WO2012166875A2 - Modulating innate immune cell activity by lunasin and selected cytokines - Google Patents
Modulating innate immune cell activity by lunasin and selected cytokines Download PDFInfo
- Publication number
- WO2012166875A2 WO2012166875A2 PCT/US2012/040144 US2012040144W WO2012166875A2 WO 2012166875 A2 WO2012166875 A2 WO 2012166875A2 US 2012040144 W US2012040144 W US 2012040144W WO 2012166875 A2 WO2012166875 A2 WO 2012166875A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- lunasin
- cytokine
- combination
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2086—IL-13 to IL-16
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/168—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2006—IL-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2013—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/208—IL-12
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
- A61K38/212—IFN-alpha
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- This invention relates to the use of lunasin and other selected cytokines in conjunction with their broad application over innate immune system responses. Particularly, lunasin demonstrated robust synergy on certain selected cytokine effect on innate immune cells.
- the innate immune system comprises cells and mechanisms that defend the host from infection by other organisms in a non-specific manner. In addition to the role as the first line of defense against infection, the innate immune response plays a vital role in killing cancerous cells.
- Natural killer (NK) cells a key component of the innate immune response, represent 10- 1 % of- circulating lymphocytes in the blood. NK cells possess potent cytolytic activity against vims- or pathogen-infected cells and tiunor cells by releasing cytotoxic gi anules that can spontaneously kill target cells. NK cells also possess immunoregulatory functions that influence adaptive immunity by modulating the activity of other immune cells.
- NK cells Aberrant immune responses can lead to excessive mflauunation and autoimmune reactions, leading to diseases such as ailhiitis and allergies. Therefore, modulation of NK cells could lead to a more robust or properly regulated immune response, enhancing immune response to infected cells, enhanced rumor clearance, decreased inflammatory and allergic responses, and increase efficacy of cancer vaccines.
- NK cells Given its critical role in immunity and tumor targeting, several strategies for the therapeutic use of NK cells has been proposed and tested.
- Adoptive transfer of NK cells from autologous or allogeneic donors have been used in the clinic to treat various types of cancers, with mixed results.
- Attempts to enhance the activity of NK cells for adoptive transfer have treated the cells with cytokines, such as IL-2 and IL- 12, prior to injecting the cells into the patient.
- cytokines such as IL-2 and IL- 12
- Adoptive transfer of NK cells to make them more active also has been attempted via genetic manipulation of the NK cells prior to injection into patient.
- Adoptive transfer poses technical and safety concerns, such as increased risk of spreading disease from the donor to host, intense donor screening and selection, teclinical expertise in handling and manipulation of the cells, great expense, and potential long term health risks to the patient.
- NK activity Other strategies to manipulate NK activity that has been pursued are the use of immunomodulatory dings such as thalidomide and cytokines such as IL-2, IL- 12. IL- 15, EL- 18, IL-21 and type I LFNs, to stimulate the patients endogenous NK cells.
- immunomodulatory dings such as thalidomide and cytokines such as IL-2, IL- 12.
- IL- 15, EL- 18, IL-21 and type I LFNs to stimulate the patients endogenous NK cells.
- cytokines such as IL-2, IL- 12.
- IL- 15 EL- 18, IL-21 and type I LFNs
- Tliis disclosure provides a combination therapy composed of luuasin and at least one cytokine.
- the combination therapy enhances the at least cytokine's effect on an iimate immune system, hi the combination therapy, the at least one cytokine is selected from the group consisting of IL-2, IL- 12, IL- 15, IL-18, IL-21 and EFN-a.
- the combination therapy enhances innate immune system expression of ⁇ - ⁇ , IL- 15. CCL2, CCL3, CCL4 or GM-CSF.
- the combination dierapy attenuates the suppression of Thl switch.
- the combination therapy enhances the innate immune system's ability to eliminate viral-infected cells and other pathogens.
- the combination therapy enhances natural killer (NK) cell cytotoxicity by increasing expression of Granzyme B and natural cytotoxicity triggeiiiig receptor 2 (NCR2).
- the combination therapy enhances NK cell cytotoxicity by decreasing expression of inhibitory killer-cell immunoglobulin-like receptors (KIR).
- KIR inhibitory killer-cell immunoglobulin-like receptors
- the combination therapy enhances antibody-dependent cell mediated cytotoxicity (ADCC) by NK cells.
- the combination therapy stimulates NK cells to enhance adoptive transfer cellular therapy.
- the combination therapy is an adjuvant to enhance efficacy of a cancer vaccine.
- Tliis disclosure provides a method of enhancing an innate immune system, the method comprising providing an individual with a pharmaceutically effective amount of a combmation of lunasin and at least one cytokine.
- the at least one cytokine is selected from the group consisting of IL-2, EL-12, IL- 15, EL- 18, IL-21 and EFN-a.
- the at least one cytokine is IL-2 or IL-12.
- the at least one cytokine is IL-12.
- the at least one cytokine is IL- 18.
- the enhanced immune system has natural killer (NK) cells widi increased expression of natural cytotoxicity triggering receptor 2 (NCR2) and
- the enhanced immune system has NK cells with decreased expression of killer-cell immunoglobulin receptors (KIR).
- KIR killer-cell immunoglobulin receptors
- the enhanced immune system has NK cells with an enhanced immune regulatory effect on allergic inflammation.
- the enhanced immune system has NK cells with increased antibody dependent cell mediated cytotoxicity (ADCC).
- ADCC antibody dependent cell mediated cytotoxicity
- This disclosure ftirther provides a method of enhancing activity of natural killer (NK) cells, the method comprising providing an individual with a pharmaceutically effective amount of a combination of luuasin and at least one cytokine,
- the aforementioned cytokine is IL-12 or IL-2.
- the NK cells have increased expression of Granzyme B or natural cytotoxicity triggering receptor 2 (NCR2).
- Tins disclosure further provides a method of increasing natural killer (NK) cell immune regulatory effect on allergic inflammation, the method comprising providing an individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine.
- a combination of lunasin and at least one cytokine is EL- 12 or IL-2.
- the NK cells have increased expression of Grauzyme B or natural cytotoxicity triggering receptor 2 (NCR2).
- This disclosure further provides a method of increasing antibody dependent cell mediated cytotoxicity (ADCC) by natural killer (NK) cells, the method comprising providing an individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine, hi some of preferred embodiments, the NK cells have increased expression of Granzyme B or natural cytotoxicity triggering receptor 2 (NCR2).
- ADCC antibody dependent cell mediated cytotoxicity
- Tins disclosure further provides a method of heating vims-infected cells in an individual, the method comprising providing the individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine.
- the cytokine is IL- 18.
- This disclosure further provides a method of enhancing efficacy of a cancer vaccine, the method comprising providing an individual a pharmaceutically effective amount of a
- the at least one cytokine is selected from the group consisting of IL-2, IL-12, IL-15, IL- 18, EL-21 and EFN-a.
- Figure 1 The levels of IFNy produced by human primary NK cells from normal controls following stimulation.
- Figure 3 Synergistic effects of luuasin and cytokines on gene expression by human primary NK cells.
- FIG. 1 Gene expression for TGF- ⁇ (TGFB1) and TGF- ⁇ receptor (TGFBR2) by human primary NK cells following stimulation over 3 days
- FIG 8. Effects of lunasin plus single cytokine IL- 12 or IL-2 on IFNy production by NK cells with acquired Stat4 deficiency following chemodierapy in a syngenic rumor mouse model.
- Figure 9. Dose-dependent effects of lunasin in combination with both cytokines IL-12 and IL-2.
- Figure 10 hitiacellular cytokine staining of IFNy production by NK cells from post-transplant NHL patients.
- Figure 12 NK cell-mediated cytotoxicity in a human B-lymphoma cell line (Raji).
- Figure 13 Lunasin augments cytotoxicity by cytokiue-activated NK cells in a xenograft model of human B-lymphoma.
- FIG 14a NCR2 gene expression (NCR2) by human primary NK cells following l day of stimulation.
- FIG. 14b NCR2 gene expression (NCR2) by human primary NK cells following 3 days of stimulation.
- Figure 15 Reduced expression of inhibitory KIRs by primary NK cells.
- Figure 17 Lunasin enhances IL-18-stimulated ADCC by human NK cells
- FIG. 18 The levels of IFNy production by human plasmacytoid dendritic cells (pDCs) from normal controls following stimulation.
- Figure 19 Effects of lunasin on gene expression by human pDC.
- Figure 20 Effects of lunasin on gene expression by human cDC.
- FIG. 21 Effects of lunasin on IFNy production by myeloid dendritic cells (niDCs) and NK cells from mice.
- FIG 22 Effects of lunasin on levels of surface molecules on human DCs.
- Figure 23 Effects of lunasin on EFNy production by macrophages from mice.
- Figure 24 Gene expression oilfng from mice heated with lunasin.
- the imiate immune system also known as non-specific immune system and fust line of defense, comprises the cells and mechanisms that defend the host from infection by other organisms. This means that the cells of the innate system recognize and respond to pathogens in a generic way. Unlike the adaptive immune system, it does not confer long-lasting or protective immunity to the host. Innate immune systems provide immediate defense against infection, and ar e found in all classes of plant and animal life.
- the major functions of the vertebrate innate immune system include: recruiting immune cells to sites of infection through the production of chemical factors, including specialized chemical mediators called cytokines; activation of the complement cascade to identify bacteria, activating cells and to promote clearance of dead cells or antibody complexes; the identification and removal of foreign substances present in organs, tissues, the blood and lymph, by specialized white blood cells; activation of the adaptive immune system through a process known as antigen presentation; acting as a physical and chemical barrier to infectious agents.
- Inflammation is one of the fust responses of the immune system to infection or irritation. Inflammation is stimulated by chenucal factors released by injured cells and selves to establish a physical barrier against the spread of infection, and to promote healing of any damaged tissue following the clearance of pathogens.
- the process of acute inflammation is initiated by cells already present in all tissues, mainly resident macrophages, dendritic cells, histiocytes, Kupffer cells and inastocytes. These cells present on their surfaces certain receptors named partem recog ition receptors (PRRs), which recognize molecules that are broadly shared by pathogens but distinguishable from host molecules, collectively referred to as pathogen-associated molecular patterns (PA Ps).
- PRRs Partm recog ition receptors
- PA Ps pathogen-associated molecular patterns
- the complement system is a biochemical cascade of the immune system that helps, or "complements", the ability of antibodies to clear pathogens or mark them for destruction by other cells.
- the cascade is composed of many plasma proteins, synthesized in the liver, primaril by hepatocytes. The proteins work together to: trigger the recruitment of inflammatory cells; "tag" pathogens for destruction by other cells by opsonizing, or coating, the surface of the pathogen; forming holes in the plasma membrane of the pathogen, resulting in cytolysis of the pathogen cell, causing the death of the pathogen; rid the body of neutralized antigen-antibody complexes.
- NK cells NK cells, mast cells, eosinophils, basophils; and the phagocytic cells including macrophages, neutrophils and dendritic cells. Many of these cells function within the immune system by identifying and eliminating pathogens that might cause infection.
- Natural killer cells are a type of lymphocyte (a white blood ce and a component of innate immune system. NK cells play a major role in the rejection of tumors and cells infected by viruses. T ey kill cells by releasing small cytoplasmic granules of proteins called perforin and grauzyiue that cause the target cell to die by apoptosis (programmed cell death). NK cells also directly exert several immunoregulatoiy functions by secreting cytokines.
- Macrophages are large phagocytic leukocytes, which are able to move outside of the vascular system by moving across the cell membrane of capillary vessels and entering the areas between cells in pursuit of invading pathogens.
- orga -specific macrophages are differentiated from phagocytic cells present in the blood called monocytes.
- Macrophages are the most efficient phagocytes, and can phagocytose substantial numbers of bacteria or other cells or microbes. The binding of bacterial molecules to receptors on the surface of a macrophage triggers it to engulf and destroy the bacteria through the generation of a "respiratory burst", causing the release of reactive oxygen species.
- Pathogens also stimulate the macrophage to produce chemokines, which summons other cells to the site of infection.
- Dendritic cells are phagocytic cells present in tissues that are in contact with the external environment, mainly the skin (where they are often called Laugerhans cells), and the inner mucosal lining of the nose, lungs, stomach and intestines. They are named for their resemblance to neuronal dendrites, but dendritic cells are not connected to the nei"vous system. Dendritic cells are veiy important in the process of antigen presentation, and serve as a link between the innate and adaptive immune systems.
- Neutrophils along with two other cell types; eosinophils and basophils, are known as granulocytes due to the presence of granules hi their cytoplasm, or as polymorphonuclear cells (PMNs) due to their distinctive lobed nuclei.
- Neutrophil granules contain a var iety of toxic substances that kill or inhibit growth of bacteria and fungi. Similar to macrophages, neutrophils attack pathogens by activating a respiratory burst. The mam products of the neutrophil respiratory burst are strong oxidizing agents including hydrogen peroxide, free oxygen radicals and hypochlorite.
- Neutiopluls are the most abundant type of phagocyte, uonnally representing 50 to 60% of the total circulating leukocytes, and are usually the first cells to arrive at the site of an infection.
- the bone marrow of a normal healthy adult produces more than 100 billion neutr ophils per day, and more than 10 times that many per day during acute inflammation.
- NK and inimuncsui veillance Despite the hostile environment that contributes to the epigeuetic and genetic alterations, cancer unrnunosurveillance of the immune system is capable of recognizing and eliminating continuously arising, nascent transformed mutant cells. Both innate and adaptive immune cells act as sentinels in confining these malignant cells to a state that can be controlled. Preclinical studies have unequivocally shown that vertebrate immune system can recognize and destroy malignant tumor cells in vivo. Moreover, adoptive cellular therapy after allogeneic
- hematopoietic stem cell transplantation has provided proof-of-principle that the immune system can eradicate tumor cells in humans.
- Innate immunity is mediated by effector cells, including NK cells and macrophages that can respond inuuediately before adaptive immunity being developed.
- NK cells represent 10-15% of circulating lymphocytes in blood, which exert a potent cytolytic activity against vims-infected or tumor cells by releasing cytotoxic granules.
- NK cells have the ability to spontaneously kill target cells without any prior immunization or stimulation.
- NK cells use granzyme B, a serine protease, to exert their cytotoxic function, which are important in immune surveillance.
- Granzyme B is constirutively expressed in NK cells, and can be further upregulated by cytokines including JL-2 and IL- 12.
- cytotoxicity of NK cells can be activated by interferon and cytokines (e.g., IL- 12) that are produced by monocytes or dendritic cells (DC).
- interferon and cytokines e.g., IL- 12
- DC dendritic cells
- activated NK cells result in the production of inflammatory cytokines (e.g., IFNy and TNFct). mediators, and enzymes (e.g., granzyme B) that contribute to the eradication of tumor cells.
- NK cells have two major classes of surface receptors: activating and inhibiting receptors.
- the activating receptors involved in NK-mediated cytolysis are NKG2D and the natural cytotoxicity receptors (NCRs) including NCR1 (NKp46 or CD335), NCR2 (NKp44 or CD336), and NCR3 (NKp30 or ' CD337).
- the inhibiting receptors include many of the killer-cell imiminoglobulin-like receptors (KIR) on NK cells recognize MHC class I ligands on target cells, which inhibit NK cell- mediated cytotoxicity.
- KIR killer-cell imiminoglobulin-like receptors
- NK cells The interaction of KIR on NK cells with MHC class I proteins on target cells is inhibitory.
- an NK cell binds to any bodily cell with high levels of MHC class I proteins, it is not activated, or more precisely, it is simultaneously activated and inhibited, and the inhibition prevails.
- an NK cell binds to a cell with low levels of class I MHC proteins or none at all, it is activated and kills the cell without inhibitory signals.
- the activation requires binding of some ligand. possibly a carbohydrate moiety on the target cell, to an "Activation Receptor" protein on the surface of the NK cell. In the absence of an inhibitory signal, from KIR for MHC class I protein, this Activation Receptor generates a signal that allows the NK cell to execute its target.
- the inhibitory signal is mediated by the MHC class I protein and therefore it might first appear that any cell in the body would be resistant to NK killing.
- many rumors and virus infected cells have reduced levels of MHC class I proteins.
- one of the viral sttategies to evade the immune system is to repress expression of class I MHC proteins, thus reducing the likelihood that viral peptides will be presented to cytotoxic T cells. This works to the advantage of the virus by delaying or reducing the immune response.
- the vims "attracts" the attention of NK cells that respond to the deficiency of class I proteins by killing the infected cell.
- the characteristics of NK cells ar e useful in fighting the viruses that use the MHC -reduction strategy.
