WO2012166626A1 - Reagents and methods for treating dental disease - Google Patents
Reagents and methods for treating dental disease Download PDFInfo
- Publication number
- WO2012166626A1 WO2012166626A1 PCT/US2012/039650 US2012039650W WO2012166626A1 WO 2012166626 A1 WO2012166626 A1 WO 2012166626A1 US 2012039650 W US2012039650 W US 2012039650W WO 2012166626 A1 WO2012166626 A1 WO 2012166626A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- polypeptide
- dental
- polypeptides
- adp5
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/39—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
- A61K8/65—Collagen; Gelatin; Keratin; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/02—Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q11/00—Preparations for care of the teeth, of the oral cavity or of dentures; Dentifrices, e.g. toothpastes; Mouth rinses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4705—Regulators; Modulating activity stimulating, promoting or activating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/43—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag
Definitions
- Demineralization loss of mineral content on the surface of tooth
- Loss of mineral can be caused by acidic diet, dry mouth, tooth whitening, abrasion and bacterial plaque formation. If left untreated, demineralization may lead to various problems from pain and sensitivity to systemic infections (e.g. heart disease) and loss of tooth.
- systemic infections e.g. heart disease
- demineralization may lead to various problems from pain and sensitivity to systemic infections (e.g. heart disease) and loss of tooth.
- systemic infections e.g. heart disease
- the carious part is physically removed and the lost hard tissue is replaced with metal or resin based materials using inorganic adhesives. These materials, however, are usually short lived and may cause toxic products or secondary infections.
- Remineralization of the early lesions is an alternative to currently employed restorative therapies. Fluoride ions have been shown to promote the remineralization of previously demineralized enamel in vitro and in situ if adequate levels of calcium and phosphate ions are available where the fluoride is applied. It has been shown; however, that prolonged exposure to fluoridated water may cause severe dental fluorosis, skeletal fluorosis, and weakened bones, and that improper implementation of fluoride can also cause acute fluoride poisoning.
- the present invention provides isolated amelogenin-derived polypeptides (ADPs) comprising or consisting of
- amelogenin-derived polypeptides of this aspect of the invention can be used, for example, to direct dental mineralization and to treat dental disease, as discussed herein.
- the present invention provides recombinant fusion polypeptide, comprising
- compositions comprising
- the present invention provides pharmaceutical compositions, comprising one or more polypeptides, recombinant fusion proteins, or compositions of the invention and a pharmaceutically acceptable carrier.
- the present invention provides oral care products, comprising any embodiment or combination of embodiments of the polypeptides, recombinant fusion proteins, and/or compositions of the invention.
- the present invention provides isolated nucleic acids encoding an ADP or fusion polypeptide of the present invention.
- the present invention provides recombinant expression vectors comprising the isolated nucleic acid of any aspect of the invention operatively linked to a suitable control sequence.
- the present invention provides host cells that have been transfected with the recombinant expression vectors disclosed herein, wherein the host cells can be either prokaryotic or eukaryotic.
- the present invention provides methods for treating dental disease, comprising administering to a subject in need thereof an amount effective to treat the dental disease of the polypeptide, recombinant fusion protein, composition, pharmaceutical composition or oral care product of any embodiment or combination of embodiments of the invention.
- FIG. 1 Identification of amelogenin derived peptides (ADPs).
- Panel a Flowchart showing the design steps for identifying the ADPs.
- Panel b High and low similarity amino acid regions among the rM180 and two experimentally selected HABP sets. Each bar represents one amino acid and the amino acid domains above the baseline represent the high similarity while those below represent low similarity regions.
- the overlapped plot shows the potential calcium ion binding domains. Note that the majority of the highest potential domains coincide with the high similarity regions (arrow heads).
- Panel c Computationally determined molecular structure for rM180 amelogenin showing position of (folded) ADP7 within rM180.
- Panel d Positions of the ion-binding domains on rM180.
- Panel e The locations of the ADPs along rM180.
