perhaps will not tolerate larger combinations. The L23 W/C30F mutant combination appeared to improve peptide potency in the presence of di fferent combinations of 127L and L29Y mutations (SAHM 1 -21 , SAHM 1 -3 1 and SAHM 1 -56; Figure 4d).
Additionally, the L23 W/L29W combination mutations, which were separately found to improve competition and yield favorable MMGBSA scores, resulted in peptides with lower IC50 values in combination with smaller substituents at C30 but not with the C30F mutant (Figure 4a). These general SAR trends were also observed in the larger E21 -Y41 stapled peptide scaffold, with more potent peptides containing the L23 W/C30F and L23 W/L29W double mutants (SAHM 1 -25, SAHM I -27, Figure 4b). As peptides from the E21 -Y41 scaffold are larger than those previously reported, decreased helicity might result in lower target affinity. To determine whether or not incorporation of multiple staples down the peptide backbone might improve activity, we synthesized two "stitched" peptides with staples spanning two sequential turns of the a-helix (SAHM 1 -29, S AH 1 -30, Figure 8). Interestingly, we found that neither was more active than their stapled peptide counterpart (SAHM 1 - 24, Figure 4b). Analogues from the largest peptide scaffold (E21 -L49) were found to be more potent than SAH 1 and SAHM 1 -24 (Figure 4b). Computational MD simulations of the most potent E21 -L49 peptide, however, revealed stable binding for much of the peptide but with significant chaos in the C-terminal stretch after the proline-induced kink (Figure 4e).
I n an effort to take advantage of prospective structure-based design enabled by our NTC MD model, we were interested to determine if incorporation of non-natural amino acids could improve stapled peptide potency as well. In a similar approach to the aforementioned point mutation computational screen, we imported libraries of commercially available non-natural amino acids into our MD simulations. Non- natural amino acids were substituted within the E21 -Y41 scaffold at promising sites for optimization as determined by MD, which included L23, C30, C37 and Y41 . The resulting mutants were docked for each binding site-amino acid pair yielding M MG B SA free energy values and MD snapshots. Comparison of MMGBSA scores and docked structures suggested that peptides containing a handful of these non- natural amino acids could improve binding and the resulting peptides were synthesized (Figure 4a, c; Figure 8). From this effort several non-natural amino acids were found to retain relative peptide potency while introducing non- proteinogenic side chains (Figure 4c). Notable examples were mutation of C37 to a D-pentafluoro phenylalanine and Y41 to 1 -naphthylalanine (Figure 4c,f)- In contrast, some hits in our MD screen yielded peptides with significantly reduced activity, such as substitution of L23 with a nicotinyl-lysine amino acid (SAHM 1 -53, Figure 4a). These results suggested that while our MD simulations can identify suitable non-proteinogenic residues for stapled peptide analogs, some predicted conformations might not be accessible and thus lead to deleterious interactions. In general, however, these SAR studies are in good agreement with the results of our initial MD simulations and have principally identified L23 and C30 as the most promising sites of optimization in both established (E21 -T36) and novel (E21 -Y 1 ) stapled peptide scaffolds. MD snapshots of the relatively rigid hydrophobic cleft in CSL forming contacts with 127 revealed the potential for improvement, however the combination of mutants at 127 with the effective L23W mutation did show appreciable additive gains. Conversely, the relatively polar and flat surface on ANK 1 targeted by L29 was the site of improvement through mutation to tyrosine or tryptophan in multiple combination mutant analogs. Inclusion of favorable mutations into stapled peptide scaffolds extended to Y41 and L49 was also found to yield increases in potency.
Cell-based activity of stapled peptide analogs
These SAR studies have established that analog stapled peptides based on three MAM L I scaffolds are capable of inhibiting NTC formation more potently than peptides based on wild type sequences alone. Despite the gains in activity observed, these improvements are not necessarily indicative of improved functional efficacy. In addition to target engagement, major factors governing cellular activity of stapled peptides are intracellular access, sub-cellular distribution and chemical stability. To determine whether the analogs described here were capable of antagonizing NOTCH 1 -CSL transactivation in cells, we tested all analogs in an established reporter-gene assay driven by constitutively activated NOTCHl31,46. U20S cells were co-trans fected with a CSL-regulated firefly luciferase construct, a control /iemV/a-kiciferase construct and the truncated AEGFALNR-NOTC/// allele prior to treatment with analog compounds or vehicle. Comparison of stapled peptide IC50 values in the ALPHAscreen assay and normalized inhibition of the NOTCH 1 -driven reporter gene signal revealed a strong correlation between biochemical and cell- based activity for the library of analogs (Figure 5a, Figure 9). This analysis indicated that more potent analogs from both the E21 -T36 and E21 -Y4 1 scaffolds were capable of nearly complete reporter repression (Figure 5b). Interestingly, dose- dependent studies with optimized analogs from the shorter scaffold (SAHM 1 -3 1 , SAHM 1 -56) revealed only slightly lower EC50 values compared to AcW-S AHM 1 . Analogs based on the longer E21 -Y4 1 scaffold (SAHM 1 -25, SAHM 1 -62) showed significantly lower EC50 values of approximately 10 μΜ and 5 μΜ, respectively. Notably, whi le peptides from the longest scaffold class (E21 -L49) exhibited simi lar ALPH Ascreen IC50 values to SAHM 1 -25 and SAHM 1 -62, they caused only moderate repression of the NOTCH 1 /CSL reporter signal (Figure 5a).
Numerous studies have established that Notch pathway inhibition with γ-secretase inhibitors, monoclonal antibodies and stapled peptides leads to growth suppression and apoptosis in many human T-ALL cell lines that harbor activating NOTCHl mutations46' 52j2, 37. Consistent with this, we found that treatment of two established NOTCH l -dependent T-ALL cell lines, SUPT 1 and HPB-ALL, with optimized SAH M analogs resulted in significantly decreased cell viability after three days (Figure 5c). In contrast to HPB-ALL and SUPT 1 cells, Jurkat T-ALL cells exhibit decreased sensitivity to Notch inhibitors owing to increased reliance on alternate signaling pathways53"55"'7. Treatment of Jurkat cells with the panel of analog SAHM peptides resulted in modest effects on cell proliferation after three days (Figure 5c). Additionally, dose-dependent treatment of H PB-ALL cells inhibited proli feration at effective concentrations similar to those observed in the reporter assay for analog peptides (Figure 5d). Together, these results confirm that optimized SAHM peptides from the E2 1 -T36 and E2 I -Y41 scaffold classes inhibit NOTCH/CSL driven transcription and cell proli feration of NOTCH 1 -dependent T-ALL cel l l ines. They further indicate that optimized peptides from the E2 1 -Y41 scaffold are more potent than peptides from the established E2 1 -T36 and novel E21 -L49 scaffolds.
Transcription factors represent some of the most attractive and validated targets in numerous diseases. Despite this, the discovery of synthetic modulators of this protein class has remained a challenging task for traditional drug discovery efforts. By incorporating the recognition properties of protein therapeutics with the synthetic accessibility of small molecules, hydrocarbon stapled peptides have demonstrated the capacity to target numerous intracellular protein-protein interactions with therapeutic potential. Reports detailing the design and characterization of novel stapled peptides to date have been primarily focused on the identification of peptides with the highest degree of structural stabilization and cell permeabil ity'""43 11. In all cases these two properties have been associated with the most active stapled peptides in cells and in vivo. Furthermore, these studies have primarily focused on stabi lization of native peptide sequences with no attempt to alter and optimize binding interactions, which likely stems from the fact that high affinity short peptides had been described previously for the majority of these targets. In the present study we sought to use molecular modeling and structure-based design to quantitatively describe the protein-protein contacts involved in the assembly of the NTC and use these insights to design more potent stapled peptide inhibitors of the NOTCH complex. Predicting protein-protein binding conformations and interaction affinities has always been a challenging problem, since most of the binding surfaces are relatively large, flat and flexible. These characteristics make it difficult to apply scoring functions due to the need to search for much larger conformational space as well as predict binding affinities that are contributed to by numerous weak interactions. Here we employed molecular dynamics simulations of the NTC based on the human X-ray structure and performed binding free energy decomposition to calculate the extent to which each residue in dnMAML l , ANK l and CSL contribute to complex formation and stability. The resulting model indicated that while dnMAML l contact residues are distributed throughout the large helical interface, a majority of the contacts contributing strongly to complex formation are found in the N-terminal helix. These calculations agree with mutational studies 45 and our reported stapled peptide screen 37, suggesting that stabilized peptides derived from this region will have the highest ligand efficiency. We subsequently employed surface plasmon resonance to measure the binding affinity of a synthetic dnMAM L l peptide (s-dnMAML l ) to a preformed RAMAN 1 -CSL complex. We found that s- dnMAML l , which contains all apparent contact residues in the human X-ray structure, bound the complex with high affinity ( ¾ = 0.04 μΜ) and that truncation to the N-terminal helix (snt-dnMAML l ) alone decreased the affinity by
approximately 10-fold. These results support the contribution of both helices in high affinity complex binding via a "clamp-like" model as previously proposed56, however the N-terminal helix alone does retain tight, specific binding. Together, these results represent the first reported binding affinities for dnMAML l polypeptides to NOTCH-CSL complexes and provide a quantitative model of NTC complex formation. In addition to the application of this model for structure-based ligand optimization, as presented here, we posit that it could provide insights into the preferential formation of isoform-specific NTCs through quantitative analysis of isoform-specific residues in MA L 1 -3 and NOTCH 1 -4. Additionally, these models could be applied in future computational ligand discovery efforts, such as small molecule docking.