- NCRs Natural Cytotoxicity Receptors
- NCR2 is cell surface glycoproteins that activate NK cells after ligand interaction.
- NCR2 is an activating receptor that promotes cytotoxicity and cytokine release upon ligand binding via the adaptor molecule.
- NCR2 expression is absent on fresh peripheral blood NK cells but may be induced by EL-2 in culture. Therefore NCR2 is used as specific marker for activated NK cells.
- HTV-patient NCR2 was found on a substantial percentage of NKs and promotes cytotoxicity against NCR2 ligand positive CD4+ T cells.
- NCR2L is induced by a part of the HTV- l envelop protein gp41 , resulting in a progressive CD4+ T cell depletion by NK cells, which is correlated to the increase of the vims load.
- a substitute activation of NCR2 is in need to activate NK cells while avoiding virus gp41 dependent NCRL induction.
- NK and ADCC antibody-dependent cellular cytotoxicity
- the binding of the Fc region of IgG to specific receptors (Fc receptors) expressed ou NK cells results in activating signals for cytotoxicity, which is called ADCC or antibody-dependent cellular cytotoxicity.
- the CD 16 (FcyRin) receptor complex expressed by NK cells is involved in ADCC.
- the development of therapeutic antibody has a great impact especially on human cancer therapy that is based on NK-mediated ADCC.
- NK secreted IFN ⁇ plays an important role in modulating allergic inflammation.
- T helper type 2 (Th2)-mediated allergic inflammation is the major molecular mechanism underlying astlmia and other allergic diseases.
- Cytokine such as IL-4 secreted by Th2 cells induces B cells for isotype class switching to IgE that binds other leukocytes such as mast cells and eosinophils. When activated, these cells rapidly release their characteristic granule contents and mediators that contribute to the disease manifestation.
- Cytokine immunotherapy enhances the anti-tumor immunity and is now pait of the therapeutic armamentarium for cancer treatment.
- Immunostimulatory cytokines such as IL- 12 and IL-2, have had limited efficacy in lymphoma patients after chemotherapy followed by autologous stem cell transplantation. It has been reported that these heavily-treated patients have acquired deficiency of Signal Transducer and Activator of Transcription 4 (STAT4), which results in defective production of ⁇ following IL-12 immunotherapy.
- STAT4 Signal Transducer and Activator of Transcription 4
- Soybean products appear in a large variety of processed food as well as in cosmetics and personal care products. Soybean comprises bioactive components that have anticancer effects. Among the most studied substances, the Bowman-Birk protease inhibitor ( ⁇ ) inhibits proteases involved in carcinogenesis, and is currently in human trials as an anti-carcinogenic agent.
- ⁇ the Bowman-Birk protease inhibitor
- Lunasin is a 43-amino acid soybean peptide that has chemopreventive properties capable of suppressing carcinogenesis via clnoinatin modification. Lunasin contains a poly-D carboxyl end with 8 D-residues and an RGD cell adhesion motif (bold) SEQ. ID. NO: 1
- Tins disclosure provides evidence that lunasin exerts additional effects imposed by selected cytokines to modulate innate immune cells, for example, NK cell activity.
- NK cells stimulated with lunasin plus IL-2 have higlier tumoricidal activity than those stimulated with EL-2 using in vitro and the xenograft mouse model.
- lunasin shows robust synergistic effects on selected cytokines when these cytokines are acted on certain innate immune cells, for example, human NK cells, various dendritic cells and macrophages.
- the synergistic effects of lunasin are broad, including but not limited to stimulating NK cells' essential for anti-tumor immunity, increasing EFNy and granzyme B production, and natural cytotoxicity triggering receptor 2 (NCR2) expression to activate NK ' s killing mode, i.e., the increased tumoricidal activity of NK cells following stimulation with luuasm peptides and selected cytokines; switching on NK's anti-viral surveil lance system, such as down regulating inhibitory receptors to stop the engagement of KIR to MHC-I class antigen, therefore tenninating the inhibitory mode of NK when any anti-viral cytokine is used in combination of lunasiu; further enhancing NK's ADCC effect when a selected cytokine
- Cancer is the number-two killer of Americans. More than 1 ,400,000 new cases of cancer are diagnosed each year in the United States and approximately 560,000 patients die of cancer annually. The high morbidity and mortality of tliis disease represents a significant economic and medical burden. However, cancer is mostly a preventable disease. More than 20% of cancer incidents are preventable by consuming a healthy diet with more vegetables and fruits.
- a short list of diet properties that relate to cancer prevention include anti-oxidation as a ROS scavenger; anti- inflainmatiou as regulating expression of pro-inflammatory mediators; promoting anti-tumor immunity by activating immune cells; and epigenetic alterations by modulating DNA methylation and chromatin acetylafion.
- IFNy is by far one of the most potent factors to activate cytotoxic T lymphocyte (CTL) cytotoxicity against rumor cell.
- CTL cytotoxic T lymphocyte
- IFNy enhances the immunogenicity of rumor cells by upregulating the MHC class I and class ⁇ expression that allows them to be recognized and eliminated by CD8 and CD4 T lymphocytes, respectively.
- Both spontaneously arising and chemically-induced tumors are more common in IFNy receptor-deficient and IFNy-deficient mice compared to wild-type mice. Inhibition of IFNy in vivo abrogates the ability of immunocompetent mice to reject transplanted syngeneic tumors.
- IFNy is required for the efficacy of several immunotherapeutic approaches in preclinical models. Strategically increase the production of IFNy is one of the targets to effectively kill tumor and other vims.
- EL- 12-based immunotherapy is one of the emerging therapeutic strategies to harness the power of the immune system to eradicate cancer cells.
- Chemotherapy is most often used as a systemic treatment to eliminate cancer cells.
- NDL Non-Hodgkin's Lymphoma
- STAT4 signal transducer and activator of transcription 4
- STAT4 deficiency may impair not only EL-12- based immunotherapy, but any therapeutic approach that requires optimal production of IFN- ⁇ for effective anti-tumor imnninity. Therefore, alternative strategy to achieve an efficacious antitumor activity after transplantation may require interventions that exploit other mechanisms of IFNy production.
- NK cells use granzyme B, a serine protease, to exert their cytotoxic function, which are important in immune surveillance.
- Granzyme B is constitutively expressed in NK cells, and can be further upiegulated by cytokines including EL-2 and EL- 12.
- cytokines including EL-2 and EL- 12.
- qPCR was performed to evaluate its gene expression.
- NK cells have augmented cytotoxic activity following stiiinilatiou with the combination of cytokine and lunasin peptides by in vitro cytotoxicity assay with the target cell Raji, a human B-lyniphoma cell line.
- the presence of lunasin further enhanced the cytotoxic activity as compared to cytokine alone.
- these results demonstrate the ability of lunasin peptide in combination with cytokine to enhance the cytotoxicity of NK cells.
- allergen is clinically defined as type I hypersensitivity that is caused by undesirable immune respouse to a normally harmless substance called allergen.
- allergens include pollen, animal dander, house dust mite, and a variety of food such as eggs and peanuts.
- allergens Exposure to allergens triggers the allergic inflammatory responses that induce the production of IgE. Binding of IgE to innate immune cells (e.g., mast cell and eosinophils) leads to the release of gr anule contents including lipid mediators and histamine. All these are the characteristics of allergic reactions. Allergic diseases are associated with a range of conditions including allergic asthma, allergic rhinitis, food allergies, and allergic eczema. The recent escalation of allergic diseases may be attributable in part to changes in environment, lifestyle, and dietaiy components It has been shown that the increased susceptibility for allergic disease is a consequence of prevalently intake of "healthy food” rich in antioxidant that suppresses ⁇ production.
- innate immune cells e.g., mast cell and eosinophils
- T helper T helper
- IL- 12 promotes the differentiation of T helper type I (Thl) cells that produce proinflammatory cytokine ⁇
- IL-4 promotes die development of Th2 cells that secrete IL-4, EL- 5 and EL- 13.
- the developed T helper subsets acquire effector pheiiotypes that promote specialized inflammatory responses.
- Th2-mediated inflammation is the major molecular mechanism underlying asthma and other allergic diseases.
- Cytokines produced by Th2 cells mediate the following effects that contribute to allergic diseases: 1 ) IL-4 induces B cell isofype class switching to IgE that binds and activates mast cells to release the granule contents; 2) IL-5 recruits and activates eosinophils; 3) EL-13 activates goblet cells to secrete mucus.
- Till cytokine ⁇ directs several imiminoregulatory mechanisms diat inhibit Th2 differentiation.
- a shift in the Th l/Th2 balance with favor in Tli2 differentiation can result in allergic diseases.
- Studies also implicate that skewing to Thl response can suppress Th2- mediated allergic iuflanunation, and therefore prevent and control allergic diseases.
- NK cells are another major population that produces ⁇ , and represent 10- 15% of circulating lymphocytes in blood, which exert a potent cytolytic activity against vims-iufected or rumor cells by releasing cytotoxic granules.
- NK cells directly exert several iimnuuoregulatory functions by secreting cytokine ⁇ .
- EFNy inhibits the development of Th2 lineage and facilitates Thl differentiation.
- Isotype switching in B cells to IgG is enhanced by ⁇ that in turns inhibits the IgE production.
- Imiate immune responses mediated by NK cells are rapid, and can provide a jump start to respond to a stimulatory signal before the development of adaptive iinniunify.
- NK cells can rapidly produce JFNy after only 4 his of stimulation.
- NK cells are normally present in human lung interstitium.
- pulmonary allergic sensitization induces NK cell accumulation in lung-draining lymph nodes and regulates ainvay eosinophilia in a murine model of asthma. All these featur es and the cytokine milieu created by EFNy-producing NK cells may preferentially prevent the development of Th2-mediated allergic inflammation.
- Immunotherapy has been shown to prevent deleterious allergic reaction by exposing patients to the allergens thereby reducing sensitivity.
- treatment is a lengthy procedure and not appropriate for everyone. Therefore, alternative strategy to achieve an efficacious antiallergic infiainmation may require interventions that exploit other mechanisms.
- NK cells are an important defense mechanism against tumor cells and various pathogens. However, by their immunoregulatory activity NK cells may diminish Tli2-mediated
- Embodiments of the invention include compositions and related methods for enhancing innate immune response that can have broad protection against a variety of pathogens or potential pathogens.
- bacterial pneimionia in a normal host occurs at a rate of 17700 persons/year-, mostly in elderly adults and young children and can be caused by a variety of organisms. It is most commonly caused by Streptococcus pneumoniae, followed in frequency by encapsulated Hemophilus influenzae. Other bacteria such as enteric gram negatives, anaerobes. and Staphylococcus aureus are significant causes of pneumonia in specific settings, such as healthcare facilities. Mycobacterium tuberculosis is highly infectious, and liistorically was an important cause of mortality worldwide.
- composition of the present invention can provide a rapid, temporal protection against a spectrum of agents that can cause, for example pneumonia or other disease states.
- present invention may be used in combination with a vaccination regime to provide an additional protection to a subject that may or is exposed to one or more pathogenic or potentially
- Bacterial microbes include, but are not limited to various species of the Bacillus, Yersinia, Franscisel!a, Streptococcus, Staphylococcus, Pseudoinonas, Mycobacterium,
- Burkholdena genus of bacteria Particular species of bacteria from which a subject may be protected include, but is not limited to Bacillus anthracia, Yersinia pestis, Francisella tulareiisis, Streptococcuspnemoniae, Staphylococcus aureas, Pseudoinonas aeniginosa, Burkholdena cepacia, Cory e.bacte.rium diphtheriae, Clostridia spp, Shigella spp., Mycobacterium avium, M. intracellular, M. kansasii, M. paratuberculosis, M. scrofulaceum, M. simiae, M. habana, M. interjectuni, M. xenopi, M. Iieckeshornense, M. szulgai, M.fortuitum, M. immunogenum, M.
- peripheral blood mononuclear cells peripheral blood mononuclear cells
- PBMCs peripheral blood mononuclear cells
- IL-12 and IL-2 are known to induce the expression of IFNG by NK cells, these two cytokines are included in the stimulation for comparison.
- Figure 1 shows human primary NK cells produce robust amount of IFNy in combination neatineut with lunasin and IL- 12 or IL-2.
- Aliquots of PBMCs isolated from healthy volunteer donors were c yopreserved in liquid nitrogen for the following assays.
- the lunasin peptides were conuuercially synthesized (LifeTeiu , South Plainfield, NJ), and the 43-amino acid sequences are the following SEQ. ID. NO: 1 :
- Stimulated PBMCs were sxuface stained with FITC-conjugated CD3 and PE- conjugated CD56 monoclonal antibodies (BD), washed, fixed, and penneabilized. After washing, cells were incubated with APC-conjugated anti-EFNy monoclonal antibody. Expression of IFNy was evaluated on 5000 events of gated CD3 negative and CD56 positive NK cell populations. The % of NK populations producing EFN y is labeled at the upper right quadrant of the dot plot. (B) IFNy production in the supernatants.
- PBMCs peripheral blood mononuclear cells
- CD56 magnetic beads CD56 magnetic beads
- Results are presented as mean ⁇ SD fiom duplicates.
- C IFNG gene expression. The cell pellets were analyzed for gene expression using qPCR with Taqman Assay primers. Data are presented as mean ⁇ SD from duplicates. Results shown are representative from over 5 different normal controls.
- NK cells heated with EL-12 and lunasin also produce other cytokines.
- Figure 2 shows TNFct production by primary NK cells isolated fiom normal controls following stimulation.
- Human primary NK cells were isolated from peripheral blood mononuclear cells (PBMCs) of normal controls using positive selection with CD56 magnetic beads (Miltenyi Biotec, Auburn, CA).
- Freshly isolated NK cells were stimulated with medium only (-), EL- 12 (lOng ml) in the absence (0) or presence of various concentiations of soluble hmasin peptides for 1 day.
- the supernatants were collected for measuring the concentrations of TNFa using ELISA. Results are presented as mean ⁇ SD from duplicates.
- IL- 12 and EL-2 are known cytokines to activate NK cells by regulating expression of a number of genes that are important for NK functions. Because of robust synergistic effects of hmasin with EL-12 or IL-2 on inducing IFNG expression, we next evaluated whether hmasin is able to modulate other target genes that are known to be regulated by cytokine IL- 12 or EL-2. Results of qPCR from samples in figure 1C showed that adding hmasin to EL-12 or IL-2 significantly increased expression of GZMB (granzyme B), while reduced TGFB1 (TGFp l) and TGFBR2 (TGFP receptor 2) as compared to those widi cytokine alone (Figure 3).
- GZMB granzyme B
- FIG. 3 shows Synergistic effects of lunasin and cytokines on gene expression by human primary NK cells.
- Freshly isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of normal controls using positive selection with CD56 magnetic beads (Miltenyi Biotec, Auburn, CA) were stimulated with medium only (-), IL- 12 ( lOng/ml), EL- 12 ( 10 ng ml) + lunasin (20 ⁇ ), EL-2 (100 unit/ml), EL-2 (100 unit/ml) + hmasin (20 ⁇ ) or lunasin alone (20 ⁇ ).
- PBMCs peripheral blood mononuclear cells
- the first-strand cDNA was synthesized followed by real time qPCR using Taqman Assay with primers for EFNy (IFNG), granzyme B (GZMB), granulysin (GNZ- ⁇ ), cheraokine (C-C motif) hgand 3 or CCL3 (CCL3), CCL4 (CCL4), Granulocyte-macrophage colony-stimulating factor or GM-CSF (CSF2), TGFp (TGFB) and TGFP receptor (TGFBR2) in ABI 7300 (Applied Biosystems by Life Technologies, Carlsbad, CA). Data are presented as mean ⁇ SD from duplicates. Results shown are representative over 5 different normal controls.
- TGF- ⁇ is a negative regulator of EFNy in NK cells, and deacetylation of histone H3 is associated with gene repression, we tested the hypothesis that lunasin inhibits TGFB1 or TGFBR2 expression by modulating chromatin structure of these gene loci in NK cells following IL- 12/IL-2 and lunasin stimulation, and therefore IFNG expression is up-regulated because of less negative regulator TGF- ⁇ and unresponsiveness to TGF- ⁇ due to reduced expression of TGF- ⁇ receptor ⁇ .
- PBMCs peripheral blood mononuclear cells
- CD56 magnetic beads Miltenyi Biotec, Auburn, CA
- IL-12 10 ug/ml
- IL-12 10 ng/ml
- lunasin 20 ⁇
- lunasiu alone 20 ⁇
- ChEP results as a percentage of input, the amount of the iinmimoprecipitated DNA from the non-immune rabbit serum was subtracted from the amount of immunoprecipitated DNA from the AcH3 antibody, followed by normalizing against the amount of the input DNA. Data are shown as mean percentage of input ⁇ SD from duplicates. Epigeuetic regulation by chromatin modification is known to alter gene expressiou, and deacetylatiou of H3 is associated with gene repression.