- FIG. 1 Binding, mineralization, and structural characterization of mineral products of the ADPs.
- Panel a Binding constants, 3 ⁇ 4, of the ADPs determined by QCM .
- Panel b Calcium consumption rates of mineralization in the presence of ADP5,7 and rM180.
- Panel c Calcium phosphate minerals formed in solution in the presence of ADPs.
- Panel d The mineral product of ADP7 resembles those formed in the presence of rM180 and these acicular crystallites are consistent with HAp morphology.
- Panel e X-ray diffraction (XRD) spectra of the minerals formed by ADPs.
- XRD X-ray diffraction
- Material formed by ADP7 and amelogenin display the characteristic peaks belonging to the HAp crystal structure, while all minerals formed by other ADPs display weak diffraction peaks, consistent with amorphous, or only loosely crystalline outcomes shown in panel c.
- Figure 3 Procedure for in vitro-, cell-free synthesis of cementomimetic layer by ADP5 on human root surfaces. Extracted human teeth are cleaned of any contaminating material and cylindrical pieces are cut right below the cementoenamel junction. An aqueous solution of ADP5, the mineralization directing peptide, is applied on the demineralized root surface. The specimen is immersed into a mineralization solution containing calcium and phosphate. Cell adhesion and proliferation is investigated on the re-mineralized root surfaces.
- FIG. 4 Structural and functional characteristics of the cementomimetic layer formed on the root of human tooth by ADP5.
- Panels a and b SEM images of the demineralized (a) and (b) ADP5 formed cementomimetic layer revealing uniform nanocrystals with a Ca/P ratio of 1.67 obtained from EDX (Energy dispersive X-ray) spectra (insets).
- Panel c TEM images and the electron diffraction pattern of the newly formed cementomimetic mineral layer in cross-section showing HAp crystallites.
- Panel d SEM image of mechanically separated cementomimetic mineral layer displaying uniform thickness of HAp crystallites;
- Panel e Attachment of hPDL cells on control and cementomimetic mineral layer.
- Panel f SEM images of the demineralized (a) and (b) ADP5 formed cementomimetic layer revealing uniform nanocrystals with a Ca/P ratio of 1.67 obtained from
- Figure 8 Schematic of the sample which nano indentation characterization was performed. 20 indentations were made on each region: mineralized dentin, demineralized dentin ( ⁇ 20 um), and cementomimetic layer ( ⁇ 10 um). Indentations in dentin were made strictly on intertubular dentin.
- the present invention provides isolated amelogenin-derived polypeptides (ADPs) comprising or consisting of
- amelogenin-derived polypeptides of this aspect of the invention can be used, for example, to direct dental mineralization and to treat dental disease, as discussed herein.
- a "functional equivalent" of a polypeptide is one that retains the biological activity of the polypeptide in treating dental disease, and included one or more amino acid substitutions, deletions, additions, or insertions.
- the functional equivalent is at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, or more identical to the recited polypeptide.
- polypeptide is used in its broadest sense to refer to a sequence of subunit amino acids, whether naturally occurring or of synthetic origin.
- the polypeptides of the invention may comprise L-amino acids, D-amino acids (which are resistant to L-amino acid-specific proteases in vivo), or a combination of D- and L-amino acids.
- the polypeptides described herein may be chemically synthesized or recombinantly expressed.
- the polypeptides may be linked to other compounds to promote an increased half-life in vivo, such as by PEGylation, HESylation, PASylation, or glycosylation. Such linkage can be covalent or non-covalent as is understood by those of skill in the art.
- the recited polypeptides may be present in 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies, preferably in one copy. When present in multiple copies, the copies are contiguous to each other. For example, 2 copies of ADP5 would be:
- the isolated ADPs comprise or consist of the amino acid sequence (PGYIN(L/F)SY(E/A)(K/N/A)SHSQArN(TA ⁇ )(D/A)(R/A)TA) 1 _ 10 (SEQ ID NO: 2) (ADP5), or a functional equivalent thereof.
