WO2012170782A2 - Production of post-translationally hydroxylated recombinant proteins in bacteria - Google Patents
Production of post-translationally hydroxylated recombinant proteins in bacteria Download PDFInfo
- Publication number
- WO2012170782A2 WO2012170782A2 PCT/US2012/041497 US2012041497W WO2012170782A2 WO 2012170782 A2 WO2012170782 A2 WO 2012170782A2 US 2012041497 W US2012041497 W US 2012041497W WO 2012170782 A2 WO2012170782 A2 WO 2012170782A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- hydroxylase
- lactone
- protein
- sugar
- nucleic acids
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0071—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0006—Oxidoreductases (1.) acting on CH-OH groups as donors (1.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/001—Oxidoreductases (1.) acting on the CH-CH group of donors (1.3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/005—Glycopeptides, glycoproteins
Definitions
- sequence listing is filed in this application in electronic format only and is incorporated herein by reference in its entirety.
- sequence listing text file 0-099-WO2_SeqListing_ST25.txt was created June 6, 2012, and is 509,165 byte in size.
- the present invention relates generally to the fields of cell biology, microbiology, and recombinant protein production, and particularly to bacterial cells capable of producing post-translationally hydroxylated recombinant proteins.
- Collagen is an important structural, protein in animals that constitutes about 30 percent by weight of all protein in the body, and is found in the skin, tendons, ligature, vasculature, musculature, organs, teeth, bones, and other tissues. Due to its physiological ubiquity, collagen is valuable for . use in a variety of pharmaceutical, medicinal, surgical, cosmetic, and food-related applications, among others.
- Type-I collagen is the most abundant collagen type and is found in the skin, tendons, vasculature, ligature, organs, teeth, and bone; type-ll collagen is found mainly in cartilage and in the vitreous humor of the eye; type-Ill collagen is a major component of granulation tissue and reticular fibers, is commonly found alongside type-l collagen, and is also found in artery walls, skin, intestines, and the uterus; type-IV collagen is found in basal lamina, in the lens of the eye, and in capillaries and nephron glomeruli.
- Type VI collagen is expressed by neuronal cells in the brain and has been found to be important in the injury response of neurons to the cytotoxicity of the Alzheimer's peptide, ⁇ -4 2 , so, for instance, might have therapeutic applications (Cheng et at., 2009, "Collagen VI protects neurons against ⁇ toxicity," Nature Neurosci. 12: 1 19- 121). Collagenous domains are also found in both surfactant protein A and surfactant protein D, which have important immune and anti-inflammatory activities within the skin and on all mucosal surfaces in the human body, as well as in the recently discovered, blood-soluble adiponectin protein, which forms a variety of different multimers and is an important regulator of blood glucose in humans.
- fibrillar collagen protein polymers that are part of the extracellular matrix in the human body can be as long as 300 nm long and 1.5 nm in diameter and are trimers of polypeptides known as a chains, each of which folds into a left-handed polyproline helix. Together, the three a chains twist together to form a highly stable, right-handed coiled coil, also known as a triple helix. With type-l collagen (and possibly with all fibrillar collagens), each triple helix associates into a right-handed super-coil that is sometimes referred to as a collagen microfibril.
- Gelatin is a hydrolyzed form of collagen, generally monomeric collagen, which can be comprised of fragments of collagen rather than whole collagen.
- Gelatin has a large number of applications, particularly in food, photography, and cosmetics, where it is frequently used as a gelling agent, and in pharmaceuticals, where it is frequently used for coating tablets or for making capsules.
- adiponectin is an adipokine that is abundantly present in plasma, typically at 2-30 pg/ml in humans ((Scherer, 2006, Diabetes 55(6), 1537-1545). Adiponectin has been shown in numerous studies to exert beneficial effects that can reverse metabolic disease, and so is a promising candidate for the development of new drugs to treat obesity- associated diseases such as cardiovascular dysfunction and type II diabetes mellitus.
- adiponectin is shown to protect against hypertension, atherosclerosis, non-alcoholic fatty liver disease, non-alcoholic steatohepatitis, and heart failure (Okamoto et al., 2002, Circulation 106: 2767-2770; Wang & Scherer, 2008, Hypertension 51 : 8-14; Xu et al., 2003, Clin. Invest. 112: 91-100; Shibata et al., 2005, Nat. Med.
- adiponectin can increase insulin sensitivity, and exerts a protective role against chronic inflammation (Shore ef al., 2006, J. Alergy Clin. Immunol. 118: 389-395; Yamauchi ei al., 2004, Circ. Res. 94; e27-31 ). Due to its multiple beneficial effects on obesity-related metabolic and cardiovascular dysfunctions, adiponectin has attracted a lot of attention in the last decade.
- HMW adiponectin is the major active form for many of adiponectin's effects, such as inhibiting hepatic glucose production and suppressing apoptosis of endothelial cells (Kobayashi et al., 2004, Circ. Res. 94: e27-31 ; Tsao et al., 2002, J. Biol. Chem. 277: 29359 - 29362).
- Adiponectin is composed of four domains: an N-terminal signal peptide, a variable domain that is divergent among species, a collagenous domain comprising 22 Gly-Xaa-Yaa repeats, and a C-terminal globular domain that binds to adiponectin receptors and perhaps to other serum binding partners as well (Simpson & Whitehead, 2010, Int. J. Biochem. Cell. Biol. 42: 785-788). Adiponectin is extensively post-translationally modified, and these modifications play important roles in multimerization. Proline hydroxylation contributes to stable association of triple- helical collagenous domains (Richards er a/., 2006, Mol. Endocriniol.
- adiponectins have been produced both in mammalian cells and Escherichia coli.
- mammalian cell production is non- ideal for broader medical applications due to yield and cost, while E. coli lacks the essential post-translational modification capabilities needed to produce a form of adiponectin that assembles into HMW multimers.
- prolyl-4-hydroxylase P4H
- the enzyme is required to hydroxylate prolyl residues to 4-hydroxyproline, for prolines that occur in the Y-position of the - Gly-X-Y- repeat sequences of collagen. Prockop et al., 1984, N. Engl. J. Med. 311 : 376-386.
- the newly synthesized chains do not properly and stably assemble and fold into the natural triple-helical conformation at 37°C.
- the polypeptides remain non-helical, are poorly secreted by cells, and cannot self-assemble into collagen fibrils.
- US Patent No. 5,928,922 disclosed the expression of active human prolyl- 4-hydroxylase in insect cells.
- US Patent Application Publication No. 2005/0164345 discloses recombinant production of human collagen in yeast, specifically Pichia spp., and insect cells.
- Bacteria are used to produce many recombinant proteins, for the reasons of, inter alia, their robustness, ease, rapidity, and low cost of growth in unsupplemented or minimally supplemented media, and capacity for survival during high-density growth, which can yield large amounts of recombinant protein with cultures of relatively small volume.
- the expression of properly formed collagen triple helices in a bacterial recombinant system has not been reported.
- bacteria are unable to produce active P4H, which requires an ascorbate co-factor that bacteria do not produce.
- Glycosylation can be an advantage, when this post- translational modification is necessary for the biological activity of a protein; but it can also be a disadvantage, since the particular forms of glycosylation that are put onto recombinantly expressed proteins in these non-human eukaryotic cells can cause an immune response if they are used in humans for medicinal, surgical, or cosmetic purposes.
- Proteins that are expressed in bacteria are typically completely free of glycosylation, since this type of post-translational modification does not normally occur in bacteria.
- collagen proteins that are expressed in bacteria such as E. coli, if pure and properly folded, could be expected to be completely non- immunogenic. This could be important for many uses of these recombinantly expressed collagenous proteins.
- nucleic acids encoding a sugar- 1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase
- nucleic acids encoding an ascorbate-dependent biosynthetic enzyme.
- the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase.
- the ascorbate-dependent biosynthetic is a hydroxylase, and in particular embodiments, the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
- the one or more nucleic acids encoding the sugar-1 , 4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector
- the one or more nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes comprise a second expression vector.
- nucleic acids encoding the sugar- 1 , 4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase and the one or more ascorbate-dependent biosynthetic enzymes comprise a single expression vector.
- separate expression vectors are provided encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes
- the invention provides methods of making a post- translationally hydroxylated recombinant protein comprising expressing in a bacterial cell as disclosed herein one or more nucleic acids encoding a peptide or protein to be hydroxylated.
- the ascorbate-dependent biosynthetic is a hydroxylase, and in particular embodiments, the hydroxylase is prolyl-4- hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
- the invention provides post-translationally hydroxylated recombinant collagen molecules or molecule comprising a collagenous domain produced by a method comprising the step of co-expressing in a bacterial cell as disclosed herein one or more nucleic acids encoding collagen or a molecule comprising a collagenous domain, one or more nucleic acids encoding a sugar-1 ,4- lactone oxidase or a sugar-1 ,4-lactone dehydrogenase, and one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme, wherein the ascorbate-dependent biosynthetic enzyme is a hydroxylase, particularly prolyl-4- hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
- the invention provides Gram-negative bacterial cells as disclosed herein capable of expressing recombinant proteins comprising one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme or an ascorbate-analog-dependent biosynthetic enzyme, wherein the enzyme is expressed in the periplasmic space of the bacterial cell, and wherein ascorbate or an ascorbate analog is supplied exogenously.
- the ascorbate- dependent biosynthetic enzyme is a hydroxylase, and in particular embodiments, the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
- kits for producing post- translationally hydroxylated recombinant proteins comprising bacterial cells as disclosed herein, and, optionally, instructions for use.
- the invention provides methods of making a post- translationally hydroxylated recombinant protein comprising a) providing nucleic acids encoding said protein and one or more nucleic acids encoding one or more ascorbate-dependent biosynthetic enzyme or ascorbate-analog-dependent biosynthetic enzyme, b) co-expressing in the periplasmic space of a Gram-negative bacterial cell said protein and one or more ascorbate-dependent biosynthetic enzyme or ascorbate-analog-dependent biosynthetic enzyme, and c) providing ascorbate or an ascorbate analog exogenously to the cell.
- the ascorbate-dependent biosynthetic enzyme is a hydroxylase
- the hydroxylase is prolyl- -hydroxylase or a combination of prolyl-4- hydroxylase and lysyl-5-hydroxylase.
- the invention provides for an engineered bacterial cell- based system that is capable of producing post-translationally hydroxylated recombinant proteins comprising:
- nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase
- nucleic acids present either as plasmids or potentially, as genes inserted directly into the bacterial genome, which encode an ascorbate-dependent biosynthetic enzyme.
- one or more of the nucleic acids encoding the sugar-1 ,4-lactone oxidase, the one or more ascorbate-dependent biosynthetic enzyme, and the peptide or protein to be hydroxylated are incorporated into the bacterial chromosome.
- the hydroxylated recombinant proteins of the disclosed methods and products comprise a collagenous domain that is sufficiently hydroxylated to form a triple-helical structure.
- the disclosed methods and products comprise a hydroxylated recombinant protein comprising a foldon domain of SEQ ID NO: 61.
- the foldon domain is fused to a terminus of the hydroxylated recombinant protein and facilitates self-assembly of the protein into a triple-helical structure.
- the bacterial cells of the products and methods of the invention are Escherichia coli, Bacillus spp., or Pseudomonas aeruginosa cells.
- Certain embodiments of the bacterial cells provided herein comprise a nucleic acid encoding a first hydroxylase, particularly prolyl-4-hydroxylase and a second nucleic acid encoding a second hydroxylase, particularly lysyl-5-hydroxylase and another nucleic acid encoding a protein having a collagenous domain, in particular adiponectin and specifically human adiponectin, wherein said nucleic acids can comprise one or a plurality of expression vectors in any advantageous combination.
- said cells further comprise a nucleic acid encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase comprising a separate expression vector or in advantageous combination with any of the other nucleic acids.
- the bacterial cells provided herein comprise a nucleic acid encoding a first hydroxylase, particularly prolyl-4-hydroxylase and a second nucleic acid encoding a second hydroxylase, particularly lysyl-5-hydroxylase and another nucleic acid encoding a protein having a collagenous domain, in particular adiponectin and specifically human adiponectin, wherein said nucleic acids can comprise one or a plurality of expression vectors in any advantageous combination.
- said cells further comprise a nucleic acid encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase comprising a separate expression vector or in advantageous combination with any of the other nucleic acids.
- the bacterial cells provided herein comprise a nucleic acid encoding a first hydroxylase, particularly prolyl-4-hydroxylase and a second nucleic acid encoding a second hydroxylase, particularly lysyl-5- hydroxylase and another nucleic acid encoding a protein having a collagenous domain, in particular adiponectin and specifically human adiponectin, wherein said nucleic acids can comprise one or a plurality of expression vectors in any advantageous combination.
- said cells further comprise a nucleic acid encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase comprising a separate expression vector or in advantageous combination with any of the other nucleic acids.
- the bacterial cells provided herein comprise a nucleic acid encoding a first hydroxylase, particularly prolyl-4-hydroxylase and a second nucleic acid encoding a second hydroxylase, particularly lysyl-5-hydroxylase and another nucleic acid encoding a protein having a collagenous domain, in particular adiponectin and specifically human adiponectin, wherein said nucleic acids can comprise one or a plurality of expression vectors in any advantageous combination.
- said cells further comprise a nucleic acid encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase comprising a separate expression vector or in advantageous combination with any of the other nucleic acids.
- Certain embodiments of the post-translationally hydroxylated recombinant molecule comprising a collagen domain provided herein comprise adiponectin.
- the protein comprising a collagenous domain is adiponectin.
- Figure 1 shows a matrix-assisted laser desorption/ionization (MALDI) mass spectrum of gluththione-S-transferase-(proline-proline-glycine) 5 (GST-(PPG) 5 ), expressed in E. coli Origami2 cells without P4H.
- MALDI matrix-assisted laser desorption/ionization
- Figure 2 shows a MALDI mass spectrum of PPG 5 without P4H co- incubation, expressed in Origami 2 (DE3) competent cells and purified on glutathione agarose resin.
- Peak 1 glycine-serine-(PPG) 5 +H + (GS(PPG) 5 +H + );
- Peak 2 GS(PPG) 5 +Na + ;
- Peak 3 GS(PPG) 5 +Na + + Na.
- Figure 3 shows a MALDI mass spectrum of PPG 5 with P4H incubation, expressed in Origami 2 (DE3) competent cells and purified on glutathione agarose resin.
- Peak 1 GS(PPG) 5 +H +
- Peak 2 GS(PPG) 5 +OH+H +
- Peak 3 GS(PPG) 5 +Na +
- Peak 4 GS(PPG) 5 +OH+Na +
- Peak 5 GS(PPG) 5 +20H+Na +
- Peak 6 GS(PPG) 5 +OH+Na + + Na
- Peak 7 GS(PPG) 5 +30H+Na +
- Peak 8 GS(PPG) 5 +20H+Na + + Na
- Peak 9 GS(PPG) 5 +30H+Na + + Na.
- Figure 4 shows liquid chromatography (LC) chromatograms from liquid chromatography-mass spectrometry (LC-MS) analyses. Top: GS(PPG) 5 ; bottom: GS(PPG) 5 incubated with P4H.
- LC liquid chromatography
- Figure 5 shows LC-MS mass spectra of peaks in Figure 4 with retention time around 8 min. Top: GS(PPG) 5 incubated with P4H; bottom: GS(PPG) 5 alone.
- Figure 6 shows a selected mass vs. retention time chromatogram of (PPG) 5 incubated with P4H. From bottom to top, (PPG) 5 , (PPG) 5 + 1 OH, (PPG) 5 + 2 OH, (PPG) 5 + 3 OH, (PPG) 5 + 4 OH. Peptides comprising a greater number of hydroxylated residues had shorter retention times.
- Figure 8 shows growth of Origami2 cells in M9 minimal media supplemented with 10 mL of 100X vitamin stock solution (0.42 g/L riboflavin, 5.4 g/L pantothenic acid, 6 g/L niacin, 1.4 g/L pyridoxine, 0.06 g/L biotin, and 0.04 g/L folic acid) per 1000 mL, 10 mL of 100X trace metal stock solution (27 g/L FeCI 3 -6H 2 0, 2 g/L ZnCI 2 4H 2 0, 2 g/L CaCI 2 -6H 2 0, 2 g/L Na 2 Mo0 4 -2H 2 0, 1.9 g/L CuSOy5H 2 0, 0.5 g/L H3BO3, and 100
- Figure 9 shows sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) of GST-(PPG) 5 after purification using glutathione resin of cultures induced at 37°C for 4h.
- SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
- Figure 10 shows SDS-PAGE of GST-(PPG) 5 after purification using glutathione resin of cultures induced at 25°C for 16h. Left to right: expression with no supplement; expression with supplement of 50 ⁇ Fe(ll)S04 and 5 mM ascorbate; expression with supplement of 100 ⁇ Fe(ll)S0 4 and 10 mM ascorbate; protein ladder.
- Figure 11 shows chromatograms of (PPG) 5 peptides cleaved from GST- (PPG)s expressed and supplemented under the indicated conditions. Mass spectrometry indicated that the (PPG) 5 peptide eluted at 8.5-8.6 min, and hydroxylated peptides eluted at retention times of 8.1 min or less. Species at 9.1 and 14.6 min are unidentified small molecules.
- Figures 12A though 12G show ultraviolet (UV) absorbance chromatograms of the GS(PPG) 5 peptide resulting from different incubation conditions.
- Figure 12A positive control ⁇ in vitro hydroxylation
- Figure 12B negative control [GST-(PPG) 5 expressed without P4H or D-arabinono-1 ,4-lactone oxidase (AL01 )]; in vivo hydroxylation of GST-(PPG) 5 in cultures incubated with Fe(ll)S0 4 and
- Figure 12C L-ascorbic acid,
- Figure 12D D-Arabinono-l,4-lactone
- Figure 12E L-Galactono-l,4-lactone
- Figure 12F L-Gulono-1 ,4-lactone, or
- Figure 12G nothing additional.
- Figures 13A though 13F show mass spectra of peaks with retention time around 8 min for in vivo hydroxylation of GS(PPG) 5 incubated with Fe(ll)S0 4 (no lactones or ascorbic acid were added).
- Figure 14 shows ALDI results of the GS(PPG) 5 peptide from cells incubated with Fe(ll)S0 , but neither lactone nor ascorbic acid.
- Peak 1 GS(PPG) 5 +H ⁇ peak 2: GS(PPG) 5 +Na +
- peak 3 GS(POG) 1 (PPG) 4 +H +
- peak 4 GS(POG) 2 (PPG) 3 +H +
- peak 5 GS(POG) 3 (PPG) 2 +H +
- peak 6 GS(POG) 2 (PPG) 3 +Na + + Na
- peak 8 GS(POG) 3 (PPG) 2 +Na + + Na
- peak 9 GS(POG) 4 (PPG) +Na + + Na
- O 4-hydroxyproline.
- Figures 15A through 15D show UV absorbance chromatograms of GS(PPG) 5 peptides from cultures expressed ( Figure 15A) in terrific broth without AL01 gene, ( Figure 15B) in terrific broth with AL01 gene, ( Figure 15C) in LB media with AL01 gene, and ( Figure 15D) in 9 minimal media plus vitamins, minerals, and 0.4% casamino acids with AL01 gene.
- Figure 16 shows the reaction catalyzed by P4H.
- P4H catalyzes the formation of peptidyl (2S,4R)-4-hydroxyproline from peptidyl L-proline and molecular oxygen.
- the catalytic Fe 2+ ion is oxidized to Fe 3+ which requires reduction by L-ascorbate for catalysis.
- Figures 17A through 17H show LC-MS analysis of (Pro-Pro-Gly)s peptides cytosolically hydroxylated in E. coli under various conditions. UV absorbance chromatograms of (Pro-Pro-Gly) 5 peptides from cultures expressing ( Figure 17A) both P4H and AL01 in: (“PA1") Terrific Broth, ("PA2”) M9 minimal media plus 0.4% tryptone and 0.4% glycerol, and (“ ⁇ 3 ⁇ ) M9 minimal media plus 0.4% tryptone.
- Figure 18 shows a plasmid map of activator/reporter plasmid pSD.COLADuet-1.GST-(PPG) 5 .AL01 (pSD1001), which encodes both P4H activator and activity reporter genes.
- the activator gene AL01 encodes the protein D- arabinono 1 ,4-lactone oxidase (AL01 ) from S. cerevisiae.
- the P4H activity reporter encodes a fusion of the affinity tag glutathione-S-transferase (GST) to the high affinity P4H substrate (Pro-Pro-Gly) 5 ((PPG) 5 ) with an intervening thrombin protease cleavage site.
- the thrombin cleavage site coincides with one of the Bam ⁇ endonuclease sites shown in the vector map.
- Figure 19 shows the relationship between hydroxylation level and the amount of tryptone in culture media. Hydroxylation levels are shown of (Pro-Pro- Gly) 5 peptides expressed in E. coli system. The culture media were M9 minimal media with different amounts of tryptone as a carbon source (0.4%, 0.8%, 1.2%, and 2.4%, respectively).
- Figures 20A and 20B show the results of an in vitro P4H activity assay. UV absorbance chromatograms are shown of (Pro-Pro-Gly)s peptides from different treatments. 0.2 mg of purified unhydroxylated GST-( Pro-Pro-Gly) 5 was incubated in 50mM Tris-HCI buffer, pH 7.8 containing bovine serum albumin (1 mg/mL), catalase (100 g/mL), dithiothreitol (100 ⁇ ), FeS0 (50 ⁇ ), ⁇ -ketoglutarate (500 ⁇ ), and P4H (1.5 ⁇ ).
- Figure 20A 2m ascorbate or Figure 20B: no ascorbate, was added to the final mixture. The reactions took place for 15 hours at 37'C. The samples were then incubated with thrombin. After boiling, the recovered peptides in the supernatant were analyzed by LC-MS.
- Figures 21 A and 21 B show triple helix formation by P4H mediated hydroxylation of collagenous peptides in E. coli.
- Figure 21A The relationship between melting temperature of (Pro-Pro-Gly) 5 -foldon and (Pro-Pro-Gly)7-foldon and hydroxylation level. Squares represent (Pro-Pro-Gly) 5 -foldon. Triangles represent (Pro-Pro-Gly) 7 -foldon.
- Figure 21 B Hydroxylation levels of (Pro-Pro-Gly) 5 , (Pro-Pro- Gly) 5 -foldon, (Pro-Pro-Gly) 7 , (Pro-Pro-Gly) 7 -foldon, (Pro-Pro-Gly) 10 , and (Pro-Pro- Gly)io-foldon constructs co-expressed with both P4H and ALO in E. coli, using M9 minimal media plus 0.4% tryptone and 0.4% glycerol. Hydroxylation level is reported as the percentage of substrate prolines (proline in the Y position of X-Y-Glycine repeats) that were hydroxylated.
- Figures 22A and 22B are schematic diagrams of plasmid maps of activator/reporter plasmid and LH3 plasmid.
- Figure 22A is a map of plasmid pSD.COLADuet-1.GST-(AQfrag).AL01 , which encodes both hydroxylase activator and activity reporter genes.
- the activator gene AL01 encodes the protein D- arabinono 1 ,4-lactone oxidase (ALO) from S. cerevisiae.
- the activity reporter encodes a fusion of the affinity tag glutathione-S-transferase (GST) to the adiponectin fragment from its collagenous domain, AQfrag, with an intervening thrombin protease cleavage site.
- the thrombin cleavage site coincides with one of the SamHI endonuclease sites shown in the vector map.
- Figure 22B is a map of plasmid pSD.CDFDuet-1.0.LH3, which encodes .the mature peptide of human LH3 (full length LH3 without the signal peptide).
- Figures 23A through 23D are schematic diagrams showing adiponectin multimer assembly and related enzymes.
- Figure 23A shows a schematic representation of adiponectin domains and multimer formation, where S-S represents disulfide bonds.
- Figure 23B assembly depends on post- translational modifications, including proline and lysine hydroxylation, which ' are catalyzed by proline and lysine hydroxylases.
- P4H hydroxylates proline residues on collagenous domains (Fig. 23B).
- LH3 is most likely involved in the post-translational modifications of lysine residues in adiponectin (Fig. 23C).
- Arabinono-1 ,4-lactone oxidase catalyses the formation of ascorbate-like molecules from sugar-1 ,4-lactones.
- ALO Arabinono-1 ,4-lactone oxidase
- D-arabinono-1 ,4-lactone is reduced by ALO to D- erythro-ascorbic acid, a 5 carbon analog of L-ascorbate (Fig. 23D).
- Figures 24A through 24F show the results of LC-MS analysis of adiponectin fragment hydroxylation.
- GST-(AQfrag) was expressed in E. coli with different co-expressed enzymes conditions: ( Figure 24A) GST-(AQfrag) only, GST- (AQfrag) co-expressed with ( Figure 24B) ALO, ( Figure 24C) P4H, (Figure 24D) both P4H and ALO, ( Figure 24E) LH3, ( Figure 24F) both LH3 and ALO.
- the AQfrag peptides were obtained after thrombin cleavage and analyzed by LC-MS.
- the calculated molecular weight of the unhydroxylated adiponectin fragment is 2988.5, and the observed mass of 1505 is the peak for the doubly charged species (+H + +Na + ).
- FIGs 25A and 25B show the results of adiponectin multimer composition analysis by SDS-PAGE and Western blotting.
- adiponectin was expressed in E. coli with different co-expressed enzymes: adiponectin only (lanes 1 , 5, 9), adiponectin co-expressed with P4H and ALO (lanes 2, 6, 10), adiponectin co-expressed with LH3 and ALO (lanes 3, 7, 11), adiponectin co-expressed with P4H, LH3, and ALO (lanes 4, 8, 12).
- adiponectin was co-expressed with P4H, LH3, and ALO under different conditions: 16 " C expression for 24 h (lane 1), 16°C expression for 48 h (lane 2), 23'C expression for 24 h (lane 3), 23'C expression for 48 h (lane 4), 30"C expression for 24 h (lane 5), 30 * C expression for 48 h (lane 6).
- FIG. 26 is a photograph showing SDS-PAGE analysis of multimer compositions using purified adiponectin.
- Adiponectin was expressed in E. coli with different co-expressed enzymes: adiponectin only (lanes 1 , 3, 5), adiponectin co- expressed with P4H, LH3, and ALO (lanes 2, 4, 6). Proteins were analyzed by SDS- PAGE under three different conditions: unboiled, unreduced; boiled, unreduced; and boiled, reduced.
- Figure 27 is a graph showing the effects of recombinant adiponectin on HUVEC viability.
- Cell death was induced by serum starvation in the presence of different concentrations of adiponectin that was produced with or without co- expressed post-translational modification enzymes (P4H, LH3, and ALO).
- P4H, LH3, and ALO post-translational modification enzymes
- FIG. 28 shows that LH3 is a multifunctional enzyme. In addition to hydroxylase activity, LH3 also possesses catalytic functions of galactosytransferase and glucosytransferase.
- Figure 29 shows in vitro His-LH3 activity assay.
- Purified, unhydroxylated GST-AQfrag fusion protein was incubated with purified His-tagged LH3 when additionally, (A) no ascorbate or (B) 2 mM ascorbate, was added to the mixture.
- the peptides AQfrag peptides were obtained after thrombin cleavage and analyzed by LC-MS.
- Manganese (II) very low levels of glucosyltransferase activity was detected, while no obvious galactosyltransferase activity was determined.
- Figure 30 show LC-MS analysis of hydroxylation pattern of (IKG) 3 .
- GST-(IKG) 3 was expressed in E. coli with different co-expressed enzymes conditions: (A) GST-(IKG) 3 only, GST-(IKG) 3 coexpressed with (B) LH3, (C) both LH3 and ALO.
- the peptides of (IKG) 3 were obtained after thrombin cleavage and analyzed by LC- MS. The calculated molecular weight of the unhydroxylated peptide is 1057, and the observed mass of 529.5 or 529.6 is the peak for the doubly charged species (+H + +H + ).
- Methods well known to those skilled in the art can be used to construct expression vectors and recombinant bacterial cells according to this invention. These methods include in vitro recombinant DNA techniques, synthetic techniques, in vivo recombination techniques, and PCR techniques. See, for example, techniques as described in Maniatis et al., 1989, MOLECULAR CLONING: A LABORATORY MANUAL, Cold Spring Harbor Laboratory, New York; Ausubel et al., 1989, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, Greene Publishing Associates and Wiley Interscience, New York, and PCR Protocols: A Guide to Methods and Applications (Innis et al., 1990, Academic Press, San Diego, CA).
- nucleic acid means one or more nucleic acids.
- the terms "polynucleotide”, “nucleotide”, “oligonucleotide”, and “nucleic acid” can be used interchangeably to refer to nucleic acid comprising DNA, RNA, derivatives thereof, or combinations thereof.
- the invention provides an engineered bacterial cell-based system that is capable of producing recombinant proteins, such as post- translationally hydroxylated recombinant proteins, comprising:
- nucleic acids encoding a sugar-1 , 4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase
- nucleic acids present either as plasmids or potentially, as genes inserted directly into the bacterial genome, which encode an ascorbate-dependent biosynthetic enzyme.
- the invention provides bacterial cells capable of expressing recombinant proteins, for example hydroxylated recombinant proteins, comprising nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4- lactone dehydrogenase that is expressed thereby, and nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes that is expressed thereby.
- the ascorbate-dependent biosynthetic enzyme is a hydroxylase, particularly a prolyl-4-hydroxylase or lysyl-5-hydroxylase or the combination thereof.
- the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector and the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase and one of the ascorbate-dependent biosynthetic enzyme comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- separate expression vectors are provided encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes.
- the bacterial cells that that can be used with the disclosed methods and products include any bacteria capable of producing a recombinant protein.
- Non- limiting examples of bacteria include Escherichia coli, Pseudomonas aeruginosa, Bacillus subtilis, and other Bacillus spp.
- the bacterial cells have a cytoplasmic environment with a relatively high reduction-oxidation (redox) potential, and are thus characterized by a relatively oxidizing cytoplasm, in order to facilitate disulfide bond formation in one or more of the recombinantly expressed proteins.
- the bacterial cells can have an oxidizing cytoplasm, inter alia, as a consequence of mutations in genes normally associated with maintaining a low redox potential in the cytoplasm, such as thioredoxin reductase (trxB) and glutathione reductase ( ⁇ .
- the bacterial cells are capable of expressing catalase, an enzyme that functions to catalyze the decomposition of hydrogen peroxide to water and oxygen.
- catalase is a eukaryotic enzyme, i.e. an enzyme produced in a eukaryotic species including species from yeast, fungi, plants, and animals.