- chromatin hnmiuioprecipitatiou (CliIP)-qPCR demonstrated that greatly reduced acetyl-H3 is associated with TGFBl locus in NK cells treated with lunasin plus IL- 12 than IL- 12 aloue ( Figure 5 A, lower panel).
- the synergistic effects of lunasin with selected cytokine such as EL- 12 are in part due to reducing the levels of aceryl-H3, which further suppresses the expression of TGFBl .
- FIG. 5 shows Chromatin nmunoprecipitation (ChEP) assay for the cliromatin structure of 1FNG gene locus in NK cells following treatment, which is positively associated with acetylated histone H3 ( Figure 5A, upper panel).
- Results provides a mechanism of gene regulation in the example oflFNG in which lunasin down-regulates expressiou of negative regulators (e.g., TGFBl and TGFBRIT) that in rum up-regulate then corresponding target genes (e.g., IFNG).
- negative regulators e.g., TGFBl and TGFBRIT
- target genes e.g., IFNG
- FIG. 7 shows that responses of NK cells to lunasin in combination of EL- 12 ar e dose dependent with IFNy as the read out.
- Human primary NK cells were isolated from peripheral blood mononuclear cells (PB Cs) of normal control using positive selection with CD56 magnetic beads (Milteuyi Biotec, Auburn, CA).
- NK cells Freshly isolated NK cells were stimulated with medium only (-), EL- 12 alone (at 1 or l Ong ml), IL-12 (at 1 or lOng/ml) in the presence of various concentrations of lunasin peptides for 1 day.
- the supematants were collected for measuring the production of IFNy using ELISA. Results are presented as mean ⁇ SD from duplicates. Taken together Figure 7 ilhistiates that it is lunasin that acts on NK cells to cause the dose dependent response of lunasin+ IL-12 treatment.
- EL-2 is approved by FDA, its toxicity in high doses prohibits die systemic administration. Because EL-2 and lunasin peptides act synergistically on inducing EFNy production by NK cells, a lower dose of IL-2 is likely to achieve the same effects on EFNy production in the presence of lunasin peptides. Similar combination of lunasin with other selective cytokine may be used to boost the desired EFN-y production.
- Example 2 the effects of lunasin on cytokine immunotherapy for lymphoma patients Effects of lunasin plus both cytokines IL-12 and IL-2 on IFNy production by NK cells from NHL patients post-transplant
- huiasin may enliance the clinical outcomes when used in combination with both cytokines IL-12 and IL-2.
- Example 3 the tumoricidal activity of lunasin-stimulated NK cells
- NK cells In addition to an iimmmoregulatory role of NK cells through cytokine production, they have the ability to spontaneously kill target cells without any prior immunization or stimulation.
- NK cells exeit their tumoricidal process tlirough the release of granules that contain granzynie B, a serine protease.
- Granzynie B is constirutively expressed in NK cells and can be up-regulated by cytokines including IL- 12 and EL-2; consequently, their cytotoxicity can be enhanced by stimulation with these cytokines.
- Figure 3 showed that the level of GZMB gene expression was higher with EL- 12 or IL-2 plus lunasin compared to cytokine alone.
- FIG. 11 further showed that cytokine IL-2 or IL-12 plus lunasin results in increased granzynie B ⁇ GZMB) gene expression by human primary NK cells following stimulation over 3 days compared to cytokine or lunasin treatment alone.
- Freshly isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of nonnal controls using positive selection with CD56 magnetic beads (Milteuyi Biotec, Auburn, CA) were stimulated with medium only (-), IL-12 (10 ng/ml), EL- 12 (10 ng/inl) + lunasin (20 uM), IL-2 (100 unit/ml), EL-2 (100 unit/ml) + lunasin (20 ⁇ ) or huiasin alone (20 ⁇ ).
- the cell pellets were lysed in Tiizol Reagents for total RNA exQaction.
- the fust-strand cDNA was synthesized followed by real time qPCR using Taquiau Assay with primer for granzyme B (GZAiB) in ABI 7300. Results are presented as mean ⁇ SD from duplicates.
- Figure 12 shows NK cell-mediated cytotoxicity in a human B-lymphoma cell line (Raji).
- Freshly isolated NK cells (described in Figure 3) were stimulated with medium only (-), IL- 12 (l ng/ml) or IL-2 (10 units/ml) only lunasin only (50 ⁇ ), IL- 12 or IL-2 + lunasin, or IL- 12 and IL-2 + lunasin as indicated for 1 day.
- the target cell Raji (a human B-lymphoma cell line) was provided by Dr. Shivani Srivastava.
- the in vitro cytotoxicity assay was measured using lactase dehydiogenase (LDH)-releasing assay with die CytoTox 96 non-Radioactive Cytotoxicity Assay Kit (Proinega, Madison, WT).
- LDH lactase dehydiogenase
- CytoTox 96 non-Radioactive Cytotoxicity Assay Kit Proinega, Madison, WT.
- the effectors were co-cultured with target cells at ratio of 10: 1 for 4 hi s at 37C in a 5% CO, incubator.
- the % of cytotoxicity was calculated according to the manufacturer's instructions. Data are presented as mean ⁇ SD from 2 duplicates. Results shown are representative from 3 independent experiments. *P ⁇ 0.05; **P>0.05.
- NK cells activated in vitro have been tested clinically against several tumors, including hematologic malignancies and solid tumors such as melanoma, renal cell carcinoma, breast cancer, ovarian cancer and neuroblastoma.
- Our in vitro cytotoxicity assay supports that activated NK cells using lunasin and cytokine(s) are superior to those activated with cytokine(s) alone (Figure 12), which may provide a more efficacious NK-based cellular therapy in vivo.
- NK cells The cytotoxicity of NK cells is also regulated by the net signaling events triggered by invariant activating and inhibitory receptors that recognize the ligauds on target cells.
- Many of the killer-cell immunoglobulin-like receptors (KIR) on NK cells recognize MHC class I hgands on target cells, which inhibit NK cell-mediated cytotoxicity.
- the activating receptors involved in NK-mediated cytolysis are NKG2D and the natural cytotoxicity receptors (NCRs) including NCR1 (NKp46 or CD335), NCR2 (NKp44 or CD336), and NCR3 (NKp30 or CD337). It has been shown that the tumor-killing activity of NK cells is correlated with the levels of NCR expression (see Figure 14), and NCR2 is involved in NK-mediated cytotoxicity against lung adenocarcinoma A549.
- Figure 14 showed that NK cells treated with IL- 12 or IL-2 plus lunasin had increase of NCR2 expression as compared to those treated with medium, or cytokine only after incubation.
- NCR2 expression was undetectable in NK cells treated with medium only while it was 5 fold higher in cells with EL- 12 and lunasin than those with IL- 12 alone ( Figure 14b).
- Similar results were observed for DL-2 treatment in combination of lunasin (see figure 14a, IL-2 panels).
- FIG. 15 shows KIR3DL1 and KIR3DL2 gene expression levels of human NK cells following stimulation.
- Freshly isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of normal control using positive selection with CD56 magnetic beads (Miltenyi Biotec, Auburn, CA) were stimulated with medium only (-), IL-12 (10 ng/ml) or EL- 12 ( 10 ng inl) + lunasin (5 iiM) for 1 day.
- the cell pellets were lysed in Tiizol Reagents for total RNA extraction.
- the first-strand cDNA was synthesized followed by real time qPCR using Taqman Assay with primer for inliibitoiy receptors K1R3DL1 (upper panel) and KIR3DL2 (lower panel) in ABI 7300.
- the reduced KIRs expression in the presence of lunasin indicates lunasin facilitates the down regulation of inhibitory receptors on NK cells, therefore activating NK's ruinoricidal activity.
- FIG 17 shows Lunasin enhances IL- 18-stinnilated ADCC by human NK cells.
- fleshly isolated human NK cells as described in figiue 1 were stimulated overnight in medium only (-).
- EL- 18 100 ng/ml
- riruximab anti-CD20 niAb at 0.1 ug/ml
- the target Raji cells were pre-treated or not with riruximab (anti-CD20 niAb at 0.1 ug/ml) for 2 his followed by the 4-hr in vino cytotoxicity assay the CytoTox 96 non-Radioactive Cytotoxicity Assay Kit (P omega, Madison, WT). The % of cytotoxicity was calculated according to the manufacturer's instructions.
- FIG 18 shows levels of IFNy production by human plasmacytoid dendritic cells (pDCs) from normal controls following stimulation.
- Freshly isolated human pDC cells from peripheral blood mononuclear cells (PBMCs) of normal controls using the CD304 (BDCA-4/Neuropilin- l) microbeads (Miltenyi Biotec, Auburn, CA) were stimulated with mediiun only (-), IL- 12 ( 10 ng nil), IL- 12 ( 10 ng nil) + Iunasin (50 niM), IL-2 ( 100 unit/ml), IL-2 (100 unit ml) + Iunasin (50 inM) or Iunasin alone (50 mM).
- PBMCs peripheral blood mononuclear cells
- CD304 BDCA-4/Neuropilin- l microbeads
- Iunasin 50 niM
- IL-2 100 unit/ml
- IL-2 100 unit ml
- Figure 19 shows Effects of Iunasin on gene expression by human pDC.
- Freshly isolated human pDC cells from peripheral blood mononuclear cells (PBMCs) of normal controls using the CD304 (BDCA-4 Neuropilin-l ) microbeads (Miltenyi Biotec, Auburn, CA) were stimulated as described in the figure 18.
- PBMCs peripheral blood mononuclear cells
- CD304 BDCA-4 Neuropilin-l
- Trizol Reagents for total RNA extraction.
- the first-strand cDNA was synthesized followed by real time qPCR using Taqman Assay with primers for gene expression using the ABI 7300 (Applied Biosystems by Life Technologies, Carlsbad, CA). Data are presented as mean ⁇ SD from duplicates. Results shown are representative from over 3 different normal controls.
- Figure 20 shows Effects of Iunasin on gene expression by human cDC.
- PBMCs peripheral blood mononuclear cells
- CDlc CDlc
- BDCA-1 CDlc microbeads
- Trizol Reagents Trizol Reagents for total RNA extraction.
- the fust-strand cDNA was synthesized followed by real time qPCR using Taqinau Assay with primers for gene expression using the ABI 7300 (Applied Biosystems by Life Technologies, Carlsbad, CA). Data are presented as mean ⁇ SD from duplicates. Results shown are representative from over 3 different normal controls.
- FIG 21 shows Effects of lunasin on IFNy production by myeloid dendritic cells (mDCs) and NK cells from mice.
- mDCs myeloid dendritic cells
- NK cells isolated from the same mice using DX5 microbeads were stimulated with the same conditions indicated.
- the levels of IFNy in the supematants were determined using ELISA. Data are presented as mean ⁇ SD from duplicates. Results shown are representative from 2 mice. *P ⁇ 0.05; **P>0.05
- Figure 22 shows Effects of lunasin on levels of surface molecules on DCs.
- Freshly isolated human pDC and cDC cells from peripheral blood mononuclear cells (PBMCs) of normal controls were stimulated as indicated.
- PBMCs peripheral blood mononuclear cells
- MHC major histocompatibility complex
- CD80 and CD86 co- stimulatory molecules
- Figure 23 shows Effects of lunasin on IFNy production by macrophages from mice.
- Freshly isolated macrophages from spleens of C57BL6 mice using the CDl lb microbeads (Miltenyi Biotec, Auburn, CA) were stimulated as indicated for 1 and 2 days.
- the levels of IFNy in the supematants were determined using ELISA. Data are presented as mean ⁇ SD from duplicates.
- Th2-mediated inflammation can promote allergic disease when IFNy production is reduced to free from its resnaining influence. It has been shown that development of spontaneous airway inflammation consistent with human asthma was found in mice lacking a transcription factor T-bet, a master regulator of Th l development and ⁇ production. These results suggest that up-regulating Thl cytokine IFNy is a potential strategy to reduce the risk of asthma and allergic disease.
- Figure 24 shows increased gene expression of Ifng in the lung from mice treated with lunasin.
- Balb/c mice were gavaged with 200 ⁇ of water only ( ⁇ ) or 4 mg of lunasin in 200 ⁇ water (Lunasin) for 3 consecutive days.
- nuce were sacrificed to collect the lungs and spleens.
- NK cells were isolated from each lung and spleen using positive selection with DX5 magnetic beads (Miltenyi Biotec) followed by RNA extraction, cDNA synthesis and real time qPCR using Taqinan assay primers (ABI).
- Gene expression for Ifng from lungs (upper panel) and spleens (lower pannel) is presented as mean ⁇ SD from 2 mice in each group.
- figure 25 shows cell counts in the bronchoalveolar lavage (BAL) fluid and IL- 4 production in a mouse model of asthma, hi LPS-induced astlima model, BABL c mice were sensitized intranasally with 0.1 ⁇ ig of LPS at day 0, 1 , and 2 with (LS) or without (Ctrl) lunasin peptide at 4 mg, and then challenged with 50 Mg of OVA on days 19, 20, and 21. Another group of mice (LC) was sensitized as the Ctrl group followed by challenging with OVA in the presence of lunasin at 4 mg. The total cell niunbers (A) and differential cell numbers of eosinophils (B) were counted from the BAL fluid.
- A total cell niunbers
- B differential cell numbers of eosinophils
- Therapeutic vaccines are designed to stimulate anti-tumor immune responses against various malignances, which could be potentially used as a treatment regimen for cancer patients.
- an immune activating agent such as cytokine can further enhance the clinical outcomes that improve progression-free survival in patients.
- a chimeric HER2 peptide vaccine that is composed of HER2 B-cell epitope fused to a promiscuous T-cell epitope from measles virus fusion protein (MAT 7 ).
- MAT 7 measles virus fusion protein
- a more recent phase I study using these therapeutic peptide vaccines showed clinical activity in patients with metastatic and/or recurrent solid tumors.
- Combining EL- 12 with two peptide vaccines (MVF HER2 316-339 and MVF HER2 62 8- «47) resulted iu significant reduction on the development of pulmonary metastases in a syngeneic HER2/neu rumor model.
- Tumor volume will be measured daily with calipers as described. One week after the last vaccination, immune responses will be measured. Sera collected will be evaluated for the levels of IFNy and antibody isotype using ELISA. Intracellular cytokine staining from splenocytes will be performed to determine if NK, cDC and/or macrophage populations are responsible for IFNy production. The rumoricidal activity of NK cells from these mice will be measured against the target cell line cT-26 HER/neu as described. Statistic consideration is followed as previously described.
- mice receiving PBS will have the largest rumor volume at the end of the study. Results will demonstrate an improved adjuvaiiticity of lunasin and IL-12 in enhancing the anti-tumor immunity for HER2 peptide vaccines as therapeutic treatment. As a result, these mice will suppress rumor growth and have reduced tumor volume.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Botany (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
This disclosure provides compositions and methods for enhancing innate immune system activities and responses by combining lunasin with at least one cytokine. The compositions synergistically enhance the effect of these selected cytokine(s), including but not limited to, activating NK cells, augmenting NK's cytotoxicity against vinises and tumors, regulating NK-mediated anti-allergic inflammation, producing potent NK cells for cellular therapy using adoptive transfer, and facilitating dendritic cells antigen presentation.
Description
MODULATING INNATE IMMUNE CELL ACTIVITY BY LUNASIN AND SELECTED
CYTOKINES
PRIORITY CLAIMS AND CROSS REFERENCES
Tins inveutiou claims the priority benefits under 35 U.S.C. Section 1 19 (e) of US provisional application 61 /491 ,450, filed May 31 , 201 1. The provisional application is incorporated herein entirely.
FIELD OF INVENTION
This invention relates to the use of lunasin and other selected cytokines in conjunction with their broad application over innate immune system responses. Particularly, lunasin demonstrated robust synergy on certain selected cytokine effect on innate immune cells.
BACKGROUND
The innate immune system comprises cells and mechanisms that defend the host from infection by other organisms in a non-specific manner. In addition to the role as the first line of defense against infection, the innate immune response plays a vital role in killing cancerous cells. Natural killer (NK) cells, a key component of the innate immune response, represent 10- 1 % of- circulating lymphocytes in the blood. NK cells possess potent cytolytic activity against vims- or pathogen-infected cells and tiunor cells by releasing cytotoxic gi anules that can spontaneously kill target cells. NK cells also possess immunoregulatory functions that influence adaptive immunity by modulating the activity of other immune cells. Aberrant immune responses can lead to excessive mflauunation and autoimmune reactions, leading to diseases such as ailhiitis and allergies. Therefore, modulation of NK cells could lead to a more robust or properly regulated immune response, enhancing immune response to infected cells, enhanced rumor clearance, decreased inflammatory and allergic responses, and increase efficacy of cancer vaccines.