Using our MD model of the NTC vve identified several hydrophobic residues in SAH l that if mutated might increase binding affinity. To calculate the relative effect of mutations at these positions, we also developed a stapled peptide MD simulation model that could be employed to compare unmodified native peptide sequences (MAML 1 [2 1 -36]), known stapled peptides (SAHM l ), stapled peptide scaffolds containing mutations and novel stapled peptide scaffolds derived from MAML 1 . Simulation of the stapled peptide SAHM 1 and its corresponding unmodified peptide revealed the significant stabilizing effect of the central hydrocarbon stapled in the peptide over the course of 20 ns, which is in agreement with previous circular dichroism experiments. This model was subsequently applied to calculate the relative BFED scores for a series of SAHM l derivatives containing hydrophobic point-mutations as well as extended SAHM scaffolds derived from E21 - Y41 and E21 -L49 in M AML 1 . The results of these in silico screens supported the notion that mutation of residues L23 and C30, which both target hydrophobic surfaces on CSL, might improve binding. Additionally, MD simulations indicated that stapled peptides derived from E21 -Y41 could improve NTC binding mainly through the addition of the Y41 .
To determine whether the predictions of our MD model yielded compounds with improved activity, we developed a miniaturized, high-throughput ALPHAscreen competition assay that measures the association of a synthetic biotinylated dnMAML l peptide with a GST-tagged RAMAN 1 -CSL protein complex. This assay proved to be specific to the presence of all complex members, displayed excellent signal-to-noise ratios and was sensitive to competition by unlabeled dnMAML l or SAH l peptides. Therefore, we employed this assay to
quantitatively profile SAH M analogs for NTC antagonism. Beyond this speci fic application, this assay represents a novel format to measure NOTCH complex formation and should be suitable for high-throughput screening of small molecules or other chemical classes.
In general, the results of our competitive ALPHAscreen assay profi ling were in agreement with our MD simulations. Analogs containing the L23 W, C30F, I27L and L29W point-mutations showed the greatest inhibition of NTC formation at these respective positions. Subsequent incorporation of these mutations in relevant combinations within the SAHM 1 and E21 -Y41 scaffolds yielded peptides with IC50 value improvements ranging from approximately three- to seven-fold. In both scaffolds the L23W/C30F, L23 W/L29W, and L23 W/C30F/L29Y mutation combinations resulted in consistent ALPHAscreen IC50 improvement. Peptides derived from the largest E21 -L49 scaffold were also found to display improved biochemical activity relative to SAHM 1 and SAHM 1 -24. Finally, taking advantage of the flexible design of stapled peptide analogs in our MD model, we sought to determine whether incorporation of non-natural amino acids into multiple positions might preserve or improve activity. By screening a commercially available library we identified a handful of promising non-proteinogenic mutations and synthesized the corresponding analog peptides. Notably, some of these residues were found to preserve activity, while others were found to significantly decrease activity. These results indicated that our model was capable of identifying productive interactions in some cases while the proposed binding conformations may not be accessible in others. As our search for non-natural residues was limited to a relatively small commercially available library, perhaps sampling a library with expanded chemical diversity in the future might yield more productive interactions.
The cell-based activity of reported stapled peptides in the literature has proven to be highly related to the degree of helical stabilization and cell penetration, rather than binding affinity alone. This phenomenon is attributed to the observation that stapled peptides enter cells through an active endocytotic mechanism, in contrast to most small molecules that enter through passive diffusion. With this in mind, a major goal of the work herein was to determine whether SAH M peptide biochemical potency could be optimized and to then determine the degree to which the cell-based activity was affected. All analog peptides were screened for inhibition of Notch signaling using an establ ished NOTCH 1 reporter gene assay. Comparison of the resulting normalized reporter inhibition to the ALPHAscreen IC50 for each peptide illustrated a positive correlation between the biochemical and cell-based activity for the l ibrary. Dose-dependent studies with four representative analog peptides revealed increased cell-based activity for all peptides relative to SAHM ! , however the degree of IC50 improvement was more modest than in the ALPHAscreen assay. The two most promising peptides, SAHM 1 -25 and SAHM 1 -62, exhibited IC50 values that were approximately two-fold and four-fold lower than SAHM 1 , respectively. The two analogs from the E21 -T36 scaffold showed improvements of 1 .5- to 2-fold. In addition, analog peptides were found to have anti-proliferative effects on NOTCH 1 - dependent T-ALL cell lines at equivalent effective concentrations as in the reporter gene assays. Taken together, these results support the notion that several stapled peptide analogs developed in this study are more potent inhibitors of Notch signaling. Additionally, our study suggests that while improved biochemical potency can contribute to increased cell-based activity, the phenomenon of active cel lular uptake of stapled peptides might impose limitations to these improvements for stapled peptide inhibitors of the NTC.
EXPERIMENTAL PROCEDURES
Stapled peptide molecular modeling- The initial structure of stapled peptide SAHM 1 was obtained based on the E2 1 -T36 dnMAML l in the human NOTCH complex39 (PDBid: 2F8X) by mutating E28 and R32 to ligated α,α-disubstituted "S5" amino acids. Conformational search of "S5" non-natural amino acids were performed in Macromodel to generate the lowest energy conformation of SAHM 1 , which was then used as the starting coordinate for energy minimization, equilibration and 20ns molecular dynamics simulation. The parameters of partial charge calculations, force fields for non-natural amino acids and MD simulations settings were described as follows. NOTCH complex modeling-The X-ray crystal structure of dnMAML l -ANK 1 -CSL bound to an oligo containing the HES1 promoter sequence (PDBid: 2f8x, 3.25Λ) was used as the starting coordinates for NTC MD simulations. The initial structure was processed in Protein Preparation Panel in Maestro 8.5. DNA and solvent molecules were removed from the structure. Protonation states were assigned to H is. Gin, Asn residues and were manually inspected. The structure was then prepared in antechamber suite in Amber 10. In LEaP module, the ff03 force field in Amber 10 was used to simulate the system. Na+ was added to neutralize the system, which was then solvated in a TI P3P water box extending IOA from the complex. The final system contained around 700 amino acid residues. Protein minimization, equilibration and molecular dynamics simulations were carried out using
SAN DER. PI module in Amber 10. Langevin dynamics was applied to control the temperature at 300 whi le Particle-Mesh-Ewald (PME) summation was employed to treat long-range interactions. The SHAKE algorithm was used to allow an integration time step of 2 fs. 35 ns MD simulations were performed to study the flexible interactions between dnMAML l and ANK 1 -CSL. Snapshots of the NTC were extracted every 10 ps from the last 30 ns of the MD simulation trajectories. Computational design of non-natural amino acids for MD simulations- For nonstandard residues, we need to calculate the charges as well as the force field parameters for MD simulation. Since the non-standard residue is a central residue in the peptide, we add ACE and NME caps to it (CH3CO-(NH-X-CO)-NHCH3).
Geometric optimization followed by single point charge calculation at HF/6-3 1 G* was applied in Gaussian 03. RESP program in antechamber suite was employed to fit the charges to atoms by restraining the total charge of the caps to zero. LEaP module in Amber 10 was used to prepare the structure. Non-natural residues were connected to the other residues and the missing parameters, like angles or dihedral, were carefully assigned using existing parameters from parm99, which describes atoms in very similar environment. Ff03 was used as the force field for the standard residues. Complexes with non-natural residues was then neutralized using Na+ and solvated by TI P3P water similar to the procedure described for NTC simulations. dnMAMLl BFED calculations- Binding free energy decomposition (BFED) calculations are based on the average MMGBSA score of the ensemble of snapshots extracted every l Ops from the converged 5-35ns MD simulation of dnMAML l . B FED calculations are carried out using MMGBSA in Amber 10. Molecular mechanics method (MM) was applied to calculate the gas phase interaction energies between dnMAML l and AN 1 -CSL. The electrostatics component of solvation energy was calculated using Generalized Born (GB) method, while the non-polar solvation energy was estimated from the Solvent Accessible Surface Area (SASA). The entropy term was not included in our calculation, which is neither accurate nor necessary to compare peptide analogs that similar simplifications have been used by other researchers. BFED evaluates the contribution of each residue from two components (dnMAML or CSL/AN ) to the total binding free energy. So one hal f of the pairwise interaction energies, for example electrostatic interactions, are assigned to each of the two interacting atoms belonging to two residues respectively. The nonpolar contributions of each residue to the free energy of binding are proportional to the difference of the accessible surface of each residue in the free molecule and the complex.
SA HM analogue binding calculations- The starting structures for the D simulations of SAHM analog complexes were obtained based on NOTCH complex X-ray structure (PDBid: 2F8X) by mutating respective residues of dnMAM L. The methods to explore the lowest energy conformations of the mutated peptides in the complex, calculate partial charges and set up energy minimization, equi libration and M D simulations are very similar as described above. 1 8ns MD simulations were applied for each of the SAHM analog complex. MMGBSA binding free energy calculations were performed based on the converged MD trajectories. MD trajectories were also analyzed to understand the dynamic behavior of the complex and explain how mutations affect the binding affinities.