- hydroxylation and "hydroxylated” refer to the chemical addition of a hydroxyl (-OH) group to an amino acid, most often to the side chain moiety of the amino acid.
- hydroxylated amino acids include 5-hydroxylysine, ⁇ -hydroxyaspartate ( ⁇ -hydroxyaspartic acid), and ⁇ -hydroxyasparagine.
- sugar refers to any monosaccharide or disaccharide.
- the sugar is D-arabinose, L-gulose, D- glucose, or L-galactose; in certain preferred embodiments, the sugar is D-arabinose.
- sucrose-1 , -lactone oxidase refers to any enzyme capable of catalyzing the chemical oxidation of a sugar-1 ,4-lactone, particularly those sugar-1 , 4-lactone oxidases that are involved in ascorbate biosynthesis, and capable of catalyzing the dehydrogenation of a sugar 1 ,4-lactone for the purpose of using the dehydrogenated sugar to activate the hydroxylase.
- the enzyme D-arabinono-1 ,4-lactone oxidase (AL01) catalyzes the conversion of D-arabinono-1 , 4-lactone and oxygen into D-erythro-ascorbate and hydrogen peroxide.
- the sugar-1 ,4-lactone oxidase is D- arabinono-1 , 4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4- lactone oxidase.
- the sugar-1 ,4-lactone oxidase is a eukaryotic enzyme, i.e. an enzyme produced in a eukaryotic species including without limitation species from yeast, fungi, plants, and animals, or an enzyme such as bacterial D-arabinono-1 ,4-lactone oxidase, L-gulono- 1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L- galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-
- sucrose-1 ,4-lactone dehydrogenase and “sugar dehydrogenase” can be used interchangeably to refer to any enzyme capable of catalyzing the chemical dehydrogenation or oxidation of a sugar-1 ,4-lactone or a sugar, particularly those dehydrogenases involved in ascorbate biosynthesis.
- Exemplary GenBank Accession Numbers for specific embodiments of such enzymes include: D-arabinono-1 ,4-lactone oxidase: U40390 (SEQ ID NO: 1 , nucleotide; SEQ ID NO: 2, protein), from Saccharomyces cerevisiae; L-gulono-1 ,4- lactone oxidase (L-gulono-y-lactone oxidase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-Y-lactone dehydrogenase): AY453064 (SEQ ID NO: 3, nucleotide; SEQ ID NO: 4, protein), from Mus musculus; L-galactono-1 ,4-lactone dehydrogenase (L- galactono-y-lactone dehydrogenase): NM_001125317 (SEQ ID NO: 5, nucleotide: SEQ ID NO: 6, protein), from Arabid
- the sugar-1 , 4-lactone oxidase is D-arabinono- 1 ,4-lactone oxidase (AL01), particularly Saccharomyces cerevisiae D-arabinono-1 ,4- lactone oxidase: GenBank Accession No. U40390 (SEQ ID NO: 1 , nucleotide; SEQ ID NO: 2, protein).
- ascorbate-dependent biosynthetic enzyme and “ascorbate-analog-dependent biosynthetic enzyme” can be used interchangeably to refer to any biosynthetic enzyme that is active only in the presence of ascorbate, an ascorbate-analog, ascorbic acid, or an ascorbic acid analog co-factor.
- Non-limiting examples of ascorbate-dependent biosynthetic enzymes include dopamine ⁇ -hydroxylase, peptidylglycine a-amidating monooxygenase, 4-hydroxyphenylpyruvate dioxygenase, prolyl-4-hydroxylase, prolyl- 3-hydroxylase, lysyl-5-hydroxylase, thymine 7-hydroxylase, pyrimidine deoxyribonucleoside 2'-hydroxylase, deoxyuridine (uridine) 1 '-hydroxylase, ⁇ - ⁇ - trimethyl-L-lysine hydroxylase, ⁇ -butyrobetaine hydroxylase; such enzymes are discussed, for example, in Englard and Seifter (1986), "The biochemical functions of ascorbic acid.” Annual Review of Nutrition 6: 365-406, incorporated herein by reference in its entirety.
- the ascorbate-dependent biosynthetic enzyme is a hydroxylase, such as, for example, prolyl-4-hydroxylase (P4H), prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5- hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase from mammalian species including without limitation human, mouse, rat, pig, or cow.
- P4H prolyl-4-hydroxylase
- prolyl-3-hydroxylase HIF prolyl hydroxylase
- HIF prolyl hydroxylase lysyl-5- hydroxylase
- aspartyl beta-hydroxylase asparaginyl beta-hydroxylase
- HIF asparaginyl hydroxylase from mammalian species including without limitation human, mouse, rat, pig, or cow.
- Exemplary GenBank Accession Numbers are further provided herein: wild-type human prolyl-4-hydroxylase alpha subunit: NM_000917 (SEQ ID NO: 9, nucleotide; SEQ ID NO: 10, protein); and wild-type human prolyl-4-hydroxylase beta subunit: NM_000918 (SEQ ID NO: 11 , nucleotide; SEQ ID NO: 12, protein); prolyl-3- hydroxylase, Homo sapiens: NM_018192 (SEQ ID NO: 13, nucleotide; SEQ ID NO: 14, protein); HIF prolyl hydroxylase, Homo sapiens: NM_022051 (SEQ ID NO: 15, nucleotide; SEQ ID NO: 16, protein); lysyl-5-hydroxylase (procollagen-lysine, 2- oxoglutarate 5-dioxygenase 3): NM_001084 (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) from
- the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably wild-type human prolyl-4-hydroxylase alpha subunit, GenBank Accession No. NM_000917 (SEQ ID NO: 9, nucleotide; SEQ ID NO: 10, protein); and wild-type human prolyl-4-hydroxylase beta subunit, GenBank Accession No. NM_000918 (SEQ ID NO: 11 , nucleotide; SEQ ID NO: 12, protein).
- the ascorbate-dependent biosynthetic enzyme comprises prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase alpha subunit as described in Kersteen et al., 2004, Protein Purification and Expression 38: 279-291.
- the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially- available (Origene).
- the bacterial cells further comprise one or more nucleic acids encoding a peptide or protein to be hydroxylated that is expressed by the cells.
- fraction of residues that are post-translationally hydroxylated according to the products and methods of the invention may be modulated by altering the temperature at which the host cells are grown, typically from 13 - 37 °C, with a higher fraction of hydroxylated residues occurring at higher temperatures.
- the expression constructs may be designed such that the promoter used in conjunction with the sugar-1 ,4-lactone oxidase (or dehydrogenase) is different from the promoter for the ascorbate-dependent biosynthetic enzyme, and can thus be induced differentially; for example, the nucleic acid encoding the sugar- 1 ,4-lactone oxidase can be placed under transcriptional control of the lac operon (inducible with a molecule such as IPTG (isopropyl ⁇ -D-l-thiogalactopyranoside)), whereas the nucleic acid encoding the ascorbate-dependent biosynthetic enzyme can be placed under control of the TetR repressor (which could be separately induced by the presence or absence of a molecule such as tetracycline).
- the nucleic acid encoding the sugar- 1 ,4-lactone oxidase can be placed under transcriptional control of the lac operon (inducible with a molecule such as
- transcriptional expression system such as the lac operon or TetR repressor
- the lac operon or TetR repressor may be used advantageously in conjunction with the products and methods of the invention.
- each of the one or more ascorbate-dependent biosynthetic enzymes, or the peptide or protein to be post-translationally modified it may be advantageous to have temporal control over the expression of the various gene and protein products of the invention.
- a protein which is unstable in its unhydroxylated form
- a first transcriptional expression system such as the lac operon
- a second transcriptional expression system such as the TetR repressor
- the one or more nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes and the sugar- 1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase comprise a first expression vector or a first and a second expression vector
- the one or more nucleic acids encoding the peptide or protein to be hydroxylated comprise a separate expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the one or more nucleic acids encoding the sugar- 1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector; the one or more nucleic acids encoding the one or more ascorbate- dependent biosynthetic enzymes comprise a second expression vector; and the one or more nucleic acids encoding the peptide or protein to be hydroxylated comprise a third expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and the peptide or protein to be hydroxylated comprise a first expression vector
- the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme and the peptide or protein to be hydroxylated comprise a first expression vector
- the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the nucleic acids encoding the sugar-1 ,4- lactone oxidase or sugar-1 ,4-lactone dehydrogenase, the one or more ascorbate- dependent biosynthetic enzymes, and the peptide or protein to be hydroxylated comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- separate expression vectors are provided encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes, wherein the peptide or protein to be hydroxylated comprises one or more of said separate expression vectors.
- the sugar- ,4-lactone oxidase is D- arabinono-1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4- lactone oxidase; and the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2- ketogluconate dehydrogenase.
- sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, preferably Saccharomyces cerevisiae D- arabinono-1 ,4-lactone oxidase.
- the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5- hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
- the peptide or protein to be hydroxylated is collagen.
- collagen refers to any member of a family of homotrimeric and heterotrimeric proteins found in the tissues of animals as discussed above.
- the peptide or protein to be hydroxylated comprises a collagenous domain.
- a non-limiting example of such a protein is adiponectin, particularly human adiponectin (GenBank Accession No. NM_004797, available from Fisher Thermo Scientific), wherein in such embodiments the expression vectors comprise a sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, prolyl-4-hydroxylase, prolyl-3-hydroxylase, or HIF prolyl hydroxylase, and lysyl-5-hydroxylase.
- the invention provides methods of making a post- translationally hydroxylated recombinant protein comprising expressing in a bacterial cell as disclosed herein one or more nucleic acids encoding a peptide or protein to be hydroxylated that is expressed thereby.
- the bacterial cell comprises a first expression vector comprising the one or more nucleic acids encoding the sugar- 1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase; a second expression vector comprising the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme; and a third expression vector comprising the one or more nucleic acids encoding the peptide or protein to be hydroxylated, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the bacterial cell comprises a first expression vector comprising the one or more nucleic acids encoding the sugar- 1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and the peptide or protein to be hydroxylated; and a second expression vector comprising the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the bacterial cell comprises a first expression vector comprising the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme and the peptide or protein to be hydroxylated; and a second expression vector comprising the one or more nucleic acids encoding the sugar-1 , 4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the bacterial cell comprises a first expression vector comprising the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme and the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase; and a second expression vector comprising the one or more nucleic acids encoding the peptide or protein to be hydroxylated, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the bacterial cell comprises an expression vector comprising the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase the ascorbate-dependent biosynthetic enzyme, and the peptide or protein to be hydroxylated, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- the bacterial cell comprises separate expression vectors encoding the sugar-1 , 4-lactone oxidase or sugar-1 ,4- lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes, wherein the peptide or protein to be hydroxyiated comprises one or more of said separate expression vectors, and wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising it.
- the sugar-1 ,4-lactone oxidase is D-arabinono- 1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono- 1 ,4-lactone dehydrogenase, L-gulono-v-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase.
- sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, preferably Saccharomyces cerevisiae D-arabinono-1 ,4-lactone oxidase.
- the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5- hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
- the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially- available (Origene).
- the peptide or protein to be hydroxyiated is collagen or a protein comprising a collagenous domain.
- the invention provides post-translationally hydroxyiated recombinant collagen molecules or molecules comprising a collagenous domain, produced in a bacterial cell comprising nucleic acids encoding collagen or a protein comprising a collagenous domain, nucleic acids encoding a sugar- 1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, and nucleic acids encoding one or more ascorbate-dependent biosynthetic enzymes that are co-expressed in a bacterial cell.
- nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector; the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzyme comprise a second expression vector; and the nucleic acids encoding collagen or a protein comprising a collagenous domain comprise a third expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and collagen or a protein comprising a collagenous domain comprise a first expression vector
- nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzyme comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- nucleic acids encoding one or more the ascorbate-dependent biosynthetic enzyme and collagen or a protein comprising a collagenous domain comprise a first expression vector
- nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar- 1 ,4-lactone dehydrogenase, the one or more ascorbate-dependent biosynthetic enzyme, and collagen or protein comprising a collagenous domain comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- separate expression vectors are provided encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes, wherein collagen or a protein comprising a collagenous domain comprises one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the sugar-1 , 4-lactone oxidase is D-arabinono- 1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono- 1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase.
- sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, preferably Saccharomyces cerevisiae D-arabinono-1 ,4-lactone oxidase.
- the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5- hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
- the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially available (Origene).
- DNA encoding any collagen monomer such as a1 (I) (GenBank Accession No. N _000088; SEQ ID NOS: 40 [nucleotide] and 41 [amino acid]), o2(l) (GenBank Accession No. NM_000089; SEQ ID NOS: 42 [nucleotide] and 43 [amino acid]), a1 (ll) (GenBank Accession No. NM_001844; SEQ ID NOS: 44 [nucleotide] and 45 [amino acid]), a1 (lll) (GenBank Accession No.
- NM_001168249 SEQ ID NOS: 54 [nucleotide] and 55 [amino acid]
- a2(XI) GenBank Accession No. NM_001163771
- collagen monomers or protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific), can be used advantageously in the products and methods of the disclosure.
- DNA can be obtained by any method from any source known in the art, such as isolation from cDNA or genomic libraries, amplification from an available template, or chemical synthesis. Using methods known in the art, de novo synthesis or modification of an existing DNA can also be used to produce DNA encoding variants.
- DNA encoding a collagen molecule, a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin or any other protein to be post-translationally hydroxylated is introduced inter alia by cloning into an expression vector.
- the particular details of the expression vector can vary according to the desired characteristics of the expression system, and to the type of host cell to be used.
- promoters and promoter/operators operative in bacterial cells such as the araB, trp, lac, gal, tac (a hybrid of the trp and lac promoter/operator), and T7, can be useful in accordance with the instant disclosure.
- the expression vector can also include a signal sequence that directs transport of the synthesized peptide into the periplasmic space; alternatively, expression can be directed intracellularly.
- said promoters and promoter/operators are inducible by inducer molecules including, inter alia, IPTG and tetracycline.
- the expression vector can also comprise a marker that enables host cells containing the expression construct (a "selectable marker") to be selected.
- a selectable marker can be a resistance gene, such as an antibiotic resistance gene (e.g., the neo r gene which confers resistance to the antibiotic gentamycin), or it can be a gene which complements an auxotrophy of the host cell.
- the expression construct can also contain sequences which act as an "ARS" (autonomous replicating sequence) that permit the expression construct to replicate in the host cell without being integrated into the host cell chromosome. Origins of replication for bacterial plasmids are well known. So, for example, the expression construct can also comprise an ARS ("ori”) as well as a selectable marker useful for selection transformed cells.
- ARS autonomous replicating sequence
- the invention provides Gram-negative bacterial cells capable of expressing recombinant proteins, for example hydroxylated recombinant proteins, comprising nucleic acids encoding an ascorbate-dependent biosynthetic enzyme or an ascorbate-analog-dependent biosynthetic enzyme, wherein the enzyme is expressed in the periplasmic space of the bacterial cell, and wherein exogenous ascorbate or an ascorbate analog is supplied to the cell. Since the bacterial periplasm is a relatively oxidizing environment, this aspect of the disclosure supplants the use, in some embodiments, of a bacterial strain with a relatively oxidizing cytoplasmic environment.
- periplasmic expression of an ascorbate- dependent or ascorbate-analog-dependent biosynthetic enzyme such as prolyl-4- hydroxylase enables hydroxylation of a recombinantly expressed protein without concomitant expression of a sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, since ascorbate supplied in the growth medium can accumulate in the periplasm and can thus activate the periplasmically expressed biosynthetic enzyme.
- the Gram-negative bacterial cells further comprise one or more nucleic acids encoding a peptide or protein to be hydroxylated, wherein the peptide or protein to be hydroxylated is expressed in the periplasmic space of the bacterial cell.
- the one or more nucleic acids encoding the one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes comprise a first expression vector
- the one or more nucleic acids encoding the peptide or protein to be hydroxylated comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- nucleic acids encoding the one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes and the peptide or protein to be hydroxylated comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- separate expression vectors are provided encoding each of the ascorbate-dependent biosynthetic enzymes, wherein the protein or peptide to be hydroxylated comprise one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5-hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta- hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
- the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially available (Origene).
- the peptide or protein to be hydroxylated is collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. N _004797 and commercially available from Fisher Thermo Scientific).
- the Gram-negative bacterial cells further comprise nucleic acids encoding a peptide or protein to be hydroxylated, wherein the peptide or protein to be hydroxylated is expressed in the periplasmic space of the bacterial cell.
- nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes comprise a first expression vector
- nucleic acids encoding the peptide or protein to be hydroxylated comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes ' and the peptide or protein to be hydroxylated comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- separate expression vectors are provided encoding each of the ascorbate-dependent biosynthetic enzymes, wherein the protein or peptide to be hydroxylated comprise one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the peptide or protein to be hydroxylated is ° collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific).
- the invention provides methods of making a post- translationally hydroxylated recombinant protein comprising the step of co-expressing in the periplasmic space of a Gram-negative bacterial cell nucleic acids encoding said protein and nucleic acids encoding one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes, and further comprising providing exogenous ascorbate or an exogenous ascorbate analog to the cell.
- the nucleic acids encoding the one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes comprise a first expression vector
- the nucleic acids encoding the protein comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the nucleic acids encoding the one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes and the protein comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- separate expression vectors are provided encoding each of the ascorbate-dependent biosynthetic enzymes, wherein the protein or peptide to be hydroxylated comprise one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the protein is collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific).
- the invention provides post-translationally hydroxylated recombinant collagen molecules or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. N _004797 and commercially available from Fisher Thermo Scientific), produced in a Gram-negative bacterial host cell co- expressing nucleic acids encoding said collagen molecules or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) and one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme.
- the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzymes comprise a first expression vector, and the nucleic acids encoding the collagen molecule or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes and the collagen molecule or a protein comprising a collagenous domain comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme comprise a first expression vector
- the nucleic acid encoding the protein to be hydroxylated comprises a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes and the protein comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
- separate expression vectors are provided encoding each of the ascorbate-dependent biosynthetic enzymes, wherein the protein or peptide to be hydroxylated comprise one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
- the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5-hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta- hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
- the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5-hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta- hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
- the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially available (Origene).
- the invention provides kits for producing a post- translationally hydroxyiated recombinant protein comprising a bacterial cell of the disclosure.
- the bacterial cells provided in said kits can be cells comprising one or more recombinant expression constructs encoding one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzyme and a sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase.
- the bacteria can additionally comprise one or more recombinant expression constructs encoding a protein to be post-translationally hydroxyiated; in particular embodiments, the protein is collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No.
- the cells can be cells comprising one or more recombinant expression constructs encoding one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes, and optionally can further comprise one or more recombinant expression constructs encoding a protein to be post-translationally hydroxyiated; in particular embodiments, the protein is collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific).
- the kit can further contain instructions.
- the disclosed hydroxyiated recombinant proteins comprise a collagenous domain that is sufficiently hydroxyiated to form a triple-helical structure. Without any hydroxylation of collagen Y-position prolyl residues into 4-hydroxyproline, collagen chains will not properly or stably assemble into their triple-helical conformation at 37°C. If hydroxylation does not occur, the polypeptides remain non-helical, are poorly secreted by cells, and cannot self-assemble into collagen fibrils.
- the hydroxyiated recombinant proteins comprise a collagenous domain, and an appropriate or sufficiently large number or fraction of Y-position prolyl residues within the collagenous domain are hydroxyiated such that the collagenous domain forms a triple-helical structure.
- said protein comprising a collagenous domain is adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific).
- the disclosed methods and products comprise a hydroxyiated recombinant protein comprising a foldon domain of SEQ ID NO: 61.
- the foldon domain is fused to a terminus of the hydroxylated recombinant protein and facilitates self-assembly of the protein into a triple-helical structure.
- the "foldon domain” is the C-terminal domain of T4 fibritin, which is a triple-stranded coiled-coil protein that forms the "whiskers" of bacteriophage T4.
- the fibritin foldon domain serves as a registration motif that is both necessary and sufficient to promote the trimerization of fibritin. As such, it can be used as an artificial trimerization domain.
- the native structure of the foldon domain comprises a small, 27-residue trimeric ⁇ -hairpin propeller. It has been shown to successfully promote the trimerization of engineered protein systems such as short collagen fibers (Frank et al., 2001 , J. Mol. Biol.
- the invention provides engineered bacterial cell-based systems capable of expressing recombinant proteins, for example hydroxylated recombinant proteins, comprising:
- nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase
- nucleic acids encoding an ascorbate-dependent biosynthetic enzyme
- nucleic acids are either genes inserted into the bacterial genome or plasmids.
- the expression vectors of the disclosure are introduced into the bacterial host cells by any method known to the art, such as calcium chloride-mediated transfection, ele.ctroporation or otherwise. After transfection, host cells comprising the expression vector or vectors can be selected on the basis of one or more selectable markers that are included in the expression vector(s).
- a selectable marker is an antibiotic resistance gene
- the transfected host cell population can be cultured in the presence of an antibiotic to which resistance is conferred by the selectable marker.
- the antibiotic kills or inhibits the growth of those cells that do not carry the resistance gene, and permit proliferation of those host cells that carry the resistance gene and the associated expression construct.
- a selectable marker is a gene which complements an auxotrophy of the host cells
- the transfected host cell population can be cultivated in the absence of the compound for which the host cells are auxotrophic. The cells that carry the complementing gene can be able to proliferate under such growth conditions and can also presumably carry the rest of the expression construct.
- host cells can be cloned according to any appropriate method known in the art.
- microbial host cells can be plated on solid media under selection conditions, after which single clones can be selected for further selection, characterization, or use. This process can be repeated one or more times to enhance the stability of the expression construct within the host cell.
- recombinant host cells comprising one or more expression vectors can be cultured to expand cell numbers in any appropriate culturing apparatus known in the art, such as a shaken culture flask or a fermenter.
- the culture medium used to culture recombinant bacterial cells will depend on the identity of the bacteria.
- Culture media used for various recombinant host cells are well known in the art.
- The. culture medium generally comprises inorganic salts and compounds, amino acids, carbohydrates, vitamins and other compounds which are either necessary for the growth of the host cells or which improve the health and/or growth of the host cells.
- the bacterial host cells are Gram-negative bacterial cells and comprise one or more recombinant ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes, such as prolyl-4-hydroxylase, which is expressed in the periplasmic space of the bacteria, then vitamin C (ascorbic acid or one of its salts) or an ascorbate analog can be added to the culture medium. If ascorbic acid is added, it is generally added to a concentration of between 0.05 mM to 20 mM, preferably to a concentration of around 2 mM.
- Iron(ll) is a necessary co-factor for some ascorbate-dependent biosynthetic enzymes, such as prolyl-4-hydroxylase. Iron(ll) concentrations in growth media for proper functioning of prolyl-4-hydroxylase range from about 0.05 mM to 1 mM, and are preferably at around 0.5 mM. Many types of growth media contain enough iron(ll) for proper functioning of the hydroxylase, such that iron(ll) need not be added. In cases where the iron(ll) concentration is lower than required for proper functioning of the hydroxylase, the media should be supplemented with iron(ll).
- collagen or a protein comprising a collagenous domain a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) from the culture will depend on the host cell type and the expression construct.
- Collagen or a protein comprising a collagenous domain a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No.
- NM_004797 and commercially available from Fisher Thermo Scientific can be trapped in the cytoplasm, and in particular embodiments, collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) can be trapped in the periplasm.
- Cell walls can be removed or weakened to release collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) located in the cytoplasm or periplasm.
- Disruption can be accomplished by any means known in the art, including sonication, microfluidization, lysis in a French press or similar apparatus, or disruption by vigorous agitation/milling with glass beads. Lysis or disruption of recombinant host cells is preferably carried out in a buffer of sufficient ionic strength to allow the collagen to remain in soluble form (e.g., more than 0.1 M NaCI, and less than 4.0 M total salts including the buffer).
- a buffer of sufficient ionic strength to allow the collagen to remain in soluble form (e.g., more than 0.1 M NaCI, and less than 4.0 M total salts including the buffer).
- Recovered collagen or a protein comprising a collagenous domain a non- limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) can be purified using known techniques, where the particular technique used depends on the host cell type and the expression construct.
- solutions of recovered collagen or a protein comprising a collagenous domain a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No.
- NM_004797 and commercially available from Fisher Thermo Scientific are first clarified (if the collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) is recovered by cell disruption or lysis). Clarification is generally accomplished by centrifugation, but can also be accomplished by sedimentation and/or filtration if desired. In cases where the collagen- or protein containing a collagenous domain-containing solution contains a substantial lipid content (for example, when the collagen has been recovered by cellular lysis or disruption), the solution can also be delipidated.
- Delipidation can be accomplished by the use of an adsorbant such as diatomaceous earth or diatomite such as that sold as CELITETM 512 (AdvancedMinerals).
- diatomaceous earth or diatomite such as that sold as CELITETM 512 (AdvancedMinerals).
- CELITETM 512 AdvancedMinerals
- the collagen or collagen-domain comprising protein product can be further purified by any one or more purification techniques known in the art, including gel filtration chromatography, ion exchange chromatography (for example, cation exchange chromatography can be used to adsorb the collagen or collagen-domain comprising protein to the matrix, and anion exchange chromatography can be used to remove a contaminant from a collagen- or collagen-domain comprising protein- containing solution), affinity chromatography, hydrophobic interaction chromatography, and high-performance liquid chromatography. Additionally, solubility of collagen or collagen-domain comprising protein can be manipulated by alterations in the pH or ionic strength of the buffer.
- any one of the following manipulations can be used, singly or in combination with others to purify products of the disclosure: insolubilize collagen or collagen-domain comprising protein in low ionic strength buffers; precipitate collagen or collagen-domain comprising protein at high ionic strengths; dissolve collagen or collagen-domain comprising protein in acidic solutions; and form collagen fibrils (by assembly of trimeric monomers) in low ionic strength buffers near neutral pH (i.e., about pH 6 to 8), thereby eliminating proteins that do not precipitate at high ionic strength.
- Recovered or purified collagen can also be treated to produce gelatin by any technique known in the art, including thermal denaturation, acid treatment, alkali treatment, or any combination thereof.
- collagen or collagen-domain comprising protein produced according to the invention can be modified by crosslinking in order to stabilize the collagen triple helix, thereby improving the resistance of trimeric fibrillar collagen to thermal denaturation and proteolytic degradation.
- Methods for crosslinking collagen are known in the art.
- the collagen or collagen- domain comprising protein is resuspended in a buffered solution such as phosphate buffered saline at about 3 mg/mL, and mixed with a relatively low concentration of glutaraldehyde, preferably about 0.0025-1 % (v/v).
- the collagen/glutaraldehyde mixture is then incubated to allow crosslinking to occur, preferably at a temperature below room temperature (i.e., less than about 20 °C).
- the glutaraldehyde is preferably of high purity and contains relatively low amounts of glutaraldehyde polymer.
- one or more of the nucleic acids encoding the sugar-1 ,4-lactone oxidase, one or more of the ascorbate-dependent biosynthetic enzymes, and the peptide or protein to be hydroxylated are incorporated into the bacterial chromosome.
- Methods of incorporating nucleic acids into the bacterial chromosome are known in the art.
- the nucleic acids of the disclosure may be incorporated into a bacteriophage ⁇ vector, which may then integrate itself into the host cell's chromosome (see, for example, Sieg et al.
- nucleic acids of the disclosure may be placed into a gene cassette under the control of a promoter that is suitable for inserting a gene into the chromosome of a bacterium, such as the very strong bacteriophage ⁇ promoter left (PL), as disclosed in International Publication No. WO 2006/029449.
- a promoter that is suitable for inserting a gene into the chromosome of a bacterium, such as the very strong bacteriophage ⁇ promoter left (PL), as disclosed in International Publication No. WO 2006/029449.
- Example 1 Expression and purification of GST-(PPG) 5 without AL01 co- expression
- GST-(PPG) 5 (SEQ ID NO: 23; GST is glutathione S-transferase) was cloned into a pCOLADuet vector as follows(also described in Pinkas et al. (2011), "Tunable, post-translational hydroxylation of collagen domains in Escherichia coli," ACS Chem Biol. 6(4): 320-24; which is incorporated by reference herein in its entirety).
- An oligonucleotide encoding (PPG) 5 (SEQ ID NO: 24) with a BamHI restriction site at the 5' end and an ⁇ site at the 3' end with the sequence:
- the specific double-stranded DNA was then digested by BamHI and Xho ⁇ restriction endonucleases and inserted into pGEX4T-1 (GE Healthcare) in order to create a fusion of (PPG) 5 and glutathione S-transferase (GST) with an intervening thrombin protease cleavage (Novagen, Inc., San Diego, CA) site, termed herein GST-(PPG) 5 .
- GST-(PPG) 5 GST-(PPG) 5 .
- the pGEX-4T-1 vector map was obtained from GE Healthcare's website; last accessed April 2, 2010.
- DNA encoding GST-(PPG) 5 was isolated from pGEX4T-1 by PCR using primers (forward primer: CAGCTACCAT GGGTtcccct atactaggtt attggaaaat taagggcc (SEQ ID NO: 28); reverse primer: CCTGACGGGC TTGTCTGCTC CC (SEQ ID NO: 29)) that flanked regions on the 5' side of the translation initiation codon including an ⁇ /col site and the 3' side of the stop codon including a Not ⁇ site.
- the PCR fragment was digested with Nco ⁇ and Not ⁇ restriction enzymes (New England Biolabs, MA) by adding 2 units enzyme for each pg DNA, and incubating at 37°C for 2 hours.
- pSD1000 was transformed into Origami 2 cells (Novagen, Inc.) with and without human prolyl- 4-hydroxylase (P4H) co-transformation.
- the pCOLADuet-1 vector map was obtained from Novagen, Inc.'s website; last accessed April 2, 2010.
- a pET22b vector (Novagen, Inc., San Diego, CA), designated pBK1.PDI1.P4H7, was used to express human P4H, as described by Kersteen ef al. (2004, Protein Purification and Expression 38: 279-291).
- the pET22b vector map was obtained from Novagen, Inc.'s web site last accessed April 2, 2010. Briefly, cDNAs encoding the a and ⁇ subunits of human prolyl-4-hydroxylase were cloned into the same plasmid.
- both cDNAs were able to be transcribed from the same T7 promoter, with each subunit having its own ribosome binding site (rbs) for translation initiation.
- the pET22b(+) vector map was obtained from Novagen, Inc.'s website, last accessed April 2, 2010.
- cDNA encoding P4Ha(l) subunit was isolated from HeLa cells and inserted into a pBSKS vector (pBS.LF17-1).