Given its critical role in immunity and tumor targeting, several strategies for the therapeutic use of NK cells has been proposed and tested. Adoptive transfer of NK cells from
autologous or allogeneic donors have been used in the clinic to treat various types of cancers, with mixed results. Attempts to enhance the activity of NK cells for adoptive transfer have treated the cells with cytokines, such as IL-2 and IL- 12, prior to injecting the cells into the patient. Adoptive transfer of NK cells to make them more active also has been attempted via genetic manipulation of the NK cells prior to injection into patient. Adoptive transfer poses technical and safety concerns, such as increased risk of spreading disease from the donor to host, intense donor screening and selection, teclinical expertise in handling and manipulation of the cells, great expense, and potential long term health risks to the patient.
Other strategies to manipulate NK activity that has been pursued are the use of immunomodulatory dings such as thalidomide and cytokines such as IL-2, IL- 12. IL- 15, EL- 18, IL-21 and type I LFNs, to stimulate the patients endogenous NK cells. However, toxicity of cytokines in high doses required for effective stimulation of NK cells prolubits then- systemic administration. As such, a novel strategy for activating NK cells with better efficacy and less toxicity is warranted, and described within.
BRIEF SUMMARY
Tliis disclosure provides a combination therapy composed of luuasin and at least one cytokine. The combination therapy enhances the at least cytokine's effect on an iimate immune system, hi the combination therapy, the at least one cytokine is selected from the group consisting of IL-2, IL- 12, IL- 15, IL-18, IL-21 and EFN-a. hi some preferred embodiment, the combination therapy enhances innate immune system expression of ΓΡΝ-γ, IL- 15. CCL2, CCL3, CCL4 or GM-CSF.
In some preferred embodiment, the combination dierapy attenuates the suppression of Thl switch. hi some preferred embodiment, the combination therapy enhances the innate immune system's ability to eliminate viral-infected cells and other pathogens.
In some prefened embodiment, the combination therapy enhances natural killer (NK) cell cytotoxicity by increasing expression of Granzyme B and natural cytotoxicity triggeiiiig receptor 2 (NCR2).
In some prefened embodiment, the combination therapy enhances NK cell cytotoxicity by decreasing expression of inhibitory killer-cell immunoglobulin-like receptors (KIR). hi some preferred embodiment, the combination therapy enhances antibody-dependent cell mediated cytotoxicity (ADCC) by NK cells.
In one prefened embodiment, the combination therapy stimulates NK cells to enhance adoptive transfer cellular therapy. hi some prefened embodiment, the combination therapy is an adjuvant to enhance efficacy of a cancer vaccine.
Tliis disclosure provides a method of enhancing an innate immune system, the method comprising providing an individual with a pharmaceutically effective amount of a combmation of lunasin and at least one cytokine. In some prefen ed embodiment, the at least one cytokine is selected from the group consisting of IL-2, EL-12, IL- 15, EL- 18, IL-21 and EFN-a. hi another prefened embodiment, the at least one cytokine is IL-2 or IL-12.
In another preferred embodiment, the at least one cytokine is IL-12.
In another prefened embodiment, the at least one cytokine is IL- 18. hi another prefened embodiment, the enhanced immune system has natural killer (NK) cells widi increased expression of natural cytotoxicity triggering receptor 2 (NCR2) and
Granzyme B.
In another prefened embodiment, the enhanced immune system has NK cells with decreased expression of killer-cell immunoglobulin receptors (KIR). hi another prefened embodiment, the enhanced immune system has NK cells with an enhanced immune regulatory effect on allergic inflammation.
In another preferred embodiment, the enhanced immune system has NK cells with increased antibody dependent cell mediated cytotoxicity (ADCC).
This disclosure ftirther provides a method of enhancing activity of natural killer (NK) cells, the method comprising providing an individual with a pharmaceutically effective amount of a combination of luuasin and at least one cytokine, In some preferred embodiments, the aforementioned cytokine is IL-12 or IL-2. In some preferred embodiments, the NK cells have increased expression of Granzyme B or natural cytotoxicity triggering receptor 2 (NCR2).
Tins disclosure further provides a method of increasing natural killer (NK) cell immune regulatory effect on allergic inflammation, the method comprising providing an individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine. In some preferred embodiments, the aforementioned cytokine is EL- 12 or IL-2. In some of preferred embodiments, the NK cells have increased expression of Grauzyme B or natural cytotoxicity triggering receptor 2 (NCR2).
This disclosure further provides a method of increasing antibody dependent cell mediated cytotoxicity (ADCC) by natural killer (NK) cells, the method comprising providing an individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine, hi some of preferred embodiments, the NK cells have increased expression of Granzyme B or natural cytotoxicity triggering receptor 2 (NCR2).
Tins disclosure further provides a method of heating vims-infected cells in an individual, the method comprising providing the individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine. In some preferred embodiments, the cytokine is IL- 18.
This disclosure further provides a method of enhancing efficacy of a cancer vaccine, the method comprising providing an individual a pharmaceutically effective amount of a
combination of lunasin and at least one cytokine.
In some of the preferred embodiments for any of aforementioned methods, the at least one cytokine is selected from the group consisting of IL-2, IL-12, IL-15, IL- 18, EL-21 and EFN-a.
These and other features, aspects and advantages of the present invention will become better understood with reference to the following figures, associated descriptions and claims.
BRIEF DESCRIPTION OF FIGURES
Figure 1. The levels of IFNy produced by human primary NK cells from normal controls following stimulation.
Figure 2. TNFa production by primary NK cells following stimulation
Figure 3. Synergistic effects of luuasin and cytokines on gene expression by human primary NK cells.
Figure 4. Gene expression for TGF-β (TGFB1) and TGF-β receptor (TGFBR2) by human primary NK cells following stimulation over 3 days
Figure 5. Chiomatin Imniunoprecipitatiou (ChIP) assay for the chromatin stiiicture of IFNG and TGFBlgene loci in NK cells following treatment.
Figure 6. Synergistic effects of lunasin with cytokine IL-15 or IL-21 on IFNy production by human NK cells.
Figure 7. Dose-dependent effects of lunasin on IFNy production
Figure 8. Effects of lunasin plus single cytokine IL- 12 or IL-2 on IFNy production by NK cells with acquired Stat4 deficiency following chemodierapy in a syngenic rumor mouse model. Figure 9. Dose-dependent effects of lunasin in combination with both cytokines IL-12 and IL-2.
Figure 10. hitiacellular cytokine staining of IFNy production by NK cells from post-transplant NHL patients.
Figure 11. Grauzyme B gene expression (GZMB) by human primaiy NK cells following stimulation over 3 days
Figure 12. NK cell-mediated cytotoxicity in a human B-lymphoma cell line (Raji).
Figure 13. Lunasin augments cytotoxicity by cytokiue-activated NK cells in a xenograft model of human B-lymphoma.
Figure 14a. NCR2 gene expression (NCR2) by human primary NK cells following l day of stimulation.
Figure 14b. NCR2 gene expression (NCR2) by human primary NK cells following 3 days of stimulation.
Figure 15. Reduced expression of inhibitory KIRs by primary NK cells.
Figure 16. Lunasin augments NK-mediated cytotoxicity in human lung cancer cell lines.
Figure 17 Lunasin enhances IL-18-stimulated ADCC by human NK cells
Figure 18 The levels of IFNy production by human plasmacytoid dendritic cells (pDCs) from normal controls following stimulation.
Figure 19. Effects of lunasin on gene expression by human pDC. Figure 20. Effects of lunasin on gene expression by human cDC.
Figure 21. Effects of lunasin on IFNy production by myeloid dendritic cells (niDCs) and NK cells from mice.
Figure 22. Effects of lunasin on levels of surface molecules on human DCs. Figure 23. Effects of lunasin on EFNy production by macrophages from mice. Figure 24. Gene expression oilfng from mice heated with lunasin.
Figure 25. Lunasin-treated mice have reduced allergic inflammation in LPS-induced astlima model.
DETAILED DESCRIPTION
While the concepts of the present disclosure are illustrated and described in detail in the figures and the description herein, results in the figures and their description are to be considered as exemplary and not restrictive in char acter; it being understood that only the illustrative embodiments are shown and described and that all changes and modifications that come within the spirit of the disclosure are desired to be protected.
Unless defined otherwise, the scientific and technology nomenclatures have the same meaning as commonly understood by a person in the ordinary skill in the art pertaining to this disclosure. We propose a term "lunakine" as a combination of lunasin and a selective cytokine in which the lunakine demonstrates synergistic effect of the selective cytokine on certain innate immune cells. Generally, the procedures for cell culture, infections, molecular biology methods and the like can be found in the art.
Overview of Innate Immune Cells
The imiate immune system, also known as non-specific immune system and fust line of defense, comprises the cells and mechanisms that defend the host from infection by other organisms. This means that the cells of the innate system recognize and respond to pathogens in a generic way. Unlike the adaptive immune system, it does not confer long-lasting or protective immunity to the host. Innate immune systems provide immediate defense against infection, and ar e found in all classes of plant and animal life.
The major functions of the vertebrate innate immune system include: recruiting immune cells to sites of infection through the production of chemical factors, including specialized chemical mediators called cytokines; activation of the complement cascade to identify bacteria, activating cells and to promote clearance of dead cells or antibody complexes; the identification and removal of foreign substances present in organs, tissues, the blood and lymph, by specialized white blood cells; activation of the adaptive immune system through a process known as antigen presentation; acting as a physical and chemical barrier to infectious agents.
Inflammation is one of the fust responses of the immune system to infection or irritation. Inflammation is stimulated by chenucal factors released by injured cells and selves to establish a
physical barrier against the spread of infection, and to promote healing of any damaged tissue following the clearance of pathogens.
The process of acute inflammation is initiated by cells already present in all tissues, mainly resident macrophages, dendritic cells, histiocytes, Kupffer cells and inastocytes. These cells present on their surfaces certain receptors named partem recog ition receptors (PRRs), which recognize molecules that are broadly shared by pathogens but distinguishable from host molecules, collectively referred to as pathogen-associated molecular patterns (PA Ps). At the onset of an infection, burn, or other injuries, these cells undergo activation (one of their PRR recognizes a PAMP) and release inflammatory mediators responsible for the clinical signs of inflammation.
Cytokines produced by natural killer (NK) cells, dendritic cells (DCs) and macrophages of the innate immune system mediate the inflammatory response. These cytokines include EFNy IL- 12, TNFot, GM-CSF, and IL- Ι β.
The complement system is a biochemical cascade of the immune system that helps, or "complements", the ability of antibodies to clear pathogens or mark them for destruction by other cells. The cascade is composed of many plasma proteins, synthesized in the liver, primaril by hepatocytes. The proteins work together to: trigger the recruitment of inflammatory cells; "tag" pathogens for destruction by other cells by opsonizing, or coating, the surface of the pathogen; forming holes in the plasma membrane of the pathogen, resulting in cytolysis of the pathogen cell, causing the death of the pathogen; rid the body of neutralized antigen-antibody complexes.
Cells involved in innate immune system including the followings: NK cells, mast cells, eosinophils, basophils; and the phagocytic cells including macrophages, neutrophils and dendritic cells. Many of these cells function within the immune system by identifying and eliminating pathogens that might cause infection.
Natural killer cells (also known as NK cells) are a type of lymphocyte (a white blood ce and a component of innate immune system. NK cells play a major role in the rejection of tumors and cells infected by viruses. T ey kill cells by releasing small cytoplasmic granules of proteins
called perforin and grauzyiue that cause the target cell to die by apoptosis (programmed cell death). NK cells also directly exert several immunoregulatoiy functions by secreting cytokines.
Macrophages are large phagocytic leukocytes, which are able to move outside of the vascular system by moving across the cell membrane of capillary vessels and entering the areas between cells in pursuit of invading pathogens. In tissues, orga -specific macrophages are differentiated from phagocytic cells present in the blood called monocytes. Macrophages are the most efficient phagocytes, and can phagocytose substantial numbers of bacteria or other cells or microbes. The binding of bacterial molecules to receptors on the surface of a macrophage triggers it to engulf and destroy the bacteria through the generation of a "respiratory burst", causing the release of reactive oxygen species. Pathogens also stimulate the macrophage to produce chemokines, which summons other cells to the site of infection.
Dendritic cells (DC) are phagocytic cells present in tissues that are in contact with the external environment, mainly the skin (where they are often called Laugerhans cells), and the inner mucosal lining of the nose, lungs, stomach and intestines. They are named for their resemblance to neuronal dendrites, but dendritic cells are not connected to the nei"vous system. Dendritic cells are veiy important in the process of antigen presentation, and serve as a link between the innate and adaptive immune systems.
Neutrophils, along with two other cell types; eosinophils and basophils, are known as granulocytes due to the presence of granules hi their cytoplasm, or as polymorphonuclear cells (PMNs) due to their distinctive lobed nuclei. Neutrophil granules contain a var iety of toxic substances that kill or inhibit growth of bacteria and fungi. Similar to macrophages, neutrophils attack pathogens by activating a respiratory burst. The mam products of the neutrophil respiratory burst are strong oxidizing agents including hydrogen peroxide, free oxygen radicals and hypochlorite. Neutiopluls are the most abundant type of phagocyte, uonnally representing 50 to 60% of the total circulating leukocytes, and are usually the first cells to arrive at the site of an infection. The bone marrow of a normal healthy adult produces more than 100 billion neutr ophils per day, and more than 10 times that many per day during acute inflammation.
NK and inimuncsui veillance
Despite the hostile environment that contributes to the epigeuetic and genetic alterations, cancer unrnunosurveillance of the immune system is capable of recognizing and eliminating continuously arising, nascent transformed mutant cells. Both innate and adaptive immune cells act as sentinels in confining these malignant cells to a state that can be controlled. Preclinical studies have unequivocally shown that vertebrate immune system can recognize and destroy malignant tumor cells in vivo. Moreover, adoptive cellular therapy after allogeneic
hematopoietic stem cell transplantation has provided proof-of-principle that the immune system can eradicate tumor cells in humans.
Innate immunity is mediated by effector cells, including NK cells and macrophages that can respond inuuediately before adaptive immunity being developed. NK cells represent 10-15% of circulating lymphocytes in blood, which exert a potent cytolytic activity against vims-infected or tumor cells by releasing cytotoxic granules. NK cells have the ability to spontaneously kill target cells without any prior immunization or stimulation.
Innate immune responses are rapid, and can provide a jump start to respond to a danger signal before the development of adaptive immunity. For example, NK cells use granzyme B, a serine protease, to exert their cytotoxic function, which are important in immune surveillance. Granzyme B is constirutively expressed in NK cells, and can be further upregulated by cytokines including JL-2 and IL- 12.
NK and cytotoxicity
The cytotoxicity of NK cells can be activated by interferon and cytokines (e.g., IL- 12) that are produced by monocytes or dendritic cells (DC). In addition, activated NK cells result in the production of inflammatory cytokines (e.g., IFNy and TNFct). mediators, and enzymes (e.g., granzyme B) that contribute to the eradication of tumor cells.
The killing activity of NK cells is regulated by the net signaling events triggered by invariant activating and inhibitory receptors that recognize the ligauds on target cells. NK cells have two major classes of surface receptors: activating and inhibiting receptors. The activating receptors involved in NK-mediated cytolysis are NKG2D and the natural cytotoxicity receptors (NCRs) including NCR1 (NKp46 or CD335), NCR2 (NKp44 or CD336), and NCR3 (NKp30 or '
CD337). The inhibiting receptors include many of the killer-cell imiminoglobulin-like receptors (KIR) on NK cells recognize MHC class I ligands on target cells, which inhibit NK cell- mediated cytotoxicity.
The interaction of KIR on NK cells with MHC class I proteins on target cells is inhibitory. Thus if an NK cell binds to any bodily cell with high levels of MHC class I proteins, it is not activated, or more precisely, it is simultaneously activated and inhibited, and the inhibition prevails. If an NK cell binds to a cell with low levels of class I MHC proteins or none at all, it is activated and kills the cell without inhibitory signals. The activation requires binding of some ligand. possibly a carbohydrate moiety on the target cell, to an "Activation Receptor" protein on the surface of the NK cell. In the absence of an inhibitory signal, from KIR for MHC class I protein, this Activation Receptor generates a signal that allows the NK cell to execute its target.