Protein Expression and Purification- Human CSL bearing a C-terminal
hexahistidine tag (residues 9-435), RAMAN I (residues 1 761 -2127) and GST- labeled RA ANK 1 were expressed in BL21 (DE3) pLysS cells (Stratagene) and puri fied as previously described^7. Peptide synthesis and purification- Stapled peptides were synthesized on a Tetras multi-channel automated peptide synthesizer (Thuramed) by standard Fmoc-based sol id-phase peptide synthesis (SPPS) methods. Olefin-containing "S5" and "β," amino acids and non-natural amino acids were purchased from Anaspec Inc.
Following synthesis, ring-closing metathesis was performed using Grubbs I catalyst (benzylidene-bis (tricyclohexylphosphine) dichlororuthenium) in dichloroethane under nitrogen. All stapled peptides were subsequently capped with a beta-alanine spacer and an N-acetyl tryptophan to allow peptide quantification by absorbance at 280 nm. The theoretical extinction coefficients of 5500 M"'cm"' and 1490 Ivl 'cm' 1 were used for tryptophan and tyrosine, respectively. Notably, previously reported peptides containing an N-terminal FITC label were not suitable for these studies due to spectral interference in the ALPHAscreen assay. Following synthesis, stapled peptides were cleaved from the resin, purified by reverse-phase H PLC on C I 8 column, quantified, lyophilized, resuspended in DMSO (5 to 10 mM) and stored at - 20°C. Compound identification and purity was assessed by coupled liquid- chromatography mass-spectrometry (LCMS).
Synthetic dnMAML l polypeptides were synthesized by SPPS using low-loading NovaPEG resin (EM D) on a CEM Liberty Microwave peptide synthesizer. Extended coupling time or double-coupling was used for beta-branched amino acids, stretches of hydrophobic residues and arginines. Al l couplings were perfomed at 70°C with the exception of histidine and cysteine, which were coupled at 50°C to prevent racemization. Biotinylated peptides (bio-s-dnMAML l and bio-snt-dnMAM L l ) were capped with a beta-alanine spacer, a 20-atom diethylene glycol (EMD) spacer and biotin. Non-labeled competitor peptides (Ac-s-dnMAML l ) were capped with an acetylated beta-alanine spacer. All peptides were cleaved, purified and quantified in the same manner as the stapled peptides.
ALPHAscreen competition assays- Briefly, ALPHAscreen assays were performed using Perkin Elmer 384-well optiplates and measurements were made on a Perkin Elmer Envision multi-label plate reader with ALPHAscreen capability. Purified GST- AMANK 1 and CSL were dialyzed into binding buffer (20 mM Tris pH 8.4, 1 50 mM NaCI, 1 mM DTT, 1 mM EDTA and 0.05% dialyzed BSA) and kept separate for experiments. Briefly, 1 5 of 4X (of desired top concentration) stapled peptide stocks in binding buffer were added to the top row of plates containing 10 μΐ^ of binding buffer in all other wells. Serial three-fold dilutions were made leaving 10 μί in all wells. Notably, only non-fluorescent peptides were used in these assays as preliminary experiments indicated that the fluorophore interferes with the ALPHAscreen signal at mid-nanomolar concentrations. A 2X stock of CSL (80 nM), GST-RAMAN 1 (80 nM) and Bio-sdnMAML l (80 nM) was made in binding buffer and immediately added to wells containing di luted peptide stocks. This 30 μ!_ solution was allowed to incubate at room temperature for 30 minutes. Separately, an 8X stock of anti-GST acceptor beads ( 160 μg/mL· for a final concentration of 20 μg/mL) was resuspended in binding buffer in the dark. 5 μL· of the acceptor bead solution was added to the wells, the plate centrifuged for 1 minute at 500 rpm and incubated for an addition 30 minutes. Finally, an 8X stock of streptavidin donor beads ( 1 60 μg/mL· for a final concentration of 20 μg mL was made in binding buffer in the dark and 5 μL· of the donor bead solution was added directly into the buffer (no centrifugation) and the 40 μL· mixture was incubated for an addition 30 minutes at room temperature in the dark. The plate was read using standard
ALPHAscreen settings and data processed using Prizm 5 software by applying nonlinear regression analysis and fitting the data to a three-parameter sigmoidal curve.
Surface Plasmon Resonance- A Biacore 3000 SPR-lnstrument (Biacore-GE, Upsala, Sweden) was used to measure binding of Bio-sdnMAML l , Bio-sntdnMAML l and B io-SAHM l peptides to soluble complexes of RAMAN 1 and CSL. Peptides were dissolved in biacore binding buffer (20 mM Tris pH 8.4, 1 50 mM NaCI, 1 mM DTT, 1 mM EDTA and 0.05% P-20) and immobilized on a discrete flow cells of a slreptavidin-CM5 Biacore chip by injection at 1 0 μΕ/ιτηη for 1 0 minutes. Equimolar dilutions of RAMAN 1 and CSL (two-fold dilutions from 1 μΜ to 0.03 125 μΜ, including two blanks) were mixed in biacore binding buffer and injected for 1 20- 1 80 seconds onto the peptide-functionalized surface to measure NTC association kinetics, after which time NTC flow was stopped and buffer was injected to measure peptide dissociation kinetics. After the appropriate dissociation time (generally > 6 minutes) the chip surface was regenerated using a high salt regeneration buffer (500 mM NaCl, 20 mM Tris pH 8.4 1 mM DTT and 0.05% P-20) to remove all bound complexes and prevent experimental carry-over. Binding data was reference-cell normalized and processed using ClampXP software:
(http://www.cores.utah.edu/interaction/clamp.html). A two-site binding model was applied to the processed dataset to determine kinetic parameters of the peptide-NTC interactions.
Luciferase Reporter Gene Assays- U20S cells were plated in white, 96-well plates (Corning) containing DMEM supplemented with 10% FBS and al lowed to accl i mate overnight. Empty pcDNA3 or AEGFALNR-NOTCH l plasmids (5 ng well) were transiently co-transfected with a CSL-regulated firefly luciferase reporter construct and a constitutively active Renilla luciferase (pRLT ) control plasmid ( 10: 1 /?e/7/7/c/:Firefly plasmid ratios) using Lipofectamine 3000 (Invitrogen) 46 37.
Approximately 24-hours post-transfection cells were treated with DMSO vehicle control or stapled peptides at the given concentrations in fresh DMEM supplemented with 10% FBS and incubated for 1 8-24 hours. Luciferase activity was subsequently measured using a dual-luciferase assay kit (Promega) and NOTCH-dependent antagonism was measured by normalization of firefly and Renilla luci ferase signals.
Cell Proliferation and Apoptosis Assays- 5 l 04 cells were seeded in white, 96-well Corning plates in a total volume of 125 RPMI-1640 media containing 1 % penicillin/streptomycin, 10% FBS and the indicated concentrations of DMSO or SAHM analog peptide. Cell viability was determined after three days by measuring cellular ATP content using the Cell Titer-Glo assay (Promega).
The structure, name, abbreviation and site(s) of introduction for non-natural amino acids used in analog stapled peptides is shown below. Amino Acid Mutant Site Abbreviaiio Fmac-(1-naphihylR- ΥΊ 1 1 Np
Alanine-OH
Fmoc-(2-naphthyl)-L- ΥΊ1 2Np
Alaninc-OH
Fmoc-(Ac)-L-Thyronine-OH Y41 Thy
Fmoc-L-Met(0;)-OH C30 Mx
Figure imgf000051_0001
o
OH
Fmoc-l.-l.ys(Nicorinyl)-OH U3 Nk
Figure imgf000051_0002
FmocHN! .
on Fmoc-D-4-me5hylflmino>-Phe-OH C37 AmF -peniafluoro- C37 pfF
Figure imgf000051_0003
Polypeptides
In some instances, the hydrocarbon cross-links described herein can be further manipulated. In one instance, a double bond of a hydrocarbon alkenyl cross-link, (e.g., as synthesized using a ruthenium-catalyzed ring closing metathesis (RCM)) can be oxidized (e.g., via epoxidation or dihydroxylation) to provide one of
Figure imgf000052_0001
Either the epoxide moiety or one of the free hydroxy! moieties can be further functionalized. For example, the epoxide can be treated with a nucleophile, which provides additional functionality that can be used, for example, to attach a tag (e.g., a radioisotope or fluorescent tag). The tag can be used to help direct the compound to a desired location in the body or track the location of the compound in the body. Alternatively, an additional therapeutic agent can be chemically attached to the functionalized cross-link (e.g., an anti-cancer agent such as rapamycin, vinblastine, taxol, etc.). Such derivitization can alternatively be achieved by synthetic manipulation of the amino or carboxy terminus of the polypeptide or via the amino acid side chain. Other agents can be attached to the functionalized cross-link, e.g., an agent that facilitates entry of the polypeptide into cells.
While hydrocarbon cross-links have been described, other cross-links are also envisioned. For example, the cross-link can include one or more of an ether, thioether, ester, amine, 1 ,4-triazole, 1 ,5-triazole, hydrazone or amide moiety. In some cases, a naturally occurring amino acid side chain can be incorporated into the cross-link. For example, a cross-link can be coupled with a functional group such as the hydroxyl in serine, the thiol in cysteine, the primary amine in lysine, the acid in aspartate or glutamate, or the amide in asparagine or glutamine - all with or without inclusion of internal crosslinking moieties (such as biselectrophile-containing alkanes with a pair of cysteines, for example). Accordingly, it is possible to create a cross-link using naturally occurring amino acids rather than using a cross-link that is made by coupling two non-naturally occurring amino acids. It is also possible to use a single non-naturally occurring amino acid together with a naturally occurring amino acid. It is further envisioned that the length of the cross-l ink can be varied! For instance, a shorter length of cross-link can be used where it is desirable to provide a relatively high degree of constraint on the secondary alpha-helical structure, whereas, in some instances, it is desirable to provide less constraint on the secondary alpha-helical structure, and thus a longer cross-link may be desired.
Additional ly, whi le examples of cross-links spanning from amino acids i to i+3, i to i+4; and i to i+7 have been described in order to provide a cross-link that is primarily on a single face of the alpha helix, the cross-links can be synthesized to span any combinations of numbers of amino acids.
[0002][003S] In some instances, alpha disubstituted amino acids are used in the polypeptide to improve the stability of the alpha hel ical secondary structure.