- the pBSKS vector map was obtained from Addgene's web site last accessed April 2, 2010.
- DNA encoding P4Ha(l) was isolated from the pBS.LF17-1 vector by PCR using primers that flank regions on the 5' side of the translation initiation codon and the 3' side of the stop codon, each of which includes a SamHI restriction site.
- PCR4-TOPO vector map was obtained from Invitrogen's website, last accessed April 2, 2010.
- a site-directed mutagenesis kit (QuikChange, Stratagene, La Jolla, CA) was used to remove DNA encoding the signal sequence of P4Ha(l) according to the manufacturer's protocols.
- the resulting plasmid pBK1.PDI1.P4H5 produced the ⁇ 4 ⁇ ( ⁇ )235-534/ ⁇ enzyme (a P4H oligomer with a 32 kDa a subunit).
- a plasmid encoding the P4Ha(l) subunit alone was produced by digesting pBK1.PDI1.P4H5 with Nde ⁇ , removing the DNA fragment encoding PDI, and then ligating the vector. QuikChange mutagenesis was then applied to the resulting construct (pBK1.P4H5) to add a SamHI site to the 5' end of the pET22b(+) rbs, yielding plasmid pBK1.P4H6.
- the cells were shaken at 200 rpm at 37°C for 1 hour before plating on an LB (Luria-Bertani) agar plate containing 30 pg/mL kanamycin and 200 ⁇ g/mL ampicillin; the plate was incubated at 37°C overnight.
- LB Lia-Bertani
- P4H was prepared recombinantly in £. coli and purified by polyproline affinity chromatography followed by ion exchange chromatography.
- a positive control wherein the 4-residue peptide Ac-GFPG-NH 2 (SEQ ID NO: 30), previously shown to be capable of hydroxylation by P4H, was used as a substrate, rather than GST-(PPG) 5 , was included in these experiments.
- the negative control was GST-(PPG) 5 incubated in buffer without P4H enzyme. The reactions took place for 2 hours at 37°C.
- the positive control was boiled for 5 min to precipitate the proteins, and the peptide was recovered in the supernatant after centrifugation.
- the samples with GST-(PPG) 5 (0.1 mg/mL) were then incubated with a 5-fold excess of thrombin in Dulbecco's phosphate-buffered saline (DPBS) to cleave GST:
- DPBS Dulbecco
- Example 2 Assessment of exogenous ascorbate as a carbon source
- Origami 2 cells were able to grow on M9 supplemented with 10 mL of 100X vitamin stock solution (0.42 g/L riboflavin, 5.4 g/L pantothenic acid, 6 g/L niacin, 1.4 g/L pyridoxine, 0.06 g/L biotin, and 0.04 g/L folic acid) per 1000 mL, 10 mL of 100X trace metal stock solution (27 g/L FeCI 3 -6H 2 0, 2 g/L ZnCI 2 -4H 2 0, 2 g/L CaCI 2 -6H 2 0, 2 g/L Na 2 oCv2H 2 0, 1.9 g/L CuS0 4 5H 2 0, 0.5 g/L H 3 B0 3 , and 100 mL/L concentrated HCI) per 1000 mL, and 0.4% casamino acids (Figure 8).
- 100X vitamin stock solution (0.42 g/L riboflavin, 5.4 g/L pantothe
- PCR was amplified using PCR to obtain a specific double-stranded DNA using primers GCTAGGATCCCCGCCGGGTC (SEQ ID NO: 26) and CTAGCTCGAGTTAACCAGGC (SEQ ID NO: ' 27) and the following PCR conditions: (1) denature for 5 min at 95°C; (2) denature for 1 min at 95°C; (3) ' anneal for 1 min at 55°C; (4) elongation for 1 min at 72°C; (5) repeat steps (2) - (4) 30 times; (6) elongation for 10 min at 72°C; hold at 4°C.
- the specific double-stranded DNA was then digested by SamHI and Xho ⁇ restriction endonucleases (New England Biolabs, MA) by adding 2 units enzyme for each >g DNA, and incubating at 37°C for 2 hours. After digestion, the DNA was separated in an agarose gel, the expected band was extracted and purified by QIAquick Gel Extraction Kit (Qiagen, Valencia, CA), and the resulting amplified sequence was inserted into pGEX4T-1 in order to create a fusion of (PPG) 5 and glutathione S-transferase (GST) with an intervening thrombin protease cleavage site, termed GST-(PPG) 5 herein.
- SamHI and Xho ⁇ restriction endonucleases New England Biolabs, MA
- DNA encoding GST-(PPG) 5 was isolated from pGEX4T-1 by PCR using primers (SEQ ID NOS: 28-29) that flanked regions on the 5' side of the translation initiation codon including an Nco ⁇ site and the 3" side of the stop codon including a ⁇ /ofl site.
- the PCR fragment was digested with Nco ⁇ and ⁇ /ofl restriction enzymes (New England Biolabs, MA) by adding 2 units enzyme for each pg DNA, and incubating at 37°C for 2 hours.
- the DNA was separated in an agarose gel, the expected band was extracted and purified by QIAquick Gel Extraction Kit (Qiagen, CA), and the resulting amplified sequence was ligated into the first cloning site in the multiple cloning site (MCS) of the pCOLADuet- 1 vector (Novagen, Inc.), yielding the plasmid pSD1000.
- MCS multiple cloning site
- cDNA encoding the AL01 gene of Saccharomyces cerevisiae was amplified from genomic DNA as previously described (Lee ef a/., 1999, Appl. Environ. Microbiol. 65: 4685-7) (see SEQ ID NO: 1 for an exemplary S. cerevisiae AL01 coding sequence). Briefly, oligonucleotide primers were synthesized on the basis of the nucleotide sequence of the AL01 gene with the sequences 5'-TTTCACCATATGTCTACTATCC-3' (forward primer; SEQ ID NO: 33) and S'-AAGGATCCTAGTCGGACAACTC-S' (reverse primer; SEQ ID NO: 34).
- the primers were designed so that the amplified DNA contained the entire open reading frame of the AL01 gene with a Nde ⁇ site at the 5' end and a SamHI site at the 3' end.
- PCR was carried out with Pfu Turbo Hotstart DNA polymerase (Stratagene).
- Template genomic DNA for PCR was prepared from S. cerevisiae ATCC 44774 according to established methods (Wach et a/., 1994, "Procedures for isolating yeast DNA for different purposes," in J. R. Johnston (ed.), MOLECULAR GENETICS OF YEASTS, IRL Press: Oxford, pp. 1-16).
- the reaction mixture contained 0.5 mM each forward and reverse primer, 0.2 mM deoxynucleoside triphosphate, 2.0 mM MgS0 4 , 1X PCR buffer, and 0.5 mg of template genomic DNA and 2.5 U Pfu polymerase per 50 mL.
- the mixture was subjected to 30 cycles of 1 min denaturation at 94 0 C, 1 min annealing at 50°C, and 2 min extension at 72°C.
- PCR fragment obtained as described above was inserted into a pET19b vector (Novagen, Inc.), and then isolated from the vector by PCR using forward primer: CCCGAAAGGA AGCTCGAGTT GGCTGCTG (SEQ ID NO: 35) and reverse primer: CAGCAGCCAA CTCGAGCTTC CTTTCGGG (SEQ ID NO: 36) that introduced an Xhol site on the 3' side of the stop codon and retained the Ndel site on the 5' side.
- the pET19b vector map was obtained from Novagen, Inc.'s web site last accessed April 2, 2010.
- a site directed mutagenesis PCR was carried out on plasmid pSD1000 to remove the ⁇ site from the end of (PPG) 5 using forward primer CGTGCCTGGT TAACTGAGCG GCCGCATAATG (SEQ ID NO: 37) and reverse primer CATTATGCGG CCGCTCAGTT AACCAGGCACG (SEQ ID NO: 38).
- the AL01 fragment was digested by Nde ⁇ and Xho ⁇ restriction enzymes, and inserted into the second cloning site of the mutated plasmid pSD1000.
- the result was a pCOLADuet-1 vector that contained the GST-(PPG) 5 gene in the first MCS, and AL01 in the second MCS designated pSD1001 (the plasmid map is shown in Figure 18).
- Example 4 Protein expression, purification, and characterization
- pSD1001 (pCOLADuet-1 vector that contained the GST-(PPG) 5 gene in the first MCS, and AL01 in the second MCS) was co-transformed with pBKI.PDI1.P4H7 (encoding P4Ha(l), as described in Example 1 ) into Origami 2 (DE3) competent cells.
- pSD1001 pCOLADuet-1 vector that contained the GST-(PPG) 5 gene in the first MCS and AL01 in the second MCS
- pBKI.PDI1.P4H7 encoding P4Ha(l)
- the cells were placed on ice for 30 minutes, heat shocked at 42°C for 1 min, and then put back on ice for 2 minutes. After adding 300 pL SOC (Super Optimal broth with Catabolite repression) media, the cells were shaken at 200 rpm at 37°C for 1 hour before plating on an LB (Luria-Bertani) agar plate containing 30 pg/mL kanamycin and 200 pg/mL ampicillin; the plate was incubated at 37°C overnight.
- SOC Super Optimal broth with Catabolite repression
- a starter culture was grown from a clone overnight in LB medium supplemented with 30 pg/mL kanamycin and 200 pg/mL ampicillin.
- the starter culture was used to inoculate flasks of terrific broth culture medium with 30pg/mL kanamycin and 200 pg/mL ampicillin.
- IPTG isopropyl-1-thio-p-D-galactopyranoside
- GST-(PPG) 5 samples were then incubated with 50 U/(mg protein) of thrombin to cleave GST tags from the (PPG) 5 peptides. Due to the cleavage pattern of thrombin, the resulting peptide was GS(PPG) 5 , i.e. Gly-Ser-(Pro-Pro(/Hyp)-Gly) 5 (SEQ ID NO: 39). After 2 hours, the cleaved peptide was separated from GST by applying the proteolysis mix to a 10 kD cutoff spin concentrator and collecting the effluent.
- the cells were then lysed by sonication and the GST-(PPG) 5 was purified using glutathione affinity resin. Effluent from resin purification was concentrated and the peptide GS(PPG) 5 was released from the GST by thrombin cleavage. The released peptides were separated by collecting the flow-through of the cleavage reaction using a 10 kD cutoff filter, diluted to equal concentrations based on pre-cleavage GST-(PPG) 5 protein concentrations, and analyzed by LC-MS ( Figure 15).
- the samples were analyzed by LC-MS (Waters) equipped with a diode array detector as well as a quadrupole mass spectrometer, with a gradient of 5-95% acetonitrile over 1 hour. Quantitative determination of hydroxylation fraction was achieved by using the areas of extracted ion chromatograms. All relative ionization efficiencies (RIE) were set equal to 1 after verification that the RIE for (Pro-Hyp-Gly) 5 was great than 80% of that for (Pro-Pro- Gly) 5 by comparing the ionization peak areas with UV 2 i4nm peak area in chromatograms. The percentage of substrate prolines hydroxylated ⁇ H.
- RIE relative ionization efficiencies
- n is the number of hydroxylated substrate prolines (note: only prolines in the Y position of X-Y-Glycine repeats are considered as substrate prolines), n max is the total number of substrate prolines, and An is the peak area in extracted ion chromatograms of peptide with hydroxylated proline number of n.
- the foldon forms an obligate trimer, reducing possible network formation by keeping individual strands attached and aligned at one end, simultaneously raising the melting point of attached collagenous domains.
- AL01 was cloned into a pCOLADuet vector as follows. Genomic DNA from Saccharomyces cerevisiae (strain EBY100) was extracted using Gentra Puregene Yeast/Bact. Kit (Qiagen) according to the manufacturer's instructions. cDNA encoding AL01 was amplified from yeast genomic DNA using primers described by Lee et al. (1999, Appl Environ Microbiol 65: 4685-7), which introduced a BamH ⁇ site at the 3' end of the gene and an Nde ⁇ site at the 5' end.
- the PCR product resulting from this amplification was digested with Nde ⁇ and SamHI (all restriction enzymes from New England Biolabs) and then ligated into a pET19b vector using T4 ligase, resulting in the plasmid named "pSD.ET19b.ALO .
- PCR was performed on plasmid "pSD.ET19b.AL01" using primers 5'- CCCGAAAGGAAGCTCGAGTTGGCTGCTG-3' (SEQ ID NO: 35) and 5'- CAGCAGCCAACTCGAGCTTCCTTTCGGG-3' (SEQ ID NO: 36).
- the PCR produced a linear fragment with a Xho ⁇ site on the 3' side of the stop codon of AL01 gene while retaining the Nde ⁇ site on its 5' side.
- GST-(PPG) 5 was cloned into pCOLADuet expression vectors as follows.
- An oligonucleotide encoding (Pro-Pro-Gly) 5 (SEQ ID NO: 25) with a SamHI restriction site at the 5' end and an Xho ⁇ site at the 3' end was amplified by PCR using primers GCTAGGATCCCCGCCGGGTC (SEQ ID NO: 26) and CTAGCTCGAGTTAACCAGGC (SEQ ID NO: 27) to obtain a specific double- stranded DNA.
- the PCR product was digested with SamHI and Xho ⁇ , and ligated into vector pGEX4T-1 (GE healthcare) in order to create the fusion of (Pro-Pro-Gly) 5 to glutathione S-transferase (GST) with an intervening thrombin protease cleavage site ("pSD.GEX4T-1.GST-(PPG) 5 ").
- PCR was carried out on the plasmid "pSD.GEX4T-1.GST-(PPG) 5 °, using primers 5'-CAGCTACCAT GGGTTCCCCT ATACTAGGTT ATTGGAAAAT TAAGGGCC-3' (SEQ ID NO: 28) and 5'-CCTGACGGGC TTGTCTGCTC CC-3' (SEQ ID NO: 29) that introduced a ⁇ /col site on the 5' side of the translation initiation codon of GST-(Pro-Pro-Gly) 5 and a ⁇ /ofl site after the 3' side of the stop codon.
- the PCR fragment was digested with Nco ⁇ and Not ⁇ , and ligated into the 1 st CS of both the empty pCOLADuet-1 vector and the plasmid "pSD.COLADuet-I .O.ALOl", which created plasmids u pSD.COLADuet-1.GST-(PPG) 5 .0" and u pSD.COLADuet-1.GST-(PPG) 5 .ALOr (see Figure 18 for plasmid map), respectively.
- Stop codons were introduced just after (Pro-Pro-G
- primers were designed to contain "non-overlapping" sequences (primer-plasmid complementary) at their 3' end and "primer-primer complementary” sequences at the 5' end.
- the melting temperature of non-overlapping sequences (T m no ) was 5 to 10°C higher than the melting temperature of the primer-primer complementary sequences (T m pp). Twelve cycles of PCR were performed of the following treatment: 95°C for 1 minute, T m no -5°C for 1 minute, and 72°C for 10 minutes. The PCR cycles were followed by T m pp - 5°C for 1 minute and 72°C for 30 minutes.
- PCR mixture was incubated with Dpn ⁇ , and then transformed the PCR product mixture into NovaBlue competent cells, followed by screening the colonies to check the DNA sequence.
- primers 5'-GGCAGCGGTTATATTCCGGAAGCACCG-3' SEQ ID NO: 74
- S'-ATATAACCGCTGCCGGATCCACGCGGAACCAGATCC-S' SEQ ID NO: 75
- the proteins containing foldon were cleaved by Thrombin CleanCleaveTM Kit (Sigma), and the cleaved products were separated from GST tag and uncleaved products by applying the mixture to glutathione affinity resin and collecting the flow through.
- the peptides were then concentrated using a 3 kDa cut off Amicon protein concentrator (Millipore), heated at 95 °C for 5 minutes, and applied to a 0.2 pm spin filter microcon (Millipore) to remove possible residual protein impurities.
- the purity of the products was checked by SDS-PAGE and analytical HPLC (Waters), and the final peptide concentration was determined by measuring UV 2 8onm in Nanodrop spectrophotometer and analytical HPLC. ⁇
- a plasmid vector encoding human lysyl hydroxylase 3 (GenBank Accession No. NM_001084, obtained from Origene) (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) was prepared as follows (also described in Ding et al. (2012), "Synthesis and Assembly of Functional High Molecular Weight Adiponectin 35 Multimers in an Engineered Strain of Escherichia coli," BioMacromolecules 13: 1035- 42; which is incorporated herein by reference in its entirety). DNA encoding the mature LH3 peptide was amplified by PCR using the following primers:
- the fragment produced by this amplification introduced an Nde ⁇ restriction enzyme recognition site at the 5' end of the fragment and an Xho ⁇ site at the 3' end.
- the fragment was digested with Nde ⁇ and ⁇ and the ligated into the second MCS of the pCDFDuet-1 vector using T4 ligase, to produce the plasmid identified as pSD.CDFDuet-1.0-LH3 (shown in Figure 22B).
- a plasmid vector encoding a fragment of human adiponectin (GenBank Accession No. NM_004797, obtained from Thermo Fisher Scientific) was prepared as follows.
- a fragment of adiponectin comprising the collagenous domain was prepared by PCR from adiponectin cDNA using the following primers:
- the fragment produced by this amplification introduced a SamHI restriction enzyme recognition site at the 5' end of the fragment and a stop codon and a ⁇ /ofl site at the 3' end.
- the fragment was digested with SamHI and ⁇ /ofl and ligated into the vector pGEX4T-1 to create a vector encoding a fusion protein between the adiponectin fragment (AQ frag) and glutathione-S-transferase (GST) comprising an intervening thrombin protease cleavage site.
- the resulting plasmid was identified as pSD.GEX4T-1.GST-(AQfrag).
- This plasmid was used to introduce the GST-thrombin cleavage-AQfrag sequence into the 1 st MCS of pCOLADuet-1 by PCR amplification using the following primers:
- the fragment produced by this amplification introduced an Nco ⁇ restriction enzyme recognition site on the 5' side of the translation initiation codon of the GST-AQfrag) adiponectin protein fragment and retained the stop codon and Not ⁇ site at the 3' end of the fragment.
- the fragment was digested with ⁇ /col and ⁇ / ⁇ and ligated into the 1 st MCS of both the empty pCOLADuet-1 vector and the pSD.COLADuet-1.0-ALO1 plasmid, resulting ion the plasmids pSD.COLADuet1.GST-(AQfrag).0 and pSD.COLADuet-1.GST-(AQFrag).(AL01 ), respectively.
- a plasmid encoding human adiponectin (GenBank Accession No. NM_004797, obtained from Thermo Fisher Scientific) was prepared as follows.
- a fragment encoding adiponectin was prepared by PCR from adiponectin cDNA using the following primers:
- the fragment produced by this amplification introduced an Asc ⁇ restriction enzyme recognition site on the 5' end of the fragment and a stop codon and ⁇ / ⁇ site at the 3' end.
- the fragment was digested with Ascl and Nott and ligated after the His6 tag in the 1 st MCS of both the empty pCOLADuet-1 vector and the pSD.COLADuet-1.0- AL01 plasmid, resulting in the plasmids pSD.COLADuet1.GST-(AdipoQ).0 and pSD.COLADuet-1.His-(AdipoQ).(AL01 ), respectively.
- Example 10 Adiponectin expression, purification and characterization of hydroxylation
- a starter culture was grown overnight in LB broth supplemented with 30 pg/ml kanamycin when a pCOLADuet-1 vector construct was transformed, 200 pg/ml ampicillin when pBK1.PDI1.P4H7 was transformed, and 50 pg/ml spectinomycin when a pCDFDuet-1 vector construct was transformed.
- the starter culture was used to inoculate flasks of 1 L of the LB broth with appropriate antibiotics.
- the culture was incubated at 37 °C (250 rpm) until ODeoo reached 0.25-0.3, and then induced with 50 ⁇ isopropyl thiogalactoside (IPTG) (US Biologicals, Swampscott, MA) and simultaneously supplemented with 1 mM Fe(ll)S0 4 (Sigma), and expressed at 23 °C (250 rpm) for 14-18 h.
- IPTG isopropyl thiogalactoside
- Cells were harvested, resuspended in lysis buffer (Dulbecco's Phosphate Buffered Saline (DPBS) plus 5mM EDTA, and then lysed by sonication.
- DPBS Dulbecco's Phosphate Buffered Saline
- 5mM EDTA 5mM EDTA
- the lysate supernatants were collected after centrifugation (30,000 g, 45 min, 4°C) and incubated with glutathione affinity resin at 4°C for 1 h.
- the resin was washed with DPBS, and then the GST tagged proteins were eluted with 50 mM Tris- HCI, 10 mM reduced glutathione, pH 8.0.
- the proteins were then concentrated and buffer exchanged into DPBS using 10 kDa cut off Amicon protein concentrator.
- the concentrations of the purified proteins were determined by UV 2 80nm with a Nanodrop spectrophotometer (Thermo Scientific).
- 4 units thrombin MP Biomedical was incubated with 75 yg of protein at room temperature for 2 h in a final volume of 60 ⁇ in DPBS; the samples were then boiled and the AQfrag peptide was recovered by taking the supernatant.
- the samples were analyzed by liquid chromatography-mass spectrometry (LC-MS, Waters) equipped with a diode array detector as well as a quadrupole mass spectrometer, with a gradient of 5-95% acetonitrile over 1 h.
- LC-MS liquid chromatography-mass spectrometry
- the GST tagged AQfrag peptides were purified from cell lysates as set forth above by glutathione affinity, liberated from their purification tags by thrombin cleavage, and then analyzed by LC-MS (Fig. 24D).
- AQfrag was co-expressed with only P4H, the major peak of the fragment was unhydroxylated because ascorbate was not available for the P4H activity; P4H was activated in E. coli cytosol when ALO was also co-expressed to biosynthesize ascorbate or ascorbate analogs, as shown by the characteristic mass spectrum with m/z shifts of 8 units.
- Example 11 Analysis of Multimerization of Adiponectin expressed in E. coli
- the cultures were incubated at 37 °C (250 rpm) until ODsoo reached 0.25-0.3, and then induced with 50 ⁇ IPTG and supplemented with 1 mM Fe(ll)S0 , and expressed at 23 °C (250 rpm) for 14-18 h. Optimization of adiponectin expression was accomplished using variant induction temperatures (16°C, 23°C, and 37°C) and times (24 h and 48 h).
- HMW adiponectin was observed only when both P4H and LH3 were activated, which confirmed that both proline and lysine hydroxylation are necessary for adiponectin HMW formation. These results also showed that 23'C induction for 24 h generated adiponectin with the highest ratio of HMW multimers.
- Example 12 Recombinant adiponectin expression, purification and optimization
- the cells were resuspended in lysis buffer (50 mM NaH 2 P0 4 , 300 mM NaCI, 10 mM Imidazole, pH 8.0), and the proteins were purified with Chelating Sepharose Fast Flow nickel- charged resin under native conditions with imldazole-based competitive elution.
- the purified proteins were buffer exchanged into 1X Hank's Buffered Salt Solution (HBSS) and stored in HBSS with 15% glycerol in -80 °C after flash freezing in liquid nitrogen.
- HBSS 1X Hank's Buffered Salt Solution
- Adiponectin activity was assessed using human umbilical vein endothelial cells (HUVECs), purchased from Cell Applications (San Diego, CA); passages 3 to 5 were used in the experiments set forth herein.
- Cell viability in the presence of adiponectin was studied by MTS assay using the CellTiter 96 AQueous kit (Promega). Briefly, cells were plated at a density of 10 4 cells per well in a 96-well plate and incubated in endothelial cell growth medium for 20 h.
- the cells were washed by HBSS, and then fresh Dulbecco's Modified Eagle Medium (DMEM) containing 0.5% FBS was added to each well, supplemented with different concentrations of recombinant adiponectin.
- DMEM Dulbecco's Modified Eagle Medium
- positive controls cells were incubated with endothelial cell growth medium. After 24 h, the cells were washed with HBSS, and fresh DMEM containing 0.5% FBS was added to each well, and the 490 nm absorbance was measured with 2 h incubations with MTS. The cell death was quantified by the percentage of the decrease in 490 nm absorbance relative to positive controls. At least 3 experiments were done for the same conditions.
- Example 14 His-LH3 gene construction, expression, purification and characterization.
- the PCR mixture was incubated with Dpnl, and then transformed into NovaBlue competent cells, followed by screening the colonies to check the DNA sequence.
- the plasmid with the correct sequence of His-tagged LH3 is named pSD.CDFDuet- 1.0.His-LH3.
- the plasmid was transformed into Origami 2 (DE3) competent cells.
- the bacterial cells were cultured in LB broth with 50 pg/ml spectinomycin at 37°C. When ⁇ reached 0.6, protein expression was induced with 50 ⁇ IPTG. The cultures were shaken at 23°C overnight, and then cells pellets were harvested by centrifugation.
- the cells were resuspended in lysis buffer (50 mM NaH 2 P0 4 , 300 mM NaCI, 10 mM Imidazole, pH 8.0), and the proteins were purified with Chelating Sepharose Fast Flow nickel-charged resin under native conditions with imidazole- based competitive elution.
- lysis buffer 50 mM NaH 2 P0 4 , 300 mM NaCI, 10 mM Imidazole, pH 8.0
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
Bacterial cells capable of producing recombinant proteins, such as post- translationally hydroxylated recombinant proteins, methods and kits for producing recombinant proteins, such as post-translationally hydroxylated recombinant proteins, and particular post-translationally hydroxylated recombinant collagen molecules and molecule comprising a collagenous domain produced by the methods and cells disclosed herein are provided by this invention.
Description
PRODUCTION OF POST-TRANSLATIONALLY HYDROXYLATED RECOMBINANT PROTEINS IN BACTERIA
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Application No. 61/495,668 filed June 10, 2011 , which is incorporated herein by reference in its entirety.
SEQUENCE LISTING STATEMENT
[0002] The sequence listing is filed in this application in electronic format only and is incorporated herein by reference in its entirety. The sequence listing text file 0-099-WO2_SeqListing_ST25.txt" was created June 6, 2012, and is 509,165 byte in size.
BACKGROUND OF THE INVENTION
Field of the Invention
[0003] The present invention relates generally to the fields of cell biology, microbiology, and recombinant protein production, and particularly to bacterial cells capable of producing post-translationally hydroxylated recombinant proteins.
Description of Related Art
[0004] Collagen is an important structural, protein in animals that constitutes about 30 percent by weight of all protein in the body, and is found in the skin, tendons, ligature, vasculature, musculature, organs, teeth, bones, and other tissues. Due to its physiological ubiquity, collagen is valuable for . use in a variety of pharmaceutical, medicinal, surgical, cosmetic, and food-related applications, among others.
[0005] There are more than twenty-eight known types of naturally occurring collagenous proteins, and an even larger number of collagen monomers, each encoded by a separate gene, that make up the different collagen types in humans. The most common collagen types are I, II, III, and IV. Type-I collagen is the most abundant collagen type and is found in the skin, tendons, vasculature, ligature, organs, teeth, and bone; type-ll collagen is found mainly in cartilage and in the vitreous humor of the eye; type-Ill collagen is a major component of granulation tissue and reticular fibers, is commonly found alongside type-l collagen, and is also found in artery walls, skin, intestines, and the uterus; type-IV collagen is found in
basal lamina, in the lens of the eye, and in capillaries and nephron glomeruli. Type VI collagen is expressed by neuronal cells in the brain and has been found to be important in the injury response of neurons to the cytotoxicity of the Alzheimer's peptide, Αβι-42, so, for instance, might have therapeutic applications (Cheng et at., 2009, "Collagen VI protects neurons against Αβ toxicity," Nature Neurosci. 12: 1 19- 121). Collagenous domains are also found in both surfactant protein A and surfactant protein D, which have important immune and anti-inflammatory activities within the skin and on all mucosal surfaces in the human body, as well as in the recently discovered, blood-soluble adiponectin protein, which forms a variety of different multimers and is an important regulator of blood glucose in humans.
[0006] Structurally, fibrillar collagen protein polymers that are part of the extracellular matrix in the human body can be as long as 300 nm long and 1.5 nm in diameter and are trimers of polypeptides known as a chains, each of which folds into a left-handed polyproline helix. Together, the three a chains twist together to form a highly stable, right-handed coiled coil, also known as a triple helix. With type-l collagen (and possibly with all fibrillar collagens), each triple helix associates into a right-handed super-coil that is sometimes referred to as a collagen microfibril.
[0007] The amino acid residues within collagen alpha chains follow a regular sequence pattern, which is often Gly-Pro-Y or Gly-X-Hyp, where Hyp is (2S,4R)-4- hydroxyproline (an amino acid that is formed in vivo only by a post-translational modification of proline), and X and Y can be any amino acid residue. Gly is required at every third position because the assembly of the triple helix puts this residue at the interior (axis) of the helix, where there is no space for a side group larger than glycine's single hydrogen atom. Consequently, the rings of the Pro and Hyp residues point outward once the chain is folded into the triple helix conformation. Proper folding of the coiled-coil collagen structure is dependent in large part on Hyp residues on the surface of the a-chain helices, since the hydroxyproline hydroxyl (-OH) groups participate in hydrogen bonds that stabilize the triple helical structure, and also contribute to a key stereoelectronic effects that stabilize the collagen helix. Most collagen types contain approximately 10-20% hydroxyproline by weight. Thus, proper recombinant expression of collagen, such that stable and biomimetic folds and structures can be formed spontaneously, requires post-translational hydroxylation of a portion of proline residues to convert them to hydroxyproline residues.
[0008] Gelatin is a hydrolyzed form of collagen, generally monomeric collagen, which can be comprised of fragments of collagen rather than whole collagen. Gelatin
has a large number of applications, particularly in food, photography, and cosmetics, where it is frequently used as a gelling agent, and in pharmaceuticals, where it is frequently used for coating tablets or for making capsules.
[0009] In addition, other proteins comprise regions having collagen-like sequences that mediate multimer formation. One example is adiponectin, which is an adipokine that is abundantly present in plasma, typically at 2-30 pg/ml in humans ((Scherer, 2006, Diabetes 55(6), 1537-1545). Adiponectin has been shown in numerous studies to exert beneficial effects that can reverse metabolic disease, and so is a promising candidate for the development of new drugs to treat obesity- associated diseases such as cardiovascular dysfunction and type II diabetes mellitus. Most other adipokines increase positively with Body Mass Index, whereas interestingly, adiponectin mRNA and serum levels are found to be decreased in obese patients (Trujillo et al., 2005, J Intern Med 257:167-175). Adiponectin is shown to protect against hypertension, atherosclerosis, non-alcoholic fatty liver disease, non-alcoholic steatohepatitis, and heart failure (Okamoto et al., 2002, Circulation 106: 2767-2770; Wang & Scherer, 2008, Hypertension 51 : 8-14; Xu et al., 2003, Clin. Invest. 112: 91-100; Shibata et al., 2005, Nat. Med. 1 1 : 1096-1 103). In addition, adiponectin can increase insulin sensitivity, and exerts a protective role against chronic inflammation (Shore ef al., 2006, J. Alergy Clin. Immunol. 118: 389-395; Yamauchi ei al., 2004, Circ. Res. 94; e27-31 ). Due to its multiple beneficial effects on obesity-related metabolic and cardiovascular dysfunctions, adiponectin has attracted a lot of attention in the last decade.