- the ADP comprises or consists of (PGYIN(L/F)SYE(K/N)SHSQAIN(T/V)DRTA)i_i 0 (SEQ ID NO: 24) (ADP5), or a functional equivalent thereof.
- ADP5 comprises or consists of (PGYINFSYENSHSQArNVDRTA)i_io (SEQ ID NO: 6) (ADP5H),
- polypeptide comprises or consists of an ADP5 mutant, selected from the group consisting of ADP5(Vl):(PGYIN(L/F)SYA(K/N)SHSQArN(TA ⁇ )ARTA) 1 _ 1 o(SEQ ID NO: 25);
- ADP5(V3) (PGYIN(L/F)SYA(A/N)SHSQArN(TA ⁇ )AATA)i_io(SEQ ID NO: 27);
- polypeptide comprises or consists of:
- ADP5, ADP5M, ADP5H, or any of the variations thereof is present in 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies.
- ADP5, ADP5M, ADP5H, or any of the variations there is present in 1 copy.
- ADP5 is shown in the examples that follow to mimic the mineralization promotion effect of the wild type amelogenin protein on a given solid surface, including dentin on human tooth, rapidly, and thus can be used in any of the methods disclosed herein.
- the ADP5 comprises or consists of ADP5H, or any of the variations thereof, preferably in one copy.
- the isolated ADPs comprise or consist of the amino acid sequence (HPP(S/T)HTLQPHHH(L/I)PVVPAQQPV(A/I)PQ
- ADP7 comprises or consists of
- ADP7H refers to ADP7 derived from human amelogenin and "ADP7M” refers to ADP7 derived from mouse amelogenin.
- ADP 7, ADP7M, or ADP7H is present in 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies.
- ADP7, ADP7M, or ADPH7 is present in 1 copy.
- ADP7 is shown in the examples that follow to control hydroxyapatite (HA) crystallography, and morphology, in a solution phase, and thus can be used in any of the methods disclosed herein.
- HA hydroxyapatite
- ADP7 can also be used, for example, to target and immobilize bioactive molecules of interest (therapeutics, labeling molecules, other polypeptides of interest, etc.) to HA surfaces on the tooth.
- the ADP7 comprises or consists of ADP7H, preferably in one copy.
- the isolated ADPs comprise or consist of the amino acid sequence WP(A/S)TDKTKREEVD) ! _ 10 (SEQ ID NO: 1)(ADP3), or a functional equivalent thereof.
- ADP5 comprises or consists of ((WPATDKTKREEVD)i-io (SEQ ID NO: 10)(ADP3M) or (WPSTDKTKREEVD)!_ 10 (SEQ ID NO: 11)(ADP3H), or a functional equivalent thereof, wherein "ADP3H” refers to ADP3 derived from human amelogenin and "ADP3M” refers to ADP3 derived from mouse amelogenin.
- ADP3, ADP3M, or ADP3H is present in 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies. In a preferred embodiment, ADP3, ADP3M, or ADP3H is present in 1 copy.
- ADP3 is a low similarity HA binder, and thus may be used in any of the methods of the invention. ADP3 can also be used, for example, to target and immobilize bioactive molecules of interest (therapeutics, labeling molecules, other polypeptides of interest, etc.) to HA surfaces on the tooth.
- the ADP3 comprises or consists of ADP3H, preferably in one copy.
- the isolated polypeptide comprises or consists of a polypeptide selected from the group consisting of:
- the recited polypeptides may be present in 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies, preferably in one copy.
- Each of these polypeptides bind to HA, and thus, even apart from their mineralization effects, they can be used to target and immobilize bioactive molecules of interest (therapeutics, labeling molecules, other polypeptides of interest, etc.) to HA surfaces on the tooth.
- ADP7 is a combination of ADP4 + ADP8 + ADP2, while ADP1 is completely contained within ADP4.
- each of these polypeptides can also be used, for example, in synthetically preparing ADP7.