However, alpha disubstituted amino acids are not required, and instances using mono-alpha substituents (e.g., in the cross-linked amino acids) are also envisioned.
As can be appreciated by the skilled artisan, methods of synthesizing the compounds of the described herein will be evident to those of ordinary skill in the art.
Additionally, the various synthetic steps may be performed in an alternate sequence or order to give the desired compounds. Synthetic chemistry transformations and protecting group methodologies (protection and deprotection) useful in synthesizing the compounds described herein are known in the art and include, for example, those such as described in R. Larock, Comprehensive Organic Transformations, VCH Publishers ( 1989); T. W. Greene and P.G.M. Wuts, Protective Groups in Organic Synthesis, 3d. Ed., John Wiley and Sons ( 1999); L. Fieser and . Fieser, Fieser and Fieser's Reagents for Organic Synthesis, John Wiley and Sons ( 1994); and L.
Paquette, ed., Encyclopedia of Reagents for Organic Synthesis, John Wiley and Sons ( 1995), and subsequent editions thereof.
The peptides of this invention can be made by chemical synthesis methods, which are well known to the ordinarily skilled artisan. See, for example, Fields et a!., Chapter 3 in Synthetic Peptides: A User's Guide, ed. Grant, W. H. Freeman & Co., New York, N.Y., 1992, p. 77. Hence, peptides can be synthesized using the automated Merrifield techniques of solid phase synthesis with the a-NH? protected by either t-Boc or Fmoc chemistry using side chain protected amino acids on, for example, an Applied Biosystems Peptide Synthesizer Model 430A or 43 1 .
One manner of making of the peptides described herein is using solid phase peptide synthesis (SPPS). The C-terminal amino acid is attached to a cross-linked polystyrene resin via an acid labile bond with a linker molecule. This resin is insoluble in the solvents used for synthesis, making it relatively simple and fast to wash away excess reagents and by-products. The N-terminus is protected with the Fmoc group, which is stable in acid, but removable by base. Any side chain functional groups are protected with base stable, acid labile groups.
Longer peptides could be made by conjoining individual synthetic peptides using native chemical ligation. Alternatively, the longer synthetic peptides can be synthesized by well-known recombinant DNA techniques. Such techniques are provided in well-known standard manuals with detailed protocols. To construct a gene encoding a peptide of this invention, the amino acid sequence is reverse translated to obtain a nucleic acid sequence encoding the amino acid sequence, preferably with codons that are optimum for the organism in which the gene is to be expressed. Next, a synthetic gene is made, typically by synthesizing ol igonucleotides which encode the peptide and any regulatory elements, if necessary. The synthetic gene is inserted in a suitable cloning vector and transfected into a host cell. The peptide is then expressed under suitable conditions appropriate for the selected expression system and host. The peptide is purified and characterized by standard methods. The peptides can be made in a high-throughput, combinatorial fashion, e.g., using a high-throughput multiple channel combinatorial synthesizer available from Advanced Chemtech. Long or complex peptides may also be made using microwave-assisted peptide synthesis, where standard solid-phase peptide synthesis methods are used in a reaction chamber enclosed in a controllable microwave apparatus. These methods permit rapid heating and cooling of the reaction environment, which can increase yields and access to otherwise difficult to synthesize peptides. In the modified polypeptides one or more conventional peptide bonds replaced by a different bond that may increase the stability of the polypeptide in the body.
Peptide bonds can be replaced by: a retro-inverso bonds (C(O)-NH); a reduced · amide bond (NH-CF ); a thiomethylene bond (S-CH2 or CH2-S); an oxomethylene bond (O-CH2 or CH2-0); an ethylene bond (CH2-CH2); a thioamide bond (C(S)- H); a trans-olefin bond (CH=CH); a fluoro substituted trans-olefin bond (CF=CH); a ketomethylene bond (C(O)-CHR) or CHR-C(O) wherein R is H or CH3; and a fiiioro-ketomethylene bond (C(O)-CFR or CFR-C(O) wherein R is H or F or CH3.
The polypeptides can be further modified by: acetylation, amidation.
biotinylation. cinnamoylation, farnesylation, fluoresceination, formylation, myristoylation, palmitoylation, phosphorylation (Ser, Tyr or Thr), stearoylation, succinylation and sulfurylation. The polypeptides of the invention may also be conjugated to, for example, polyethylene glycol (PEG); alky I groups (e.g., C 1 -C20 straight or branched alkyl groups); fatty acid radicals; and combinations thereof.
Methods of Treatment
The present invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant (e.g., excessive) Notch activity or aberrant activity of a gene, gene-product or molecular signaling pathway that is regulated (positively or negatively) by Notch proteins (isoforms 1 -4), MAML proteins (isoforms 1 -3) and/or CSL. This is because the polypeptides are expected to act as dominant negative inhibitors of Notch-family, MAML-family and CSL protein activity. As used herein, the term "treatment" is defined as the application oradministration of a therapeutic agent to a patient, or appl ication or administration of
a therapeutic agent to an isolated tissue or cell line from a patient, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease. The polypeptides of the invention can be used to treat, prevent, and/or diagnose cancers and neoplastic conditions. As used herein, the terms "cancer",
"hypcrproliferativc" and "neoplastic" refer to cells having the capacity for autonomous growth, i.e., an abnonnal state or condition characterized by rapidly prol i ferating cell growth. Hyperproliferative and neoplastic disease states may be categorized as pathologic, i.e., characterizing or constituting a disease state, or may be categorized as non-pathologic, i.e., a deviation from normal but not associated with a disease state. The term is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transfonned cells, tissues, or 30 organs, irrespective of histopathologic type or stage of invasiveness. " Pathologic hyperproliferative" cells occur in disease states characterized by malignant tumor growth. Examples of non-pathologic hyperproliferative cells include proliferation of cells associated with wound repair.
Examples of cel lular proliferative and/or differcntiative disorders include cancer, e.g., carcinoma, sarcoma, or metastatic disorders. The compounds (i.e., the stapled polypeptides) can act as novel therapeutic agents for controlling breast cancer, T cell cancers and B cell cancer. The polypeptides may also be useful for treatingmucoepidermoid carcinoma and medulloblastoma. Examples of proli ferative disorders include hematopoietic neoplastic disorders. As used herein, the term "hematopoietic neoplastic disorders" includes diseases involving
hyperplastic/neoplastic cells of hematopoietic origin, e.g., arising
from myeloid, lymphoid or erythroid lineages, or precursor cells thereof. Exemplary disorders include: acute leukemias, e.g., erythroblastic leukemia and acute mcgakaryoblastic leukemia. Additional exemplary myeloid disorders include, but are not limited to, acute promyeloid leukemia (APML), acute myelogenous 1 5 leukemia (AML) and chronic myelogenous leukemia (CML) (reviewed in Vaickus, L. ( 1 991 ) Crit Rev. in Oncol. IHemotol. 1 1 :267-97); lymphoid
malignancies include, but are not limited to acute lymphoblastic leukemia (ALL) which includes B lineageALL and T-lineage ALL, chronic lymphocytic leukemia (eLL), prolymphocyte leukemia (PLL), multiple mylenoma, hairy cell leukemia (HLL) and Waldenstrom's macroglobulinemia (WM). Additional forms of malignant lymphomas include, but are not limited to non-Hodgkin lymphoma and variants thereof, peripheral T cell lymphomas, adult T cellieukemialiymphoma (ATL), cutaneous T-ccl 1 1 ymphoma (CTCL), large granular lymphocytic leukemia (LGF), Hodgkin's disease and Reed-Sternberg disease. Examples of cellular proliferative and/or differentiative disorders of the breast include, but arc not limited to, proli ferative breast disease including, e.g, epithelial hyperplasia, sclerosing adenosis, and small duct papillomas; tumors, e.g., stromal tumors such as fibroadenoma, phyl l Odes tumor, and sarcomas, and epithelialtumors such as large duct papilloma; carcinoma of the breast including in situ (noninvasive) carcinoma that includes ductal carcinoma in situ (including Paget's disease) and lobular carcinoma in situ, and invasive (infiltrating) carcinoma including, but not limited to, invasive ductal carcinoma, invasive lobular carcinoma, medullary carcinoma, colloid (mucinous) carcinoma, tubular carcinoma, and invasive papillary carcinoma, and miscellaneous malignant neoplasms. Disorders in the male breast include, but are not limited to, gynecomastia and carcinoma. Other proliferative disorders that could be treated include cancers or metastatic disseminated tumors of the lung, pancreas, ovaries, gastrointestinal tract, liver as wel l as melanoma and medulloblastoma. The polypeptides could also be used for the treatment of any metastatic tumor on the basis of Notch-required signaling for angiogenesis (maintenance of blood supply) and cancer stem-cell like properties of metastatic cells. Cancers associated with hyperactivity of AM L-interacting proteins other than Notch and CSL, which include NF-kappa-B.
The polypeptides describe herein could be used for the treatment of many noncancerous diseases associated with overactive Notch signaling, including osteoporosis, autoimmune disorders, inflammatory atherosclerosis and pulmonary hypertension. Additionally, other diseases associated with NF-kappa-B signaling, such as immunologic disorders, may be treated with the polypeptides herein.
Furthermore, the polypeptides herein could be used for the treatment (in vivo or ex vivo) of tissues or cells from patients for regenerative medicine or stem cell therapy. Pharmaceutical Compositions and Routes of Administration
As used herein, the compounds of this invention, including the compounds of formulae described herein, are defined to include pharmaceutically acceptable derivatives or prodrugs thereof. A "pharmaceutically acceptable derivative or prodrug" means any pharmaceutically acceptable salt, ester, salt of an ester, or other derivative of a compound of this invention which, upon administration to a recipient, is capable of providing (directly or indirectly) a compound of this invention.
Particularly favored derivatives and prodrugs are those that increase the