[0010] Different oligomeric states of adiponectin forms have been found in circulation: low-molecular weight multimers (LMW), middle-molecular weight multimers (MMW), and high-molecular weight multimers (HMW). HMW adiponectin is the major active form for many of adiponectin's effects, such as inhibiting hepatic glucose production and suppressing apoptosis of endothelial cells (Kobayashi et al., 2004, Circ. Res. 94: e27-31 ; Tsao et al., 2002, J. Biol. Chem. 277: 29359 - 29362). Reduction in the amount of circulating HMW adiponectin has been shown to be associated with diseases like coronary artery disease and type II diabetes (Tonelli ei al., 2004, Diabetes 53: 1621-1629; Waki ei al., 2003, J. Biol. Chem. 278: 40352- 40363).
[0011] Adiponectin is composed of four domains: an N-terminal signal peptide, a variable domain that is divergent among species, a collagenous domain comprising 22 Gly-Xaa-Yaa repeats, and a C-terminal globular domain that binds to adiponectin receptors and perhaps to other serum binding partners as well (Simpson &
Whitehead, 2010, Int. J. Biochem. Cell. Biol. 42: 785-788). Adiponectin is extensively post-translationally modified, and these modifications play important roles in multimerization. Proline hydroxylation contributes to stable association of triple- helical collagenous domains (Richards er a/., 2006, Mol. Endocriniol. 20: 1673-1687). Hexamer and higher order multimer formation are mediated by the formation of disulfide bonds (Tsao et a/., 2003, J. Biol. Chem. 278: 50810-50817). Hydroxylation and glycosylation of conserved lysines in collagenous domains enable assembly of H W multimers (Wang ef a/., 2006, J. Biol. Chem. 281 : 16391-16400).
[0012] To date, however, recombinant adiponectins have been produced both in mammalian cells and Escherichia coli. However, mammalian cell production is non- ideal for broader medical applications due to yield and cost, while E. coli lacks the essential post-translational modification capabilities needed to produce a form of adiponectin that assembles into HMW multimers.
[0013] Expression of many exogenous genes is readily achievable in a variety of recombinant host-vector systems. Expression of biologically functional proteins, however, becomes difficult to obtain if the final formation of the protein requires extensive post-translational processing. Specifically, the difficulty in producing collagens using recombinant technology is due to the fact that many host cell types used for recombinant production, including in particular bacterial cells, do not possess the active hydroxylase enzyme necessary to post-translationally convert proline residues in collagen to hydroxyproline residues.
[0014] One such hydroxylase enzyme is prolyl-4-hydroxylase (P4H) that is involved in the synthesis of all collagens. The enzyme is required to hydroxylate prolyl residues to 4-hydroxyproline, for prolines that occur in the Y-position of the - Gly-X-Y- repeat sequences of collagen. Prockop et al., 1984, N. Engl. J. Med. 311 : 376-386. Unless an appropriate number (or fraction) of Y-position prolyl residues are hydroxylated to 4-hydroxyproline by P4H, the newly synthesized chains do not properly and stably assemble and fold into the natural triple-helical conformation at 37°C. Moreover, if hydroxylation does not occur, the polypeptides remain non-helical, are poorly secreted by cells, and cannot self-assemble into collagen fibrils.
[0015] US Patent No. 5,928,922 disclosed the expression of active human prolyl- 4-hydroxylase in insect cells.
[0016] US Patent Application Publication No. 2005/0164345 discloses recombinant production of human collagen in yeast, specifically Pichia spp., and insect cells.
[0017] Bacteria are used to produce many recombinant proteins, for the reasons of, inter alia, their robustness, ease, rapidity, and low cost of growth in unsupplemented or minimally supplemented media, and capacity for survival during high-density growth, which can yield large amounts of recombinant protein with cultures of relatively small volume. However, the expression of properly formed collagen triple helices in a bacterial recombinant system has not been reported. Unlike eukaryotic cells such as yeast and insect cells, bacteria are unable to produce active P4H, which requires an ascorbate co-factor that bacteria do not produce. Thus, there is a need in the art to provide a bacterial cell capable of producing properly formed collagen structures, as well as methods for successful recombinant expression of any post-translationally hydroxylated protein in bacteria; there are many possible target proteins that could be expressed in E. coli more cheaply than they are currently expressed in insect cells or yeast cells. Moreover, it is very often the case that recombinant proteins have a medical purpose. Proteins that are expressed in eukaryotic cells such as yeast cells, insect cells, or Chinese hamster ovary (CHO) cells will often be glycosylated by these cells, which can be either an advantage or a disadvantage. Glycosylation can be an advantage, when this post- translational modification is necessary for the biological activity of a protein; but it can also be a disadvantage, since the particular forms of glycosylation that are put onto recombinantly expressed proteins in these non-human eukaryotic cells can cause an immune response if they are used in humans for medicinal, surgical, or cosmetic purposes. Proteins that are expressed in bacteria are typically completely free of glycosylation, since this type of post-translational modification does not normally occur in bacteria. Hence, collagen proteins that are expressed in bacteria such as E. coli, if pure and properly folded, could be expected to be completely non- immunogenic. This could be important for many uses of these recombinantly expressed collagenous proteins.
SUMMARY OF THE INVENTION
[0018] It is against the above background that the present invention provides certain advantages and advancements over the prior art.
[0019J Although this invention is not limited to specific advantages or functionality, it is noted that the invention provides bacterial cells capable of producing recombinant proteins comprising:
a. one or more nucleic acids encoding a sugar- 1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase; and
b. one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme.
In certain embodiments, the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase. In certain other embodiments, the ascorbate-dependent biosynthetic is a hydroxylase, and in particular embodiments, the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
[0020] In various aspects of the invention the one or more nucleic acids encoding the sugar-1 , 4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector, and the one or more nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes comprise a second expression vector.
[0021] , In further aspects of the invention, the nucleic acids encoding the sugar- 1 , 4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase and the one or more ascorbate-dependent biosynthetic enzymes comprise a single expression vector.
[0022] In additional aspects, separate expression vectors are provided encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes
[0023] In another aspect, the invention provides methods of making a post- translationally hydroxylated recombinant protein comprising expressing in a bacterial cell as disclosed herein one or more nucleic acids encoding a peptide or protein to be hydroxylated. In certain other embodiments, the ascorbate-dependent biosynthetic is a hydroxylase, and in particular embodiments, the hydroxylase is prolyl-4- hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
[0024] In another aspect, the invention provides post-translationally hydroxylated recombinant collagen molecules or molecule comprising a collagenous domain produced by a method comprising the step of co-expressing in a bacterial cell as disclosed herein one or more nucleic acids encoding collagen or a molecule comprising a collagenous domain, one or more nucleic acids encoding a sugar-1 ,4- lactone oxidase or a sugar-1 ,4-lactone dehydrogenase, and one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme, wherein the
ascorbate-dependent biosynthetic enzyme is a hydroxylase, particularly prolyl-4- hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
[0025] In yet another aspect, the invention provides Gram-negative bacterial cells as disclosed herein capable of expressing recombinant proteins comprising one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme or an ascorbate-analog-dependent biosynthetic enzyme, wherein the enzyme is expressed in the periplasmic space of the bacterial cell, and wherein ascorbate or an ascorbate analog is supplied exogenously. In certain other embodiments, the ascorbate- dependent biosynthetic enzyme is a hydroxylase, and in particular embodiments, the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
[0026] In a further aspect, the invention provides kits for producing post- translationally hydroxylated recombinant proteins comprising bacterial cells as disclosed herein, and, optionally, instructions for use.
[0027] In yet another aspect, the invention provides methods of making a post- translationally hydroxylated recombinant protein comprising a) providing nucleic acids encoding said protein and one or more nucleic acids encoding one or more ascorbate-dependent biosynthetic enzyme or ascorbate-analog-dependent biosynthetic enzyme, b) co-expressing in the periplasmic space of a Gram-negative bacterial cell said protein and one or more ascorbate-dependent biosynthetic enzyme or ascorbate-analog-dependent biosynthetic enzyme, and c) providing ascorbate or an ascorbate analog exogenously to the cell. In certain other embodiments, the ascorbate-dependent biosynthetic enzyme is a hydroxylase, and in particular embodiments, the hydroxylase is prolyl- -hydroxylase or a combination of prolyl-4- hydroxylase and lysyl-5-hydroxylase.
[0028] In another aspect, the invention provides for an engineered bacterial cell- based system that is capable of producing post-translationally hydroxylated recombinant proteins comprising:
a. one or more nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase; and
b. one or more nucleic acids, present either as plasmids or potentially, as genes inserted directly into the bacterial genome, which encode an ascorbate-dependent biosynthetic enzyme.
[0029] In certain embodiments of any of the disclosed aspects, one or more of the nucleic acids encoding the sugar-1 ,4-lactone oxidase, the one or more
ascorbate-dependent biosynthetic enzyme, and the peptide or protein to be hydroxylated are incorporated into the bacterial chromosome.
[0030] In some embodiments, the hydroxylated recombinant proteins of the disclosed methods and products comprise a collagenous domain that is sufficiently hydroxylated to form a triple-helical structure.
[0031] In other embodiments, the disclosed methods and products comprise a hydroxylated recombinant protein comprising a foldon domain of SEQ ID NO: 61. In certain embodiments, the foldon domain is fused to a terminus of the hydroxylated recombinant protein and facilitates self-assembly of the protein into a triple-helical structure.
[0032] In certain embodiments, the bacterial cells of the products and methods of the invention are Escherichia coli, Bacillus spp., or Pseudomonas aeruginosa cells.
[0033] Certain embodiments of the bacterial cells provided herein comprise a nucleic acid encoding a first hydroxylase, particularly prolyl-4-hydroxylase and a second nucleic acid encoding a second hydroxylase, particularly lysyl-5-hydroxylase and another nucleic acid encoding a protein having a collagenous domain, in particular adiponectin and specifically human adiponectin, wherein said nucleic acids can comprise one or a plurality of expression vectors in any advantageous combination. In alternative embodiments, said cells further comprise a nucleic acid encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase comprising a separate expression vector or in advantageous combination with any of the other nucleic acids.
[0034] In certain embodiments of the methods of making a post-translationally hydroxylated recombinant protein comprising expressing in a bacterial cell as disclosed herein one or more nucleic acids encoding a peptide or protein to be hydroxylated, the bacterial cells provided herein comprise a nucleic acid encoding a first hydroxylase, particularly prolyl-4-hydroxylase and a second nucleic acid encoding a second hydroxylase, particularly lysyl-5-hydroxylase and another nucleic acid encoding a protein having a collagenous domain, in particular adiponectin and specifically human adiponectin, wherein said nucleic acids can comprise one or a plurality of expression vectors in any advantageous combination. In alternative embodiments, said cells further comprise a nucleic acid encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase comprising a separate expression vector or in advantageous combination with any of the other nucleic acids.
[0035] In ertain embodiments of the Gram-negative bacterial cell capable of expressing recombinant proteins comprising one or more nucleic acids encoding one or more ascorbate-dependent biosynthetic enzymes or an ascorbate-analog- dependent biosynthetic enzyme disclosed herein, the bacterial cells provided herein comprise a nucleic acid encoding a first hydroxylase, particularly prolyl-4-hydroxylase and a second nucleic acid encoding a second hydroxylase, particularly lysyl-5- hydroxylase and another nucleic acid encoding a protein having a collagenous domain, in particular adiponectin and specifically human adiponectin, wherein said nucleic acids can comprise one or a plurality of expression vectors in any advantageous combination. In alternative embodiments, said cells further comprise a nucleic acid encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase comprising a separate expression vector or in advantageous combination with any of the other nucleic acids.
[0036] In certain embodiments of the methods of making a post-translationally hydroxylated recombinant protein comprising expressing in a Gram-negative bacterial cell as disclosed herein one or more nucleic acids encoding a peptide or protein to be hydroxylated, the bacterial cells provided herein comprise a nucleic acid encoding a first hydroxylase, particularly prolyl-4-hydroxylase and a second nucleic acid encoding a second hydroxylase, particularly lysyl-5-hydroxylase and another nucleic acid encoding a protein having a collagenous domain, in particular adiponectin and specifically human adiponectin, wherein said nucleic acids can comprise one or a plurality of expression vectors in any advantageous combination. In alternative embodiments, said cells further comprise a nucleic acid encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase comprising a separate expression vector or in advantageous combination with any of the other nucleic acids.
[0037] Certain embodiments of the post-translationally hydroxylated recombinant molecule comprising a collagen domain provided herein comprise adiponectin.
[0038] In certain embodiments of the Gram-negative bacterial cell capable of producing a hydroxylated recombinant protein comprising a collagenous domain that is sufficiently hydroxylated to form a triple-helical structure, the protein comprising a collagenous domain is adiponectin.
[0039] These and other features and advantages of the present invention will be more fully understood from the following detailed description of the invention taken together with the accompanying claims. It is noted that the scope of the claims is
defined by the recitations therein and not by the specific discussion of features and advantages set forth in the present description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0040] The following detailed description of the embodiments of the present invention can be best understood when read in conjunction with the following drawings.
[0041] Figure 1 shows a matrix-assisted laser desorption/ionization (MALDI) mass spectrum of gluththione-S-transferase-(proline-proline-glycine)5 (GST-(PPG)5), expressed in E. coli Origami2 cells without P4H.
[0042] Figure 2 shows a MALDI mass spectrum of PPG5 without P4H co- incubation, expressed in Origami 2 (DE3) competent cells and purified on glutathione agarose resin. Peak 1 : glycine-serine-(PPG)5+H+ (GS(PPG)5+H+); Peak 2: GS(PPG)5+Na+; Peak 3: GS(PPG)5+Na++ Na.
[0043] Figure 3 shows a MALDI mass spectrum of PPG5 with P4H incubation, expressed in Origami 2 (DE3) competent cells and purified on glutathione agarose resin. Peak 1 : GS(PPG)5+H+; Peak 2: GS(PPG)5+OH+H+; Peak 3: GS(PPG)5+Na+; Peak 4: GS(PPG)5+OH+Na+; Peak 5: GS(PPG)5+20H+Na+; Peak 6: GS(PPG)5+OH+Na++ Na; Peak 7: GS(PPG)5+30H+Na+; Peak 8: GS(PPG)5+20H+Na++ Na; Peak 9: GS(PPG)5+30H+Na++ Na.
[0044] Figure 4 shows liquid chromatography (LC) chromatograms from liquid chromatography-mass spectrometry (LC-MS) analyses. Top: GS(PPG)5; bottom: GS(PPG)5 incubated with P4H.
[0045] Figure 5 shows LC-MS mass spectra of peaks in Figure 4 with retention time around 8 min. Top: GS(PPG)5 incubated with P4H; bottom: GS(PPG)5 alone.
[0046] Figure 6 shows a selected mass vs. retention time chromatogram of (PPG)5 incubated with P4H. From bottom to top, (PPG)5, (PPG)5 + 1 OH, (PPG)5 + 2 OH, (PPG)5 + 3 OH, (PPG)5 + 4 OH. Peptides comprising a greater number of hydroxylated residues had shorter retention times.
[0047] Figure 7 shows growth of bacterial expression strains (BLR and Origami2-Ori2, Novagen) in M9 minimal media using different carbon sources. Lactone = L-gulonoTl,4-lactone.
[0048] Figure 8 shows growth of Origami2 cells in M9 minimal media supplemented with 10 mL of 100X vitamin stock solution (0.42 g/L riboflavin, 5.4 g/L pantothenic acid, 6 g/L niacin, 1.4 g/L pyridoxine, 0.06 g/L biotin, and 0.04 g/L folic acid) per 1000 mL, 10 mL of 100X trace metal stock solution (27 g/L FeCI3-6H20, 2 g/L ZnCI2 4H20, 2 g/L CaCI2-6H20, 2 g/L Na2Mo04-2H20, 1.9 g/L CuSOy5H20, 0.5 g/L H3BO3, and 100 mlJL concentrated HCI) per 1000 mL, and 0.4% casamino acids. Asc = ascorbic acid. Lact = L-gulono-l,4-lactone.
[0049] Figure 9 shows sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) of GST-(PPG)5 after purification using glutathione resin of cultures induced at 37°C for 4h. Left to right: expression with no supplement; expression with supplement of 50 μΜ Fe(ll)S0 and 5 mM ascorbate; expression with supplement of 100 μΜ Fe(ll)S04 and 10 mM ascorbate; protein ladder.
[0050] Figure 10 shows SDS-PAGE of GST-(PPG)5 after purification using glutathione resin of cultures induced at 25°C for 16h. Left to right: expression with no supplement; expression with supplement of 50 μΜ Fe(ll)S04 and 5 mM ascorbate; expression with supplement of 100 μΜ Fe(ll)S04 and 10 mM ascorbate; protein ladder.
[0051] Figure 11 shows chromatograms of (PPG)5 peptides cleaved from GST- (PPG)s expressed and supplemented under the indicated conditions. Mass spectrometry indicated that the (PPG)5 peptide eluted at 8.5-8.6 min, and hydroxylated peptides eluted at retention times of 8.1 min or less. Species at 9.1 and 14.6 min are unidentified small molecules.
[0052] Figures 12A though 12G show ultraviolet (UV) absorbance chromatograms of the GS(PPG)5 peptide resulting from different incubation conditions. (Figure 12A) positive control {in vitro hydroxylation); (Figure 12B) negative control [GST-(PPG)5 expressed without P4H or D-arabinono-1 ,4-lactone oxidase (AL01 )]; in vivo hydroxylation of GST-(PPG)5 in cultures incubated with Fe(ll)S04 and (Figure 12C) L-ascorbic acid, (Figure 12D) D-Arabinono-l,4-lactone, (Figure 12E) L-Galactono-l,4-lactone, (Figure 12F) L-Gulono-1 ,4-lactone, or (Figure 12G) nothing additional.
[0053] Figures 13A though 13F show mass spectra of peaks with retention time around 8 min for in vivo hydroxylation of GS(PPG)5 incubated with Fe(ll)S04 (no lactones or ascorbic acid were added). Retention times (min) for each spectrum are: (Figure 13A) glutathione-S-transferase-(proline-4-hydroxyproline-glycine)s (GS(POG)s), 6.557; (Figure 13B) GS(POG)4(PPG), 6.860; (Figure 13C)
GS(POG)3(PPG)2, 7.331 , (Figure 13D) GS(POG)2(PPG)3, 7.734, (Figure 13E) GS(POG)(PPG)4, 8.138, (Figure 13F) GS(PPG)5, 8.642.
[0054] Figure 14 shows ALDI results of the GS(PPG)5 peptide from cells incubated with Fe(ll)S0 , but neither lactone nor ascorbic acid. Peak 1 : GS(PPG)5 +H\ peak 2: GS(PPG)5 +Na+, peak 3: GS(POG)1(PPG)4 +H+, peak 4: GS(POG)2(PPG)3 +H+, peak 5: GS(POG)3(PPG)2 +H+, peak 6: GS(POG)2(PPG)3 +Na++ Na, peak 7: GS(POG)4(PPG) +H+, peak 8: GS(POG)3(PPG)2 +Na++ Na, peak 9: GS(POG)4(PPG) +Na++ Na; O = 4-hydroxyproline.
[0055] Figures 15A through 15D show UV absorbance chromatograms of GS(PPG)5 peptides from cultures expressed (Figure 15A) in terrific broth without AL01 gene, (Figure 15B) in terrific broth with AL01 gene, (Figure 15C) in LB media with AL01 gene, and (Figure 15D) in 9 minimal media plus vitamins, minerals, and 0.4% casamino acids with AL01 gene.
[0056] Figure 16 shows the reaction catalyzed by P4H. P4H catalyzes the formation of peptidyl (2S,4R)-4-hydroxyproline from peptidyl L-proline and molecular oxygen. In the process the catalytic Fe2+ ion is oxidized to Fe3+ which requires reduction by L-ascorbate for catalysis.
[0057] Figures 17A through 17H show LC-MS analysis of (Pro-Pro-Gly)s peptides cytosolically hydroxylated in E. coli under various conditions. UV absorbance chromatograms of (Pro-Pro-Gly)5 peptides from cultures expressing (Figure 17A) both P4H and AL01 in: ("PA1") Terrific Broth, ("PA2") M9 minimal media plus 0.4% tryptone and 0.4% glycerol, and ("ΡΑ3η) M9 minimal media plus 0.4% tryptone. (Figure 17B) Cultures not expressing AL01 : ("NEG") expressing neither P4H nor AL01 in Terrific Broth, ("PI") expressing P4H only in Terrific Broth, ("P2") expressing P4H only in M9 minimal media plus 0.4% tryptone and 0.4% glycerol, and ("P3") expressing P4H only in M9 minimal media plus 0.4% tryptone. Arrows indicate number of hydroxylated prolines in the associated peaks as determined by quadrupole mass detection. Mass spectra of peaks with 0-5 hydroxyls are shown in Figures 1 C-17H), respectively.
[0058] Figure 18 shows a plasmid map of activator/reporter plasmid pSD.COLADuet-1.GST-(PPG)5.AL01 (pSD1001), which encodes both P4H activator and activity reporter genes. The activator gene AL01 encodes the protein D- arabinono 1 ,4-lactone oxidase (AL01 ) from S. cerevisiae. The P4H activity reporter encodes a fusion of the affinity tag glutathione-S-transferase (GST) to the high affinity P4H substrate (Pro-Pro-Gly)5 ((PPG)5) with an intervening thrombin protease
cleavage site. The thrombin cleavage site coincides with one of the Bam \ endonuclease sites shown in the vector map.
[0059] Figure 19 shows the relationship between hydroxylation level and the amount of tryptone in culture media. Hydroxylation levels are shown of (Pro-Pro- Gly)5 peptides expressed in E. coli system. The culture media were M9 minimal media with different amounts of tryptone as a carbon source (0.4%, 0.8%, 1.2%, and 2.4%, respectively).
[0060] Figures 20A and 20B show the results of an in vitro P4H activity assay. UV absorbance chromatograms are shown of (Pro-Pro-Gly)s peptides from different treatments. 0.2 mg of purified unhydroxylated GST-( Pro-Pro-Gly)5 was incubated in 50mM Tris-HCI buffer, pH 7.8 containing bovine serum albumin (1 mg/mL), catalase (100 g/mL), dithiothreitol (100μΜ), FeS0 (50 μΜ), α-ketoglutarate (500 μΜ), and P4H (1.5μΜ). Figure 20A: 2m ascorbate or Figure 20B: no ascorbate, was added to the final mixture. The reactions took place for 15 hours at 37'C. The samples were then incubated with thrombin. After boiling, the recovered peptides in the supernatant were analyzed by LC-MS.
[0061] Figures 21 A and 21 B show triple helix formation by P4H mediated hydroxylation of collagenous peptides in E. coli. Figure 21A: The relationship between melting temperature of (Pro-Pro-Gly)5-foldon and (Pro-Pro-Gly)7-foldon and hydroxylation level. Squares represent (Pro-Pro-Gly)5-foldon. Triangles represent (Pro-Pro-Gly)7-foldon. Figure 21 B: Hydroxylation levels of (Pro-Pro-Gly)5, (Pro-Pro- Gly)5-foldon, (Pro-Pro-Gly)7, (Pro-Pro-Gly)7-foldon, (Pro-Pro-Gly)10, and (Pro-Pro- Gly)io-foldon constructs co-expressed with both P4H and ALO in E. coli, using M9 minimal media plus 0.4% tryptone and 0.4% glycerol. Hydroxylation level is reported as the percentage of substrate prolines (proline in the Y position of X-Y-Glycine repeats) that were hydroxylated.
[0062] Figures 22A and 22B are schematic diagrams of plasmid maps of activator/reporter plasmid and LH3 plasmid. Figure 22A is a map of plasmid pSD.COLADuet-1.GST-(AQfrag).AL01 , which encodes both hydroxylase activator and activity reporter genes. The activator gene AL01 encodes the protein D- arabinono 1 ,4-lactone oxidase (ALO) from S. cerevisiae. The activity reporter encodes a fusion of the affinity tag glutathione-S-transferase (GST) to the adiponectin fragment from its collagenous domain, AQfrag, with an intervening thrombin protease cleavage site. The thrombin cleavage site coincides with one of the SamHI endonuclease sites shown in the vector map. Figure 22B is a map of
plasmid pSD.CDFDuet-1.0.LH3, which encodes .the mature peptide of human LH3 (full length LH3 without the signal peptide).
[0063] Figures 23A through 23D are schematic diagrams showing adiponectin multimer assembly and related enzymes. As shown, Figure 23A shows a schematic representation of adiponectin domains and multimer formation, where S-S represents disulfide bonds. Figure 23B, assembly depends on post- translational modifications, including proline and lysine hydroxylation, which' are catalyzed by proline and lysine hydroxylases. P4H hydroxylates proline residues on collagenous domains (Fig. 23B). Among the families of Iysyl hydroxylases, LH3 is most likely involved in the post-translational modifications of lysine residues in adiponectin (Fig. 23C). Arabinono-1 ,4-lactone oxidase (ALO) catalyses the formation of ascorbate-like molecules from sugar-1 ,4-lactones. In the case shown, the named reaction for ALO, D-arabinono-1 ,4-lactone is reduced by ALO to D- erythro-ascorbic acid, a 5 carbon analog of L-ascorbate (Fig. 23D).
[0064] Figures 24A through 24F show the results of LC-MS analysis of adiponectin fragment hydroxylation. GST-(AQfrag) was expressed in E. coli with different co-expressed enzymes conditions: (Figure 24A) GST-(AQfrag) only, GST- (AQfrag) co-expressed with (Figure 24B) ALO, (Figure 24C) P4H, (Figure 24D) both P4H and ALO, (Figure 24E) LH3, (Figure 24F) both LH3 and ALO. The AQfrag peptides were obtained after thrombin cleavage and analyzed by LC-MS. The calculated molecular weight of the unhydroxylated adiponectin fragment is 2988.5, and the observed mass of 1505 is the peak for the doubly charged species (+H++Na+).
[0065] Figures 25A and 25B show the results of adiponectin multimer composition analysis by SDS-PAGE and Western blotting. In Figure 25A, adiponectin was expressed in E. coli with different co-expressed enzymes: adiponectin only (lanes 1 , 5, 9), adiponectin co-expressed with P4H and ALO (lanes 2, 6, 10), adiponectin co-expressed with LH3 and ALO (lanes 3, 7, 11), adiponectin co-expressed with P4H, LH3, and ALO (lanes 4, 8, 12). After lysing by sonication in DPBS buffer, lysate supernatants were analyzed by SDS-PAGE under three different conditions: unboiled, unreduced; boiled, unreduced; and boiled, reduced. In Figure 25B, adiponectin was co-expressed with P4H, LH3, and ALO under different conditions: 16"C expression for 24 h (lane 1), 16°C expression for 48 h (lane 2), 23'C expression for 24 h (lane 3), 23'C expression for 48 h (lane 4), 30"C expression for 24 h (lane 5), 30*C expression for 48 h (lane 6).
[0066] Figure 26 is a photograph showing SDS-PAGE analysis of multimer compositions using purified adiponectin. Adiponectin was expressed in E. coli with different co-expressed enzymes: adiponectin only (lanes 1 , 3, 5), adiponectin co- expressed with P4H, LH3, and ALO (lanes 2, 4, 6). Proteins were analyzed by SDS- PAGE under three different conditions: unboiled, unreduced; boiled, unreduced; and boiled, reduced.
[0067] Figure 27 is a graph showing the effects of recombinant adiponectin on HUVEC viability. Cell death was induced by serum starvation in the presence of different concentrations of adiponectin that was produced with or without co- expressed post-translational modification enzymes (P4H, LH3, and ALO). Cell viability was determined by MTS assay.
[0068] Figure 28 shows that LH3 is a multifunctional enzyme. In addition to hydroxylase activity, LH3 also possesses catalytic functions of galactosytransferase and glucosytransferase.
[0069] Figure 29 shows in vitro His-LH3 activity assay. Purified, unhydroxylated GST-AQfrag fusion protein was incubated with purified His-tagged LH3 when additionally, (A) no ascorbate or (B) 2 mM ascorbate, was added to the mixture. The peptides AQfrag peptides were obtained after thrombin cleavage and analyzed by LC-MS. When supplementing the activity assay reaction mixture with Manganese (II), very low levels of glucosyltransferase activity was detected, while no obvious galactosyltransferase activity was determined.
[0070] Figure 30 show LC-MS analysis of hydroxylation pattern of (IKG)3.
GST-(IKG)3 was expressed in E. coli with different co-expressed enzymes conditions: (A) GST-(IKG)3 only, GST-(IKG)3 coexpressed with (B) LH3, (C) both LH3 and ALO. The peptides of (IKG)3 were obtained after thrombin cleavage and analyzed by LC- MS. The calculated molecular weight of the unhydroxylated peptide is 1057, and the observed mass of 529.5 or 529.6 is the peak for the doubly charged species (+H++H+).
[0071] Skilled artisans will appreciate that elements in the figures are illustrated for simplicity and clarity and have not necessarily been drawn to scale. For example, the dimensions of some of the elements in the figures can be exaggerated relative to other elements to help improve understanding of the embodiment(s) of the present invention.
DETAILED DESCRIPTION OF THE INVENTION
[0072] All publications, patents and patent applications cited herein are hereby expressly incorporated by reference for all purposes.
[0073] Methods well known to those skilled in the art can be used to construct expression vectors and recombinant bacterial cells according to this invention. These methods include in vitro recombinant DNA techniques, synthetic techniques, in vivo recombination techniques, and PCR techniques. See, for example, techniques as described in Maniatis et al., 1989, MOLECULAR CLONING: A LABORATORY MANUAL, Cold Spring Harbor Laboratory, New York; Ausubel et al., 1989, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, Greene Publishing Associates and Wiley Interscience, New York, and PCR Protocols: A Guide to Methods and Applications (Innis et al., 1990, Academic Press, San Diego, CA).