The inhibitory signal is mediated by the MHC class I protein and therefore it might first appear that any cell in the body would be resistant to NK killing. Interestingly, however, many rumors and virus infected cells have reduced levels of MHC class I proteins. Indeed one of the viral sttategies to evade the immune system is to repress expression of class I MHC proteins, thus reducing the likelihood that viral peptides will be presented to cytotoxic T cells. This works to the advantage of the virus by delaying or reducing the immune response. But by lowering the levels of class I MHC, the vims "attracts" the attention of NK cells that respond to the deficiency of class I proteins by killing the infected cell. Thus the characteristics of NK cells ar e useful in fighting the viruses that use the MHC -reduction strategy.
Receptors involved in NK mediated cytolysis are NKG2D and the natural cytotoxicity receptors. Natural Cytotoxicity Receptors (NCRs) are cell surface glycoproteins that activate NK cells after ligand interaction. NCR2 is an activating receptor that promotes cytotoxicity and cytokine release upon ligand binding via the adaptor molecule. NCR2 expression is absent on fresh peripheral blood NK cells but may be induced by EL-2 in culture. Therefore NCR2 is used as specific marker for activated NK cells. In HTV-patient NCR2 was found on a substantial percentage of NKs and promotes cytotoxicity against NCR2 ligand positive CD4+ T cells.
Unfortunately NCR2L is induced by a part of the HTV- l envelop protein gp41 , resulting in a
progressive CD4+ T cell depletion by NK cells, which is correlated to the increase of the vims load.
A substitute activation of NCR2 is in need to activate NK cells while avoiding virus gp41 dependent NCRL induction.
NK and ADCC (antibody-dependent cellular cytotoxicity)
The binding of the Fc region of IgG to specific receptors (Fc receptors) expressed ou NK cells results in activating signals for cytotoxicity, which is called ADCC or antibody-dependent cellular cytotoxicity. The CD 16 (FcyRin) receptor complex expressed by NK cells is involved in ADCC. The development of therapeutic antibody has a great impact especially on human cancer therapy that is based on NK-mediated ADCC.
NK secreted IFN γ in allergic inflammation
NK secreted IFN γ plays an important role in modulating allergic inflammation. The rising prevalence of allergic diseases has resulted in increased cost of health services and reduced productivity, which represents a significant medical and economic burden. T helper type 2 (Th2)-mediated allergic inflammation is the major molecular mechanism underlying astlmia and other allergic diseases. Cytokine such as IL-4 secreted by Th2 cells induces B cells for isotype class switching to IgE that binds other leukocytes such as mast cells and eosinophils. When activated, these cells rapidly release their characteristic granule contents and mediators that contribute to the disease manifestation. A shift of the Thl Th2 balance toward Th2
differentiation predisposes individuals to allergic diseases. It has been shown that the increased susceptibility for allergic disease is a consequence of prevalent intake of "healthy food" rich in antioxidant that suppresses IFNy production, a hallmark of Till cytokine. Furthermore, western modem diet containing increased polyunsaturated fatty acid (PUFA) has been linked to the increase in asthma and allergic diseases because of suppressed Thl differentiation that promotes Th2 inunune responses. NK secreted IFNy may skew the balance of Th2/Thl so that reverse the allergic disease process.
Current status of cytokine immunotherapy
Cytokine immunotherapy enhances the anti-tumor immunity and is now pait of the therapeutic armamentarium for cancer treatment. Immunostimulatory cytokines, such as IL- 12 and IL-2, have had limited efficacy in lymphoma patients after chemotherapy followed by autologous stem cell transplantation. It has been reported that these heavily-treated patients have acquired deficiency of Signal Transducer and Activator of Transcription 4 (STAT4), which results in defective production of ΙΡΝγ following IL-12 immunotherapy.
Bioavailability of lunasin.
Soybean products appear in a large variety of processed food as well as in cosmetics and personal care products. Soybean comprises bioactive components that have anticancer effects. Among the most studied substances, the Bowman-Birk protease inhibitor (ΒΒΓ) inhibits proteases involved in carcinogenesis, and is currently in human trials as an anti-carcinogenic agent. Lunasin is a 43-amino acid soybean peptide that has chemopreventive properties capable of suppressing carcinogenesis via clnoinatin modification. Lunasin contains a poly-D carboxyl end with 8 D-residues and an RGD cell adhesion motif (bold) SEQ. ID. NO: 1
SKWQHQQDSCRKQLQG\n rLTPCEKHIMEKIQGRGDDDDDDDDD.
Lunasin is present in all genotypes of soybean and other natural products such as wheat. Significant levels of lunasin could be detected in the blood after oral consumption, demonstrating that lunasin survives digestion in the gastrointetstinal tract. Furthermore, lunasin extracted from autoclaved soybean products or blood of rats fed with hmasin-enriched soy (LES) is still active as evidenced by inhibiting acetylation of histone H3 and H4. These findings demonstrate that lunasin is a promising chemopreventive agent as it is heat-stable and remains its bioactivity after boiling or intestinal digestion.
Lunasin is known to directly induce apoptosis of transformed cells. Lunasin has utility as a preemptive strategy as well as a potential therapeutic regimens.
Tins disclosure provides evidence that lunasin exerts additional effects imposed by selected cytokines to modulate innate immune cells, for example, NK cell activity.
Complementary interventions using dietaiy botanical products are able to modulate the immune system. Lunasin exhibits iimuunostimulatoiy effects. Adding lunasin to the IL- 12 or IL-2 exerts
robust synergistic effects on regulating expression of several important genes by NK cells, which may harness rumor inununosurveillauce. The combination of lunasin and cytokines cocktails (IL- 12 plus IL-2) was capable of restoring LFNy production by NK cells in post-transplant Nou- Hodgkin's lymphoma patients who have immune dysfunction due to chemotherapy, hi addition, NK cells stimulated with lunasin plus IL-2 have higlier tumoricidal activity than those stimulated with EL-2 using in vitro and the xenograft mouse model.
Lunasin shows robust synergistic effects on selected cytokines when these cytokines are acted on certain innate immune cells, for example, human NK cells, various dendritic cells and macrophages. The synergistic effects of lunasin are broad, including but not limited to stimulating NK cells' essential for anti-tumor immunity, increasing EFNy and granzyme B production, and natural cytotoxicity triggering receptor 2 (NCR2) expression to activate NK's killing mode, i.e., the increased tumoricidal activity of NK cells following stimulation with luuasm peptides and selected cytokines; switching on NK's anti-viral surveil lance system, such as down regulating inhibitory receptors to stop the engagement of KIR to MHC-I class antigen, therefore tenninating the inhibitory mode of NK when any anti-viral cytokine is used in combination of lunasiu; further enhancing NK's ADCC effect when a selected cytokine with such effect is used in conjunction with lunasiu, etc. Liuisin's synergistic effect on selected cytokine (or cytokine cocktails) is also demonstrated on die downstream effectors of cytokines, such as to skew the Tli2/Thl differentiation to reverse allergic immune disease progress.
Lunasin treatment also reduces allergic inflammation in mouse models, symbolized as reduced production of allergic inflammatory cytokine, such as IL-4.
Elucidation of the cocktail of selected cytokines with lunasin may result in preemptive strategies for tlierapeutic prevention of cancer, immune modulation, and/or antiviral, anti-allergic therapy alternatives.
Cancer prevention
Cancer is the number-two killer of Americans. More than 1 ,400,000 new cases of cancer are diagnosed each year in the United States and approximately 560,000 patients die of cancer annually. The high morbidity and mortality of tliis disease represents a significant economic and
medical burden. However, cancer is mostly a preventable disease. More than 20% of cancer incidents are preventable by consuming a healthy diet with more vegetables and fruits.
Various preventive strategies can be undertaken to keep cancer cells dormant. Dietary modification is an important approach to prevent cancer development. A short list of diet properties that relate to cancer prevention include anti-oxidation as a ROS scavenger; anti- inflainmatiou as regulating expression of pro-inflammatory mediators; promoting anti-tumor immunity by activating immune cells; and epigenetic alterations by modulating DNA methylation and chromatin acetylafion.
IFNy is by far one of the most potent factors to activate cytotoxic T lymphocyte (CTL) cytotoxicity against rumor cell. In addition, IFNy enhances the immunogenicity of rumor cells by upregulating the MHC class I and class Π expression that allows them to be recognized and eliminated by CD8 and CD4 T lymphocytes, respectively. Both spontaneously arising and chemically-induced tumors are more common in IFNy receptor-deficient and IFNy-deficient mice compared to wild-type mice. Inhibition of IFNy in vivo abrogates the ability of immunocompetent mice to reject transplanted syngeneic tumors. Moreover, IFNy is required for the efficacy of several immunotherapeutic approaches in preclinical models. Strategically increase the production of IFNy is one of the targets to effectively kill tumor and other vims.
Effects of lunasin on immune cells.
Due to the significant levels of lunasin detected in the peripheral blood after oral consumption, we tested the lunasin peptides' immunomodulatory effects on human immune cells. We have demonstrated that lunasin and cytokine EL- 12 or IL-2 have synergistic effects on human NK cells, including up-regulating IFNG (interferon y), GZMB (grauzyme B) and NCR2 (natural cytotoxicity receptor 2) as well as augmenting in vitro cytotoxicity.
IL-12, IFN-y, and cancer immunotherapy
EL- 12-based immunotherapy is one of the emerging therapeutic strategies to harness the power of the immune system to eradicate cancer cells. Chemotherapy is most often used as a systemic treatment to eliminate cancer cells. However, there are numerous instances where clinical results do not meet expectations, possibly due to unforeseen effects during chemotherapy
as demonstrated in our study. Indeed, we found that chemotherapy-treated Non-Hodgkin's Lymphoma (NHL) patients are refractory to IL-12 inmnvnotherapy due to profound deficiency of signal transducer and activator of transcription 4 (STAT4) that is required for EL-12-mediated biological function including IFNy production. STAT4 deficiency may impair not only EL-12- based immunotherapy, but any therapeutic approach that requires optimal production of IFN-γ for effective anti-tumor imnninity. Therefore, alternative strategy to achieve an efficacious antitumor activity after transplantation may require interventions that exploit other mechanisms of IFNy production.
Treatment of PBMCs with both IL- 12 and EL- 18 can partially rescue IFNy production in PBMCs of Non-Hodgkin's Lymphoma. (NHL) post-transplant. Moreover, NHL post-transplant patient PBMCs produce comparable levels of IFNy when they are stimulated with PMA and ionomyciu. a strong and non-physiological stimulus, suggesting they are capable of making EFNy if with a proper stimulus. We explored bioactive food component using lunasin, a soy peptide, as alternatives to circumvent the deficiency of IFNy production. While lunasin alone had moderate effects, the combination of EL- 12 and lunasin peptides markedly increased IFNG gene expression in a dose-dependent maimer. The levels of EFNy in the supeniatants detennined using ELISA also confirmed these results. Human peripheral blood mononuclear cells (PBMCs) of normal controls were stimulated, and we found that N but not CD4 or CD8 T populations respond to lunasin stimulation as evidenced by IFNy production evaluated using intracellular cytokine staining, hi addition, the combination of lunasin and EL- 12 further enhances the production of EFNy by purified NK cells. Given the fact that lunasin enters peripheral blood and retains its bioactivity, tins peptide exerts systemic effects on NK cells.
NK cells use granzyme B, a serine protease, to exert their cytotoxic function, which are important in immune surveillance. Granzyme B is constitutively expressed in NK cells, and can be further upiegulated by cytokines including EL-2 and EL- 12. We have shown granzyme B is regulated by lunasin in NK cells. qPCR was performed to evaluate its gene expression.
Although the increased concentration of IL-12 had no further induction of GZMB, the combination of IL- 12 and lunasin peptides readily increased the gene expression of GZMB.
The combination of lunasin and selected cytokine (a therapeutics together designated as lunakiue) exerts robust synergistic effects on modulating expression of various genes that are important for NK functions. These results have demonstrated the in vitro responsiveness of freshly isolated hiunan NK cells to a lunakine in which lunasin peptides are in combination with IL-12 oi IL-2.
We have also shown that NK cells have augmented cytotoxic activity following stiiinilatiou with the combination of cytokine and lunasin peptides by in vitro cytotoxicity assay with the target cell Raji, a human B-lyniphoma cell line. The presence of lunasin further enhanced the cytotoxic activity as compared to cytokine alone. Taken together, these results demonstrate the ability of lunasin peptide in combination with cytokine to enhance the cytotoxicity of NK cells.
Synergistic effects of lunasin with other cytokines
In addition to EL- 12. we also found that lunasin exerts the synergistic effects with other cytokines including EL-2, IL-15, IL- 18, IL-21 and DFNct, which are known cytokines to activate NK cells. The combination of IL-2 and lunasin peptides readily increased EFNy production while EL- 15, IL- 18, EL-21 and EFNa had modest effects. In addition, production of EFNy by NK cells treated with lunasin plus EL-2 is similar to that with lunasin and IL- 12 over 3 days of incubation. Furthermore, augmenting expression of granzyme B was observed in NK cells following the combination of EL-2 and lunasin stimulation. Since EL-2 mediates its biological function independent of STAT4. the application of IL-2 and lunasin peptides is a potential alternative to enhance the cancer unmunotherapy for NHL patients who acquire STAT4 deficiency.
Our results have supported the immunomodulatory activity of hmakine on NK cells. The combination of lunasin with selected cytokines, such as IL- 12 or IL-2 is an alternative strategy for enhancing (1) the efficacy of cancer immunotherapy by augmenting EFNy production. (2) the tumoricidal activity of NK cells by increasing granzyme B expression, and (3) the potential of therapeutic prevention for cancer by promoting NK-mediated anti-rumor immunity and adjuvanticiry.
Lunasin on modulating allergic airway inflammation
Allergy is clinically defined as type I hypersensitivity that is caused by undesirable immune respouse to a normally harmless substance called allergen. Common allergens include pollen, animal dander, house dust mite, and a variety of food such as eggs and peanuts.
Exposure to allergens triggers the allergic inflammatory responses that induce the production of IgE. Binding of IgE to innate immune cells (e.g., mast cell and eosinophils) leads to the release of gr anule contents including lipid mediators and histamine. All these are the characteristics of allergic reactions. Allergic diseases are associated with a range of conditions including allergic asthma, allergic rhinitis, food allergies, and allergic eczema. The recent escalation of allergic diseases may be attributable in part to changes in environment, lifestyle, and dietaiy components It has been shown that the increased susceptibility for allergic disease is a consequence of prevalently intake of "healthy food" rich in antioxidant that suppresses ΓΕΝγ production.
Pathogenesis of allergic inflammation
Depending on the cytokine milieu in the inflamed tissues, CD4+ T lymphocytes have the plasticity to differentiate into distinct subsets of T helper (Th) cells that are characterized by the production of signature cytokines. IL- 12 promotes the differentiation of T helper type I (Thl) cells that produce proinflammatory cytokine ΓΕΝγ, whereas IL-4 promotes die development of Th2 cells that secrete IL-4, EL- 5 and EL- 13. The developed T helper subsets acquire effector pheiiotypes that promote specialized inflammatory responses.
It is well-established that Th2-mediated inflammation is the major molecular mechanism underlying asthma and other allergic diseases. Cytokines produced by Th2 cells mediate the following effects that contribute to allergic diseases: 1 ) IL-4 induces B cell isofype class switching to IgE that binds and activates mast cells to release the granule contents; 2) IL-5 recruits and activates eosinophils; 3) EL-13 activates goblet cells to secrete mucus. On the contrary, Till cytokine ΓΕΝγ directs several imiminoregulatory mechanisms diat inhibit Th2 differentiation. A shift in the Th l/Th2 balance with favor in Tli2 differentiation can result in allergic diseases. Studies also implicate that skewing to Thl response can suppress Th2- mediated allergic iuflanunation, and therefore prevent and control allergic diseases.
Natural Killer (NK) in lung inflammation
NK cells are another major population that produces ΓΓΝγ, and represent 10- 15% of circulating lymphocytes in blood, which exert a potent cytolytic activity against vims-iufected or rumor cells by releasing cytotoxic granules. NK cells directly exert several iimnuuoregulatory functions by secreting cytokine ΓΓΝγ. EFNy inhibits the development of Th2 lineage and facilitates Thl differentiation. Isotype switching in B cells to IgG is enhanced by ΓΓΝγ that in turns inhibits the IgE production. Imiate immune responses mediated by NK cells are rapid, and can provide a jump start to respond to a stimulatory signal before the development of adaptive iinniunify. Indeed, NK cells can rapidly produce JFNy after only 4 his of stimulation. NK cells are normally present in human lung interstitium. In mice, pulmonary allergic sensitization induces NK cell accumulation in lung-draining lymph nodes and regulates ainvay eosinophilia in a murine model of asthma. All these featur es and the cytokine milieu created by EFNy-producing NK cells may preferentially prevent the development of Th2-mediated allergic inflammation.