bioavailabi lity of the compounds of this invention when such compounds are administered to a mammal (e.g., by al lowing an oral ly administered compound to be more readily absorbed into the blood) or which enhance delivery of the parent compound to a biological compartment (e.g., the brain or lymphatic system) relative to the parent species. Preferred prodrugs include derivatives where a group which enhances aqueous solubility or active transport through the gut membrane is appended to the structure of formulae described herein.
The compounds of this invention may be modified by appending appropriate functionalities to enhance selective biological properties. Such modifications are known in the art and include those which increase biological penetration into a given biological compartment (e.g., blood, lymphatic system, central nervous system), increase oral availability, increase solubility to allow administration by injection, alter metabolism and alter rate of excretion.
Pharmaceutically acceptable salts of the compounds of this invention include those derived from pharmaceutically acceptable inorganic and organic acids and bases. Examples of suitable acid salts include acetate, adipate, benzoate, benzenesulfonate. butyrate, citrate, digluconate, dodecylsulfate, formate, fumarate, glycolate, hemisul fate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide. lactate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, palmoate, phosphate, picrate, pivalate. propionate, salicylate, succinate, sulfate, tartrate, tosylate, trifluoromethylsulfonate, and undecanoate. Salts derived from appropriate bases include alkali metal (e.g., sodium), alkaline earth metal (e.g., magnesium), ammonium and N-(alkyl)4 + salts. This invention also envisions the quaternization of any basic nitrogen-containing groups of the compounds disclosed herein. Water or oil-soluble or dispersible products may be obtained by such quaternization.
The compounds of the formulae described herein can, for example, be administered by injection, intravenously, intraarterially, subdermally, intraperitoneally, intramuscularly, or subcutaneously; or orally, buccally, nasally, transmucosal ly. topical ly, in an ophthalmic preparation, or by inhalation, with a dosage ranging from about 0.001 to about 100 mg/kg of body weight, or according to the requirements of the particular drug. The methods herein contemplate administration of an effective amount of compound or compound composition to achieve the desired or stated effect. Typical ly, the pharmaceutical compositions of this invention wil l be administered from about 1 to about 6 times per day or alternatively, as a continuous infusion. Such administration can be used as a chronic or acute therapy. The amount of active ingredient that may be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration. A typical preparation will contain from about 5% to about 95% active compound (w/w). Alternatively, such preparations contain from about 20% to about 80% active compound.
Lower or higher doses than those recited above may be required. Specific dosage and treatment regimens for any particular patient will depend upon a variety of factors, including the activity of the specific compound employed, the age, body weight, general health status, sex, diet, time of administration, rate of excretion, drug combination, the severity and course of the disease, condition or symptoms, the patient's disposition to the disease, condition or symptoms, and the judgment of the treating physician.
Upon improvement of a patient's condition, a maintenance dose of a compound, composition or combination of this invention may be administered, if necessary. Subsequently, the dosage or frequency of administration, or both, may be reduced, as a function of the symptoms, to a level at which the improved condition is retained. Patients may, however, require intermittent treatment on a long-term basis upon any recurrence of disease symptoms.
Pharmaceutical compositions of this invention comprise a compound of the formulae described herein or a pharmaceutically acceptable salt thereof; an additional agent including for example, morphine or codeine; and any
pharmaceutically acceptable carrier, adjuvant or vehicle. Alternate compositions of this invention comprise a compound of the formulae described herein or a pharmaceutically acceptable salt thereof; and a pharmaceutically acceptable carrier, adjuvant or vehicle. The compositions delineated herein include the compounds of the formulae delineated herein, as well as additional therapeutic agents i f present, in amounts effective for achieving a modulation of disease or disease symptoms. The term "pharmaceutically acceptable carrier or adjuvant" refers to a carrier or adjuvant that may be administered to a patient, together with a compound of this invention, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the compound.
Pharmaceutical ly acceptable carriers, adjuvants and vehicles that may be used in the pharmaceutical compositions of this invention include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug deliver)' systems (SEDDS) such as d-ct-tocopherol polyethyleneglycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric deliver}' matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene- block polymers, polyethylene glycol and wool fat. Cyclodextrins such as α-, β-, and γ-cyclodextrin, may also be advantageously used to enhance delivery of compounds of the formulae described herein.
The pharmaceutical compositions of this invention may be administered orally, parenterally, by inhalation spray, topically, rectal ly, nasally, buccally, vaginally or via an implanted reservoir, preferably by oral administration or administration by injection. The pharmaceutical compositions of this invention may contain any conventional non-toxic pharmaceutically-acceptable carriers, adjuvants or vehicles. I n some cases, the pH of the formulation may be adjusted with pharmaceutically acceptable acids, bases or buffers to enhance the stability of the formulated compound or its delivery form. The term parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional and intracranial' injection or in fusion techniques.
The pharmaceutical compositions may be in the form of a sterile injectable preparation, for example, as a sterile injectable aqueous or oleaginous suspension. This suspension may be formulated according to techniques known in the art using suitable dispersing or wetting agents (such as, for example, Tween 80) and suspending agents. The sterile injectable preparation may also be a steri le injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example, as a solution in 1 ,3-butanediol. Among the acceptable vehicles and solvents that may be employed are mannitol, water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil may be employed including synthetic mono- or diglycerides. Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables. as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions. These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, or carboxymethyl cellulose or similar dispersing agents which are commonly used in the formulation of pharmaceutically acceptable dosage forms such as emulsions and or suspensions. Other commonly used surfactants such as Tweens or Spans and/or other similar emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.
The pharmaceutical compositions of this invention may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, emulsions and aqueous suspensions, dispersions and solutions. In the case of tablets for oral use, carriers which are commonly used include lactose and corn starch. Lubricating agents, such as magnesium stearate, are also typically added. For oral administration in a capsule form, useful diluents include lactose and dried corn starch. When aqueous suspensions and/or emulsions are administered orally, the active ingredient may be suspended or dissolved in an oily phase is combined with emulsifying and/or suspending agents. If desired, certain sweetening and/or flavoring and/or coloring agents may be added.
The pharmaceutical compositions of this invention may also be administered in the form of suppositories for rectal administration. These compositions can be prepared by mixing a compound of this invention with a suitable non-irritating excipient which is solid at room temperature but liquid at the rectal temperature and therefore will melt in the rectum to release the active components. Such materials include, but are not limited to, cocoa butter, beeswax and polyethylene glycols.
The pharmaceutical compositions of this invention may be administered by nasal aerosol or inhalation. Such compositions are prepared according to techniques well- known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other solubilizing or dispersing agents known in the art. When the compositions of this invention comprise a combination of a compound of the formulae described herein and one or more additional therapeutic or prophylactic agents, both the compound and the additional agent should be present at dosage levels of between about 1 to 100%, and more preferably between about 5 to 95% of the dosage normally administered in a monotherapy regimen. The additional agents may be administered separately, as part of a multiple dose regimen, from the compounds of this invention. Alternatively, those agents may be part of a single dosage form, mixed together with the compounds of this invention in a single composition.
Modification of Polypeptides
The stapled polypeptides can include a drug, a toxin, a derivative of polyethylene glycol; a second polypeptide; a carbohydrate, etc. Where a polymer or other agent is linked to the stapled polypeptide is can be desirable for the composition to be substantial ly homogeneous.
The addition of polyethelene glycol (PEG) molecules can improve the
pharmacokinetic and pharmacodynamic properties of the polypeptide. For example. PEGylation can reduce renal clearance and can result in a more stable plasma concentration. PEG is a water soluble polymer and can be represented as linked to the polypeptide as formula:
XO--(CH2CH20)„-CH2CH2~Y where n is 2 to 10,000 and X is H or a terminal modification, e.g., a C |.4 alkyl; and Y is an amide, carbamate or urea linkage to an amine group (including but not limited to, the epsilon amine of lysine or the N- terminus) of the polypeptide. Y may also be a maleimide linkage to a thiol group (including but not limited to, the thiol group of cysteine). Other methods for link ing PEG to a polypeptide, directly or indirectly, are known to those of ordinary skil l in the art. The PEG can be linear or branched. Various forms of PEG including various functionalized derivatives are commercially available.