[0074] Before describing the present invention in detail, a number of terms will be defined. As used herein, the singular forms "a", "an", and "the" include plural referents unless the context clearly dictates otherwise. For example, reference to a "nucleic acid" means one or more nucleic acids.
[0075] It is noted that terms like "preferably", "commonly", and "typically" are not utilized herein to limit the scope of the claimed invention or to imply that certain features are critical, essential, or even important to the structure or function of the claimed invention. Rather, these terms are merely intended to highlight alternative or additional features that can or cannot be utilized in a particular embodiment of the present invention.
[0076] For the purposes of describing and defining the present invention it is noted that the term "substantially" is utilized herein to represent the inherent degree of uncertainty that can be attributed to any quantitative comparison, value, measurement, or other representation. The term "substantially" is also utilized herein to represent the degree by which a quantitative representation can vary from a stated reference without resulting in a change in the basic function of the subject matter at issue.
[0077] As used herein, the terms "polynucleotide", "nucleotide", "oligonucleotide", and "nucleic acid" can be used interchangeably to refer to nucleic acid comprising DNA, RNA, derivatives thereof, or combinations thereof.
[0078] In one aspect, the invention provides an engineered bacterial cell-based system that is capable of producing recombinant proteins, such as post- translationally hydroxylated recombinant proteins, comprising:
a. one or more nucleic acids encoding a sugar-1 , 4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase; and
b. one or more nucleic acids, present either as plasmids or potentially, as genes inserted directly into the bacterial genome, which encode an ascorbate-dependent biosynthetic enzyme.
[0079] In another aspect, the invention provides bacterial cells capable of expressing recombinant proteins, for example hydroxylated recombinant proteins, comprising nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4- lactone dehydrogenase that is expressed thereby, and nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes that is expressed thereby. In certain embodiments, the ascorbate-dependent biosynthetic enzyme is a hydroxylase, particularly a prolyl-4-hydroxylase or lysyl-5-hydroxylase or the combination thereof.
[0080] In various embodiments, the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector and the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[0081] In further embodiments, the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase and one of the ascorbate-dependent biosynthetic enzyme comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[0082] In additional embodiments, separate expression vectors are provided encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes.
[0083] The bacterial cells that that can be used with the disclosed methods and products include any bacteria capable of producing a recombinant protein. Non- limiting examples of bacteria include Escherichia coli, Pseudomonas aeruginosa, Bacillus subtilis, and other Bacillus spp.
[0084] In various embodiments, the bacterial cells have a cytoplasmic environment with a relatively high reduction-oxidation (redox) potential, and are thus
characterized by a relatively oxidizing cytoplasm, in order to facilitate disulfide bond formation in one or more of the recombinantly expressed proteins. The bacterial cells can have an oxidizing cytoplasm, inter alia, as a consequence of mutations in genes normally associated with maintaining a low redox potential in the cytoplasm, such as thioredoxin reductase (trxB) and glutathione reductase (ςοή.
[0085] In particular embodiments, the bacterial cells are capable of expressing catalase, an enzyme that functions to catalyze the decomposition of hydrogen peroxide to water and oxygen.
[0086] In other particular embodiments, catalase is a eukaryotic enzyme, i.e. an enzyme produced in a eukaryotic species including species from yeast, fungi, plants, and animals.
[0087] As used herein, the terms "hydroxylation" and "hydroxylated" refer to the chemical addition of a hydroxyl (-OH) group to an amino acid, most often to the side chain moiety of the amino acid. For example, when post-translationally hydroxylated, the amino acid proline becomes 4-hydroxy-L-proline, also known as (2S,4R)-4- hydroxyproline or hydroxyproline (Hyp). Other non-limiting examples of hydroxylated amino acids include 5-hydroxylysine, β-hydroxyaspartate (β-hydroxyaspartic acid), and β-hydroxyasparagine.
[0088] As used herein, the term "sugar" refers to any monosaccharide or disaccharide. In certain embodiments, the sugar is D-arabinose, L-gulose, D- glucose, or L-galactose; in certain preferred embodiments, the sugar is D-arabinose.
[0089] As used herein, the term "sugar-1 , -lactone oxidase" refers to any enzyme capable of catalyzing the chemical oxidation of a sugar-1 ,4-lactone, particularly those sugar-1 , 4-lactone oxidases that are involved in ascorbate biosynthesis, and capable of catalyzing the dehydrogenation of a sugar 1 ,4-lactone for the purpose of using the dehydrogenated sugar to activate the hydroxylase. For example, the enzyme D-arabinono-1 ,4-lactone oxidase (AL01) catalyzes the conversion of D-arabinono-1 , 4-lactone and oxygen into D-erythro-ascorbate and hydrogen peroxide. In certain embodiments, the sugar-1 ,4-lactone oxidase is D- arabinono-1 , 4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4- lactone oxidase.
[0090] In particular embodiments of all aspects provided by the invention, the sugar-1 ,4-lactone oxidase is a eukaryotic enzyme, i.e. an enzyme produced in a eukaryotic species including without limitation species from yeast, fungi, plants, and animals, or an enzyme such as bacterial D-arabinono-1 ,4-lactone oxidase, L-gulono-
1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L- galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L- sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase.
[0091] As used herein, the terms "sugar-1 ,4-lactone dehydrogenase" and "sugar dehydrogenase" can be used interchangeably to refer to any enzyme capable of catalyzing the chemical dehydrogenation or oxidation of a sugar-1 ,4-lactone or a sugar, particularly those dehydrogenases involved in ascorbate biosynthesis.
[0092] Exemplary GenBank Accession Numbers for specific embodiments of such enzymes include: D-arabinono-1 ,4-lactone oxidase: U40390 (SEQ ID NO: 1 , nucleotide; SEQ ID NO: 2, protein), from Saccharomyces cerevisiae; L-gulono-1 ,4- lactone oxidase (L-gulono-y-lactone oxidase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-Y-lactone dehydrogenase): AY453064 (SEQ ID NO: 3, nucleotide; SEQ ID NO: 4, protein), from Mus musculus; L-galactono-1 ,4-lactone dehydrogenase (L- galactono-y-lactone dehydrogenase): NM_001125317 (SEQ ID NO: 5, nucleotide: SEQ ID NO: 6, protein), from Arabidopsis thaliana; and 2-ketogluconate dehydrogenase (2-ketogluconate reductase)": XM_001940605 (SEQ ID NO: 7, nucleotide; SEQ ID NO: 8, protein), from Pyrenophora tritici-repentis PMC-BFP.
[0093] In particular embodiments, the sugar-1 , 4-lactone oxidase is D-arabinono- 1 ,4-lactone oxidase (AL01), particularly Saccharomyces cerevisiae D-arabinono-1 ,4- lactone oxidase: GenBank Accession No. U40390 (SEQ ID NO: 1 , nucleotide; SEQ ID NO: 2, protein).
[0094] As used herein, the terms "ascorbate-dependent biosynthetic enzyme" and "ascorbate-analog-dependent biosynthetic enzyme" can be used interchangeably to refer to any biosynthetic enzyme that is active only in the presence of ascorbate, an ascorbate-analog, ascorbic acid, or an ascorbic acid analog co-factor. Non-limiting examples of ascorbate-dependent biosynthetic enzymes include dopamine β-hydroxylase, peptidylglycine a-amidating monooxygenase, 4-hydroxyphenylpyruvate dioxygenase, prolyl-4-hydroxylase, prolyl- 3-hydroxylase, lysyl-5-hydroxylase, thymine 7-hydroxylase, pyrimidine deoxyribonucleoside 2'-hydroxylase, deoxyuridine (uridine) 1 '-hydroxylase, ε-Ν- trimethyl-L-lysine hydroxylase, γ-butyrobetaine hydroxylase; such enzymes are discussed, for example, in Englard and Seifter (1986), "The biochemical functions of
ascorbic acid." Annual Review of Nutrition 6: 365-406, incorporated herein by reference in its entirety.
[0095] In certain embodiments of all aspects provided by the invention, the ascorbate-dependent biosynthetic enzyme is a hydroxylase, such as, for example, prolyl-4-hydroxylase (P4H), prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5- hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase from mammalian species including without limitation human, mouse, rat, pig, or cow.
[0096] Exemplary GenBank Accession Numbers are further provided herein: wild-type human prolyl-4-hydroxylase alpha subunit: NM_000917 (SEQ ID NO: 9, nucleotide; SEQ ID NO: 10, protein); and wild-type human prolyl-4-hydroxylase beta subunit: NM_000918 (SEQ ID NO: 11 , nucleotide; SEQ ID NO: 12, protein); prolyl-3- hydroxylase, Homo sapiens: NM_018192 (SEQ ID NO: 13, nucleotide; SEQ ID NO: 14, protein); HIF prolyl hydroxylase, Homo sapiens: NM_022051 (SEQ ID NO: 15, nucleotide; SEQ ID NO: 16, protein); lysyl-5-hydroxylase (procollagen-lysine, 2- oxoglutarate 5-dioxygenase 3): NM_001084 (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) from Homo sapiens; aspartyl beta-hydroxylase or asparaginyl beta- hydroxylase: NM_004318 (SEQ ID NO: 19, nucleotide; SEQ ID NO: 20, protein) from Homo sapiens; and HIF asparaginyl hydroxylase: NM_017902 (SEQ ID NO: 21 , nucleotide; SEQ ID NO: 22, protein) from Homo sapiens.
[0097] In particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably wild-type human prolyl-4-hydroxylase alpha subunit, GenBank Accession No. NM_000917 (SEQ ID NO: 9, nucleotide; SEQ ID NO: 10, protein); and wild-type human prolyl-4-hydroxylase beta subunit, GenBank Accession No. NM_000918 (SEQ ID NO: 11 , nucleotide; SEQ ID NO: 12, protein).
[0098] In other particular embodiments, the ascorbate-dependent biosynthetic enzyme comprises prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase alpha subunit as described in Kersteen et al., 2004, Protein Purification and Expression 38: 279-291.
[0099] In other particular embodiments, the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially- available (Origene).
[00100] In further embodiments, the bacterial cells further comprise one or more nucleic acids encoding a peptide or protein to be hydroxylated that is expressed by the cells.
[00101] The fraction of residues that are post-translationally hydroxylated according to the products and methods of the invention may be modulated by altering the temperature at which the host cells are grown, typically from 13 - 37 °C, with a higher fraction of hydroxylated residues occurring at higher temperatures. Alternatively, the expression constructs may be designed such that the promoter used in conjunction with the sugar-1 ,4-lactone oxidase (or dehydrogenase) is different from the promoter for the ascorbate-dependent biosynthetic enzyme, and can thus be induced differentially; for example, the nucleic acid encoding the sugar- 1 ,4-lactone oxidase can be placed under transcriptional control of the lac operon (inducible with a molecule such as IPTG (isopropyl β-D-l-thiogalactopyranoside)), whereas the nucleic acid encoding the ascorbate-dependent biosynthetic enzyme can be placed under control of the TetR repressor (which could be separately induced by the presence or absence of a molecule such as tetracycline).
[00102] It is contemplated that more than one type of transcriptional expression system (such as the lac operon or TetR repressor) may be used advantageously in conjunction with the products and methods of the invention. Depending on the individual characteristics of the sugar-1 ,4-lactone dehydrogenase, each of the one or more ascorbate-dependent biosynthetic enzymes, or the peptide or protein to be post-translationally modified, it may be advantageous to have temporal control over the expression of the various gene and protein products of the invention. For example, in the case that a protein, which is unstable in its unhydroxylated form, is to be post-translationally hydroxylated in a cell of the invention, it may be advantageous to first induce the expression of each of the hydroxylases and the sugar-1 ,4-lactone dehydrogenase (together under the control of a first transcriptional expression system, such as the lac operon), and later induce the expression of the protein to be hydroxylated (under the control of a second transcriptional expression system, such as the TetR repressor) in order to minimize the amount of time the protein is present in its unhydroxylated form.
[00103] Accordingly, in certain embodiments, the one or more nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes and the sugar- 1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase comprise a first expression vector or a first and a second expression vector, and the one or more nucleic acids encoding the peptide or protein to be hydroxylated comprise a separate expression
vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00104] In other embodiments, the one or more nucleic acids encoding the sugar- 1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector; the one or more nucleic acids encoding the one or more ascorbate- dependent biosynthetic enzymes comprise a second expression vector; and the one or more nucleic acids encoding the peptide or protein to be hydroxylated comprise a third expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00105] In further embodiments, the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and the peptide or protein to be hydroxylated comprise a first expression vector, and the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00106] In yet other embodiments, the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme and the peptide or protein to be hydroxylated comprise a first expression vector, and the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00107] In yet other embodiments, the nucleic acids encoding the sugar-1 ,4- lactone oxidase or sugar-1 ,4-lactone dehydrogenase, the one or more ascorbate- dependent biosynthetic enzymes, and the peptide or protein to be hydroxylated comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[00108] In additional embodiments, separate expression vectors are provided encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes, wherein the peptide or protein to be hydroxylated comprises one or more of said separate expression vectors.
[00109] In various embodiments of this aspect, the sugar- ,4-lactone oxidase is D- arabinono-1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4- lactone oxidase; and the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-y-lactone
dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2- ketogluconate dehydrogenase. In particular embodiments the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, preferably Saccharomyces cerevisiae D- arabinono-1 ,4-lactone oxidase.
[00110] In certain other embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5- hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
[00111] In other embodiments, the peptide or protein to be hydroxylated is collagen. As used herein, the term "collagen" refers to any member of a family of homotrimeric and heterotrimeric proteins found in the tissues of animals as discussed above.
[00112] In other embodiments, the peptide or protein to be hydroxylated comprises a collagenous domain. A non-limiting example of such a protein is adiponectin, particularly human adiponectin (GenBank Accession No. NM_004797, available from Fisher Thermo Scientific), wherein in such embodiments the expression vectors comprise a sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, prolyl-4-hydroxylase, prolyl-3-hydroxylase, or HIF prolyl hydroxylase, and lysyl-5-hydroxylase.
[00113] In another aspect, the invention .provides methods of making a post- translationally hydroxylated recombinant protein comprising expressing in a bacterial cell as disclosed herein one or more nucleic acids encoding a peptide or protein to be hydroxylated that is expressed thereby.
[00114] In certain embodiments of the methods of making post-translationally hydroxylated recombinant proteins disclosed herein, the bacterial cell comprises a first expression vector comprising the one or more nucleic acids encoding the sugar- 1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase; a second expression vector comprising the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme; and a third expression vector comprising the one or more nucleic acids encoding the peptide or protein to be hydroxylated, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00115] In other embodiments of the methods of making post-translationally hydroxylated recombinant proteins disclosed herein, the bacterial cell comprises a first expression vector comprising the one or more nucleic acids encoding the sugar- 1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and the peptide or protein to be hydroxylated; and a second expression vector comprising the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00116] In other embodiments of the methods of making post-translationally hydroxylated recombinant proteins disclosed herein, the bacterial cell comprises a first expression vector comprising the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme and the peptide or protein to be hydroxylated; and a second expression vector comprising the one or more nucleic acids encoding the sugar-1 , 4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00117] In further embodiments of the methods of making post-translationally hydroxylated recombinant proteins disclosed herein, the bacterial cell comprises a first expression vector comprising the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme and the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase; and a second expression vector comprising the one or more nucleic acids encoding the peptide or protein to be hydroxylated, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00118] In still further embodiments of the methods of making post-translationally hydroxylated recombinant proteins disclosed herein, the bacterial cell comprises an expression vector comprising the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase the ascorbate-dependent biosynthetic enzyme, and the peptide or protein to be hydroxylated, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[00119] In additional embodiments of the methods of making post-translationally hydroxylated recombinant proteins disclosed herein, the bacterial cell comprises separate expression vectors encoding the sugar-1 , 4-lactone oxidase or sugar-1 ,4- lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes,
wherein the peptide or protein to be hydroxyiated comprises one or more of said separate expression vectors, and wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising it.
[00120] In certain embodiments, the sugar-1 ,4-lactone oxidase is D-arabinono- 1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono- 1 ,4-lactone dehydrogenase, L-gulono-v-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase. In particular embodiments the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, preferably Saccharomyces cerevisiae D-arabinono-1 ,4-lactone oxidase.
[00121] In further embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5- hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
[00122] In other particular embodiments, the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially- available (Origene).
[00123] In various aspects of the disclosed methods and products, the peptide or protein to be hydroxyiated is collagen or a protein comprising a collagenous domain.
[00124] In further aspect, the invention provides post-translationally hydroxyiated recombinant collagen molecules or molecules comprising a collagenous domain, produced in a bacterial cell comprising nucleic acids encoding collagen or a protein comprising a collagenous domain, nucleic acids encoding a sugar- 1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, and nucleic acids encoding one or more ascorbate-dependent biosynthetic enzymes that are co-expressed in a bacterial cell.
[00125] In particular embodiments, nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector; the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzyme comprise a second expression vector; and the nucleic acids encoding collagen or a protein comprising a collagenous domain comprise a third expression vector, wherein
each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00126] In further embodiments, nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and collagen or a protein comprising a collagenous domain comprise a first expression vector, and nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzyme comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00127] In yet further embodiments, nucleic acids encoding one or more the ascorbate-dependent biosynthetic enzyme and collagen or a protein comprising a collagenous domain comprise a first expression vector, and the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00128] In still further embodiments, nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar- 1 ,4-lactone dehydrogenase, the one or more ascorbate-dependent biosynthetic enzyme, and collagen or protein comprising a collagenous domain comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[00129] In additional embodiments, separate expression vectors are provided encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, one of the ascorbate-dependent biosynthetic enzymes and (in a separate vector) a second of the ascorbate-dependent biosynthetic enzymes, wherein collagen or a protein comprising a collagenous domain comprises one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00130] In various embodiments, the sugar-1 , 4-lactone oxidase is D-arabinono- 1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono- 1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase. In particular embodiments the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, preferably Saccharomyces cerevisiae D-arabinono-1 ,4-lactone oxidase.
[00131] In yet other certain embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5- hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
[00132] In other particular embodiments, the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially available (Origene).
[00133] DNA encoding any collagen monomer, such as a1 (I) (GenBank Accession No. N _000088; SEQ ID NOS: 40 [nucleotide] and 41 [amino acid]), o2(l) (GenBank Accession No. NM_000089; SEQ ID NOS: 42 [nucleotide] and 43 [amino acid]), a1 (ll) (GenBank Accession No. NM_001844; SEQ ID NOS: 44 [nucleotide] and 45 [amino acid]), a1 (lll) (GenBank Accession No. N _000090; SEQ ID NOS: 46 [nucleotide] and 47 [amino acid]), a1 (V) (GenBank Accession No. NM_000093; SEQ ID NOS: 48 [nucleotide] and 49 [amino acid]), a2(V) (GenBank Accession No. NM_000393; SEQ ID NOS: 50 [nucleotide] and 51 [amino acid]), a3(V) (GenBank Accession No. NM_015719; SEQ ID NOS: 52 [nucleotide] and 53 [amino acid]), a1 (XI) (GenBank Accession No. NM_001168249; SEQ ID NOS: 54 [nucleotide] and 55 [amino acid]), and a2(XI) (GenBank Accession No. NM_001163771 ; SEQ ID NOS: 56 [nucleotide] and 57 [amino acid]) collagen monomers, or protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific), can be used advantageously in the products and methods of the disclosure. DNA can be obtained by any method from any source known in the art, such as isolation from cDNA or genomic libraries, amplification from an available template, or chemical synthesis. Using methods known in the art, de novo synthesis or modification of an existing DNA can also be used to produce DNA encoding variants.
[00134] For use in this invention, DNA encoding a collagen molecule, a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin or any other protein to be post-translationally hydroxylated is introduced inter alia by cloning into an expression vector. As is well known in the art, the particular details of the expression vector can vary according to the desired characteristics of the expression system, and to the type of host cell to be used. For example, promoters and promoter/operators operative in bacterial cells,
such as the araB, trp, lac, gal, tac (a hybrid of the trp and lac promoter/operator), and T7, can be useful in accordance with the instant disclosure. The expression vector can also include a signal sequence that directs transport of the synthesized peptide into the periplasmic space; alternatively, expression can be directed intracellularly. In particular embodiments, said promoters and promoter/operators are inducible by inducer molecules including, inter alia, IPTG and tetracycline.
[00135] In particular embodiments, the expression vector can also comprise a marker that enables host cells containing the expression construct (a "selectable marker") to be selected. Selectable markers are well known in the art. For example, the selectable marker can be a resistance gene, such as an antibiotic resistance gene (e.g., the neor gene which confers resistance to the antibiotic gentamycin), or it can be a gene which complements an auxotrophy of the host cell. The expression construct can also contain sequences which act as an "ARS" (autonomous replicating sequence) that permit the expression construct to replicate in the host cell without being integrated into the host cell chromosome. Origins of replication for bacterial plasmids are well known. So, for example, the expression construct can also comprise an ARS ("ori") as well as a selectable marker useful for selection transformed cells.
[00136] In a further aspect, the invention provides Gram-negative bacterial cells capable of expressing recombinant proteins, for example hydroxylated recombinant proteins, comprising nucleic acids encoding an ascorbate-dependent biosynthetic enzyme or an ascorbate-analog-dependent biosynthetic enzyme, wherein the enzyme is expressed in the periplasmic space of the bacterial cell, and wherein exogenous ascorbate or an ascorbate analog is supplied to the cell. Since the bacterial periplasm is a relatively oxidizing environment, this aspect of the disclosure supplants the use, in some embodiments, of a bacterial strain with a relatively oxidizing cytoplasmic environment.
[00137] In particular embodiments, periplasmic expression of an ascorbate- dependent or ascorbate-analog-dependent biosynthetic enzyme such as prolyl-4- hydroxylase enables hydroxylation of a recombinantly expressed protein without concomitant expression of a sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, since ascorbate supplied in the growth medium can accumulate in the periplasm and can thus activate the periplasmically expressed biosynthetic enzyme.
[00138] In certain particular embodiments, the Gram-negative bacterial cells further comprise one or more nucleic acids encoding a peptide or protein to be hydroxylated, wherein the peptide or protein to be hydroxylated is expressed in the periplasmic space of the bacterial cell.
[00139] In further embodiments, the one or more nucleic acids encoding the one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes comprise a first expression vector, and the one or more nucleic acids encoding the peptide or protein to be hydroxylated comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00140] In yet further embodiments, the nucleic acids encoding the one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes and the peptide or protein to be hydroxylated comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[00141] In yet further embodiments, separate expression vectors are provided encoding each of the ascorbate-dependent biosynthetic enzymes, wherein the protein or peptide to be hydroxylated comprise one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00142] In further embodiments of this aspect, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5-hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta- hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
[00143] In other particular embodiments, the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially available (Origene).
[00144] In certain particular embodiments, the peptide or protein to be hydroxylated is collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. N _004797 and commercially available from Fisher Thermo Scientific).
[00145] In various embodiments, the Gram-negative bacterial cells further comprise nucleic acids encoding a peptide or protein to be hydroxylated, wherein the peptide or protein to be hydroxylated is expressed in the periplasmic space of the bacterial cell.
[00146] . In further embodiments, the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes comprise a first expression vector, and the nucleic acids encoding the peptide or protein to be hydroxylated comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00147] In yet further embodiments, the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes' and the peptide or protein to be hydroxylated comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[00148] In yet further embodiments, separate expression vectors are provided encoding each of the ascorbate-dependent biosynthetic enzymes, wherein the protein or peptide to be hydroxylated comprise one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00149] In still further embodiments, the peptide or protein to be hydroxylated is ° collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific).
[00150] In another aspect, the invention provides methods of making a post- translationally hydroxylated recombinant protein comprising the step of co-expressing in the periplasmic space of a Gram-negative bacterial cell nucleic acids encoding said protein and nucleic acids encoding one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes, and further comprising providing exogenous ascorbate or an exogenous ascorbate analog to the cell.
[00151] In particular embodiments, the nucleic acids encoding the one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes comprise a first expression vector, and the nucleic acids encoding the protein comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00152] In further embodiments, the nucleic acids encoding the one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes and the protein comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[00153] In yet further embodiments, separate expression vectors are provided encoding each of the ascorbate-dependent biosynthetic enzymes, wherein the protein or peptide to be hydroxylated comprise one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00154] In further particular embodiments, the protein is collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific).
[00155] In another aspect, the invention provides post-translationally hydroxylated recombinant collagen molecules or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. N _004797 and commercially available from Fisher Thermo Scientific), produced in a Gram-negative bacterial host cell co- expressing nucleic acids encoding said collagen molecules or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) and one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme.
[00156] In particular embodiments, the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzymes comprise a first expression vector, and the nucleic acids encoding the collagen molecule or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) comprise a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00157] In further embodiments, the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes and the collagen molecule or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No.
N _004797 and commercially available from Fisher Thermo Scientific) comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[00158] In particular embodiments, the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme comprise a first expression vector, and the nucleic acid encoding the protein to be hydroxylated comprises a second expression vector, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00159] In further embodiments, the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzymes and the protein comprise a single expression vector, wherein each of the proteins encoded by the expression vector is expressed in the cell comprising it.
[00160] In yet further embodiments, separate expression vectors are provided encoding each of the ascorbate-dependent biosynthetic enzymes, wherein the protein or peptide to be hydroxylated comprise one or more of said separate expression vectors, wherein each of the proteins encoded by each of the expression vectors is expressed in the cell comprising them.
[00161] In particular embodiments of this aspect, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5-hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta- hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
[00162] In yet further embodiments of this aspect, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, HIF prolyl hydroxylase, lysyl-5-hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta- hydroxylase, or HIF asparaginyl hydroxylase, and in particular embodiments, the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, preferably human prolyl-4-hydroxylase.
[00163] In other particular embodiments, the ascorbate-dependent biosynthetic enzyme comprises lysyl-5-hydroxylase, preferably human lysyl-5-hydroxylase identified by (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) and commercially available (Origene).
[00164] In another aspect, the invention provides kits for producing a post- translationally hydroxyiated recombinant protein comprising a bacterial cell of the disclosure. The bacterial cells provided in said kits can be cells comprising one or more recombinant expression constructs encoding one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzyme and a sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase. In alternative embodiments, the bacteria can additionally comprise one or more recombinant expression constructs encoding a protein to be post-translationally hydroxyiated; in particular embodiments, the protein is collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific). In Gram-negative bacteria embodiments thereof, the cells can be cells comprising one or more recombinant expression constructs encoding one or more ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes, and optionally can further comprise one or more recombinant expression constructs encoding a protein to be post-translationally hydroxyiated; in particular embodiments, the protein is collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific). The kit can further contain instructions.
[00165] In some embodiments of any of the disclosed methods and products, the disclosed hydroxyiated recombinant proteins comprise a collagenous domain that is sufficiently hydroxyiated to form a triple-helical structure. Without any hydroxylation of collagen Y-position prolyl residues into 4-hydroxyproline, collagen chains will not properly or stably assemble into their triple-helical conformation at 37°C. If hydroxylation does not occur, the polypeptides remain non-helical, are poorly secreted by cells, and cannot self-assemble into collagen fibrils. Thus, in particular embodiments of the disclosed methods and products, the hydroxyiated recombinant proteins comprise a collagenous domain, and an appropriate or sufficiently large number or fraction of Y-position prolyl residues within the collagenous domain are hydroxyiated such that the collagenous domain forms a triple-helical structure. In particular embodiments said protein comprising a collagenous domain is adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific).
[00166] In some embodiments of any of the aspects of the invention, the disclosed methods and products comprise a hydroxyiated recombinant protein comprising a
foldon domain of SEQ ID NO: 61. In certain embodiments of the disclosed methods and products, the foldon domain is fused to a terminus of the hydroxylated recombinant protein and facilitates self-assembly of the protein into a triple-helical structure.
[00167] As used herein, the "foldon domain" is the C-terminal domain of T4 fibritin, which is a triple-stranded coiled-coil protein that forms the "whiskers" of bacteriophage T4. The fibritin foldon domain serves as a registration motif that is both necessary and sufficient to promote the trimerization of fibritin. As such, it can be used as an artificial trimerization domain. The native structure of the foldon domain comprises a small, 27-residue trimeric β-hairpin propeller. It has been shown to successfully promote the trimerization of engineered protein systems such as short collagen fibers (Frank et al., 2001 , J. Mol. Biol. 308: 1081-1089; Stetefeld et al., 2003, Structure 11 : 339-346), HIV1 envelope glycoprotein (Yang et al., 2002, J. Virol. 76: 4634-4642), adenovirus fiber shaft (Papanikolopoulou et al., 2004, J. Biol. Chem. 279: 8991-8998; Papanikolopoulou et al., 2004, J. Mol. Biol. 342: 219-227), and rabies virus glycoprotein (Sissoeff et al., 2005, J. Gen. Virol. 86: 2543-2552). Fragments, truncations, and other variants of'the foldon domain may be used in the disclosed methods and products.
[00168] In another aspect, the invention provides engineered bacterial cell-based systems capable of expressing recombinant proteins, for example hydroxylated recombinant proteins, comprising:
a. one or more nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase; and
b. one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme,
wherein the nucleic acids are either genes inserted into the bacterial genome or plasmids.
[00169] The expression vectors of the disclosure are introduced into the bacterial host cells by any method known to the art, such as calcium chloride-mediated transfection, ele.ctroporation or otherwise. After transfection, host cells comprising the expression vector or vectors can be selected on the basis of one or more selectable markers that are included in the expression vector(s).
[00170] As will be apparent to one skilled in the art, the particulars of the selection process depend on the identities of the selectable markers. If a selectable marker is
an antibiotic resistance gene, the transfected host cell population can be cultured in the presence of an antibiotic to which resistance is conferred by the selectable marker. The antibiotic kills or inhibits the growth of those cells that do not carry the resistance gene, and permit proliferation of those host cells that carry the resistance gene and the associated expression construct. If a selectable marker is a gene which complements an auxotrophy of the host cells, the transfected host cell population can be cultivated in the absence of the compound for which the host cells are auxotrophic. The cells that carry the complementing gene can be able to proliferate under such growth conditions and can also presumably carry the rest of the expression construct.
[00171] After selection, host cells can be cloned according to any appropriate method known in the art. For example, microbial host cells can be plated on solid media under selection conditions, after which single clones can be selected for further selection, characterization, or use. This process can be repeated one or more times to enhance the stability of the expression construct within the host cell. To produce collagen or another hydroxylated recombinant protein of interest, recombinant host cells comprising one or more expression vectors can be cultured to expand cell numbers in any appropriate culturing apparatus known in the art, such as a shaken culture flask or a fermenter.