Intervention of allergy
Immunotherapy has been shown to prevent deleterious allergic reaction by exposing patients to the allergens thereby reducing sensitivity. However, treatment is a lengthy procedure and not appropriate for everyone. Therefore, alternative strategy to achieve an efficacious antiallergic infiainmation may require interventions that exploit other mechanisms.
Dietary modification is able to exquisitely structure the immune system that results in the imbalance of Th l/Th2 inflammation. Certain dietary components have the ability to stimulate immune cells, making them more effective for inmnuiomodulation by secreting cytokines, chemokines, and other inflammatory mediators. It has been observed that increased
susceptibility for allergic diseases is likely due to increased intake of food rich in antioxidant that suppresses EFNy production. Epidemiologic data have linked the increasing polyunsaturated fatty acid (PUPA) in western modem diet to the increase in asthma and allergic diseases because increased syu thesis of prostaglandin E2 suppresses Thl and promotes Tli2 differentiation. On the other hand, daily consumption of whole milk reduces asthma risk in preschool children. Furthermore, therapeutic intervention of herbal medicine is in part due to their effects on modulating the Th l/Th2 development, which is a common practice for regulating a number of
diseases. The Chinese herbal extracts MSSM-002 have been shown to exert anti-allergic airway hyperreactivity by suppressing production of Th2 cytokines. On the other hand, extracts of other Chinese herbs suppress secretion of Thl cytokine IFNy and promotes Th2-mediated immune response, which are used to control autoimmune diseases with the expense of increased susceptibility for allergy. These studies suggest that the innnune system can be manipulated by dietaiy component, which has significant impact on human health.
We have found that lunasin has immunomodulatory effects on enhancing Till cytokine IFNy production by NK cells, hi addition, significant levels of bioactive lunasin could be detected in the lung and peripheral blood, suggesting tins peptide could potential exeit effects on NK cells to promote IFNy production and restrain the influence of Th2 allergic inflammation.
NK cells are an important defense mechanism against tumor cells and various pathogens. However, by their immunoregulatory activity NK cells may diminish Tli2-mediated
inflammation that alleviates the allergic responses to allergens. The concept of modulating allergic inflammation by lunasin is novel.
Our studies have demonstrated that lunasin has immunomodulatory effects on NK cells to enhance the production of IFNy, which creates the cytokine milieu that promotes Thl differentiation. Lunasin stimulates NK cells to increase the production of IFNy that may inhibit Tli2 development, and therefore, suppress Th2-mediated allergic airway inflammation.
Therefore, there is a use of soy peptide lunasin for prevention and/or treatment of asthma and other allergic diseases. We have revealed additional effect of lunasin other than
chemopreventative property in winch it exerts anti-allergic inflammation.
Microbial organisms
Embodiments of the invention include compositions and related methods for enhancing innate immune response that can have broad protection against a variety of pathogens or potential pathogens. For example, bacterial pneimionia in a normal host occurs at a rate of 17700 persons/year-, mostly in elderly adults and young children and can be caused by a variety of organisms. It is most commonly caused by Streptococcus pneumoniae, followed in frequency by encapsulated Hemophilus influenzae. Other bacteria such as enteric gram negatives, anaerobes.
and Staphylococcus aureus are significant causes of pneumonia in specific settings, such as healthcare facilities. Mycobacterium tuberculosis is highly infectious, and liistorically was an important cause of mortality worldwide. It has mostly been controlled with antibiotics in the developed world, though lnultidrugresistant strains continue to cause problems and are classified as Categoiy C bioweapon agents. Legionella pneumophila was fust identified dming an outbreak in Philadelphia in 1978, though it is now recognized to occur widely at a low endemic rate related to environmental sources. Also, fungal infections of the lungs can cause symptomatic disease hi normal hosts. Histoplasma capsulation, Coccidiodes immitis, Blastomyces der atitidis, and Ctyptococ is neoformans can all cause pneumonia related to local exposure to high environmental concentrations. Pneumonia due to these pathogenic fungi is usually self-limited in normal hosts. Some additional "atypical" microorganisms, such as mycoplasmas, account for a substantial fraction of additional pneumonias in normal hosts. It is contemplated that a composition of the present invention can provide a rapid, temporal protection against a spectrum of agents that can cause, for example pneumonia or other disease states. In certain aspects the present invention may be used in combination with a vaccination regime to provide an additional protection to a subject that may or is exposed to one or more pathogenic or potentially
pathogenic organism.
There are numerous microbes that are considered pathogenic or potentially pathogenic under certain conditions. In certain aspects, the pathogenicity is determined relative to infection via the lungs. Bacterial microbes include, but are not limited to various species of the Bacillus, Yersinia, Franscisel!a, Streptococcus, Staphylococcus, Pseudoinonas, Mycobacterium,
Burkholdena genus of bacteria. Particular species of bacteria from which a subject may be protected include, but is not limited to Bacillus anthracia, Yersinia pestis, Francisella tulareiisis, Streptococcuspnemoniae, Staphylococcus aureas, Pseudoinonas aeniginosa, Burkholdena cepacia, Cory e.bacte.rium diphtheriae, Clostridia spp, Shigella spp., Mycobacterium avium, M. intracellular, M. kansasii, M. paratuberculosis, M. scrofulaceum, M. simiae, M. habana, M. interjectuni, M. xenopi, M. Iieckeshornense, M. szulgai, M.fortuitum, M. immunogenum, M.
chelonae, M. marinum, M. genavense, M. haemophilum, M. celatum, M. conspicuuni, M.
ina!nioense, M. ulceraiis, M. smegmatis, M. wolinskyi, M. goodii, M. thermoresistible, M.
neoaunim, M. vaccae, M. palustre, M. elephantis, M. bohernicam and M. septiciim
EXAMPLES
Example 1 Lunasin's effect on nature killer (NK) cells
Lunasin is originally known for its chemopreventive property that has been demonstrated in cell cultures and mice models (ref). It is known that lunasin can be detected in the peripheral blood after oral consumption. However, the effects of lunasin on immune cells in the peripheral blood are largely unknown. In this study we have identified an additional effect of lunasin on enhancing anti-tumor immunity mediated by peripheral NK cells, supporting its potential as an imniunomodulating agent in harnessing cancer irriraunosurveillauce. hi addition, we have developed an alternative strategy to induce IFNg production by NK cells using lunasin in combination with single cytokine or cytokme cocktails (IL-12 and IL-2). The combination of lunasin and selected cytokine (a therapeutics together designated as lunakine) exeits robust synergistic effects on modulating expression of a number of genes that are important for NK function, suggesting lunakine is superior to cytokine alone for enhancing the efficacy of cytokine immunotherapy.
Lunasin stimulates NK cells to produce IFNg
To investigate the effects of huiasin on immune cells, peripheral blood mononuclear cells
(PBMCs) from healthy donors were stimulated with or without lunasin in the presence or absence of cytokine IL- 12 or BL-2. Because IL-12 and IL-2 are known to induce the expression of IFNG by NK cells, these two cytokines are included in the stimulation for comparison.
Following 1 day of stimulation, distinct cell populations that respond to stimulation were evaluated using intracellular cytokine staining for EFNy production. We found that CD4 and CDS T populations remained negative with all stimulus (data not shown), while nature killer (NK) populations had more positive staining for IFNy following stimulation with both lunasin aud cytokine IL-12 or IL-2 as compared to cytokme or lunasin alone (Figure 1A). This finding was further confirmed by stimulation of purified human NK cells followed by analysis of secreted IFNy in the supematants using ELISA (Figure IB). Results showed that huiasin in combination with cytokine IL- 12 or IL-2 markedly increased the production of IFNy while lunasin alone had moderate effects. The mRNA expression of IFNG from the cell pellets of the same cultures correlated with the ELISA results (Figure 1C). Consistent with intracellular staining, purified
CD4+ or CD8+ T cells produced undetectable levels of EFNy under the same stimulation as in NK cultures (data not shown). Our initial data suggested that human NK cells respond to hmasin stimulation, and hmasin works with cytokine IL-12 or IL-2 to induce the production of IFNy.
Figure 1 shows human primary NK cells produce robust amount of IFNy in combination neatineut with lunasin and IL- 12 or IL-2. Aliquots of PBMCs isolated from healthy volunteer donors were c yopreserved in liquid nitrogen for the following assays. The lunasin peptides were conuuercially synthesized (LifeTeiu , South Plainfield, NJ), and the 43-amino acid sequences are the following SEQ. ID. NO: 1 :
SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD. (A) Intracellular cytokine staining of IFNy production by human NK cells using flow cytometry. Peripheral blood mononuclear cells (PBMCs) of normal controls were stimulated with medium only (-), lunasin only at 20uM (hi) cytokine IL-12 at lOng/ml or IL-2 at l OOunits/ml, and cytokine with lunasin for 1 day. At the last 6 hi s of stimulation, golgistop (monensin) was added to block the secretion of IFNy. Stimulated PBMCs were sxuface stained with FITC-conjugated CD3 and PE- conjugated CD56 monoclonal antibodies (BD), washed, fixed, and penneabilized. After washing, cells were incubated with APC-conjugated anti-EFNy monoclonal antibody. Expression of IFNy was evaluated on 5000 events of gated CD3 negative and CD56 positive NK cell populations. The % of NK populations producing EFN y is labeled at the upper right quadrant of the dot plot. (B) IFNy production in the supernatants. Freshly isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of normal controls using positive selection with CD56 magnetic beads (Miltenyi Biotec, Auburn, CA) were stimulated as indicated. One day following stimulation, the supernatants were collected for measuring the production of IFNy using ELISA. Results are presented as mean ± SD fiom duplicates. (C) IFNG gene expression. The cell pellets were analyzed for gene expression using qPCR with Taqman Assay primers. Data are presented as mean ± SD from duplicates. Results shown are representative from over 5 different normal controls.
In addition to EFNy. NK cells heated with EL-12 and lunasin also produce other cytokines. Figure 2 shows TNFct production by primary NK cells isolated fiom normal controls following stimulation. Human primary NK cells were isolated from peripheral blood mononuclear cells
(PBMCs) of normal controls using positive selection with CD56 magnetic beads (Miltenyi Biotec, Auburn, CA). Freshly isolated NK cells were stimulated with medium only (-), EL- 12 (lOng ml) in the absence (0) or presence of various concentiations of soluble hmasin peptides for 1 day. The supernatants were collected for measuring the concentrations of TNFa using ELISA. Results are presented as mean ± SD from duplicates.
IL- 12 and EL-2 are known cytokines to activate NK cells by regulating expression of a number of genes that are important for NK functions. Because of robust synergistic effects of hmasin with EL-12 or IL-2 on inducing IFNG expression, we next evaluated whether hmasin is able to modulate other target genes that are known to be regulated by cytokine IL- 12 or EL-2. Results of qPCR from samples in figure 1C showed that adding hmasin to EL-12 or IL-2 significantly increased expression of GZMB (granzyme B), while reduced TGFB1 (TGFp l) and TGFBR2 (TGFP receptor 2) as compared to those widi cytokine alone (Figure 3). Lunasin appeared to exert synergistic effects imposed by the selected cytokine IL- 12 or EL-2 to modulate expression of target genes in NK cells. In addition, we also found that lunasin by itself is sufficient to up-regulate genes such as CCL3, CCL4 and CSF2 while no effects on GNLY (Figure 3C and 3B).
Figure 3 shows Synergistic effects of lunasin and cytokines on gene expression by human primary NK cells. Freshly isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of normal controls using positive selection with CD56 magnetic beads (Miltenyi Biotec, Auburn, CA) were stimulated with medium only (-), IL- 12 ( lOng/ml), EL- 12 ( 10 ng ml) + lunasin (20 μΜ), EL-2 (100 unit/ml), EL-2 (100 unit/ml) + hmasin (20 μΜ) or lunasin alone (20 μΜ). One day following the stimulation, the cell pellets were resuspended in Trizol Reagents for total RNA extraction. The first-strand cDNA was synthesized followed by real time qPCR using Taqman Assay with primers for EFNy (IFNG), granzyme B (GZMB), granulysin (GNZ-Γ), cheraokine (C-C motif) hgand 3 or CCL3 (CCL3), CCL4 (CCL4), Granulocyte-macrophage colony-stimulating factor or GM-CSF (CSF2), TGFp (TGFB) and TGFP receptor (TGFBR2) in ABI 7300 (Applied Biosystems by Life Technologies, Carlsbad, CA). Data are presented as mean ± SD from duplicates. Results shown are representative over 5 different normal controls.
Lunasin is shoAvn to down regulate IFNy's negative regulators
Lu Figure 3, we observed a greater reduction of TGFB1 and TGFBR2 (TGF-β receptor Π) in NK cells following EL- 12/EL-2 and lunasiu stimulation than those with medium only, cytokine or lunasin aloue. Figure 4 shows gene expression for TGF-β (TGFB1) and TGF-β receptor (TGFBR2) by human primary NK cells following stimulation over 3 days. Freslily isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of normal controls using positive selection with CD56 magnetic beads (Miltenyi Biotec. Auburn, CA) were stimulated with medium only (-), IL- 12 (10 ug/ml), EL- 12 (10 ng/ml) + lunasin (20 μΜ), EL-2 (100 umt/ral), IL-2 (100 unit/ml) + lunasin (20 μΜ) or lunasin alone (20 μΜ). Following 1 , 2, and 3 days of stimulation, the cell pellets were lysed in Trizol Reagents for total RNA extraction. The first- strand cDNA was synthesized followed by real time qPCR using Taqman Assay with primer for TGFB1 and TGFBR2 in ABI 7300. Results are presented as mean ± SD from duplicates.
Because TGF-βΙ is a negative regulator of EFNy in NK cells, and deacetylation of histone H3 is associated with gene repression, we tested the hypothesis that lunasin inhibits TGFB1 or TGFBR2 expression by modulating chromatin structure of these gene loci in NK cells following IL- 12/IL-2 and lunasin stimulation, and therefore IFNG expression is up-regulated because of less negative regulator TGF-βΙ and unresponsiveness to TGF-βΙ due to reduced expression of TGF-β receptor Π.
To evaluate chromatin remodeling, freslily isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of normal controls using positive selection with CD56 magnetic beads (Miltenyi Biotec, Auburn, CA) were stimulated with medium only (-), IL-12 (10 ug/ml), IL-12 (10 ng/ml) + lunasin (20 μΜ) or lunasiu alone (20 μΜ). Following 1 day of stimulation, cells were subjected to ChEP assay. Chromatin DNA fragments were
immunoprecipitated with antibodies against acetyl-histone H3 (AcH3) and non-immune rabbit serum (Millipore, Billerica, MA), individually. The relative degr ee of histone acetylation of IFNG and TGFB1 loci was compared by qPCR using primers that amplify the promoter region (+lkb). For quantification of chr omatin immunoprecipitates, a standard curve was generated from a known amount of sonicated NK cell DNA. For calculation of ChEP results as a percentage of input, the amount of the iinmimoprecipitated DNA from the non-immune rabbit serum was subtracted from the amount of immunoprecipitated DNA from the AcH3 antibody, followed by normalizing against the amount of the input DNA. Data are shown as mean percentage of input ± SD from duplicates.
Epigeuetic regulation by chromatin modification is known to alter gene expressiou, and deacetylatiou of H3 is associated with gene repression. Indeed, chromatin hnmiuioprecipitatiou (CliIP)-qPCR demonstrated that greatly reduced acetyl-H3 is associated with TGFBl locus in NK cells treated with lunasin plus IL- 12 than IL- 12 aloue (Figure 5 A, lower panel). The synergistic effects of lunasin with selected cytokine such as EL- 12 are in part due to reducing the levels of aceryl-H3, which further suppresses the expression of TGFBl . Figure 5 shows Chromatin nmunoprecipitation (ChEP) assay for the cliromatin structure of 1FNG gene locus in NK cells following treatment, which is positively associated with acetylated histone H3 (Figure 5A, upper panel). Results provides a mechanism of gene regulation in the example oflFNG in which lunasin down-regulates expressiou of negative regulators (e.g., TGFBl and TGFBRIT) that in rum up-regulate then corresponding target genes (e.g., IFNG).
Synergistic effects of lunasin with other cytokines
Results using ChEP assay suggest that IL-2 or IL-12 initiates the chromatin remodeling that permits the access of lunasin peptide into the nucleosomes, which modulates histone modification for regulating expression of target genes. Other cytokines or agents capable of chromatin remodeling are therefore anticipated to grant the access of lunasin peptide for regulating gene expression. Indeed, we observed that the combination of IL-15, IL-18. IL-21 or EFNa with lunasin increases the expression of EFNy production (Figure 6).