- the present invention provides recombinant fusion polypeptide, comprising (a) the ADP of any embodiment or combination of embodiments of the first aspect of the invention.
- a "heterologous polypeptide” is any polypeptide that either (a) is not derived from amelogenin; or (b) is a different ADP than the ADP recited in component (a) of the recombinant fusion polypeptide.
- the recombinant fusion polypeptide does not include wild type amelogenin.
- the recombinant fusion polypeptide may comprise or consist of a fusion of ADP5 and ADP7, so long as the fusion polypeptide is not amelogenin.
- the recombinant fusion polypeptides of the invention can be used, for example, to treat dental disease.
- providing the ADPs as fusion polypeptides is a useful strategy for providing increased functionality when carrying out such treatments, or for any other suitable use.
- the heterologous polypeptide is a detectable polypeptide, to allow for detection of the recombinant fusion, for example, during administration to treat dental disease.
- the heterologous polypeptide is an affinity tag of any type (including but not limited to FLAG tags, hexa-histidine tags, and myc tags) that, for example, can be used to assist in isolation of the polypeptide.
- the heterologous polypeptide provides added functionality, for example, when the fusion polypeptides are used to treat dental disease.
- exemplary such heterologous polypeptide include, but are not limited to anti-microbial polypeptides (inhibiting bacterial infection), biomineralizati on-promoting polypeptides (i.e.: any polypeptides that are useful for controlling or promoting biomineralization), inorganic material-binding polypeptides, three-dimensional scaffold-forming polypeptides, collagen, chitosan, amphiphilic peptides, protein-binding polypeptides, enamelin-derived polypeptides, tuftelin-derived peptides, statherin-derived polypeptides, dentin-derived polypeptides, bone sialoprotein-derived polypeptides, osteocalcin-derived polypeptides, osteopontin-derived polypeptides, proteins with caries inhibitory activity, casein, and bone morphogenetic-derived polypeptides.
- heterologous polypeptide may comprise or consist of the full length protein, or functional polypeptides derived therefrom.
- heterologous polypeptides are known to those of skill in the art.
- such heterologous polypeptides include, but are not limited to dentin or polypeptides derived therefrom; cementum, or polypeptides derived therefrom; or other amelogenin-derived peptides including but not limited to: MPLPPHPGSPGYI LSYEVLTPLKWYQSMIRQPPLSPILPELPLEAWPATDKTK REEVD (SEQ ID NO: 28)
- LPPHPGSPGYINLSYEVLTPLKWYQSMIRQPYPSYGYE SEQ ID NO: 30
- SPILPELPLEAWPATDK SEQ ID NO: 31
- compositions comprising
- non-peptide moiety is any non-peptide moiety, whether naturally occurring or synthetic, that provides added functionality to the ADPs of the invention.
- the non-peptide moiety may be any organic or inorganic nanostructure, or hybrids thereof.
- the compositions can be used, for example, to treat dental disease.
- providing the ADPs as the recited compositions is a useful strategy for providing increased functionality when carrying out such treatments, or for any other suitable use.
- the non-peptide moiety may be a non-peptide detectable moiety, including but not limited to radioactive isotopes, non-peptide affinity tags, isotope-coded affinity tags, and fluorophores, to allow for detection of the composition, for example, during administration to treat dental disease.
- a non-peptide detectable moiety including but not limited to radioactive isotopes, non-peptide affinity tags, isotope-coded affinity tags, and fluorophores, to allow for detection of the composition, for example, during administration to treat dental disease.
- the non-peptide moiety may comprise organic nanostructures (ex: micelles, liposomes, and dendrimers) or inorganic nanostructures (ex: metallic, semiconducting and dielectric), including but not limited to nanotubes, nanowires, nanoparticles, atomic clusters, quantum dots, single layer or multilayer atomic materials, inorganic ions or ion clusters, and organic-inorganic hybrid nanostructures, and non-peptide polymers.