[00172] The culture medium used to culture recombinant bacterial cells will depend on the identity of the bacteria. Culture media used for various recombinant host cells are well known in the art. The. culture medium generally comprises inorganic salts and compounds, amino acids, carbohydrates, vitamins and other compounds which are either necessary for the growth of the host cells or which improve the health and/or growth of the host cells.
[00173] If the bacterial host cells are Gram-negative bacterial cells and comprise one or more recombinant ascorbate-dependent or ascorbate-analog-dependent biosynthetic enzymes, such as prolyl-4-hydroxylase, which is expressed in the periplasmic space of the bacteria, then vitamin C (ascorbic acid or one of its salts) or an ascorbate analog can be added to the culture medium. If ascorbic acid is added, it is generally added to a concentration of between 0.05 mM to 20 mM, preferably to a concentration of around 2 mM.
[00174] Iron(ll) is a necessary co-factor for some ascorbate-dependent biosynthetic enzymes, such as prolyl-4-hydroxylase. Iron(ll) concentrations in growth media for proper functioning of prolyl-4-hydroxylase range from about 0.05 mM to 1
mM, and are preferably at around 0.5 mM. Many types of growth media contain enough iron(ll) for proper functioning of the hydroxylase, such that iron(ll) need not be added. In cases where the iron(ll) concentration is lower than required for proper functioning of the hydroxylase, the media should be supplemented with iron(ll).
[00175] After expression, the particular method of recovery of collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) from the culture will depend on the host cell type and the expression construct. Collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) can be trapped in the cytoplasm, and in particular embodiments, collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) can be trapped in the periplasm. Cell walls can be removed or weakened to release collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) located in the cytoplasm or periplasm. Disruption can be accomplished by any means known in the art, including sonication, microfluidization, lysis in a French press or similar apparatus, or disruption by vigorous agitation/milling with glass beads. Lysis or disruption of recombinant host cells is preferably carried out in a buffer of sufficient ionic strength to allow the collagen to remain in soluble form (e.g., more than 0.1 M NaCI, and less than 4.0 M total salts including the buffer).
[00176] Recovered collagen or a protein comprising a collagenous domain, a non- limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) can be purified using known techniques, where the particular technique used depends on the host cell type and the expression construct. Generally, solutions of recovered collagen or a protein comprising a collagenous domain, a non-limiting example thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) are first clarified (if the collagen or a protein comprising a collagenous domain, a non-limiting example
thereof being adiponectin and particularly human adiponectin (identified by GenBank Accession No. NM_004797 and commercially available from Fisher Thermo Scientific) is recovered by cell disruption or lysis). Clarification is generally accomplished by centrifugation, but can also be accomplished by sedimentation and/or filtration if desired. In cases where the collagen- or protein containing a collagenous domain-containing solution contains a substantial lipid content (for example, when the collagen has been recovered by cellular lysis or disruption), the solution can also be delipidated. Delipidation can be accomplished by the use of an adsorbant such as diatomaceous earth or diatomite such as that sold as CELITE™ 512 (AdvancedMinerals). When diatomaceous earth or diatomite is used for delipidation, it is preferably prewashed before use, then removed after use by filtration.
[00177] The collagen or collagen-domain comprising protein product can be further purified by any one or more purification techniques known in the art, including gel filtration chromatography, ion exchange chromatography (for example, cation exchange chromatography can be used to adsorb the collagen or collagen-domain comprising protein to the matrix, and anion exchange chromatography can be used to remove a contaminant from a collagen- or collagen-domain comprising protein- containing solution), affinity chromatography, hydrophobic interaction chromatography, and high-performance liquid chromatography. Additionally, solubility of collagen or collagen-domain comprising protein can be manipulated by alterations in the pH or ionic strength of the buffer. In particular, any one of the following manipulations can be used, singly or in combination with others to purify products of the disclosure: insolubilize collagen or collagen-domain comprising protein in low ionic strength buffers; precipitate collagen or collagen-domain comprising protein at high ionic strengths; dissolve collagen or collagen-domain comprising protein in acidic solutions; and form collagen fibrils (by assembly of trimeric monomers) in low ionic strength buffers near neutral pH (i.e., about pH 6 to 8), thereby eliminating proteins that do not precipitate at high ionic strength.
[00178] Recovered or purified collagen can also be treated to produce gelatin by any technique known in the art, including thermal denaturation, acid treatment, alkali treatment, or any combination thereof.
[00179] After purification, collagen or collagen-domain comprising protein produced according to the invention can be modified by crosslinking in order to stabilize the collagen triple helix, thereby improving the resistance of trimeric fibrillar collagen to thermal denaturation and proteolytic degradation. Methods for
crosslinking collagen are known in the art. In general, the collagen or collagen- domain comprising protein is resuspended in a buffered solution such as phosphate buffered saline at about 3 mg/mL, and mixed with a relatively low concentration of glutaraldehyde, preferably about 0.0025-1 % (v/v). The collagen/glutaraldehyde mixture is then incubated to allow crosslinking to occur, preferably at a temperature below room temperature (i.e., less than about 20 °C). For crosslinking, the glutaraldehyde is preferably of high purity and contains relatively low amounts of glutaraldehyde polymer.
[00180] In certain embodiments of the disclosed methods and products, one or more of the nucleic acids encoding the sugar-1 ,4-lactone oxidase, one or more of the ascorbate-dependent biosynthetic enzymes, and the peptide or protein to be hydroxylated are incorporated into the bacterial chromosome. Methods of incorporating nucleic acids into the bacterial chromosome are known in the art. For example, the nucleic acids of the disclosure may be incorporated into a bacteriophage λ vector, which may then integrate itself into the host cell's chromosome (see, for example, Sieg et al. (1989), "A versatile phage lambda expression vector system for cloning in Escherichia coli." Gene 75(2): 261-70.). Alternatively, the nucleic acids of the disclosure may be placed into a gene cassette under the control of a promoter that is suitable for inserting a gene into the chromosome of a bacterium, such as the very strong bacteriophage λ promoter left (PL), as disclosed in International Publication No. WO 2006/029449.
[00181] The methods and products of the disclosure can be used for a wide variety of pharmaceutical, cosmetic, and medicinal purposes that are known in the art, including as a component in artificial skin (see, for example, US Patent No. 5,800,81 1 , herein incorporated by reference in its entirety), alone or in combination with antibiotics in a dressing to promote wound healing (see, for example, US Patent No. 5,219,576), or as a component in cardiac devices (see, for example, US Patent No. 7,008,397). EXAMPLES
[00182] The Examples that follow are illustrative of specific embodiments of the invention, and various uses thereof. They are set forth for explanatory purposes only, and are not to be taken as limiting the invention.
Example 1 : Expression and purification of GST-(PPG)5 without AL01 co- expression
[00183] GST-(PPG)5 (SEQ ID NO: 23; GST is glutathione S-transferase) was cloned into a pCOLADuet vector as follows(also described in Pinkas et al. (2011), "Tunable, post-translational hydroxylation of collagen domains in Escherichia coli," ACS Chem Biol. 6(4): 320-24; which is incorporated by reference herein in its entirety).. An oligonucleotide encoding (PPG)5 (SEQ ID NO: 24) with a BamHI restriction site at the 5' end and an ΧΛοΙ site at the 3' end with the sequence:
GCTAGGATCCCCGCCGGGTCCGCCAGGCCCACCGGGTCCACCTGGCCCGCCT GGTTAAAGGAGAAGCAGGTGCTGGACAGGGCGAGGCATCGTGCCTGGTTAACT CGAGCTAG (SEQ ID NO: 25)
was amplified using PCR to obtain a specific double-stranded DNA using primers GCTAGGATCC CCGCCGGGTC (SEQ ID NO: 26) and CTAGCTCGAG TTAACCAGGC (SEQ ID NO: 27) and the following PCR conditions: (1 ) denature for 5 min at 95°C; (2) denature for 1 min at 95°C; (3) anneal for 1 min at 55°C; (4) elongation for 1 min at 72°C; (5) repeat steps (2) - (4) 30 times; (6) elongation for 10 min at 72°C; hold at 4°C. The specific double-stranded DNA was then digested by BamHI and Xho\ restriction endonucleases and inserted into pGEX4T-1 (GE Healthcare) in order to create a fusion of (PPG)5 and glutathione S-transferase (GST) with an intervening thrombin protease cleavage (Novagen, Inc., San Diego, CA) site, termed herein GST-(PPG)5. The pGEX-4T-1 vector map was obtained from GE Healthcare's website; last accessed April 2, 2010. DNA encoding GST-(PPG)5 was isolated from pGEX4T-1 by PCR using primers (forward primer: CAGCTACCAT GGGTtcccct atactaggtt attggaaaat taagggcc (SEQ ID NO: 28); reverse primer: CCTGACGGGC TTGTCTGCTC CC (SEQ ID NO: 29)) that flanked regions on the 5' side of the translation initiation codon including an Λ/col site and the 3' side of the stop codon including a Not\ site. The PCR fragment was digested with Nco\ and Not\ restriction enzymes (New England Biolabs, MA) by adding 2 units enzyme for each pg DNA, and incubating at 37°C for 2 hours. After digestion, the DNA was separated in an agarose gel, the expected band was extracted and purified by QIAquick Gel Extraction Kit (Qiagen, Valencia, CA), and the resulting amplified sequence was ligated into the first cloning site in the multiple cloning site (MCS) of the pCOLADuet- 1 vector (Novagen, Inc., San Diego, CA), yielding the plasmid pSD1000. pSD1000 was transformed into Origami 2 cells (Novagen, Inc.) with and without human prolyl- 4-hydroxylase (P4H) co-transformation. The pCOLADuet-1 vector map was obtained from Novagen, Inc.'s website; last accessed April 2, 2010.
[00184] A pET22b vector (Novagen, Inc., San Diego, CA), designated pBK1.PDI1.P4H7, was used to express human P4H, as described by Kersteen ef al.
(2004, Protein Purification and Expression 38: 279-291). The pET22b vector map was obtained from Novagen, Inc.'s web site last accessed April 2, 2010. Briefly, cDNAs encoding the a and β subunits of human prolyl-4-hydroxylase were cloned into the same plasmid. From this bicistronic vector, both cDNAs were able to be transcribed from the same T7 promoter, with each subunit having its own ribosome binding site (rbs) for translation initiation. cDNA encoding human protein disulfide isomerase (PDI— the β subunit of P4H), without its signal sequence encoding region, was inserted between the Nde\ and SamHI restriction sites of a pET22b(+) expression vector (Novagen, Inc., San Diego, CA) to give a plasmid, designated pBKLPDH . The pET22b(+) vector map was obtained from Novagen, Inc.'s website, last accessed April 2, 2010.
[00185] cDNA encoding P4Ha(l) subunit (PA11 clone), was isolated from HeLa cells and inserted into a pBSKS vector (pBS.LF17-1). The pBSKS vector map was obtained from Addgene's web site last accessed April 2, 2010. DNA encoding P4Ha(l) was isolated from the pBS.LF17-1 vector by PCR using primers that flank regions on the 5' side of the translation initiation codon and the 3' side of the stop codon, each of which includes a SamHI restriction site. The resulting PCR fragment was cloned into a PCR4-TOPO vector (Invitrogen, Carlsbad, CA), digested with SamHI, and then ligated into the pBKI .PDH plasmid, which was previously digested with SamHI, yielding plasmid pBK1.PDI1.P4H1. The PCR4-TOPO vector map was obtained from Invitrogen's website, last accessed April 2, 2010.
[00186] A site-directed mutagenesis kit (QuikChange, Stratagene, La Jolla, CA) was used to remove DNA encoding the signal sequence of P4Ha(l) according to the manufacturer's protocols. The resulting plasmid pBK1.PDI1.P4H5 produced the Ρ4Ηα(Ι)235-534/β enzyme (a P4H oligomer with a 32 kDa a subunit).
[00187] A plasmid encoding the P4Ha(l) subunit alone was produced by digesting pBK1.PDI1.P4H5 with Nde\, removing the DNA fragment encoding PDI, and then ligating the vector. QuikChange mutagenesis was then applied to the resulting construct (pBK1.P4H5) to add a SamHI site to the 5' end of the pET22b(+) rbs, yielding plasmid pBK1.P4H6. SamHI digestion of the pBKLPDH and pBK1.P4H6 plasmids, followed by ligation, resulted in a vector, designated pBK1.PDI1.P4H6, with the PDI cDNA preceding the P4Ha(l) cDNA, both having the polylinker of pET22b(+) on the 5' side of their start codons. Finally, the ATG codon of Met235 of the a subunit was replaced with a CTT codon (leucine) by QuikChange mutagenesis to yield plasmid pBK1. PDI 1.P4H7, . which was used to produce the full-length P4H tetramer.
[00188] For co-transformation, 1 μΙ_ of pCOLADuet-1 vector that contained the GST-(PPG)5 gene in the first MCS and 1μί pBKI.PDI1.P4H7 (encoding P4Ha(l)) were added to a 20 μί aliquot of Origami 2 (DE3) competent cells at the same time. The cells were placed on ice for 30 minutes, heat shocked at 42°C for 1 min, and then put back on ice for 2 minutes. After adding 300 μί SOC (Super Optimal broth with Catabolite repression) media, the cells were shaken at 200 rpm at 37°C for 1 hour before plating on an LB (Luria-Bertani) agar plate containing 30 pg/mL kanamycin and 200 μg/mL ampicillin; the plate was incubated at 37°C overnight.
[00189] After 2-liter shaker expressions in terrific broth, the proteins were purified by glutathione agarose resin. The proteins appeared in a single band by SDS- PAGE. The molecular weight of GST-(PPG)5 (SEQ ID NO: 23) without P4H co- expression was confirmed by MALDI mass spectrometry. As shown in Figure 1 , the first peak is consistent with the expected molecular weight (~27.5 kD), while the second peak is GST-(PPG)s plus a glutathione adduct (glutathione was not removed from the protein buffer before MALDI). As expected, there was no hydroxylation observed even with P4H co-expression as the cytosol of E. coli does not provide the necessary cofactors necessary for hydroxylase activity.
[00190] To confirm that P4H can hydroxylate the substrate GST-(PPG)5 (SEQ ID NO: 23), and to develop a method for detecting GST-(PPG)5 hydroxylation, 0.2 mg of GST-(PPG)5 was incubated in 100 pL of 50 mM Tris-HCI buffer, pH 7.8 containing bovine serum albumin (1mg/mL), catalase (100 pg/mL), dithiothreitol (100 μΜ), Fe(ll)S04 (50 μΜ), α-ketoglutarate (500 μΜ), and ascorbate (2 mM), and an aliquot of purified P4H (50 pL at 4.5 μΜ) was added to the mixture. P4H was prepared recombinantly in £. coli and purified by polyproline affinity chromatography followed by ion exchange chromatography. A positive control, wherein the 4-residue peptide Ac-GFPG-NH2 (SEQ ID NO: 30), previously shown to be capable of hydroxylation by P4H, was used as a substrate, rather than GST-(PPG)5, was included in these experiments. The negative control was GST-(PPG)5 incubated in buffer without P4H enzyme. The reactions took place for 2 hours at 37°C. The positive control was boiled for 5 min to precipitate the proteins, and the peptide was recovered in the supernatant after centrifugation. The samples with GST-(PPG)5 (0.1 mg/mL) were then incubated with a 5-fold excess of thrombin in Dulbecco's phosphate-buffered saline (DPBS) to cleave GST:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPY YIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDF ETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDWLYMDPMCLD
AFPKLVCFKKRIEEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPR (SEQ ID NO: 31) from the GS-(PPG)5 peptide (SEQ ID NO: 32). After 2 hour cleavage, the cleaved peptide was separated from GST and P4H by running the cleavage mixture through a 10 kD cutoff spin concentrator ( illipore).
[00191] Samples were then mixed with sinapinic acid (10mg/mL, in 50% acetonitrile solution containing 0.1 % trifluoroacetic acid) and analyzed by MALDI- TOF mass spectrometry (Applied Biosystems, CA) (Figures 2 and 3). In addition, samples were analyzed by injection into a Micromass ZQ LC- S (Figures 4 and 5) using a gradient of 0 - 100% acetonitrile with 0.1 % formic acid; UV absorbance was monitored at 214 nm. The positive control showed that the proline residue in Ac- GFPG-NH2 was hydroxylated.
[00192] The calculated molecular weight of the unhydroxylated (PPG)5 peptide after cleavage (GSPPGPPGPPGPPGPPG, GS-(PPG)5; SEQ ID NO: 32) was 1417.7 (monoisotopic mass in Da). As shown in Figure 3, peaks having an apparent molecular weight of 1441 , 1457, and 1471 were detected, indicating that up to 3 hydroxyproline residues were produced in the (PPG)5 peptide after incubation with P4H.
[00193] The LC-MS results are consistent with the MALDI results (Figures 4 and 5). The species with a retention time of 8.5 min was GS-(PPG)5 and peaks having slightly shorter retention times were the hydroxylated species. The doubly-charged species of hydroxylated compounds exhibited an additional m/z = 8. The observed m/z corresponds to (PPG)5 (SEQ ID NO: 24), rather than GS-(PPG)5 (SEQ ID NO: 32), indicating that the /V-terminal GS residues were cleaved during analysis, most likely during ionization. These experiments confirmed that P4H is able to hydroxylate GST-(PPG)5 (SEQ ID NO: 23).
Example 2: Assessment of exogenous ascorbate as a carbon source
[00194] To determine if expression strains BLR (DE3) (Novagen, Inc.) and Origami 2 (Novagen, Inc.) were able to assimilate ascorbate as a carbon source, each strain was grown in M9 minimal media supplemented with 0.2 wt% of glucose, glycerol, or lactone (Figure 7). Although the BLR strain grew on some carbon sources, the Origami 2 strain did not grow in M9 minimal media, even with glucose supplementation.
[00195] Origami 2 cells were able to grow on M9 supplemented with 10 mL of 100X vitamin stock solution (0.42 g/L riboflavin, 5.4 g/L pantothenic acid, 6 g/L niacin, 1.4 g/L pyridoxine, 0.06 g/L biotin, and 0.04 g/L folic acid) per 1000 mL, 10 mL of
100X trace metal stock solution (27 g/L FeCI3-6H20, 2 g/L ZnCI2-4H20, 2 g/L CaCI2-6H20, 2 g/L Na2 oCv2H20, 1.9 g/L CuS04 5H20, 0.5 g/L H3B03, and 100 mL/L concentrated HCI) per 1000 mL, and 0.4% casamino acids (Figure 8). Additionally, the eventual overgrowth of the Origami 2 strain with the addition of 5 mM ascorbate (Figure 8) strongly suggested that these bacteria could assimilate carbon from ascorbate, although the ascorbate shows a dose-dependent toxicity. On the other hand, L-gulono-l,4-lactone was not a viable carbon source, which indicated that it was either not transported into the cell, or not metabolized there.
[00196] To determine whether Origami 2 cells were able to accumulate significant intracellular levels of exogenously supplied ascorbate, and thereby activate P4H intracellular^, Origami 2 cells were transformed with the genes for P4H and GST- (PPG)5 and then grown at 37°C to a concentration having an OD60o = 0.6 in M9 minimal media supplemented with vitamins, minerals, casamino acids, and 5 mM ascorbate. After induction of protein production with IPTG, the media was supplemented with different levels of Fe(ll)S04/ascorbate. GST-(PPG)5 samples were purified as described above, and all samples after purification yielded a single band by SDS PAGE (Figure 9). As demonstrated by the chromatograms in Figure 10, none of the above experimental conditions yielded hydroxylated (PPG)5. This result is in agreement with expectations as E. coli is known not to transport ascorbate into the cytoplasm under aerobic conditions. As molecular oxygen is a required substrate for P4H, this experiment confirms that exogenous addition of ascorbic acid to cells that express P4H intracellularly was not a viable method of achieving hydroxylation.
Example 3: Construction of expression plasmids comprising AL01 DNA
[00197] An oligonucleotide encoding (PPG)5 with a SamHI restriction site at the 5' end and an Xho\ site at the 3' end with the sequence:
GCTAGGATCCCCGCCGGGTCCGCCAGGCCCACCGGGTCCACCTGGCCCGCCT GGTTAAAGGAGAAGCAGGTGCTGGACAGGGCGAGGCATCGTGCCTGGTTAACT CGAGCTAG (SEQ ID NO: 25)
was amplified using PCR to obtain a specific double-stranded DNA using primers GCTAGGATCCCCGCCGGGTC (SEQ ID NO: 26) and CTAGCTCGAGTTAACCAGGC (SEQ ID NO:'27) and the following PCR conditions: (1) denature for 5 min at 95°C; (2) denature for 1 min at 95°C; (3)'anneal for 1 min at 55°C; (4) elongation for 1 min at 72°C; (5) repeat steps (2) - (4) 30 times; (6) elongation for 10 min at 72°C; hold at 4°C. The specific double-stranded DNA was
then digested by SamHI and Xho\ restriction endonucleases (New England Biolabs, MA) by adding 2 units enzyme for each >g DNA, and incubating at 37°C for 2 hours. After digestion, the DNA was separated in an agarose gel, the expected band was extracted and purified by QIAquick Gel Extraction Kit (Qiagen, Valencia, CA), and the resulting amplified sequence was inserted into pGEX4T-1 in order to create a fusion of (PPG)5 and glutathione S-transferase (GST) with an intervening thrombin protease cleavage site, termed GST-(PPG)5 herein. DNA encoding GST-(PPG)5 was isolated from pGEX4T-1 by PCR using primers (SEQ ID NOS: 28-29) that flanked regions on the 5' side of the translation initiation codon including an Nco\ site and the 3" side of the stop codon including a Λ/ofl site. The PCR fragment was digested with Nco\ and Λ/ofl restriction enzymes (New England Biolabs, MA) by adding 2 units enzyme for each pg DNA, and incubating at 37°C for 2 hours. After digestion, the DNA was separated in an agarose gel, the expected band was extracted and purified by QIAquick Gel Extraction Kit (Qiagen, CA), and the resulting amplified sequence was ligated into the first cloning site in the multiple cloning site (MCS) of the pCOLADuet- 1 vector (Novagen, Inc.), yielding the plasmid pSD1000.
[00198] cDNA encoding the AL01 gene of Saccharomyces cerevisiae (strain EBY100) was amplified from genomic DNA as previously described (Lee ef a/., 1999, Appl. Environ. Microbiol. 65: 4685-7) (see SEQ ID NO: 1 for an exemplary S. cerevisiae AL01 coding sequence). Briefly, oligonucleotide primers were synthesized on the basis of the nucleotide sequence of the AL01 gene with the sequences 5'-TTTCACCATATGTCTACTATCC-3' (forward primer; SEQ ID NO: 33) and S'-AAGGATCCTAGTCGGACAACTC-S' (reverse primer; SEQ ID NO: 34). The primers were designed so that the amplified DNA contained the entire open reading frame of the AL01 gene with a Nde\ site at the 5' end and a SamHI site at the 3' end. PCR was carried out with Pfu Turbo Hotstart DNA polymerase (Stratagene). Template genomic DNA for PCR was prepared from S. cerevisiae ATCC 44774 according to established methods (Wach et a/., 1994, "Procedures for isolating yeast DNA for different purposes," in J. R. Johnston (ed.), MOLECULAR GENETICS OF YEASTS, IRL Press: Oxford, pp. 1-16). The reaction mixture contained 0.5 mM each forward and reverse primer, 0.2 mM deoxynucleoside triphosphate, 2.0 mM MgS04, 1X PCR buffer, and 0.5 mg of template genomic DNA and 2.5 U Pfu polymerase per 50 mL. The mixture was subjected to 30 cycles of 1 min denaturation at 940C, 1 min annealing at 50°C, and 2 min extension at 72°C.
[00199] The PCR fragment obtained as described above was inserted into a pET19b vector (Novagen, Inc.), and then isolated from the vector by PCR using
forward primer: CCCGAAAGGA AGCTCGAGTT GGCTGCTG (SEQ ID NO: 35) and reverse primer: CAGCAGCCAA CTCGAGCTTC CTTTCGGG (SEQ ID NO: 36) that introduced an Xhol site on the 3' side of the stop codon and retained the Ndel site on the 5' side. The pET19b vector map was obtained from Novagen, Inc.'s web site last accessed April 2, 2010. At the same time, a site directed mutagenesis PCR was carried out on plasmid pSD1000 to remove the ΧΛοΙ site from the end of (PPG)5 using forward primer CGTGCCTGGT TAACTGAGCG GCCGCATAATG (SEQ ID NO: 37) and reverse primer CATTATGCGG CCGCTCAGTT AACCAGGCACG (SEQ ID NO: 38). The AL01 fragment was digested by Nde\ and Xho\ restriction enzymes, and inserted into the second cloning site of the mutated plasmid pSD1000. The result was a pCOLADuet-1 vector that contained the GST-(PPG)5 gene in the first MCS, and AL01 in the second MCS designated pSD1001 (the plasmid map is shown in Figure 18).
Example 4: Protein expression, purification, and characterization
[00200] pSD1001 (pCOLADuet-1 vector that contained the GST-(PPG)5 gene in the first MCS, and AL01 in the second MCS) was co-transformed with pBKI.PDI1.P4H7 (encoding P4Ha(l), as described in Example 1 ) into Origami 2 (DE3) competent cells. For co-transformation, 1 pL of pCOLADuet-1 vector that contained the GST-(PPG)5 gene in the first MCS and 1 pL pBKI.PDI1.P4H7 (encoding P4Ha(l)) were added to a 20 pL aliquot of Origami 2 (DE3) competent cells at the same time. The cells were placed on ice for 30 minutes, heat shocked at 42°C for 1 min, and then put back on ice for 2 minutes. After adding 300 pL SOC (Super Optimal broth with Catabolite repression) media, the cells were shaken at 200 rpm at 37°C for 1 hour before plating on an LB (Luria-Bertani) agar plate containing 30 pg/mL kanamycin and 200 pg/mL ampicillin; the plate was incubated at 37°C overnight.
[00201] A starter culture was grown from a clone overnight in LB medium supplemented with 30 pg/mL kanamycin and 200 pg/mL ampicillin. The starter culture was used to inoculate flasks of terrific broth culture medium with 30pg/mL kanamycin and 200 pg/mL ampicillin. The culture was incubated at 37°C (250 rpm), and induced with 500 μΜ isopropyl-1-thio-p-D-galactopyranoside (IPTG) at ODeoo = 1.6 - 1.8, and expressed at 23°C (250 rpm) for 14-18 h. Cell pellets were collected, washed three times with PBS, and then resuspended in PBS for incubation with effectors.
[00202] These cell suspensions were split into five aliquots, and to each aliquot was added 250 μΜ Fe(ll)S04, together with one of the following compounds at a concentration of 10 m : (1) D-arabinono-1 ,4-lactone, (2) L-galactono-1 ,4-lactone, (3) L-gulono-l ,4-lactone, (4) L-ascorbic acid, or (5) nothing additional. The cell suspensions were incubated at 30°C (250 rpm) for 3 hrs. Cell pellets were collected, washed three times with PBS, resuspended in PBS, and then lysed by sonication. The lysate supernatants were collected after centrifugation and the expressed GST- (PPG)5 was purified using glutathione affinity resin.
[00203] GST-(PPG)5 samples were then incubated with 50 U/(mg protein) of thrombin to cleave GST tags from the (PPG)5 peptides. Due to the cleavage pattern of thrombin, the resulting peptide was GS(PPG)5, i.e. Gly-Ser-(Pro-Pro(/Hyp)-Gly)5 (SEQ ID NO: 39). After 2 hours, the cleaved peptide was separated from GST by applying the proteolysis mix to a 10 kD cutoff spin concentrator and collecting the effluent.
[00204] The GST-(PPG)5 protein with neither P4H nor AL01 coexpression was previously expressed and purified as a negative control. A positive control experiment was carried out by incubating the purified GST-(PPG)5 with purified P4H. The preparation of the controls is described in Example 1.
[00205] The resulting peptides were analyzed by LC-MS (Figures 12 and 13) and MALDI (Figure 14). All of the samples where hydroxylation was carried out in vivo exhibited similar patterns of hydroxylation (Figures 12C-F). Cells expressing P4H and AL01 incubated with only Fe(ll)SO,» (a presumed negative control) produced a hydroxylation pattern similar to that of all the other experiments (Figure 12G). The observation of hydroxylation in all of the samples suggests that there is an endogenous source of sugar-1 ,4-lactone in E. coli that can be used as a substrate for AL01 ; thus, unexpectedly, the addition of substrate to the growth media is unnecessary. The LC-MS data shows a clear pattern of hydroxylation having additional m/z = 8 in the doubly charged species (Figure 13), with peaks showing up to 5 hydroxyproline residues (fully hydroxylated) (Figure 13A). The MALDI result was consistent with the electrospray data obtained by LC-MS (Figure 14).
Example 5: Confirmation of AL01 activity in E. coli
[00206] To confirm the hydroxylase activity results shown in Example 4, and to investigate the nutritional requirements for the observed activity, GST-(PPG)5 was co-expressed with P4H and AL01 in the Origami 2 strain of E. coli in three different media, along with the negative control of expression in rich media without AL01
gene. Cultures were grown at 37°C to ODMO = 0.6 for cultures grown in LB and M9 media, and to OD^o = 1.2 for cultures grown in terrific broth. The temperature was then reduced to 23°C, the cultures were induced with 500 μΜ IPTG and expressed for 16 hours. After centrifugation, pellets were collected, washed twice with PBS, and then resuspended in PBS with 5 mM EDTA. The cells were then lysed by sonication and the GST-(PPG)5 was purified using glutathione affinity resin. Effluent from resin purification was concentrated and the peptide GS(PPG)5 was released from the GST by thrombin cleavage. The released peptides were separated by collecting the flow-through of the cleavage reaction using a 10 kD cutoff filter, diluted to equal concentrations based on pre-cleavage GST-(PPG)5 protein concentrations, and analyzed by LC-MS (Figure 15).
[00207] The results demonstrated in vivo hydroxylation of the peptide, and confirmed the results described in Example 4. Additionally, the results demonstrated that the precursor of the oxidase substrate was being synthesized by E. coli, since hydroxylation occurred in defined media with no yeast extract.