Dose dependent effects of lunasin on IFNy production
Because of the robust synergistic effects of lunasin with IL- 12, we next tested: (1 ) if lunasin could reduce the concentrations of IL-12 while maintaining the efficacy on EFNy production by NK cells; and (2) if this synergistic effect depends on the dose of lunasin. Human NK cells were stimulated with EL-12 at low (1 ng ml) or high (lOng/ml) or along with various concenti ations of lunasin. Results demonstrated that IL- 12 alone at high concentration is required to induce more IFNy production than tliat with 10 fold lower concentration of IL- 12 (Figure 7A). However, in the presence of lunasin, lower concentration of EL- 12 is capable of inducing EFNy production to the levels comparable to those using 10 fold higher of EL-12, and this effect is dependent on the dose of lunasin (Figure 7B).
Figure 7 shows that responses of NK cells to lunasin in combination of EL- 12 ar e dose dependent with IFNy as the read out. Human primary NK cells were isolated from peripheral blood mononuclear cells (PB Cs) of normal control using positive selection with CD56 magnetic beads (Milteuyi Biotec, Auburn, CA). Freshly isolated NK cells were stimulated with medium only (-), EL- 12 alone (at 1 or l Ong ml), IL-12 (at 1 or lOng/ml) in the presence of various concentrations of lunasin peptides for 1 day. The supematants were collected for measuring the production of IFNy using ELISA. Results are presented as mean ± SD from duplicates. Taken together Figure 7 ilhistiates that it is lunasin that acts on NK cells to cause the dose dependent response of lunasin+ IL-12 treatment.
Effects of lunasin plus single cytokine IL-12 or IL-2 on IFNy production by NK cells with acquired Srat4 deficiency following chemotherapy in a syngenic tumor mouse model
We previously reported that heavily-treated NHL patients acquired STAT4 deficiency as a consequence of chemotherapy, which contributes to impaired IFNy production following IL-12 immunotherapy. Since IL-2 mediates its biological function independent of STAT4 {Lin. 2000 #648} and lunasin works synergistically with IL-2 (Figures 1 and 3), we wanted to test whether IL-2 alone or the combination of lunasin and EL-2 can circumvent the deficiency of IFNy produced by NK cells that are refractory to IL-12 stimulation due to chemotherapy-induced STAT4 deficiency, hi our mouse model reduced Stat4 was found in NK cells from rumor- bearing mice following chemotherapy with etoposide. As expected, Stat4-defective NK cells secreted less IFNy than those from Stat4-sufficient cells following IL- 12 stimulation (Figure 8A. filled bars). Adding lunasin to the EL-12 culture increased EFNy production by NK cells from mice without chemotherapy (- etoposide) while no effects on those with reduced Stat4 following chemotherapy (+ etoposide). Despite the poteutial independence of Stat4 mediated by the IL-2 signaling pathway, Stat4-deficient NK cells did not respond to DL-2 stimulation, which resulted in undetectable levels of IFNy production (Figure 8B, filled bars). However, combination of lunasin with IL-2 was able to induce the production of EFNy by Stat4-deficieut NK cells, albeit at a lower level than those without Stat4 deficiency (Figure 8B, open bars).
Dose-dependent effects of lunasin in combination with both cytokines IL-12 and IL-2
Combination therapy of IL-12 and EL-2 induces potent anti-rumor immunity and is currently in clinical trial. Since adding lunasin to single cytokine did not result in successful recovering of EFNy production by NK cells with acquired Stat4 deficiency in our mouse model, we wanted to test whether combination therapy with IL-12 and EL-2 in the presence of lunasin can circumvent such deficiency for rescuing IFNy production. We next evaluated the production of IFNy by normal NK cells following exposure to different concentrations of IL-12 and IL-2 to define the dose-response relationship. We foi d that at higher concentrations of IL- 12 (5 and 10 ng/nil), adding IL-2 as little as 10 units/ml had significantly increased the production of IFNy as compared to IL-12 alone, and the response was less dependent on the dose of IL-2 (Figure 9A). When lowest concentration of IL-12 was used (at l ug/ml), the production of IFNy increased in the presence of higher dose of IL-2. Combining both IL- 12 and EL-2 even at the lowest doses significantly enhanced the levels of EFNy as compared to those stimulated with single cytokine (Figure 9A).
We next wanted to test the effects of adding various couceutiations of lunasin to both cytokines on EFNy production by NK cells. Levels of EFNy were significantly higher in NK cultures with both cytokines IL-12 and EL-2 in the presence of lunasin than those without lunasin (Figure 9B). Adding lunasin synergistically enhanced EFNy production by NK cells stimulated with both cytokines EL- 12 and IL-2 combined at various couceutiations. The induction of EFNy depends on the dose of lunasin, which appeared to reach the plateau in the presence of lunasin at 20 μ . Thus, adding lunasin to NK cultures can enhance EFNy production following stimulation with lower concentiatious of both cytokines IL-12 and EL-2, which may reduce the toxicity associated with the use of these cytokines.
Although EL-2 is approved by FDA, its toxicity in high doses prohibits die systemic administration. Because EL-2 and lunasin peptides act synergistically on inducing EFNy production by NK cells, a lower dose of IL-2 is likely to achieve the same effects on EFNy production in the presence of lunasin peptides. Similar combination of lunasin with other selective cytokine may be used to boost the desired EFN-y production.
Example 2 the effects of lunasin on cytokine immunotherapy for lymphoma patients Effects of lunasin plus both cytokines IL-12 and IL-2 on IFNy production by NK cells from NHL patients post-transplant
Our results in figure 8 suggest the limited efficacy of lunasin in combination with single cytokine on inducing IFNy production by NK cells with reduced Stat4 following chemotherapy. Because the unprecedented induction of IFNy by adding lunasin to combination cytokines IL- 12 and EL-2, we next tested the effects of this intervention on IFNy production by post-transplant NHL NK cells ex vivo. As reported previously, STAT4 deficiency was observed in post- transplant patient PBMCs. Stimulation of patient PBMCs with both cytokines IL- 12 and IL-2 resulted in positive production of IFNy by NK populations (CD3-CD56+) using intracellular staining, albeit at a much lower % as compared to cells from normal controls (Figure 10).
However, adding huiasin to the stimulation can further increase the % of patient NK cells that produce IFNy, which is similar to the level from normal controls. Thus, huiasin may enliance the clinical outcomes when used in combination with both cytokines IL-12 and IL-2.
Example 3 the tumoricidal activity of lunasin-stimulated NK cells
In addition to an iimmmoregulatory role of NK cells through cytokine production, they have the ability to spontaneously kill target cells without any prior immunization or stimulation. NK cells exeit their tumoricidal process tlirough the release of granules that contain granzynie B, a serine protease. Granzynie B is constirutively expressed in NK cells and can be up-regulated by cytokines including IL- 12 and EL-2; consequently, their cytotoxicity can be enhanced by stimulation with these cytokines. Figure 3 showed that the level of GZMB gene expression was higher with EL- 12 or IL-2 plus lunasin compared to cytokine alone. Figure 11 further showed that cytokine IL-2 or IL-12 plus lunasin results in increased granzynie B {GZMB) gene expression by human primary NK cells following stimulation over 3 days compared to cytokine or lunasin treatment alone. Freshly isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of nonnal controls using positive selection with CD56 magnetic beads (Milteuyi Biotec, Auburn, CA) were stimulated with medium only (-), IL-12 (10 ng/ml), EL- 12 (10 ng/inl) + lunasin (20 uM), IL-2 (100 unit/ml), EL-2 (100 unit/ml) + lunasin (20 μΜ) or huiasin alone (20 μΜ). Following 1, 2, and 3 days of stimulation, the cell pellets were lysed in Tiizol Reagents for total RNA exQaction. The fust-strand cDNA was synthesized followed by real time qPCR using
Taquiau Assay with primer for granzyme B (GZAiB) in ABI 7300. Results are presented as mean ± SD from duplicates.
Lunasln augments cytotoxicity by cytokine-activated NK cells
Our results showed that lunasin acted synergistically with IL-12 or IL-2 to activate NK cells that had higher levels of IFNy production. To detemiine whether activated NK cells have augmented cytotoxicity following stimulation with hinasin, we measured their killing activity using die hi Vitro Cytotoxicity Assay. As expected, cytokine-activated NK cells exhibited higher cytolytic activity against Raji lymphoma cells as compared to that with unstimulated effectors (Figure 12). Moreover, NK cells stimulated with the combination of lunasin and single cytokine or both cytokines mediated cytotoxicity superior to tliat by NK cells activated with single or both cytokines alone (Figure 12). These in vitro results have demonstrated the ability of lunasin synergistically works with single or both cytokines IL- 12 and EL-2 to enhance the tumoncidal activity of NK cells against Raji lymphoma cells that are resistant to NK-inediated killing.
Figure 12 shows NK cell-mediated cytotoxicity in a human B-lymphoma cell line (Raji). Freshly isolated NK cells (described in Figure 3) were stimulated with medium only (-), IL- 12 (l ng/ml) or IL-2 (10 units/ml) only lunasin only (50 μΜ), IL- 12 or IL-2 + lunasin, or IL- 12 and IL-2 + lunasin as indicated for 1 day. The target cell Raji (a human B-lymphoma cell line) was provided by Dr. Shivani Srivastava. The in vitro cytotoxicity assay was measured using lactase dehydiogenase (LDH)-releasing assay with die CytoTox 96 non-Radioactive Cytotoxicity Assay Kit (Proinega, Madison, WT). The effectors were co-cultured with target cells at ratio of 10: 1 for 4 hi s at 37C in a 5% CO, incubator. The % of cytotoxicity was calculated according to the manufacturer's instructions. Data are presented as mean ± SD from 2 duplicates. Results shown are representative from 3 independent experiments. *P<0.05; **P>0.05.
Lunasin augments cytotoxicity by cytokine-activated NK cells in a xenograft model of human B-lymphoma
Cellular therapy using NK cells activated in vitro has been tested clinically against several tumors, including hematologic malignancies and solid tumors such as melanoma, renal cell carcinoma, breast cancer, ovarian cancer and neuroblastoma. Our in vitro cytotoxicity assay supports that activated NK cells using lunasin and cytokine(s) are superior to those activated
with cytokine(s) alone (Figure 12), which may provide a more efficacious NK-based cellular therapy in vivo. We next evaluated the in vivo cytolytic activity of activated NK cells in human Raji lymphoma xenograft model. As expected, tumor growth has increased over time in the control group without transferred NK cells. Wliile tumor growth has attenuated in mice receiving NK cells activated with cytokine, the group receiving NK cells activated with lunasin and cytokine had lowest tumor size when compared to the group receiving NK cells activated with cytokine only (Figure 13).
These results support that the combination of EL- 12 or IL-2 with lunasin is superior to cytokine alone for enhancing NK cell tumoricidal activity.
Increased expression of NCR2 in NK cells accompanies elimination of tumor cells
The cytotoxicity of NK cells is also regulated by the net signaling events triggered by invariant activating and inhibitory receptors that recognize the ligauds on target cells. Many of the killer-cell immunoglobulin-like receptors (KIR) on NK cells recognize MHC class I hgands on target cells, which inhibit NK cell-mediated cytotoxicity. The activating receptors involved in NK-mediated cytolysis are NKG2D and the natural cytotoxicity receptors (NCRs) including NCR1 (NKp46 or CD335), NCR2 (NKp44 or CD336), and NCR3 (NKp30 or CD337). It has been shown that the tumor-killing activity of NK cells is correlated with the levels of NCR expression (see Figure 14), and NCR2 is involved in NK-mediated cytotoxicity against lung adenocarcinoma A549.
Figure 14 showed that NK cells treated with IL- 12 or IL-2 plus lunasin had increase of NCR2 expression as compared to those treated with medium, or cytokine only after incubation. At day 3, NCR2 expression was undetectable in NK cells treated with medium only while it was 5 fold higher in cells with EL- 12 and lunasin than those with IL- 12 alone (Figure 14b). Similar results were observed for DL-2 treatment in combination of lunasin (see figure 14a, IL-2 panels). These results suggest that the combination of cytokine IL- 12 or IL-2 with lunasin is capable of regulating expression of receptors that modulate NK-mediated cytotoxic effects.
Reduced expression of KIRs in NK cells accompanies elimination of tumor cells
Figure 15 shows KIR3DL1 and KIR3DL2 gene expression levels of human NK cells following stimulation. Freshly isolated human NK cells from peripheral blood mononuclear cells (PBMCs) of normal control using positive selection with CD56 magnetic beads (Miltenyi Biotec, Auburn, CA) were stimulated with medium only (-), IL-12 (10 ng/ml) or EL- 12 ( 10 ng inl) + lunasin (5 iiM) for 1 day. The cell pellets were lysed in Tiizol Reagents for total RNA extraction. The first-strand cDNA was synthesized followed by real time qPCR using Taqman Assay with primer for inliibitoiy receptors K1R3DL1 (upper panel) and KIR3DL2 (lower panel) in ABI 7300. The reduced KIRs expression in the presence of lunasin indicates lunasin facilitates the down regulation of inhibitory receptors on NK cells, therefore activating NK's ruinoricidal activity.
Our data here have suggested additional effects of lunasin on anti-tumor iinmunity by augmenting NK cell cytotoxicity. Indeed, our initial studies demonstrate that NK cells' stimulated with EL- 12 or IL-2 plus lunasin resulted in a higher cytotoxicity against not only hematopoietic malignants (human B-lymphoina cell line Raji in Figure 12) but also solid tumors (human lung cancer cell lines A549 and 1299 in figure 16) compared to medium alone. The study reveals the ruinoricidal activity of NK cells is correlated with the expression levels of gianzyine B and/or NCR2, and reversely correlated with the expression level of inhibitory KERs.
Results from our study suggest that allogeneic NK cells can be manipulated to reduce their expression of inhibitory receptors using lunasin peptides, which can mediate potent graft- versus-leukemia (GVL) effects after adoptive transfer.
Lunasin enhances IL-18-stimulated Antibody-dependent cellular cytotoxicity (ADCC) activity by NK cells
Figure 17 shows Lunasin enhances IL- 18-stinnilated ADCC by human NK cells. Briefly, fleshly isolated human NK cells as described in figiue 1 were stimulated overnight in medium only (-). EL- 18 (100 ng/ml) in the absence (-.) or presence (+) of lunasin peptide. The target Raji cells were pre-treated or not with riruximab (anti-CD20 niAb at 0.1 ug/ml) for 2 his followed by the 4-hr in vino cytotoxicity assay the CytoTox 96 non-Radioactive Cytotoxicity Assay Kit (P omega, Madison, WT). The % of cytotoxicity was calculated according to the manufacturer's instructions. Data are presented as mean ± SD from duplicates. *P<0.05; ND, not detecable.
Example 4. Effects of Iunasin on dendritic cells (DCs) and macrophages (Figures 18-23) hi this example we showed that luuasin in combination with other cytokines promotes robust IFNy production in various deudiitic cells and macrophages. Similar to NK cells, deudiitic cells aud macrophages are involved in innate immune responses with multiple functions including secreting various cytokines upon stimulation, or increasing co-stimulating molecule after being stimulated by an antigen. Adding Iunasin into the treatment regimen synergistically enhance the effects imposed by the selective cytokines on these innate immune cell types.
Figure 18 shows levels of IFNy production by human plasmacytoid dendritic cells (pDCs) from normal controls following stimulation. Freshly isolated human pDC cells from peripheral blood mononuclear cells (PBMCs) of normal controls using the CD304 (BDCA-4/Neuropilin- l) microbeads (Miltenyi Biotec, Auburn, CA) were stimulated with mediiun only (-), IL- 12 ( 10 ng nil), IL- 12 ( 10 ng nil) + Iunasin (50 niM), IL-2 ( 100 unit/ml), IL-2 (100 unit ml) + Iunasin (50 inM) or Iunasin alone (50 mM). One day following stimulation, the supematants were collected for measuring the production of IFNg using ELISA. Data are presented as mean ± SD from duplicates. Results shown are representative from over 3 different normal controls.
Figure 19 shows Effects of Iunasin on gene expression by human pDC. Freshly isolated human pDC cells from peripheral blood mononuclear cells (PBMCs) of normal controls using the CD304 (BDCA-4 Neuropilin-l ) microbeads (Miltenyi Biotec, Auburn, CA) were stimulated as described in the figure 18. One day following stimulation, the cell pellets were resuspended in Trizol Reagents for total RNA extraction. The first-strand cDNA was synthesized followed by real time qPCR using Taqman Assay with primers for gene expression using the ABI 7300 (Applied Biosystems by Life Technologies, Carlsbad, CA). Data are presented as mean ± SD from duplicates. Results shown are representative from over 3 different normal controls.