PEG having degradable linkages in the backbone can be used. For example, PEG can be prepared with ester linkages that are subject to hydrolysis. Conjugates having degradable PEG linkages are described in WO 99/34833; WO 99/14259, and U.S. 6,348,558.
In certain embodiments, macromolecular polymer (e.g., PEG) is attached to an agent described herein through an intermediate linker. In certain embodiments, the linker is made up of from 1 to 20 amino acids linked by peptide bonds, wherein the amino acids are selected from the 20 naturally occurring amino acids. Some of these amino acids may be glycosylated, as is well understood by those in the art. In other embodiments, the 1 to 20 amino acids are selected from glycine, alanine, proline, asparagine, glutamine, and lysine. In other embodiments, a linker is made up of a majority of amino acids that are sterically unhindered, such as glycine and alanine. Non-peptide linkers are also possible. For example, alkyl linkers such as
-NH(CH2)nC(0)-, wherein n = 2-20 can be used. These alkyl linkers may further be substituted by any non-sterically hindering group such as lower alkyl (e.g., C i-Ce) lower acyl, halogen (e.g., CI, Br), CN, NH2, phenyl, etc. U.S. Pat. No. 5,446,090 describes a Afunctional PEG linker and its use in forming conjugates having a peptide at each of the PEG linker termini.
In some cases solubi l ity and/or alpha helicity can sometime be improved by modi fying the amino-terminus of the peptide to attach spermine (Muppidi et al. 201 1 Bioorg Med. Chem Lett 7412).
Screening Assays
The assays described herein can be performed with individual candidate compounds or can be performed with a plurality of candidate compounds. Where the assays are performed with a plurality of candidate compounds, the assays can be performed using mixtures of candidate compounds or can be run in parallel reactions with each reaction having a single candidate compound. The test compounds or agents can be obtained using any of the numerous approaches in combinatorial library methods known in the art. Other applications
A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.
References
1 . Darnell, J. E. J. Transcription factors as targets for cancer therapy. Nat Rev Cancer 2, 740-749 (2002).
2. Artavanis-Tsakonas, S., Rand, M. D. & Lake, R. J. Notch signaling: cel l fate control and signal integration in development. Science 284, 770-776 ( 1 999).
3. Bray, S. J. Notch signalling: a simple pathway becomes complex. Nat Rev Mol Cell Biol 7, 678-689 (2006).
4. Joutel, A. et al. Notch3 mutations in CADAS I L, a hereditary adult-onset condition causing stroke and dementia. Nature 383, 707-710 ( 1 996).
5. Garg, V. et al. Mutations in NOTCH 1 cause aortic valve disease. Nature 437, 270-274 (2005).
6. Li, L. et al. Alagille syndrome is caused by mutations in human Jagged 1 . which encodes a ligand for Notch 1 . Nat Genet 16, 243-251 ( 1 997).
7. El lisen, L. W. et al. TAN- 1 , the human homolog of the Drosophila notch gene, is broken by chromosomal translocations in T lymphoblastic neoplasms. Cell 66, 649-661 ( 1991 ).
8. Weng, A. P. et al. Activating mutations of NOTCH I in human T cell acute lymphoblastic leukemia. Science 306, 269-271 (2004).
9. Colaluca, I. N. et al. NUMB controls p53 tumour suppressor activity. Nature 451 , 76-80 (2008).
10. Park, J. T. et al. Notch3 gene amplification in ovarian cancer. Cancer Res 66, 63 12-63 1 8 (2006).
1 1 . onishi, J. et al. Gamma-secretase inhibitor prevents Notch3 activation and reduces proliferation in human lung cancers. Cancer Res 67, 805 1 -8057 (2007). 1 2. Westhoff, B. et al. Alterations of the Notch pathway in lung cancer. Proc Natl Acad Sci U S 106, 22293-22298 (2009). 1 3. De La, O. J. P. et al. Notch and Kras reprogram pancreatic acinar cells to ductal intraepithelial neoplasia. Proc Natl Acad Sci U S A 105, 1 8907- 1 8912 (2008).
1 . Pinnix, C. C. et al. Active Notch l confers a transformed phenotype to primary human'melanocytes. Cancer Res 69, 53 1 2-5320 (2009).
1 5. Nefedova, Y., Cheng, P., Alsina, M., Dalton, W. S. & Gabrilovich, D. I . Involvement of Notch- 1 signaling in bone marrow stroma-mediated de novo drug resistance of myeloma and other malignant lymphoid cell lines. Blood 103, 3503- 35 10 (2004).
16. Fung, E. et al. Delta-like 4 induces notch signaling in macrophages:
impl ications for inflammation. Circulation 115, 2948-2956 (2007).
1 7. Niranjan, T. et al. The Notch pathway in podocytes plays a role in the development of glomerular disease. Nat Med 14, 290-298 (2008).
1 8. Hilton, M. J. et al. Notch signaling maintains bone marrow mesenchymal progenitors by suppressing osteoblast differentiation. Nat Med 14, 306-3 14 (2008).
1 9. Li, X. et al. Notch3 signaling promotes the development of pulmonary arterial hypertension. Nat Med 15, 1289- 1297 (2009).
20. Brou, C. et al. A novel proteolytic cleavage involved in Notch signaling: the role of the disintegrin-metalloprotease TACE. Mol Cell 5, 207-21 6 (2000).
21 . Struhl, G. & Greenwald, I . Presenilin is required for activity and nuclear access of Notch in Drosophi la. Nature 398, 522-525 ( 1999).
22. Ye, Y., Lukinova, N. & Fortini, M. E. Neurogenic phenotypes and altered Notch processing in Drosophila Presenilin mutants. Nature 398, 525-529 ( 1 999).
23. De Strooper, B. et al. A presenilin- 1 -dependent gamma-secretase-like protease mediates release of Notch intracellular domain. Nature 398, 51 8-522 ( 1999).
24. Wu, L. et al. MAML 1 , a human homologue of Drosophila mastermind, is a transcriptional co-activator for NOTCH receptors. Nat Genet 26, 484-489 (2000).
25. Fryer, C. J., Lamar, E., Turbachova, I., intner, C. & Jones, K. A.
Mastermind mediates chromatin-specific transcription and turnover of the Notch enhancer complex. Genes Dev 16, 1 397- 141 1 (2002).
26. Oswald, F. et al. RBP-Jkappa/SHARP recruits CtlP/CtBP corepressors to silence Notch target genes. Mol Cell Biol 25, 1 0379- 10390 (2005). 27. Kovall, R. A. & Hendrickson, W. A. Crystal structure of the nuclear effector of Notch signaling, CSL, bound to DNA. EMBO J 23, 3441 -345 1 (2004).
28. Nam, Y., Weng, A. P., Aster, J. C. & Blacklovv, S. C. Structural requirements for assembly of the CSL. intracellular Notch 1 .Mastermind-like 1 transcriptional activation complex. J Biol Chem 278, 21232-21239 (2003).
29. Noguera-Troise, I. et al. Blockade of D114 inhibits tumour growth by promoting non-productive angiogenesis. Nature 444, 1032- 1 037 (2006).
30. Ridgway, J. et al . Inhibition of D114 signalling inhibits tumour growth by deregulating angiogenesis. Nature 444, 1083- 1087 (2006).
3 1 . Li, K. et al. Modulation of Notch signaling by antibodies specific for the extracel lular negative regulator ' region of NOTCH3. J Biol Chem 283, 8046-8054 (2008).
32. Wu, Y. et al . Therapeutic antibody targeting of individual Notch receptors. Nature 464, 1052- 1057 (2010).
33. Tian, G. et al. Linear non-competitive inhibition of solubilized human gamma-secretase by pepstatin A methylester, L685458, sulfonamides, and benzodiazepines. J Biol Chem 277, 3 1499-3 1 505 (2002).
34. Dovey, H. F. et al. Functional gamma-secretase inhibitors reduce beta- amyloid peptide levels in brain. J Neurochem 76, 173- 181 (2001 ).
35. Seiffert, D. et al. Presenilin- 1 and -2 are molecular targets for gamma- secretase inhibitors. J Biol Chem 275, 34086-34091 (2000).
36. Sparey, T. et al. Cyclic sulfamide gamma-secretase inhibitors. Bioorg Med Chem Lett 15, 4212-4216 (2005).
37. Moellering, R. E. et al. Direct inhibition of the NOTCH transcription factor complex. Nature 462, 1 82- 1 88 (2009).
38. Wilson, J. J. & Kovall, R. A. Crystal structure of the CSL-Notch- Mastermind ternary complex bound to DNA. Cell 124, 985-996 (2006).
39. Nam, Y., Sliz, P., Song, L., Aster, J. C. & Blacklovv, S. C. Structural basis for cooperativity in recruitment of MAML coactivators to Notch transcription complexes. Cell 124, 973-983 (2006). 40. Schafmeister, C. E., Po, J. & Verdine, G. L. An all-hydrocarbon cross- linking system for enhancing the helicity and metabolic stability of peptides. J Am Chem Soc 122, 5891 -5892 (2000).
41 . Walensky, L. D. et al. Activation of apoptosis in vivo by a hydrocarbon- stapled BH3 helix. Science 305, 1466- 1470 (2004).
42. Bernal, F., Tyler, A. F.. Korsmeyer, S. J ., Walensky, L. D. & Verdine, G. L. Reactivation of the p53 tumor suppressor pathway by a stapled p53 peptide. J Am Chem Soc 129, 2456-2457 (2007).
43. Danial, N. N. et al. Dual role of proapoptotic BAD in insulin secretion and beta cell survival. Nat Med 14, 144- 1 53 (2008).
44. Zhang, H. et al. A cell-penetrating helical peptide as a potential HlV- 1 inhibitor. J Mol Biol 378, 565-580 (2008).
45. Del Bianco, C., Aster, J. C. & Blacklow, S. C. Mutational and energetic studies of Notch 1 transcription complexes. J Mol Biol 376, 1 3 1 - 140 (2008).
46. Weng, A. P. et al. Growth suppression of pre-T acute lymphoblastic leukemia cel ls by inhibition of notch signaling. Mol Cell Biol 23, 655-664 (2003).
47. Kutchukian, P. S., Yang, J. S., Verdine, G. L. & Shakhnovich, E. I . Al l-atom model for stabilization of alpha-helical structure in peptides by hydrocarbon staples. J Am Chem Soc 131, 4622-4627 (2009).
48. Guo, Z. et al. Probing the alpha-helical structural stability of stapled p53 peptides: molecular dynamics simulations and analysis. Chem Biol Drug Des 75, 348-359 (2010).
49. Lubman, O. Y., Ilagan, M. X., Kopan, R. & Barrick, D. Quantitative dissection of the Notch.CSL interaction: insights into the Notch-mediated transcriptional switch. J Mol Biol 365, 577-589 (2007).
50. Ullman, E. F. et al. Luminescent oxygen channeling immunoassay:
measurement of particle binding kinetics by chemiluminescence. Proc Natl Acad Sci U S A 91 , 5426-5430 ( 1994).
51 . Eglen, R. M. et al. The use of AlphaScreen technology in HTS: current status. Ciirr Chem Genomics 1, 2- 10 (2008). 52. Lewis, H. D. et al. Apoptosis in T cell acute lymphoblastic leukemia cells after cell cycle arrest induced by pharmacological inhibition of notch signaling. Chem Biol 14, 209-219 (2007).
53. O'Neil, J. et al. FBW7 mutations in leukemic cells mediate NOTCH pathway activation and resistance to gamma-secretase inhibitors. J Exp Med 204, 1 81 3- 1 824 (2007).
54. Rao, S. S. et al. Inhibition of NOTCH signaling by gamma secretase inhibitor engages the RB pathway and elicits cell cycle exit in T-cell acute lymphoblastic leukemia cells. Cancer Res 69, 3060-3068 (2009).
55. Palomero, T. et al. Mutational loss of PTEN induces resistance to NOTCH I inhibition in T-cell leukemia. Nat Med 13, 1 203- 1 210 (2007).
56. Friedmann, D. R., Wilson, J. J. & Kovall, R. A. RAM-induced allostery facilitates assembly of a notch pathway active transcription complex. J Biol Chem 283, 14781 - 14791 (2008).