Example 6: Optimization of shake flask culture for high hydroxylation levels
[00208] An ordinary shake flask culture methodology was optimized for high hydroxylation levels. The concentrations of the purified proteins were determined by U 280nm with a Nanodrop spectrophotometer (Thermo Scientific). In order to remove GST tags from the collagen-like peptides, 4 units thrombin (MP Biomedical) were incubated with 75 ig of protein at room temperature for 2 hours in a final volume of 60 pL in DPBS; 1mM benzamidine (Sigma-Aldrich) was added to the mixture to stop the cleavage reaction. The samples were analyzed by LC-MS (Waters) equipped with a diode array detector as well as a quadrupole mass spectrometer, with a gradient of 5-95% acetonitrile over 1 hour. Quantitative determination of hydroxylation fraction was achieved by using the areas of extracted ion chromatograms. All relative ionization efficiencies (RIE) were set equal to 1 after verification that the RIE for (Pro-Hyp-Gly)5 was great than 80% of that for (Pro-Pro- Gly)5 by comparing the ionization peak areas with UV2i4nm peak area in chromatograms. The percentage of substrate prolines hydroxylated {H. level %) was calculated as
in which n is the number of hydroxylated substrate prolines (note: only prolines in the Y position of X-Y-Glycine repeats are considered as substrate prolines), nmax is the total number of substrate prolines, and An is the peak area in extracted ion chromatograms of peptide with hydroxylated proline number of n.
[00209] The amount of hydroxylation was strongly dependent on culture media. Minimal media generally yielded higher hydroxylation levels than rich media (Figures 17A, 17C-H), with M9 minimal media plus 0.4% tryptone as the carbon source producing the highest hydroxylation levels at 71 ± 6 % of Y position prolines. The trend of less-rich media leading to higher hydroxylation levels repeated itself in an experiment where the amount of tryptone was varied while holding other media parameters constant (shown in Figure 19).
[00210] Cultures in which P4H was expressed without AL01 in rich media showed very low levels of hydroxylation. However, when P4H was expressed without AL01 in optimized minimal media conditions, hydroxylation was observed in an unexpected "all-or-none" pattern. That is, the expressed (Pro-Pro-Gly)5 repeats were either nearly fully hydroxylated ((Pro-Hyp-Gly)5, SEQ ID NO: 58; sequence given is of the peptide after thrombin cleavage), or remained unhydroxylated ((Pro-Pro-Gly)5, SEQ ID NO: 59; sequence given is of the peptide after thrombin cleavage) (Figure 17B). The results indicate the existence of a distinct ascorbate-independent mode of processing Pro-Pro-Gly repeats by P4H. No hydroxylation was found in an in vitro experiment where ascorbate was not supplemented (Figure 20), indicating that this effect is mediated by factors present in E. coli that are not present in vitro.
Example 7: Hydroxylation of PPG-foldon fusions
[00211] In eukaryotes, proper hydroxylation of collagen manifests itself as an increase in the melting temperature. An experiment was conducted to determine whether P4H-mediated hydroxylation observed in the prokaryotic system disclosed herein would function for that purpose. (Pro-Pro-Gly)s (SEQ ID NO: 59; sequence given is of the peptide after thrombin cleavage) or (Pro-Pro-Gly)7 (SEQ ID NO: 60; sequence given is of the peptide after thrombin cleavage) constructs were fused at the C-terminus to the 27-amino-acid T4-phage foldon domain (GSGSGYIPEAPRDGQAYVRKDGEWVLLSTFL) (SEQ ID NO: 61 ; sequence given is of the peptide after thrombin cleavage) as was done previously for Pro-Pro-Gly synthetic peptide repeats in studies of collagen melting, see Frank et al. (2001 , "Stabilization of short collagen-like triple helices by protein engineering," J. Mol. Biol. 308: 1081-9). The foldon forms an obligate trimer, reducing possible network
formation by keeping individual strands attached and aligned at one end, simultaneously raising the melting point of attached collagenous domains.
[00212] AL01 was cloned into a pCOLADuet vector as follows. Genomic DNA from Saccharomyces cerevisiae (strain EBY100) was extracted using Gentra Puregene Yeast/Bact. Kit (Qiagen) according to the manufacturer's instructions. cDNA encoding AL01 was amplified from yeast genomic DNA using primers described by Lee et al. (1999, Appl Environ Microbiol 65: 4685-7), which introduced a BamH\ site at the 3' end of the gene and an Nde\ site at the 5' end. The PCR product resulting from this amplification was digested with Nde\ and SamHI (all restriction enzymes from New England Biolabs) and then ligated into a pET19b vector using T4 ligase, resulting in the plasmid named "pSD.ET19b.ALO . In order to generate an AL01 (the gene encoding ALO) insert with restriction sites appropriate for insertion into the co-expression vector pCOLADuet-1 (Novagen), PCR was performed on plasmid "pSD.ET19b.AL01" using primers 5'- CCCGAAAGGAAGCTCGAGTTGGCTGCTG-3' (SEQ ID NO: 35) and 5'- CAGCAGCCAACTCGAGCTTCCTTTCGGG-3' (SEQ ID NO: 36). The PCR produced a linear fragment with a Xho\ site on the 3' side of the stop codon of AL01 gene while retaining the Nde\ site on its 5' side. The resulting fragment was then digested with Nde\ and X/iol restriction enzymes, and ligated into the 2nd multiple cloning site (MCS) of pCOLADuet-1 vector, resulting in a plasmid named "pSD.COLADuet- 1.0.ALO1" (see Figure 18 for vector map of similar plasmid pSD.COLADuet-1.GST- (PPG)5.AL01).
[00213] GST-(PPG)5 was cloned into pCOLADuet expression vectors as follows. An oligonucleotide encoding (Pro-Pro-Gly)5 (SEQ ID NO: 25) with a SamHI restriction site at the 5' end and an Xho\ site at the 3' end was amplified by PCR using primers GCTAGGATCCCCGCCGGGTC (SEQ ID NO: 26) and CTAGCTCGAGTTAACCAGGC (SEQ ID NO: 27) to obtain a specific double- stranded DNA. The PCR product was digested with SamHI and Xho\, and ligated into vector pGEX4T-1 (GE healthcare) in order to create the fusion of (Pro-Pro-Gly)5 to glutathione S-transferase (GST) with an intervening thrombin protease cleavage site ("pSD.GEX4T-1.GST-(PPG)5"). In order to introduce appropriate restriction sites to ligate GST-(Pro-Pro-Gly)5 into the 1st MCS of pCOLADuet- 1 vector, PCR was carried out on the plasmid "pSD.GEX4T-1.GST-(PPG)5°, using primers 5'-CAGCTACCAT GGGTTCCCCT ATACTAGGTT ATTGGAAAAT TAAGGGCC-3' (SEQ ID NO: 28) and 5'-CCTGACGGGC TTGTCTGCTC CC-3' (SEQ ID NO: 29) that introduced a Λ/col site on the 5' side of the translation initiation codon of GST-(Pro-Pro-Gly)5 and a
Λ/ofl site after the 3' side of the stop codon. The PCR fragment was digested with Nco\ and Not\, and ligated into the 1st CS of both the empty pCOLADuet-1 vector and the plasmid "pSD.COLADuet-I .O.ALOl", which created plasmids upSD.COLADuet-1.GST-(PPG)5.0" and upSD.COLADuet-1.GST-(PPG)5.ALOr (see Figure 18 for plasmid map), respectively.
[00214] The DNA encoding (Pro-Pro-Gly)' 10-foldon (SEQ ID NO: 62; sequence given is of the peptide after thrombin cleavage):
5'-
GGATCCCCTGGTGCCGCGTGGCAGCGGTCCGCCGGGCCCGCCGGGCCCGCC GGGTCCGCCGGGACCTCCGGGTCCTCCTGGCCCTCCTGGTCCGCCGGGACCC CCGGGTCCGCCGGGCAGCGGTTATATTCCGGAAGCACCGCGTGATGGTCAGG CATACGTGCGTAAAGATGGCGAATGGGTTCTGCTGTCTACCTTTCTGTAAGCGG CCGC-3' (SEQ ID NO: 63)
was synthesized (Genscript), and PCR-amplified from the supplied vector using primers S'-GTGCCGCGTGGATCCGGTCCGCC-S1 (SEQ ID NO: 64) and 5'- ACGATGCGGCCGCTTACAGAAAGGTAGACAG-3' (SEQ ID NO: 65). The PCR product and the plasmid "pSD.COLADuet-1.GST-(PPG)5.0" were both digested with SamHI and Λ/ofl, and then ligated. This resulted in plasmid "pSD.COLADuet-1.GST- (PPG)10-foldon.0".
[00215] The DNA encoding GST-(Pro-Pro-Gly)10-foldon (SEQ ID NO: 66) was then isolated from the plasmid by Λ/col and Wofl digestion and gel extraction, and then ligated into the 1 st MCS of plasmid "pSD.COLADuet-1.0.ALO1", resulting in plasmid "pSD.COLADuet-1. GST-(PPG)i0-foldon.ALO1 ".
[00216] Stop codons were introduced just after (Pro-Pro-G|y)io (SEQ ID NO: 67; sequence given is of the peptide after thrombin cleavage) in both plasmids "pSD.COLADuet-1.GST-(PPG)10-foldon.0" and "pSD.COLADuet-1.GST-(PPG),0- foldon.AL.01" by site-directed mutagenesis per the Stratagene Quickchange protocol using primers 5'-GACCCCCGGGTCCGCCGTGAGCGGTTATATTC-3' (SEQ ID NO: 68) and 5'-GAATATAACCGCTCACGGCGGACCCGGGGGTC-3' (SEQ ID NO: 69). This resulted in plasmids "pSD.COLADuet-1.GST-(PPG)10.0" and "pSD.COLADuet- 1.GST-(PPG)10.ALO1". Similarly, by introducing stop codons 3' to (Pro-Pro-Gly)7 (SEQ ID NO: 60; sequence given is of the peptide after thrombin cleavage) using primers 5'-CTGGCCCTCCTTGACGGGACCCCCGGGTCCG-3' (SEQ ID NO: 70) and 5'-CGGACCCGGGGGTCCCGTCAAGGAGGGCCAG-3' (SEQ ID NO: 71 ),
plasmids "pSD.COLADuet-1.GST-(PPG)7.0" and "pSD.COLADuet-1.GST- (PPG)7.AL01 " were obtained.
[00217] In order to create plasmids encoding GST-foldon, GST-(Pro-Pro-Gly)5- foldon (SEQ ID NO: 72) and GST-(Pro-Pro-Gly)7-foldon (SEQ ID NO: 73), deletion mutagenesis was performed on the plasmids "pSD.COLADuet-1.GST-(PPG)i0- foldon.ALOl" and "pSD.COLADuet-1.GST-(PPG)10-foldon.0" according to the strategy described by Liu et al. (Liu & Naismith, 2008, BMC Biotechnol 8: 91). Briefly, primers were designed to contain "non-overlapping" sequences (primer-plasmid complementary) at their 3' end and "primer-primer complementary" sequences at the 5' end. The melting temperature of non-overlapping sequences (Tm no) was 5 to 10°C higher than the melting temperature of the primer-primer complementary sequences (Tm pp). Twelve cycles of PCR were performed of the following treatment: 95°C for 1 minute, Tm no -5°C for 1 minute, and 72°C for 10 minutes. The PCR cycles were followed by Tm pp - 5°C for 1 minute and 72°C for 30 minutes. The PCR mixture was incubated with Dpn\, and then transformed the PCR product mixture into NovaBlue competent cells, followed by screening the colonies to check the DNA sequence. Similarly, primers 5'-GGCAGCGGTTATATTCCGGAAGCACCG-3' (SEQ ID NO: 74) and S'-ATATAACCGCTGCCGGATCCACGCGGAACCAGATCC-S' (SEQ ID NO: 75) were used to generate plasmid "pSD.COLADuet-1. GST-foldon.0". Using primers 5'- CGCGTGGATCCGGTCCTCCTGGCCCTCCTGGTC-3" (SEQ ID NO: 76) and 5'- GGATCCACGCGGAACCAGATCCGATTTTG-3' (SEQ ID NO: 77), plasmids "pSD.COLADuet-1.GST-(PPG)5-foldon.AL01 " and "pSD.COLADuet-1.GST-(PPG)5- foldon.0" were generated, and PCR with primers 5'- GGCAGCGGTTATATTCCGGAAGCACCG-3' (SEQ ID NO: 78) and 5'- ATATAACCGCTGCCAGGAGGGCCAGGAGGACCC-3' (SEQ ID NO: 79) resulted in plasmids "pSD.COLADuet-1.GST-(PPG)7-foldon.AL01" and "pSD.COLADuet-1.GST- (PPG)7-foldon.0n.
[00218] The proteins containing foldon were cleaved by Thrombin CleanCleave™ Kit (Sigma), and the cleaved products were separated from GST tag and uncleaved products by applying the mixture to glutathione affinity resin and collecting the flow through. The peptides were then concentrated using a 3 kDa cut off Amicon protein concentrator (Millipore), heated at 95 °C for 5 minutes, and applied to a 0.2 pm spin filter microcon (Millipore) to remove possible residual protein impurities. The purity of the products was checked by SDS-PAGE and analytical HPLC (Waters), and the final peptide concentration was determined by measuring UV28onm in Nanodrop spectrophotometer and analytical HPLC.
υ
[00219] (Pro-Pro-Gly)5-foldon (SEQ ID NO: 80; sequence given is of the peptide after thrombin cleavage) and (Pro-Pro-Gly)7-foldon (SEQ ID NO: 81 ; sequence given is of the peptide after thrombin cleavage) constructs were hydroxylated to different extents by varying culture conditions and measuring the resulting melting 5 temperatures by circular dichroism using a previously described method (see Boudko et a/., 2002, "Nucleation and propagation of the collagen triple helix in single-chain and trimerized peptides: transition from third to first order kinetics," J. Mol. Biol. 317: 459-70). The spectra of the peptides (55 μΜ in DPBS buffer) were acquired in Jasco J-815 CD spectrometer with a 1 mm path length quartz cell. The ellipticity at 210 nm
10 was then monitored from -10°C to 80°C as the temperature was increased at a rate of 1 °C per minute. The thermal transition curve was defined as three phases: pre- melt, melting, and post-melt, which were each linearly fit into a line. The value of Tmei, was determined as the temperature at the midpoint of the intersections. Melting points were found to increase with hydroxylation level for both constructs (Figure
15 21A).
[00220] The system was then used to investigate how P4H interacts with collagen as it folds. A series of (Pro-Pro-Gly)n constructs were produced, wherein n = 5 ,7 ,and 10, that were either expressed as fusions to a foldon domain or left unfused. These constructs were chosen for having melting points ranging from well above culture
20 conditions for unhydroxylated (Pro-Pro-Gly)10-foldon (SEQ ID NO: 62; sequence given is of the peptide after thrombin cleavage) (63 ± 2 °C) to not capable of forming trimers even when fully hydroxylated ((Pro-Hyp-Gly)5, SEQ ID NO: 58). This series of collagenous materials was produced in bacteria coexpressing both P4H and AL01 in M9 minimal media plus 0.4% tryptone and 0.4% glycerol. Foldon-fused Pro-Pro-Gly
25 repeats consistently exhibited lower extents of hydroxylation than their unfused counterparts (Figure 21 B). Also, the longer Pro-Pro-Gly repeats were disproportionately less hydroxylated (Figure 21 B). These data indicate that P4H- mediated hydroxylation is dependent on the folded state of the collagenous material in the E. coli expression system.
30 Example 8: Preparation of LH3-encoding plasmid
[00221] A plasmid vector encoding human lysyl hydroxylase 3 (GenBank Accession No. NM_001084, obtained from Origene) (SEQ ID NO: 17, nucleotide; SEQ ID NO: 18, protein) was prepared as follows (also described in Ding et al. (2012), "Synthesis and Assembly of Functional High Molecular Weight Adiponectin 35 Multimers in an Engineered Strain of Escherichia coli," BioMacromolecules 13: 1035-
42; which is incorporated herein by reference in its entirety). DNA encoding the mature LH3 peptide was amplified by PCR using the following primers:
Forward: 5'-ACTGACATATGTCCGACCGGCCCCGGGGC-3' (SEQ ID NO:82);
Reverse: 5'-ATCGACTCGAGTCAGGGGTCGACAAAGGACACCATGATG-3' (SEQ ID NO:83).
The fragment produced by this amplification introduced an Nde\ restriction enzyme recognition site at the 5' end of the fragment and an Xho\ site at the 3' end. The fragment was digested with Nde\ and ΧΛοΙ and the ligated into the second MCS of the pCDFDuet-1 vector using T4 ligase, to produce the plasmid identified as pSD.CDFDuet-1.0-LH3 (shown in Figure 22B).
Example 9: Preparation of human adiponectin and fragment-encoding plasmid
[00222] A plasmid vector encoding a fragment of human adiponectin (GenBank Accession No. NM_004797, obtained from Thermo Fisher Scientific) was prepared as follows. A fragment of adiponectin comprising the collagenous domain was prepared by PCR from adiponectin cDNA using the following primers:
Forward: 5'-ACTGAGGATCCGATCCAGGTCTTATTGGTCCTAAGGGAGAC-3' (SEQ ID NO: 84)
Reverse: S'-CGATAGCGGCCGCTTAGCCTTGGATTCCCGGAAAGCCTCG-S' (SEQ ID NO: 85).
The fragment produced by this amplification introduced a SamHI restriction enzyme recognition site at the 5' end of the fragment and a stop codon and a Λ/ofl site at the 3' end. The fragment was digested with SamHI and Λ/ofl and ligated into the vector pGEX4T-1 to create a vector encoding a fusion protein between the adiponectin fragment (AQ frag) and glutathione-S-transferase (GST) comprising an intervening thrombin protease cleavage site. The resulting plasmid was identified as pSD.GEX4T-1.GST-(AQfrag).
[00223] This plasmid was used to introduce the GST-thrombin cleavage-AQfrag sequence into the 1st MCS of pCOLADuet-1 by PCR amplification using the following primers:
Forward: 5'- CAGCTACCATGGGTTCCCCTATACTAGGTTATTGGAAAATTAAGGGCC-3' (SEQ ID NO:86);
Reverse: 5'-CGATAGCGGCCGCTTAGCCTTGGATTCCCGGAAAGCCTCG-3' (SEQ ID NO:87).
The fragment produced by this amplification introduced an Nco\ restriction enzyme recognition site on the 5' side of the translation initiation codon of the GST-AQfrag) adiponectin protein fragment and retained the stop codon and Not\ site at the 3' end of the fragment. The fragment was digested with Λ/col and Λ/οίΙ and ligated into the 1st MCS of both the empty pCOLADuet-1 vector and the pSD.COLADuet-1.0-ALO1 plasmid, resulting ion the plasmids pSD.COLADuet1.GST-(AQfrag).0 and pSD.COLADuet-1.GST-(AQFrag).(AL01 ), respectively.
[00224] A plasmid encoding human adiponectin (GenBank Accession No. NM_004797, obtained from Thermo Fisher Scientific) was prepared as follows. A fragment encoding adiponectin was prepared by PCR from adiponectin cDNA using the following primers:
Forward: S'-CAGTAGGCGCGCCCCGGTCATGACCAGGAAACCACG (SEQ ID NO:88)
Reverse: 5'-CTAGTGCGGCCGCTCAGTTGGTGTCATGGTAGAGAAGAAAGCCTG (SEQ ID NO:89).
The fragment produced by this amplification introduced an Asc\ restriction enzyme recognition site on the 5' end of the fragment and a stop codon and Λ/οίΙ site at the 3' end. The fragment was digested with Ascl and Nott and ligated after the His6 tag in the 1st MCS of both the empty pCOLADuet-1 vector and the pSD.COLADuet-1.0- AL01 plasmid, resulting in the plasmids pSD.COLADuet1.GST-(AdipoQ).0 and pSD.COLADuet-1.His-(AdipoQ).(AL01 ), respectively.
Example 10: Adiponectin expression, purification and characterization of hydroxylation
[00225] The plasmid pSD.COLADuet-1.GST-(AQfrag).0 or pSD.COLADuet- 1.GST-(AQfrag).AL01 was transformed or co-transformed with pBK1.PDI1.P4H7 and pSD.CDFDuet-1.0.LH3 into Origami 2 (DE3) competent cells as described above. In each case a starter culture was grown overnight in LB broth supplemented with 30 pg/ml kanamycin when a pCOLADuet-1 vector construct was transformed, 200 pg/ml ampicillin when pBK1.PDI1.P4H7 was transformed, and 50 pg/ml spectinomycin when a pCDFDuet-1 vector construct was transformed. When all three antibiotics were in use, the dose for each of the antibiotics was reduced by half. The starter culture was used to inoculate flasks of 1 L of the LB broth with appropriate antibiotics.
The culture was incubated at 37 °C (250 rpm) until ODeoo reached 0.25-0.3, and then induced with 50 μΜ isopropyl thiogalactoside (IPTG) (US Biologicals, Swampscott, MA) and simultaneously supplemented with 1 mM Fe(ll)S04 (Sigma), and expressed at 23 °C (250 rpm) for 14-18 h. Cells were harvested, resuspended in lysis buffer (Dulbecco's Phosphate Buffered Saline (DPBS) plus 5mM EDTA, and then lysed by sonication. The lysate supernatants were collected after centrifugation (30,000 g, 45 min, 4°C) and incubated with glutathione affinity resin at 4°C for 1 h. The resin was washed with DPBS, and then the GST tagged proteins were eluted with 50 mM Tris- HCI, 10 mM reduced glutathione, pH 8.0. The proteins were then concentrated and buffer exchanged into DPBS using 10 kDa cut off Amicon protein concentrator.
[00226] The concentrations of the purified proteins were determined by UV280nm with a Nanodrop spectrophotometer (Thermo Scientific). In order to remove GST tags from the collagenous peptides, 4 units thrombin (MP Biomedical) was incubated with 75 yg of protein at room temperature for 2 h in a final volume of 60 μΙ in DPBS; the samples were then boiled and the AQfrag peptide was recovered by taking the supernatant. The samples were analyzed by liquid chromatography-mass spectrometry (LC-MS, Waters) equipped with a diode array detector as well as a quadrupole mass spectrometer, with a gradient of 5-95% acetonitrile over 1 h.
[00227] The GST tagged AQfrag peptides were purified from cell lysates as set forth above by glutathione affinity, liberated from their purification tags by thrombin cleavage, and then analyzed by LC-MS (Fig. 24D). When AQfrag was co-expressed with only P4H, the major peak of the fragment was unhydroxylated because ascorbate was not available for the P4H activity; P4H was activated in E. coli cytosol when ALO was also co-expressed to biosynthesize ascorbate or ascorbate analogs, as shown by the characteristic mass spectrum with m/z shifts of 8 units.
[00228] After successfully activating P4H to hydroxylate prolines in the natural collagenous sequence of adiponectin, the hydroxylase activity of human LH3 was determined in E. coli (Fig. 24E and F). These results showed that LH3 was indeed active in the cytosol of E. coli when ALO was co-expressed. Interestingly, LH3 was showed a similar level of activity even when ALO was not co-expressed. Similar to the observation of P4H activity under certain conditions in the cytosol of this E. coli strain, LH3 has an ascorbate-independent mode of activation in these cells.
Example 11 : Analysis of Multimerization of Adiponectin expressed in E. coli
[00229] The plasmid pSD.COLADuet-LHis-AdipoQ.O or pSD.COLADuet-1.His- AdipoQ.ALOI was transformed or co-transformed with pBK1.PDI1.P4H7 and
pSD.CDFDuet-1.0.LH3 into Origami 2 (DE3) competent cells as described herein. After overnight culture of the cells in 2 ml LB broth with appropriate antibiotics, 10 ml of the LB broth with appropriate antibiotics was inoculated with 250 μΙ overnight culture for each culture condition. The cultures were incubated at 37 °C (250 rpm) until ODsoo reached 0.25-0.3, and then induced with 50 μΜ IPTG and supplemented with 1 mM Fe(ll)S0 , and expressed at 23 °C (250 rpm) for 14-18 h. Optimization of adiponectin expression was accomplished using variant induction temperatures (16°C, 23°C, and 37°C) and times (24 h and 48 h).
[00230] Cells were harvested, resuspended in lysis buffer (DPBS plus 5 mM EDTA), and then lysed by sonication. The lysate supernatants were collected and analyzed by SDS-PAGE and Western blot. Samples were incubated with or without reducing agents (2-mercaptoethanol) for 5 min at 4 °C , followed by boiling or not. After separation with 4-12% gradient gels (Life Technologies) at 4 °C, proteins were analyzed with Western Blot using anti-adiponectin antibody (BD Biosciences) as the primary antibody.
[00231] The results of these Western blot experiments are shown in Figures 25A and 25B. In the unheated, unreduced conditions, adiponectin showed a wide range of electrophoretic mobilities when it was co-expressed with LH3, P4H, and ALO, corresponding to different multimeric states. When adiponectin was expressed without either hydroxylase, adiponectin multimers were present in the low molecular weight range. To characterize the nature of the different species, the samples were also analyzed under heated, unreduced, or heated, reduced conditions. When the samples were both boiled and reduced, all the multimers were denatured, and monomer bands of approximately 28 kDa were seen as the sole bands for all co- expression conditions. Under conditions where the samples were heat-denatured but not reduced, higher order multimers requiring collagenous domain-mediated trimerization were dissociated into monomers and disulfide bond bridged dimers (around 56 kDa). Unlike monomers and dimers, adiponectin multimers bigger than dimers don't migrate proportional to their molecular masses in SDS-PAGE. as they retain certain structures under the SDS-PAGE condition. Usually, adiponectin trimers migrated only slightly slower than dimers, followed by MMW multimers (started with hexamers), and then HMW multimers (12-18mers). HMW adiponectin was observed only when both P4H and LH3 were activated, which confirmed that both proline and lysine hydroxylation are necessary for adiponectin HMW formation. These results also showed that 23'C induction for 24 h generated adiponectin with the highest ratio of HMW multimers.
Example 12: Recombinant adiponectin expression, purification and optimization
[00232] Cultures of Origami 2 bacterial cells containing plasmids pSD.COLADuet- I.His-AdipoQ.ALOI, pBK1.PDI1.P4H7 and pSD.CDFDuet-1.0.LH3 were cultured under optimal conditions in LB broth with appropriate antibiotics at 37°C. When ODeoo reached 0.25-0.3, protein expression was induced with 50 μΜ IPTG and 1 mM Fe(ll)S0 was supplemented to the medium. The cultures were shaken at 23°C for 24 h, and then cells pellets were harvested by centrifugation. The cells were resuspended in lysis buffer (50 mM NaH2P04, 300 mM NaCI, 10 mM Imidazole, pH 8.0), and the proteins were purified with Chelating Sepharose Fast Flow nickel- charged resin under native conditions with imldazole-based competitive elution. The purified proteins were buffer exchanged into 1X Hank's Buffered Salt Solution (HBSS) and stored in HBSS with 15% glycerol in -80 °C after flash freezing in liquid nitrogen.
[00233] The results of these experiments are shown in Figure 26. The results were consistent with those obtained from small scale test expressions. Adiponectin was assembled into higher order structures, including HMW multimers, when P4H and LH3 were both activated in the expression system, while most of the proteins were monomers, dimers, or other low molecular weight multimers when the hydroxylases were not co-expressed.
Example 13: Adiponectin Activity Assays
[00234] Adiponectin activity was assessed using human umbilical vein endothelial cells (HUVECs), purchased from Cell Applications (San Diego, CA); passages 3 to 5 were used in the experiments set forth herein. Cell viability in the presence of adiponectin was studied by MTS assay using the CellTiter 96 AQueous kit (Promega). Briefly, cells were plated at a density of 104 cells per well in a 96-well plate and incubated in endothelial cell growth medium for 20 h. The cells were washed by HBSS, and then fresh Dulbecco's Modified Eagle Medium (DMEM) containing 0.5% FBS was added to each well, supplemented with different concentrations of recombinant adiponectin. In positive controls, cells were incubated with endothelial cell growth medium. After 24 h, the cells were washed with HBSS, and fresh DMEM containing 0.5% FBS was added to each well, and the 490 nm absorbance was measured with 2 h incubations with MTS. The cell death was quantified by the percentage of the decrease in 490 nm absorbance relative to positive controls. At least 3 experiments were done for the same conditions.
[00235] These results were used to confirm biological activity of the recombinant adiponectin produced in E. coli as set forth herein. Recombinant adiponectin with HMW multimers was assessed for its activity to suppress endothelial cell apoptosis using HUVEC cells. Apoptosis was induced by serum deprivation, and the protective effect of adiponectin was investigated by adding different concentrations of adiponectin multimers to the cells. Cell viability was quantified by MTS assay, and cell death percentage was calculated by comparing to counts of cells cultured in complete medium. When no adiponectin was added to the cells cultured in serum- deprived medium, the majority of cells were dead after 24 h (Fig. 27). Recombinant adiponectin co-expressed with the essential post-translational modification enzymes as set forth herein showed a much more significant effect in preventing the HUVECs from death compared to adiponectin expressed without post-translational enzyme co- expression. This result indicated that the recombinant adiponectin modified using £. coli as set forth herein not only assembles into HMW multimers, but also that these multimers are active in exerting their biological functions
Example 14: His-LH3 gene construction, expression, purification and characterization.
[00236] To introduce an N-terminal His-tag to LH3 for the ease of purification, PCR was performed on the plasmid pSD.CDFDuet-1.0.LH3 with primers:
Forward: 5'- AAGGAGATATACATATGCACCATCACCATCACCACGGCAGCTCCGACC GGCCCCGGGGC-3' (SEQ ID NO:90);
Reverse: 5'-CATATGTATATCTCCTTCTTATACTTAACTAATATACTAAGATGGGG- 3' (SEQ ID NO:91 ).
The PCR mixture was incubated with Dpnl, and then transformed into NovaBlue competent cells, followed by screening the colonies to check the DNA sequence. The plasmid with the correct sequence of His-tagged LH3 is named pSD.CDFDuet- 1.0.His-LH3. The plasmid was transformed into Origami 2 (DE3) competent cells. The bacterial cells were cultured in LB broth with 50 pg/ml spectinomycin at 37°C. When ΟΟβοο reached 0.6, protein expression was induced with 50 μΜ IPTG. The cultures were shaken at 23°C overnight, and then cells pellets were harvested by centrifugation. The cells were resuspended in lysis buffer (50 mM NaH2P04, 300 mM NaCI, 10 mM Imidazole, pH 8.0), and the proteins were purified with Chelating Sepharose Fast Flow nickel-charged resin under native conditions with imidazole- based competitive elution.