Figure 20 shows Effects of Iunasin on gene expression by human cDC. Freshly isolated human cDC cells from peripheral blood mononuclear cells (PBMCs) of normal controls using the CDlc (BDCA-1) microbeads (Miltenyi Biotec, Auburn, CA) were stimulated as indicated. One day following stimulation, the cell pellets were resuspended in Trizol Reagents for total RNA extraction. The fust-strand cDNA was synthesized followed by real time qPCR using
Taqinau Assay with primers for gene expression using the ABI 7300 (Applied Biosystems by Life Technologies, Carlsbad, CA). Data are presented as mean ± SD from duplicates. Results shown are representative from over 3 different normal controls.
Figure 21 shows Effects of lunasin on IFNy production by myeloid dendritic cells (mDCs) and NK cells from mice. Freshly isolated mDCs from spleens of C57BL6 mice using the CD1 lc microbeads (Miltenyi Biotec, Auburn, CA) were stimulated with medium (-), inIL-12 (2 ng/ml) without (-) or with (+) limasin, lunasiu (lu, 50 inM) or lipopolysaccharide (LPS) (l fig/uil) alone for 1 and 2 days. NK cells isolated from the same mice using DX5 microbeads were stimulated with the same conditions indicated. The levels of IFNy in the supematants were determined using ELISA. Data are presented as mean ± SD from duplicates. Results shown are representative from 2 mice. *P<0.05; **P>0.05
Figure 22 shows Effects of lunasin on levels of surface molecules on DCs. Freshly isolated human pDC and cDC cells from peripheral blood mononuclear cells (PBMCs) of normal controls were stimulated as indicated. One day following stimulation, the expression of surface molecules, including major histocompatibility complex (MHC) class I and class II. as well as co- stimulatory molecules CD80 and CD86, was analyzed using flow cytometry with commercial available antibodies. The levels of surface molecules were evaluated on 5000 events and presented as mean fluorescent intensity (MFI).
Figure 23 shows Effects of lunasin on IFNy production by macrophages from mice. Freshly isolated macrophages from spleens of C57BL6 mice using the CDl lb microbeads (Miltenyi Biotec, Auburn, CA) were stimulated as indicated for 1 and 2 days. The levels of IFNy in the supematants were determined using ELISA. Data are presented as mean ± SD from duplicates.
Exampl 5. Effect of lunasin on modulating allergic inflammation
There is a plethora of evidence that Th2-mediated inflammation can promote allergic disease when IFNy production is reduced to free from its resnaining influence. It has been shown that development of spontaneous airway inflammation consistent with human asthma was
found in mice lacking a transcription factor T-bet, a master regulator of Th l development and ΓΤΝγ production. These results suggest that up-regulating Thl cytokine IFNy is a potential strategy to reduce the risk of asthma and allergic disease.
Our studies found that soy peptide lunasin alone or in combination with IL- 12 or IL-2 had effects on enhancing the production of ΓΓΝγ by human and mouse NK cells, hi addition, dietary supplementation of gavaged lunasin maintains its bioactivity, which can be found in the lung and blood. Taken together, these results suggest the ability of lunasin to uiduce ΓΓΝγ production by NK cells and therefore, may suppress Tli2-mediated allergic inflammation.
Figure 24 shows increased gene expression of Ifng in the lung from mice treated with lunasin. Balb/c mice were gavaged with 200 μΐ of water only (Άβ) or 4 mg of lunasin in 200 μΐ water (Lunasin) for 3 consecutive days. One day after the last gavage, nuce were sacrificed to collect the lungs and spleens. NK cells were isolated from each lung and spleen using positive selection with DX5 magnetic beads (Miltenyi Biotec) followed by RNA extraction, cDNA synthesis and real time qPCR using Taqinan assay primers (ABI). Gene expression for Ifng from lungs (upper panel) and spleens (lower pannel) is presented as mean ± SD from 2 mice in each group.
This study supported in vivo stimulatory effects of lunasin on NK cells for increasing the production of ΓΓΝγ, wliich may suppress Th2-mediated allergic inflammation.
hi this example we showed Lunasin-treated mice have reduced allergic inflammation evidenced by lower cell counts in the bronchoalveolar lavage (BAL) fluid, and reduced production of IL-4 in the LPS-induced asthma mouse model
Briefly, figure 25 shows cell counts in the bronchoalveolar lavage (BAL) fluid and IL- 4 production in a mouse model of asthma, hi LPS-induced astlima model, BABL c mice were sensitized intranasally with 0.1 \ig of LPS at day 0, 1 , and 2 with (LS) or without (Ctrl) lunasin peptide at 4 mg, and then challenged with 50 Mg of OVA on days 19, 20, and 21. Another group of mice (LC) was sensitized as the Ctrl group followed by challenging with OVA in the presence of lunasin at 4 mg. The total cell niunbers (A) and differential cell numbers of eosinophils (B) were counted from the BAL fluid. Data are presented as mean ± SD from 3 mice hi each group. *, P<0.05; ns (not-significant), p>0.05. (C) Cells from draining lympho nodes (mediastinal) were
stimulated with OVA, and the levels of IL-4 production in the supematants were evaluated using ELISA. Data are presented as mean ± SD from 3 mice iu each group. ***. P<0.05: ns (not- significant), p>0.05. (Ctrl: low LPS sensitization, OVA challenge; LS: Low LPS sensitization with lunasiii, OVA challenge; LC: Low LPS sensitization, OVA challenge with lunasin)
Example 6 the effects of lunasin on therapeutic prevention for cancer in mouse models
Therapeutic vaccines are designed to stimulate anti-tumor immune responses against various malignances, which could be potentially used as a treatment regimen for cancer patients. In addition, combining a cancer vaccine with an immune activating agent such as cytokine can further enhance the clinical outcomes that improve progression-free survival in patients.
There are superior anti-tumor responses using a chimeric HER2 peptide vaccine that is composed of HER2 B-cell epitope fused to a promiscuous T-cell epitope from measles virus fusion protein (MAT7). A more recent phase I study using these therapeutic peptide vaccines showed clinical activity in patients with metastatic and/or recurrent solid tumors. Combining EL- 12 with two peptide vaccines (MVF HER2 316-339 and MVF HER2 628-«47) resulted iu significant reduction on the development of pulmonary metastases in a syngeneic HER2/neu rumor model. Without limiting the theories, one explanation for conferring protection in this model has been attr ibuted to increased production of EFNy following IL-12 treatment, which promotes the isotype switch to IgG2a that mediates ADCC activity in mice treated with these peptide vaccines. hi our studies, the combination of lunasin with IL- 12 is superior to IL-12 alone for induction of IFNy by NK cells. We also observed increased expression of TNFa, GM-CSF and CCL3 (macrophage inflammatory protein- l a or MTP-l a) which may facilitate the development of inflammatory environment by recruiting more immune cells and promotes the differentiation of dendritic cells from monocytes, In addition, our new data in both human and murine systems demonstrated that cDCs produced IFNy and up-regulated the surface levels of co-stiniulatoiy molecules (e.g., CD80 and CD86) as well as MHC class Π following stimulation widi lunasin and IL-12. These results suggest that lunasin may enhance the adjuvanticity of EL- 12 in vivo.
We want to test the hypothesis that lunasin and IL- 12 will enhance the anti-tumor effects mediated by the peptide vaccine (MVF HER2 316-3 9 and MVF HER2 628-647)· and therefore a more efficacious therapeutic vaccine against HER2 positive tumors. The effectiveness of lunasin
arid EL- 12 in therapeutic vaccine will be evaluated in a syngeneic HER2/ueu tumor model as established.
Tumor volume will be measured daily with calipers as described. One week after the last vaccination, immune responses will be measured. Sera collected will be evaluated for the levels of IFNy and antibody isotype using ELISA. Intracellular cytokine staining from splenocytes will be performed to determine if NK, cDC and/or macrophage populations are responsible for IFNy production. The rumoricidal activity of NK cells from these mice will be measured against the target cell line cT-26HER/neu as described. Statistic consideration is followed as previously described.
Control group of mice receiving PBS will have the largest rumor volume at the end of the study. Results will demonstrate an improved adjuvaiiticity of lunasin and IL-12 in enhancing the anti-tumor immunity for HER2 peptide vaccines as therapeutic treatment. As a result, these mice will suppress rumor growth and have reduced tumor volume.
Claims
1. A combmation therapy of hiuasin and at least one cytokine, wherein the combination therapy enhances the at least one cytokine's effect on an innate immune system.
2. The combination therapy of Claim 1, wherein t e at least one cytokine is selected from the group consisting of IL-2, IL-12, IL-15, IL- 18, EL-21 and EFN-ct.
3. The combination tlierapy of Claim 1 , wherein the combination therapy enliauces innate immune system expression of ErN-γ, EL- 15, CCL2. CCL3, CCL4 or GM-CSF.
4. The combination therapy of Claim 1 , wherein the combmation therapy attenuates
suppression of Till switch.
5. The combination therapy of Claim 1 , wherein the combination therapy enhances the innate immune system's ability to eliminate viral- infected cells and other pathogens.
6. The combination therapy of Claim 1. wherein the combination therapy enliauces natural killer (NK) cell cytotoxicity by increasing expression of Granzyme B and natural cytotoxicity triggering receptor 2 (NCR2).
7. The combination therapy of Claim 1 , wherein the combiuation tlierapy enliauces NK cell cytotoxicity by decreasing expression of inhibitory killer-cell immunoglobulin-like receptors (KIR).
8. The combination therapy of Claim 1, wherein the combmation therapy enhances
antibody-dependent cell mediated cytotoxicity (ADCC) by NK cells.
9. The combination therapy of Claim 1 , wherein the combmation therapy stimulates NK cells to enhance adoptive transfer cellular therapy.
10. The combination therapy of Claim 1. wherein the combination therapy is an adjuvant to enhance efficacy of a cancer vaccine.
1 1. A method of enhancing an innate immune system, the method comprising providing an individual with a pharmaceutically effective amount of a combination of luuasin and at least one cytokine.
12. The method of Claim 1 1 , wherein the at least one cytokine is selected from the group consisting of IL-2, IL-12, IL- 15, IL-18, IL-21 and IFN-u.
13. The method of Claim 1 1 , wherein the at least one cytokine is EL-2 or EL- 12.
14. The method of Claim 1 1, wherein the at least one cytokine is EL- 12.
15. The method of Claim 1 1, wherein the at least one cytokine is EL- 18.
16. The method of Claim 1 1, wherein the enhanced immune system has natural killer (NK) cells with increased expression of natural cytotoxicity triggering receptor 2 (NCR2) and Granzyme B.
17. The method of Claim 1 1, wherein the enhanced immune system has NK cells with decreased expression of killer-cell immunoglobulin receptors (KER).
18. The method of Claim 1 1 , wherein the enhanced immune system has NK cells with an enhanced immune regulator}' effects on allergic inflammation.
19. The method of Claim 1 1 , wherein the enhanced inunune system has NK cells with increased antibody dependent cell mediated cytotoxicity (ADCC).
20. A method of enhancing activity of natural killer (NK) cells, the method comprising providing an individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine.
21. A method of increasing natural killer (NK) cell immune regulatory effect on allergic inflammation, the method comprising providing an individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine.
22. A method of increasing antibody dependent cell mediated cytotoxicity (ADCC) by
natural killer (NK) cells, the method comprising providing an individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine.
23. A method of treating virus-infected cells in an individual, the method comprising
providing the individual with a pharmaceutically effective amount of a combination of lunasin and at least one cytokine.
24. A method of enhancing efficacy of a cancer vaccine, the method compi ising providing an individual a pharmaceutically effective amount of a combination of lunasin and at least one cytokine.
25. The method of any of Claims 20-24, wherem the at least one cytokine is selected from the group consisting of IL-2, EL- 12, EL- 15, EL- 18, EL-21 and EFN-a.
26. The method of Claim 20 or 21 , wherein the at least one cytokine is IL-2 or EL- 12.
27. The method of Claim 23, wherein the at least one cytokine is EL- 18.
28. The method of any of Claims 20-22, wherem the NK cells have increased expression of Granzynie B or natural cytotoxicity triggering receptor 2 (NCR2).
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/123,202 US9173923B2 (en) | 2011-05-31 | 2012-05-31 | Modulating innate immune cell activity by lunasin and selected cytokines |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161491450P | 2011-05-31 | 2011-05-31 | |
| US61/491,450 | 2011-05-31 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012166875A2 true WO2012166875A2 (en) | 2012-12-06 |
| WO2012166875A9 WO2012166875A9 (en) | 2013-01-24 |
Family
ID=47260308
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/040144 Ceased WO2012166875A2 (en) | 2011-05-31 | 2012-05-31 | Modulating innate immune cell activity by lunasin and selected cytokines |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US9173923B2 (en) |
| WO (1) | WO2012166875A2 (en) |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NZ552316A (en) * | 2006-12-22 | 2009-10-30 | Fonterra Co Operative Group | Dairy product and process |
-
2012
- 2012-05-31 US US14/123,202 patent/US9173923B2/en not_active Expired - Fee Related
- 2012-05-31 WO PCT/US2012/040144 patent/WO2012166875A2/en not_active Ceased
Also Published As
| Publication number | Publication date |
|---|---|
| US20140099282A1 (en) | 2014-04-10 |
| WO2012166875A9 (en) | 2013-01-24 |
| US9173923B2 (en) | 2015-11-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Opzoomer et al. | Cytotoxic chemotherapy as an immune stimulus: a molecular perspective on turning up the immunological heat on cancer | |
| Wennerberg et al. | Immune recognition of irradiated cancer cells | |
| Wachowska et al. | 5-Aza-2′-deoxycytidine potentiates antitumour immune response induced by photodynamic therapy | |
| Zhang et al. | Proanthocyanidin from grape seeds potentiates anti-tumor activity of doxorubicin via immunomodulatory mechanism | |
| Le et al. | Gemcitabine directly inhibits myeloid derived suppressor cells in BALB/c mice bearing 4T1 mammary carcinoma and augments expansion of T cells from tumor-bearing mice | |
| Kaur et al. | Radiation-induced effects and the immune system in cancer | |
| Bae et al. | The effect of alloferon on the enhancement of NK cell cytotoxicity against cancer via the up-regulation of perforin/granzyme B secretion | |
| Kurosawa et al. | Early-appearing tumour-infiltrating natural killer cells play a crucial role in the generation of anti-tumour T lymphocytes | |
| Chang et al. | Oral administration of an Enoki mushroom protein FVE activates innate and adaptive immunity and induces anti-tumor activity against murine hepatocellular carcinoma | |
| Lum et al. | In vivo CD40 ligation can induce T cell-independent antitumor effects that involve macrophages | |
| Khan et al. | NOD-2 and TLR-4 signaling reinforces the efficacy of dendritic cells and reduces the dose of TB drugs against Mycobacterium tuberculosis | |
| Luo et al. | Th1 cytokine‐secreting recombinant Mycobacterium bovis bacillus Calmette‐Guérin and prospective use in immunotherapy of bladder cancer | |
| Son et al. | Improvement of antitumor effect of intratumoral injection of immature dendritic cells into irradiated tumor by cyclophosphamide in mouse colon cancer model | |
| Proietti et al. | Exploitation of the propulsive force of chemotherapy for improving the response to cancer immunotherapy | |
| Savarin et al. | Differential regulation of self-reactive CD4+ T cells in cervical lymph nodes and central nervous system during viral encephalomyelitis | |
| Alyamkina et al. | Effects of human exogenous DNA on production of perforin-containing CD8+ cytotoxic lymphocytes in laboratory setting and clinical practice | |
| KR20130060188A (en) | Methods and compositions for inhibition of treg cells | |
| JP2022023136A (en) | Methods of T cell expansion and activation | |
| Hance et al. | The antitumor and immunoadjuvant effects of IFN-α in combination with recombinant poxvirus vaccines | |
| US9173923B2 (en) | Modulating innate immune cell activity by lunasin and selected cytokines | |
| AU2005314271A1 (en) | Alpha thymosin peptides as cancer vaccine adjuvants | |
| Grekova et al. | Genomic CpG enrichment of oncolytic parvoviruses as a potent anticancer vaccination strategy for the treatment of pancreatic adenocarcinoma | |
| EP2050455B1 (en) | Compounds leading to an increase of the IL-12/IL-10 ratio and their use for therapy of infectious and proliferative diseases | |
| Sharma et al. | Augmentation of human natural killer cell activity by cyclophosphamide in vitro | |
| Siegel et al. | Interleukin 2 therapy in infectious diseases: rationale and prospects |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12793049 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14123202 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 12793049 Country of ref document: EP Kind code of ref document: A2 |