Claims

1. An internally cross-linked polypeptide comprising the amino acid sequence of any of SEQ ID NOs 12-20, wherein the side chains of at least two amino acids separated by three or six amino acids are replaced by an internal cross-link.
2. The internally cross-linked polypeptide of claim 1 wherein:
(a) the side chains of a first, a second and a third amino acid are replaced by internal cross-links;
(b) the first and second amino acids are separated by three or six amino acid and the second and third amino acids are separated by three or six amino acids; and
(c) there is an internal cross-link between the first and second amino acid and an internal cross-link between the second and third amino acids.
3. The internally cross-linked polypeptide of claim 1 wherein the side chains of Xaa8 and Xaal2 are replaced by an internal cross-link or the side chains of Xaa4 and Xaa8 are replaced by an internal cross-link or the side chains of Xaal2 and Xaal6 are replaced by an internal cross-link.
4. A modified polypeptide of Formula (I),
Figure imgf000070_0001
Formula (I)
or a pharmaceutically acceptable salt thereof,
wherein:
each Ri and I¾ are independently H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, or heterocyclylalkyl;
each R3 is independently alkyl, alkenyl, alkynyl; [R4-K-R4']n; each of which is substituted with 0-6 R5;
R4 and Ri'are independently alkylene, alkenylene or alkynylene ; each R5 is independently is halo, alkyl, ORe, N(Re)2, SRe, SOR6, S02R6, CO2R6, Re, a fluorescent moiety, or a radioisotope;
O
each K is independently O, S, SO, S02, CO, C02, CONR6, or ^ ; each R6 is independently H, alkyl, or a therapeutic agent;
n is an integer from 1 -4;
x is 2, 3 or 6;
y and w are independently integers from 0-100;
z is an integer from 1-10; and
each Xaa is independently an amino acid;
wherein the modified polypeptide comprises at least 8 contiguous amino acids of any of SEQ ID NOs: 12-20 except that: (a) within the 8 contiguous amino acids the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the linking group R3 which connects the alpha carbons of the pair of amino acids as depicted in Formula I and (b) the alpha carbon of the first amino acid of the pair of amino acids is substituted with Ri as depicted in formula I and the alpha carbon of the second amino acid of the pair of amino acids is substituted with R2 as depicted in Formula I.
5. The modified polypeptide of claim 1, wherein the modified polypeptide binds to IC 1-CSL.
6. The modified polypeptide of claim 4, wherein x is 2.
7. The modified polypeptide of claim 4, wherein x is 3.
8. The modified polypeptide of claim 4, wherein x is 6.
9. The modified polypeptide of claim 4, wherein x is 2, 3 or 6; R3 is an alkenyl containing a single double bond, and both Ri and independently R2 are H or methyl.
10. The modified polypeptide of claim 4, wherein each y is
independently an integer between 3 and 15.
11. The modified polypeptide of claim 4, wherein the polypeptide comprises at least 16 contiguous amino acids of any SEQ ID NO: 12-20 except that:
(a) within the 8 contiguous amino acids the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the linking group R3 which connects the alpha carbons of the pair of amino acids as depicted in Formula I and
(b) the alpha carbon of the first amino acid of the pair of amino acids is substituted with Ri as depicted in formula I and the alpha carbon of the second amino acid of the pair of amino acids is substituted with R2 as depicted in Formula I.
12. The modified polypeptide of claim 4 comprising at least 16 contiguous amino acids of
GluiArg2Xaa3Xaa4Arg5Arg6Xaa7Xaa8Xaa9XaaioArgnXaai2Hisi3Hisi4Seri5 Xaa16 (SEQ ID NO: 12)
wherein the side chains of Xaa4 and Xaas are replaced the linking group R3 as depicted in Formula I which connects the alpha carbons of the pair of amino acids and the alpha carbon of the first amino acid of the pair of amino acids is substituted with Ri as depicted in formula I and the alpha carbon of the second amino acid of the pair of amino acids is substituted with R2 as depicted in Formula I.
13. The modified polypeptide of claim 1 or 4 wherein the polypeptide does not have a net negative charge at pH 7.
14. The modified polypeptide of claim 17 wherein the polypeptide comprises at least one amino acid that has a positive charge at pH 7.
15. The modified polypeptide of claim 1 or 4 wherein the polypeptide is covalently bound to PEG.
16. The modified polypeptide of claim 4, wherein Ri and R2 are each independently H or Ci-Ce alkyl.
17. The modified polypeptide of claim 4, wherein Ri and R2 are each independently C1-C3 alkyl.
18. The modified polypeptide of claim 4, wherein Ri and R2 are methyl.
19. The modified polypeptide of claim 1, wherein R3 is alkenyl.
20. The modified polypeptide of claim 4 wherein x is 3.
21. The modified polypeptide of claim 20, wherein R3 is Cs alkenyl.
22. The modified polypeptide of claim 4, wherein x is 6.
23. The modified polypeptide of claim 22, wherein R3 is Cn alkenyl.
24. The modified polypeptide of claim 1, wherein R3 is alkenyl.
25. A modified polypeptide of Formula (II),
Figure imgf000073_0001
Formula (II)
or a pharmaceutically acceptable salt thereof,
wherein;
each Ri and R2 are independently H or a Ci to Cio alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, or heterocyclylalkyl; R3 is alkylene, alkenylene or alkynylene, or [R4 -K-R4]n; each of which is substituted with 0-6 R5;
R4 and Ri'are independently alkylene, alkenylene or alkynylene (e.g., each are independently a CI, C2, C3, C4, C5, C6, C7, C8, C9 or CIO alkylene, alkenylene or alkynylene);
R5 is halo, alkyl, ORe, N(R6)2, SRe, SOR6, S02R6, C02R6, Re, a fluorescent moiety, or a radioisotope;
K is O, S, SO, S02, CO, C02, CONR6, or & , aziridine, episulfide, diol, amino alcohol;
R6 is H, alkyl, or a therapeutic agent;
n is 2, 3, 4 or 6;
x is an integer from 2-10;
w and y are independently an integer from 0-100;
z is an integer from 1-10 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10); and
each Xaa is independently an amino acid (e.g., one of the 20 naturally occurring amino acids or any naturally occurring non-naturally occurring amino acid);
R7 is PEG, a tat protein, an affinity label, a targeting moiety, a fatty acid- derived acyl group, a biotin moiety, a fluorescent probe (e.g. fluorescein or rhodamine) linked via, e.g., a thiocarbamate or carbamate linkage;
R8 is H, OH, NH2, NHR8a, NR8aR8b;
wherein the polypeptide comprises at least 8 contiguous amino acids of any of SEQ ID NOs: 12 - 20 or another polypeptide sequence described herein except that: (a) within the 8 contiguous amino acids of any of SEQ ID NOs: 12 - 20the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the linking group, R3, which connects the alpha carbons of the pair of amino acids as depicted in formula I; and (b) the alpha carbon of the first of the pair of amino acids is substituted with Ri as depicted in Formula II and the alpha carbon of the second of the pair of amino acids is substituted with R2 as depicted in Formula II.
26. The modified polypeptide of any of the forgoing claims wherein one of more Xaa are alpha methyl amino acids.
27. A conjugated peptide comprising the modified polypeptide of claim 1 conjugated to PEG or spermine.
28. The conjugated peptide of claim 27 wherein the PEG or spermine is conjugated to the amino terminus of the modified peptide.
PCT/US2012/042719 2011-06-17 2012-06-15 Stabilized variant maml peptides and uses thereof Ceased WO2012174409A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
JP2014516044A JP2014520120A (en) 2011-06-17 2012-06-15 Stabilized mutant MAML peptides and uses thereof
EP12800679.8A EP2721061A4 (en) 2011-06-17 2012-06-15 STABILIZED VARIANT MAML PEPTIDES AND USES THEREOF
US14/127,039 US20140256912A1 (en) 2011-06-17 2012-06-15 Stabilized Variant MAML Peptides and Uses Thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161498477P 2011-06-17 2011-06-17
US61/498,477 2011-06-17