[00237] For the in vitro His-LH3 activity assay, 0.2 mg of purified unhydroxylated GST-AQfrag was incubated in 50 mM Tris-HCI buffer, pH 7.8 containing bovine serum albumin (1 mg/mL), catalase (100 g/mL), dithiothreitol (100 μΜ), FeS04 (50 μΜ), α-ketoglutarate (500 μΜ), and ascorbate 2 mM. Purified His-LH3 (1 μΜ) was added to the final mixture. The reactions took place for 6 h at 37 °C. The samples were then incubated with thrombin. After boiling, the recovered peptides in the supernatant were analyzed by LC-MS (Figure 29).
[00238] Having described the invention in detail and by reference to specific embodiments thereof, it will be apparent that modifications and variations are possible without departing from the scope of the invention defined in the appended claims. More specifically, although some aspects of the present invention are identified herein as particularly advantageous, it is contemplated that the present invention is not necessarily limited to these particular aspects of the invention.
Claims
1. A bacterial cell capable of expressing recombinant proteins comprising:
a) one or more nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase; and
b) one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme.
2. The bacterial cell of claim 1 , wherein the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector, and the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme comprise a second expression vector.
3. The bacterial cell of claim 1 , wherein the nucleic acids encoding the sugar- 1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and the one or more ascorbate-dependent biosynthetic enzymes comprise a single expression vector.
4. The bacterial cell of any one of claims 1-3,
wherein the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and wherein the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase.
5. The bacterial cell of claim 4, wherein the sugar-1 ,4-lactone oxidase is D- arabinono-1 ,4-lactone oxidase.
6. The bacterial cell of any one of claims 1-5, wherein the ascorbate-dependent biosynthetic enzyme is a hydroxylase.
7. The bacterial cell of claim 6, wherein the hydroxylase is prolyl-4-hydroxylase, prolyl-3-hydroxylase, or lysyl-5-hydroxylase, or a combination of prolyl-4- hydroxylase and lysyl-5-hydroxylase or prolyl-3-hydroxylase and lysyl-5- hydroxylase.
8. The bacterial cell of claim 6, wherein the hydroxylase is HIF prolyl hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase.
9. The bacterial cell of claim 7, wherein the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
10. The bacterial cell of claim 6, further comprising one or more nucleic acids encoding a peptide or a protein to be hydroxylated.
11. The bacterial cell of claim 10, wherein the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise the first expression vector; the one or more nucleic acids encoding the hydroxylase comprise the second expression vector; and the one or more nucleic acids encoding the peptide or the protein to be hydroxylated comprise a third expression vector.
12. The bacterial cell of claim 10, wherein the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4-lactone dehydrogenase and the peptide or the protein to be hydroxylated comprise a first expression vector, and the one or more nucleic acids encoding the hydroxylase comprise a second expression vector.
13. The bacterial cell of claim 10, wherein the one or more nucleic acids encoding the hydroxylase and the peptide or protein to be hydroxylated comprise a first expression vector, and the one or more nucleic acids encoding the sugar-1 ,4- lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a second expression vector.
14. The bacterial cell of claim 10, wherein the one or more nucleic acids encoding the hydroxylase and the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector, and the one or more nucleic acids encoding the peptide or the protein to be hydroxylated comprise a second expression vector.
15. The bacterial cell of claim 10, wherein the nucleic acids encoding the sugar- 1 , 4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, the one or more nucleic acids encoding the hydroxylase, and the peptide or protein to be hydroxylated comprise a single expression vector.
16. The bacterial cell of any one of claims 10-15, wherein the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and wherein the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase.
17. The bacterial cell of claim 16, wherein the sugar-1 ,4-lactone oxidase is D- arabinono-1 ,4-lactone oxidase.
18. The bacterial cell of any one of claims 10-17, wherein the ascorbate- dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, or lysyl-5-hydroxylase, or a combination of prolyl-4-hydroxylase and lysyl-5- hydroxylase or prolyl-3-hydroxylase and lysyl-5-hydroxylase.
19. The bacterial cell of any one of claims 10-17, wherein the ascorbate- dependent biosynthetic enzyme is HIF prolyl hydroxylase, aspartyl beta- hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase.
20. The bacterial cell of claim 18, wherein the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase lysyl-5-hydroxylase, or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
21. The bacterial cell of any one of claims 7, 9, 18, and 20, wherein the peptide or the protein to be hydroxylated is collagen or a protein comprising a collagenous domain.
22. The bacterial cell of any one of claims 1-21 that is an Escherichia coli cell.
23. A method of making a post-translationally hydroxylated recombinant protein comprising expressing in the bacterial cell according to claim 1 one or more nucleic acids encoding a peptide or a protein to be hydroxylated, wherein the ascorbate-dependent biosynthetic enzyme is a hydroxylase.
24. The method of claim 23, wherein the bacterial cell comprises:
a) a first expression vector comprising the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase;
b) a second expression vector comprising the one or more nucleic acids encoding the hydroxylase; and c) a third expression vector comprising the one or more nucleic acids encoding the peptide or the protein to be hydroxylated.
25. The method of claim 23, wherein the bacterial cell comprises:
a) a first expression vector comprising the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and the peptide or the protein to be hydroxylated; and b) the second expression vector comprising the one or more nucleic acids encoding the hydroxylase.
26. The method of claim 23, wherein the bacterial cell comprises:
a) a first expression vector comprising the one or more nucleic acids encoding the hydroxylase and the peptide or the protein to be hydroxylated; and
b) a second expression vector comprising the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase.
27. The method of claim 23, wherein the bacterial cell comprises:
a) a first expression vector comprising the one or more nucleic acids encoding the hydroxylase and the sugar-1 ,4-lactone oxidase or sugar- 1 ,4-lactone dehydrogenase; and
b) a second expression vector comprising the one or more nucleic acids encoding the peptide or the protein to be hydroxylated.
28. The method of claim 23, wherein the bacterial cell comprises an expression vector comprising the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, the one or more nucleic acids encoding the hydroxylase, and the peptide or the protein to be hydroxylated.
29. The method of any one of claims 23-28,
wherein the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and wherein the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase.
30. The method of claim 29, wherein the sugar-1 ,4-lactone oxidase is D- arabinono-1 ,4-lactone oxidase.
31. The method of any one of claims 23-30, wherein the hydroxylase is prolyl-4- hydroxylase, prolyl-3-hydroxylase, or lysyl-5-hydroxylase, or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase or prolyl-3-hydroxylase and lysyl-5-hydroxylase.
32. The method of any one of claims 23-30, wherein the hydroxylase is HIF prolyl hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase.
33. The method of claim 31 , wherein the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
34. The method of claim 31 or 33, wherein the peptide or the protein to be hydroxylated is collagen or a protein comprising a collagenous domain.
35. The method of any one of claims 23-34, wherein the bacterial host cell is Escherichia coli.
36. A post-translationally hydroxylated recombinant molecule comprising a collagen domain produced by a method comprising the step of co-expressing in a bacterial cell one or more nucleic acids encoding a protein comprising a collagenous domain, one or more nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 , 4-lactone dehydrogenase, and one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme, wherein the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3- hydroxylase, or lysyl-5-hydroxylase.
37. The molecule comprising a collagen domain of claim 36, wherein the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4- lactone dehydrogenase comprise a first expression vector; the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme comprise a second expression vector; and the one or more nucleic acids encoding a protein comprising a collagenous domain comprise a third expression vector.
38. The molecule comprising a collagen domain of claim 36, wherein the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 , 4- lactone dehydrogenase and a protein comprising a collagenous domain comprise a first expression vector, and the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme comprise the second expression vector.
39. The molecule comprising a collagen domain of claim 36, wherein the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme and a protein comprising a collagenous domain comprise a first expression vector, and the one or more nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a second expression vector.
40. The molecule comprising a collagen domain of claim 36, wherein the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme and the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase comprise a first expression vector, and the one or more nucleic acids encoding a protein comprising a collagenous domain comprise a second expression vector.
41 . The molecule comprising a collagen domain of claim 36, wherein the nucleic acids encoding the sugar-1 , 4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, the ascorbate-dependent biosynthetic enzyme, and protein comprising a collagenous domain comprise a single expression vector.
42. The molecule comprising a collagen domain any one of claims 36-41 ,
wherein the sugar-1 ,4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase, L-gulono-1 ,4-lactone oxidase, or D-glucono-1 ,4-lactone oxidase; and wherein the sugar-1 ,4-lactone dehydrogenase is D-arabinose dehydrogenase, L-gulono-1 ,4-lactone dehydrogenase, L-gulono-y-lactone dehydrogenase, D-glucose dehydrogenase, L-galactono-1 ,4-lactone dehydrogenase, L-galactono-y-lactone dehydrogenase, L-sorbosone dehydrogenase, or 2-ketogluconate dehydrogenase.
43. The molecule comprising a collagen domain of claim 42, wherein the sugar- 1 , 4-lactone oxidase is D-arabinono-1 ,4-lactone oxidase.
44. The molecule comprising a collagen domain of claim 43, wherein the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
45. The molecule comprising a collagen domain of any one of claims 36-43, wherein the bacterial host cell is Escherichia coli.
46. A Gram-negative bacterial cell capable of expressing recombinant proteins comprising one or more nucleic acids encoding one or more ascorbate- dependent biosynthetic enzymes or an ascorbate-analog-dependent biosynthetic enzyme,
wherein the one or more ascorbate-dependent biosynthetic enzymes is expressed in the periplasmic space of the bacterial cell; and
wherein ascorbate or an ascorbate analog is supplied exogenously.
47. The bacterial cell of claim 46, wherein the ascorbate-dependent biosynthetic enzyme is a hydroxylase.
48. The bacterial cell of claim 47, further comprising one or more nucleic acids encoding a peptide or a protein to be hydroxylated, wherein the peptide or the protein to be hydroxylated is expressed in the periplasmic space of the bacterial cell.
49. The bacterial cell of claim 48, wherein the one or more nucleic acids encoding the hydroxylase comprise a first expression vector, and the one or more nucleic acids encoding the peptide or protein to be hydroxylated comprise a second expression vector.
50. The bacterial cell of claim 48, wherein the nucleic acids encoding the hydroxylase and the peptide or protein to be hydroxylated comprise a single expression vector.
51. The bacterial cell of any one of claims 46-50, wherein the hydroxylase is prolyl-4-hydroxylase, prolyl-3-hydroxylase, or lysyl-5-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase or prolyl-3- hydroxylase and lysyl-5-hydroxylase.
52. The bacterial cell of any one of claims 46-50, wherein the hydroxylase is HIF prolyl hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase.
53. The bacterial cell of claim 51 , wherein the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
54. The bacterial cell of claims 51 or 53, wherein the peptide or protein to be hydroxylated is collagen or a protein comprising a collagenous domain.
55. The bacterial cell of any one of claims 46-54 that is an Escherichia coli cell.
56. A kit for producing a post-translationally hydroxylated recombinant protein comprising the bacterial cell according to any one of claims 1-22, 46-55, or 74-75.
57. A method of making a post-translationally hydroxylated recombinant protein comprising expressing in the Gram-negative bacterial cell of claim 48 one or more nucleic acids encoding a peptide or protein to be hydroxylated.
58. The method of claim 57, wherein the one or more nucleic acids encoding one or more ascorbate-dependent hydroxylases comprise a first expression vector, and the nucleic acid encoding the protein comprises a second expression vector.
59. The method of claim 57, wherein the nucleic acids encoding one or more ascorbate-dependent hydroxylases and the protein comprise a single expression vector.
60. The method of any one of claims 57-59, wherein the hydroxylase is prolyl-4- hydroxylase, prolyl-3-hydroxylase, or lysyl-5-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase or prolyl-3-hydroxylase and lysyl-5-hydroxylas.
61. The method of any one of claims 57-59, wherein the hydroxylase is HIF prolyl hydroxylase, aspartyl beta-hydroxylase, asparaginyl beta-hydroxylase, or HIF asparaginyl hydroxylase.
62. The method of claim 60, wherein the hydroxylase is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
63. The method of claims 60 or 62, wherein the protein is collagen or a protein comprising a collagenous domain.
64. The method of any one of claims 57-63, wherein the bacterial host cell is Escherichia coli.
65. A post-translationally hydroxylated recombinant molecule comprising a collagenous domain produced in a Gram-negative bacterial host cell co- expressing nucleic acids encoding said molecule comprising a collagenous domain and one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme, wherein the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase, prolyl-3-hydroxylase, or lysyl-5-hydroxylase.
66. The molecule comprising a collagenous domain of claim 65, wherein the one or more nucleic acids encoding the ascorbate-dependent biosynthetic enzyme comprise a first expression vector, and the nucleic acids encoding the molecule comprising a collagenous domain comprises a second expression vector.
67. The molecule comprising a collagenous domain of claim 65, wherein the nucleic acids encoding the one or more ascorbate-dependent biosynthetic enzyme and the molecule comprising a collagenous domain comprise a single expression vector.
68. The molecule comprising a collagenous domain of claim 65, wherein the ascorbate-dependent biosynthetic enzyme is prolyl-4-hydroxylase or a combination of prolyl-4-hydroxylase and lysyl-5-hydroxylase.
69. The molecule comprising a collagenous domain of any one of claims 65-68, wherein the bacterial host cell is Escherichia coli.
70. The bacterial cell of claim 1 or 46, wherein one or more of the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase and one or more ascorbate-dependent biosynthetic enzymes are incorporated into the bacterial chromosome.
71. The bacterial cell of claim 10 or 48, wherein one or more of the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, the one or more hydroxylases, and the peptide or protein to be hydroxylated are incorporated into the bacterial chromosome.
72. The molecule comprising a collagenous domain of claim 36, wherein one or more of the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar- 1 ,4-lactone dehydrogenase, the one or more hydroxylase, and the molecule comprising a collagenous domain are incorporated into the bacterial chromosome.
73. The method of claim 23 or 57, wherein one or more of the nucleic acids encoding the sugar-1 ,4-lactone oxidase or sugar-1 ,4-lactone dehydrogenase, the one or more hydroxylase, and the peptide or protein to be hydroxylated are incorporated into the bacterial chromosome.
74. A bacterial cell according to claim 1 capable of producing a hydroxylated recombinant protein comprising a collagenous domain that is sufficiently hydroxylated to form a triple-helical structure.
75. A bacterial cell according to claim 10 that produces a hydroxylated recombinant protein comprising a collagenous domain that is sufficiently hydroxylated to form a triple-helical structure.
76. The method of claim 23, wherein the post-translationally hydroxylated recombinant protein comprises a collagenous domain that is sufficiently hydroxylated to form a triple-helical structure.
77. The post-translationally hydroxylated recombinant molecule comprising a collagenous domain of claim 36, wherein the collagenous domain is sufficiently hydroxylated to form a triple-helical structure.
78. The Gram-negative bacterial cell of claim 46, that is capable of producing a hydroxylated recombinant protein comprising a collagenous domain that is sufficiently hydroxylated to form a triple-helical structure.
79. The method of claim 57 wherein the post-translationally hydroxylated recombinant protein comprises a collagenous domain that is sufficiently hydroxylated to form a triple-helical structure.
80. The post-translationally hydroxylated recombinant molecule comprising a collagenous domain of claim 65, wherein the collagenous domain is sufficiently hydroxylated to form a triple-helical structure.
81. A bacterial cell according to claim 1 capable of producing a hydroxylated recombinant protein comprising a foldon domain of SEQ ID NO: 61.
82. A bacterial cell according to claim 10 that produces a hydroxylated recombinant protein comprising a foldon domain of SEQ ID NO: 61.
83. The method of claim 23, wherein the post-translationally hydroxylated recombinant protein comprises a foldon domain of SEQ ID NO: 61.
84. The post-translationally hydroxylated recombinant collagen molecule of claim 36, comprising a foldon domain of SEQ ID NO: 61.
85. The Gram-negative bacterial cell of claim 46, that is capable of producing a hydroxylated recombinant protein comprising a foldon domain of SEQ ID NO: 61.
86. The method of claim 57 wherein the post-translationally hydroxylated recombinant protein comprises a foldon domain of SEQ ID NO: 61.
87. The post-translationally hydroxylated recombinant collagen molecule of claim 65, comprising a foldon domain of SEQ ID NO: 61.
88. The bacterial cell of claim 81 , 82, or 85, wherein the foldon domain is fused to a terminus of the hydroxylated recombinant protein and facilitates self- assembly of the protein into a triple-helical structure.
89. The method of claim 83 or 86, wherein the foldon domain is fused to a terminus of the hydroxylated recombinant protein and facilitates self-assembly of the protein into a triple-helical structure.
90. The post-translationally hydroxylated recombinant collagen molecule of claim 84 or 87, wherein the foldon domain is fused to a terminus of the hydroxylated recombinant protein and facilitates self-assembly of the protein into a triple- helical structure.
91. An engineered bacterial cell-based system capable of expressing recombinant proteins comprising:
a) one or more nucleic acids encoding a sugar-1 ,4-lactone oxidase or a sugar-1 ,4-lactone dehydrogenase; and
b) one or more nucleic acids encoding an ascorbate-dependent biosynthetic enzyme,
wherein the nucleic acids are either genes inserted into the bacterial genome or plasmids.
92. The bacterial cell of claim 21 , wherein the protein comprising a collagenous domain is adiponectin.
93. The method of claim 34, wherein the protein comprising a collagenous domain is adiponectin.
94. The bacterial cell of claims 51 or 53, wherein the protein comprising a collagenous domain is adiponectin.
95. The method of claims 60, 62 or 79, wherein the protein comprising a collagenous domain is adiponectin.
96. The bacterial cell of claims 74 or 75, wherein the protein comprising a collagenous domain is adiponectin.
97. The method of claim 76, wherein the protein comprising a collagenous domain is adiponectin.
98. The post-translationally hydroxylated recombinant molecule of claim 77 that is adiponectin. The Gram-negative bacterial cell of claim 78, wherein the protein comprising a collagenous domain is adiponectin.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161495668P | 2011-06-10 | 2011-06-10 | |
| US61/495,668 | 2011-06-10 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012170782A2 true WO2012170782A2 (en) | 2012-12-13 |
| WO2012170782A3 WO2012170782A3 (en) | 2013-03-14 |
Family
ID=46458594
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/041497 Ceased WO2012170782A2 (en) | 2011-06-10 | 2012-06-08 | Production of post-translationally hydroxylated recombinant proteins in bacteria |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2012170782A2 (en) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019067908A1 (en) * | 2017-09-28 | 2019-04-04 | International Dehydrated Foods, Inc. | Compositions and methods for preventing/treating metabolic syndrome |
| CN111087464A (en) * | 2019-12-28 | 2020-05-01 | 河北纳科生物科技有限公司 | Recombinant human III-type collagen with functional structure and expression method thereof |
| EP3684800A4 (en) * | 2017-09-22 | 2021-07-21 | Modern Meadow, Inc. | RECOMBINANT YEAST STEMS |
| US11478504B2 (en) | 2013-07-08 | 2022-10-25 | International Dehydrated Foods, Inc. | Compositions and methods for preventing/treating metabolic syndrome |
| CN115478055A (en) * | 2021-06-15 | 2022-12-16 | 佛山汉腾生物科技有限公司 | A method for regulating the hydroxylation level of recombinant protein |
| CN119505021A (en) * | 2025-01-20 | 2025-02-25 | 内蒙古和讯生物科技有限公司 | A repetitive structural unit recombinant protein cpE2 and its preparation method and application |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5219576A (en) | 1988-06-30 | 1993-06-15 | Collagen Corporation | Collagen wound healing matrices and process for their production |
| US5800811A (en) | 1995-06-06 | 1998-09-01 | Hall; Frederick L. | Artificial skin prepared from coclagen matrix containing transforming growth factor-β having a collagen binding site |
| US5928922A (en) | 1996-04-10 | 1999-07-27 | Academy Of Finland | α2 subunit of prolyl-4-hydroxylase, nucleic acid sequences encoding such subunit and methods for producing the same |
| US20050164345A1 (en) | 1992-06-10 | 2005-07-28 | Kivirikko Kari I. | Synthesis of human procollagens and collagens in recombinant DNA systems |
| US7008397B2 (en) | 2002-02-13 | 2006-03-07 | Percardia, Inc. | Cardiac implant and methods |
| WO2006102944A1 (en) | 2005-03-30 | 2006-10-05 | Henkel Kommanditgesellschaft Auf Aktien | Spackling kit and tool |
-
2012
- 2012-06-08 WO PCT/US2012/041497 patent/WO2012170782A2/en not_active Ceased
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5219576A (en) | 1988-06-30 | 1993-06-15 | Collagen Corporation | Collagen wound healing matrices and process for their production |
| US20050164345A1 (en) | 1992-06-10 | 2005-07-28 | Kivirikko Kari I. | Synthesis of human procollagens and collagens in recombinant DNA systems |
| US5800811A (en) | 1995-06-06 | 1998-09-01 | Hall; Frederick L. | Artificial skin prepared from coclagen matrix containing transforming growth factor-β having a collagen binding site |
| US5928922A (en) | 1996-04-10 | 1999-07-27 | Academy Of Finland | α2 subunit of prolyl-4-hydroxylase, nucleic acid sequences encoding such subunit and methods for producing the same |
| US7008397B2 (en) | 2002-02-13 | 2006-03-07 | Percardia, Inc. | Cardiac implant and methods |
| WO2006102944A1 (en) | 2005-03-30 | 2006-10-05 | Henkel Kommanditgesellschaft Auf Aktien | Spackling kit and tool |
Non-Patent Citations (38)
| Title |
|---|
| AUSUBEL ET AL.: "CURRENT PROTOCOLS IN MOLECULAR BIOLOGY", 1989, GREENE PUBLISHING ASSOCIATES AND WILEY INTERSCIENCE |
| BOUDKO ET AL.: "Nucleation and propagation of the collagen triple helix in single-chain and trimerized peptides: transition from third to first order kinetics", J. MOL. BIOL., vol. 317, 2002, pages 459 - 70, XP004468980, DOI: doi:10.1006/jmbi.2002.5439 |
| CHENG ET AL.: "Collagen VI protects neurons against Ap toxicity", NATURE NEUROSCI., vol. 12, 2009, pages 119 - 121 |
| DING ET AL.: "Synthesis and Assembly of Functiorlal High Molecular Weight Adiponectin Multimers in an Engineered Strain of Escherichia coli", BIOMACROMOLECULES, vol. 13, 2012, pages 1035 - 42, XP055037523, DOI: doi:10.1021/bm2017367 |
| ENGLARD; SEIFTER: "The biochemical functions of ascorbic acid.", ANNUAL REVIEW OF NUTRITION, vol. 6, 1986, pages 365 - 406 |
| FRANK ET AL., J. MOL. BIOL., vol. 308, 2001, pages 1081 - 1089 |
| FRANK ET AL.: "Stabilization of short collagen-like triple helices by protein engineering", J. MOL. BIOL., vol. 308, 2001, pages 1081 - 9, XP004466182, DOI: doi:10.1006/jmbi.2001.4644 |
| INNIS ET AL.: "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| KERSTEEN ET AL., PROTEIN PURIFICATION AND EXPRESSION, vol. 38, 2004, pages 279 - 291 |
| KOBAYASHI ET AL., CIRC. RES., vol. 94, 2004, pages E27 - 31 |
| LEE ET AL., APPL ENVIRON MICROBIOL, vol. 65, 1999, pages 4685 - 7 |
| LEE ET AL., APPL. ENVIRON. MICROBIOL., vol. 65, 1999, pages 4685 - 7 |
| LIU; NAISMITH, BMC BIOTECHNOL, vol. 8, 2008, pages 91 |
| MANIATIS ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL", 1989, COLD SPRING HARBOR LABORATORY |
| OKAMOTO ET AL., CIRCULATION, vol. 106, 2002, pages 2767 - 2770 |
| PAPANIKOLOPOULOU ET AL., J. BIOL. CHEM., vol. 279, 2004, pages 8991 - 8998 |
| PAPANIKOLOPOULOU ET AL., J. MOL. BIOL., vol. 342, 2004, pages 219 - 227 |
| PINKAS ET AL.: "Tunable, post-translational hydroxylation of collagen domains in Escherichia coli", ACS CHEM BIOL., vol. 6, no. 4, 2011, pages 320 - 24, XP002648321 |
| PROCKOP ET AL., N. ENGL. J. MED., vol. 311, 1984, pages 376 - 386 |
| RICHARDS, MOL. ENDOCRINIOL., vol. 20, 2006, pages 1673 - 1687 |
| SCHERER, DIABETES, vol. 55, no. 6, 2006, pages 1537 - 1545 |
| SHIBATA ET AL., NAT. MED., vol. 11, 2005, pages 1096 - 1103 |
| SHORE ET AL., J. ALERGY CLIN. IMMUNOL., vol. 118, 2006, pages 389 - 395 |
| SIEG ET AL.: "A versatile phage lambda expression vector system for cloning in Escherichia coli.", GENE, vol. 75, no. 2, 1989, pages 261 - 70, XP023544217, DOI: doi:10.1016/0378-1119(89)90272-2 |
| SIMPSON; WHITEHEAD, INT. J. BIOCHEM. CELL. BIOL., vol. 42, 2010, pages 785 - 788 |
| SISSOEFF ET AL., J. GEN. VIROL., vol. 86, 2005, pages 2543 - 2552 |
| STETEFELD ET AL., STRUCTURE, vol. 11, 2003, pages 339 - 346 |
| TONELLI ET AL., DIABETES, vol. 53, 2004, pages 1621 - 1629 |
| TRUJILLO ET AL., J INTERN MED, vol. 257, 2005, pages 167 - 175 |
| TSAO ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 29359 - 29362 |
| TSAO ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 50810 - 50817 |
| WACH ET AL.: "MOLECULAR GENETICS OF YEASTS", 1994, IRL PRESS, article "Procedures for isolating yeast DNA for different purposes", pages: 1 - 16 |
| WAKI ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 40352 - 40363 |
| WANG ET AL., J. BIOL. CHEM., vol. 281, 2006, pages 16391 - 16400 |
| WANG; SCHERER, HYPERTENSION, vol. 51, 2008, pages 8 - 14 |
| XU ET AL., CLIN. INVEST., vol. 112, 2003, pages 91 - 100 |
| YAMAUCHI ET AL., CIRC. RES., vol. 94, 2004, pages E27 - 31 |
| YANG ET AL., J. VIROL., vol. 76, 2002, pages 4634 - 4642 |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11478504B2 (en) | 2013-07-08 | 2022-10-25 | International Dehydrated Foods, Inc. | Compositions and methods for preventing/treating metabolic syndrome |
| EP3684800A4 (en) * | 2017-09-22 | 2021-07-21 | Modern Meadow, Inc. | RECOMBINANT YEAST STEMS |
| US11384135B2 (en) | 2017-09-22 | 2022-07-12 | Modern Meadow, Inc. | Recombinant yeast strains |
| WO2019067908A1 (en) * | 2017-09-28 | 2019-04-04 | International Dehydrated Foods, Inc. | Compositions and methods for preventing/treating metabolic syndrome |
| CN111087464A (en) * | 2019-12-28 | 2020-05-01 | 河北纳科生物科技有限公司 | Recombinant human III-type collagen with functional structure and expression method thereof |
| CN111087464B (en) * | 2019-12-28 | 2021-10-29 | 河北纳科生物科技有限公司 | Recombinant human III-type collagen with functional structure and expression method thereof |
| CN115478055A (en) * | 2021-06-15 | 2022-12-16 | 佛山汉腾生物科技有限公司 | A method for regulating the hydroxylation level of recombinant protein |
| CN119505021A (en) * | 2025-01-20 | 2025-02-25 | 内蒙古和讯生物科技有限公司 | A repetitive structural unit recombinant protein cpE2 and its preparation method and application |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2012170782A3 (en) | 2013-03-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20130116412A1 (en) | Production of Post-Translationally Hydroxylated Recombinant Proteins in Bacteria | |
| EP3294762B1 (en) | Expression constructs and methods of genetically engineering methylotrophic yeast | |
| Nozaki et al. | Characterization of the Gene Encoding Serine Acetyltransferase, a Regulated Enzyme of Cysteine Biosynthesis from the Protist ParasitesEntamoeba histolyticaand Entamoeba dispar: REGULATION AND POSSIBLE FUNCTION OF THE CYSTEINE BIOSYNTHETIC PATHWAY IN ENTAMOEBA | |
| WO2012170782A2 (en) | Production of post-translationally hydroxylated recombinant proteins in bacteria | |
| Morales‐Ríos et al. | A novel 11‐kDa inhibitory subunit in the F1FO ATP synthase of Paracoccus denitrificans and related α‐proteobacteria | |
| Kenny et al. | Bacterial expression, purification, and characterization of rat kidney-type mitochondrial glutaminase | |
| US20230399379A1 (en) | Expression of collagen peptide components in prokaryotic systems | |
| ES2583259T3 (en) | New alpha-amidant peptidyl alpha-hydroxyglycine liases | |
| Xie et al. | Effects of thioredoxin: SUMO and intein on soluble fusion expression of an antimicrobial peptide OG2 in Escherichia coli | |
| Diao et al. | Intein-mediated expression is an effective approach in the study of β-defensins | |
| JP5506668B2 (en) | Method for producing cis-4-hydroxy-L-proline | |
| US12221639B2 (en) | Allulose epimerase variant with excellent thermal stability, preparation method therefor, and preparation method for allulose using same | |
| Neubauer et al. | High-level production of human collagen prolyl 4-hydroxylase in Escherichia coli | |
| Shi et al. | Transaminase encoded by NCgl2515 gene of Corynebacterium glutamicum ATCC13032 is involved in γ-aminobutyric acid decomposition | |
| WO2023118318A1 (en) | Improved expression of peptides | |
| EP1164192A1 (en) | Sorbitol dehydrogenase, gene encoding the same and use thereof | |
| US10125353B2 (en) | Recombinant therapeutic glycine N-acyltransferase | |
| Kiema et al. | Organization of the multifunctional enzyme type 1: interaction between N-and C-terminal domains is required for the hydratase-1/isomerase activity | |
| KR20080039879A (en) | Method for producing water-soluble and active recombinant protein using PDI as a fusion partner | |
| KR102124346B1 (en) | Recombinant vector for antimicrobial peptide expression and uses thereof | |
| WO2010097416A1 (en) | Fructanase | |
| CN102154234A (en) | Cytochrome P450 monooxygenase with polycyclic aromatic hydrocarbon hydroxylase-like activity | |
| JP2006516385A (en) | Transcription activator gene for genes involved in cobalamin biosynthesis | |
| US20260110012A1 (en) | Compositions and methods for enzymatic production of polyphenol aglycone compounds | |
| KR20200126319A (en) | Method of purifying heme―iron using affinity attachment/detachment thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12732738 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 12732738 Country of ref document: EP Kind code of ref document: A2 |