Publications (1)

Publication Number Publication Date
WO2012174409A1 true WO2012174409A1 (en) 2012-12-20

Family

ID=47357495

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/042719 Ceased WO2012174409A1 (en) 2011-06-17 2012-06-15 Stabilized variant maml peptides and uses thereof

Country Status (4)

Country Link
US (1) US20140256912A1 (en)
EP (1) EP2721061A4 (en)
JP (1) JP2014520120A (en)
WO (1) WO2012174409A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014151369A2 (en) 2013-03-15 2014-09-25 Dana-Farber Cancer Institute, Inc. Stabilized ezh2 peptides
WO2014201370A1 (en) 2013-06-14 2014-12-18 President And Fellows Of Harvard College Stabilized polypeptide insulin receptor modulators
US11198713B2 (en) 2017-09-07 2021-12-14 Fog Pharmaceuticals, Inc. Agents modulating beta-catenin functions and methods thereof

Families Citing this family (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7192713B1 (en) 1999-05-18 2007-03-20 President And Fellows Of Harvard College Stabilized compounds having secondary structure motifs
PL1680443T3 (en) 2003-11-05 2014-02-28 Dana Farber Cancer Inst Inc Stabilized alpha helical peptides and uses thereof
CA2682174C (en) 2007-03-28 2021-04-06 President And Fellows Of Harvard College Stitched polypeptides
EP2356139A4 (en) 2008-07-23 2013-01-09 Harvard College LIGATURE OF STAPLED POLYPEPTIDES
JP2012515172A (en) 2009-01-14 2012-07-05 エルロン・セラピューティクス・インコーポレイテッド Peptidomimetic macrocycle
US9163330B2 (en) 2009-07-13 2015-10-20 President And Fellows Of Harvard College Bifunctional stapled polypeptides and uses thereof
WO2011038049A1 (en) 2009-09-22 2011-03-31 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
KR20130099938A (en) 2010-08-13 2013-09-06 에일러론 테라퓨틱스 인코포레이티드 Peptidomimetic macrocycles
US9487562B2 (en) 2011-06-17 2016-11-08 President And Fellows Of Harvard College Stabilized polypeptides as regulators of RAB GTPase function
CN104039342A (en) 2011-10-18 2014-09-10 爱勒让治疗公司 peptidomimetic macrocycle
NZ627528A (en) 2012-02-15 2016-05-27 Aileron Therapeutics Inc Peptidomimetic macrocycles
HK1205454A1 (en) 2012-02-15 2015-12-18 Aileron Therapeutics, Inc. Triazole-crosslinked and thioether-crosslinked peptidomimetic macrocycles
US9617309B2 (en) 2012-09-26 2017-04-11 President And Fellows Of Harvard College Proline-locked stapled peptides and uses thereof
SG11201503052RA (en) 2012-11-01 2015-05-28 Aileron Therapeutics Inc Disubstituted amino acids and methods of preparation and use thereof
EP3391898A3 (en) 2013-03-13 2019-02-13 President and Fellows of Harvard College Stapled and stitched polypeptides and uses thereof
CN114805527A (en) 2014-05-21 2022-07-29 哈佛大学的校长及成员们 RAS inhibitory peptides and their uses
MX2017003797A (en) 2014-09-24 2017-06-15 Aileron Therapeutics Inc Peptidomimetic macrocycles and uses thereof.
MX389354B (en) 2014-09-24 2025-03-20 Aileron Therapeutics Inc PEPTIDOMIMETIC MACROCYCLES AND FORMULATIONS THEREOF.
WO2016154058A1 (en) 2015-03-20 2016-09-29 Aileron Therapeutics, Inc. Peptidomimetic macrocycles and uses thereof
WO2017004548A1 (en) 2015-07-01 2017-01-05 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
JP2018528217A (en) 2015-09-10 2018-09-27 エルロン・セラピューティクス・インコーポレイテッドAileron Therapeutics,Inc. Peptidomimetic macrocycles as modulators of MCL-1
US20190135868A1 (en) * 2016-04-29 2019-05-09 The University Of Chicago Synthetic dna binding domain peptides and uses thereof
WO2019136209A1 (en) * 2018-01-05 2019-07-11 President And Fellows Of Harvard College Stabilized polypeptides and uses thereof
KR20210060482A (en) 2018-08-20 2021-05-26 포그 파마슈티컬스 인코포레이티드 Collection of peptides, peptide agents and methods of use thereof
CN114174313A (en) 2019-04-09 2022-03-11 芝加哥大学 Macrocyclization and multimerization of peptides and proteins of the general type using diels-alder cycloaddition

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008061192A2 (en) * 2006-11-15 2008-05-22 Dana-Farber Cancer Institute, Inc. Stabilized maml peptides and uses thereof
WO2010034029A1 (en) * 2008-09-22 2010-03-25 Aileron Therapeutics, Inc. Peptidomimetic macrocycles

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2009294877C1 (en) * 2008-09-22 2015-05-07 Aileron Therapeutics, Inc. Peptidomimetic macrocycles

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008061192A2 (en) * 2006-11-15 2008-05-22 Dana-Farber Cancer Institute, Inc. Stabilized maml peptides and uses thereof
WO2010034029A1 (en) * 2008-09-22 2010-03-25 Aileron Therapeutics, Inc. Peptidomimetic macrocycles

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
MOELLERING RAYMOND E. ET AL.: "Direct inhibition of the NOTCH transcription factor complex.", NATURE, vol. 462, no. 7270, 2009, pages 182 - 188, XP055075485 *
See also references of EP2721061A4 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014151369A2 (en) 2013-03-15 2014-09-25 Dana-Farber Cancer Institute, Inc. Stabilized ezh2 peptides
WO2014151369A3 (en) * 2013-03-15 2014-11-20 Dana-Farber Cancer Institute, Inc. Stabilized ezh2 peptides
US10308926B2 (en) 2013-03-15 2019-06-04 Dana-Farber Cancer Institute, Inc. Stablized EZH2 peptides
WO2014201370A1 (en) 2013-06-14 2014-12-18 President And Fellows Of Harvard College Stabilized polypeptide insulin receptor modulators
US11198713B2 (en) 2017-09-07 2021-12-14 Fog Pharmaceuticals, Inc. Agents modulating beta-catenin functions and methods thereof
US11834482B2 (en) 2017-09-07 2023-12-05 Fog Pharmaceuticals, Inc. Agents modulating beta-catenin functions and methods thereof

Also Published As

Publication number Publication date
US20140256912A1 (en) 2014-09-11
EP2721061A1 (en) 2014-04-23
JP2014520120A (en) 2014-08-21
EP2721061A4 (en) 2014-11-05

Similar Documents

Publication Publication Date Title
EP2721061A1 (en) Stabilized variant maml peptides and uses thereof
US9074009B2 (en) Stabilized MAML peptides and uses thereof
DK2603600T3 (en) PEPTIDOMIMETIC MACROCYCLES
US7723469B2 (en) Stabilized alpha helical peptides and uses thereof
EP2118123B1 (en) Stabilized p53 peptides and uses thereof
US11673919B2 (en) Bicyclic peptidyl inhibitors
CA2864120A1 (en) Triazole-crosslinked and thioether-crosslinked peptidomimetic macrocycles
JP2015509940A (en) Peptidomimetic macrocycle
JP7780253B2 (en) Polypeptide conjugates for intracellular delivery of stapled peptides - Patent Application 20070122999
US12466853B2 (en) Selective targeting of apoptosis proteins by structurally-stabilized and/or cysteine-reactive NOXA peptides
WO2021041895A1 (en) Stapled beta-catenin ligands
US20240016943A1 (en) Synthetic dna binding domains and uses thereof
AU2017203561B2 (en) Stabilized alpha helical peptides and uses thereof
AU2014200485A1 (en) Stabilized maml peptides and uses thereof
HK1089191B (en) Stabilized alpha helical peptides and uses thereof
HK1126230A (en) Stabilized alpha helical peptides from bcl-2 and uses thereof
HK1188468A (en) Peptidomimetic macrocycles
HK1188468B (en) Peptidomimetic macrocycles

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12800679

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2014516044

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2012800679

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 14127039

Country of ref document: US