- organic nanostructures ex: micelles, liposomes, and dendrimers
- inorganic nanostructures ex: metallic, semiconducting and dielectric
- nanotubes including but not limited to nanotubes, nanowires, nanoparticles, atomic clusters, quantum dots, single layer or multilayer atomic materials, inorganic ions or ion clusters, and organic-inorganic hybrid nanostructures, and non-peptide polymers.
- the non-peptide moiety may comprise non-peptide entities that provide for additional therapeutic benefit to a subject being treated, including but not limited to fish flour, amino acids (including but not limited to glycine), and non-peptide polymers.
- the heterologous polypeptide or non- peptide moiety can be linked to the ADP through covalent bonding, including, but not limited to, disulfide bonding, hydrogen bonding, electrostatic bonding, recombinant fusion and conformational bonding.
- the heterologous polypeptide or non-peptide moiety can be linked to the ADP by means of one or more linking compounds. Techniques for conjugating moieties to polypeptides are well known to the skilled artisan.
- Any suitable detectable polypeptide or detectable non-peptide moiety can be linked to the ADP in the second and third aspects of the invention, including but not limited to enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals, and nonradioactive paramagnetic metal ions.
- the tag used will depend on the specific detection techniques and/or methods used.
- Enzymes typically conjugated to polypeptides to permit their visualization are well known and include, but are not limited to, acetylcholinesterase, alkaline phosphatase, beta- galactosidase, glucose oxidase, horseradish peroxidase, and urease. Typical substrates for production and deposition of visually detectable products are also well known to the skilled person in the art.
- the ADPs can be labeled using colloidal gold or they can be labeled with
- radioisotopes such as P, P, S, H, and I.
- ADPs of the invention can be attached to radionuclides directly or indirectly via a chelating agent by methods well known in the art.
- the present invention provides pharmaceutical compositions, comprising one or more polypeptides, recombinant fusion proteins, or compositions of the invention and a pharmaceutically acceptable carrier.
- the pharmaceutical compositions of the invention can be used, for example, in the methods of the invention described below.
- the pharmaceutical composition may comprise in addition to the polypeptide of the invention (a) a lyoprotectant; (b) a surfactant; (c) a bulking agent; (d) a tonicity adjusting agent; (e) a stabilizer; (f) a preservative and/or (g) a buffer.
- the buffer in the pharmaceutical composition is a Tris buffer, a hi.st.idme buffer, a phosphate buffer, a. citrate buffer or an acetate buffer.
- the pharmaceutical composition may also include a. lyoprotectant, e.g. sucrose, sorbitol or trehalose.
- the pharmaceutical composition includes a preservative e.g.
- the pharmaceutical composition includes a bulking agent, like glycine.
- the pharmaceutical composition includes a surfactant e.g., polysorbate-20, polysorbate-40, polysorbate- 60, polysorbate-65, polysorbate-80 polysorbate-85, poloxamer-188, sorbitan monolaurate, sorbitan monopalmitate, sorbitan monostearate, sorbitan monooleate, sorbitan trilaurate, sorbitan tristearate, sorbitan trioleaste, or a combination thereof.
- the pharmaceutical composition may also include a tonicity adjusting agent, e.g., a compound that renders the formulation substantially isotonic or isoosmotic with human Wood.
- Exemplary tonicity adjusting agents include sucrose, sorbitol, glycine, methionine, mannitol, dextrose, inositol, sodium chloride, arginine and arginine hydrochloride.
- the pharmaceutical composition additionally includes a stabilizer, e.g., a molecule which, when combined with a protein of interest substantially prevents or reduces chemical and/or physical instability of the protein of interest in lyophilized or liquid form.
- Exemplary stabilizers include sucrose, sorbitol, glycine, inositol, sodium chloride, methionine, arginine, and arginine hydrochloride.
- polypeptides of the invention may be the sole active agent in the pharmaceutical composition, or the composition may further comprise one or more other active agents suitable for an intended use, including but not limited to anti-microbial polypeptides (inhibiting bacterial infection), biomineralization-promoting polypeptides (i.e.: any polypeptides that are useful for controlling or promoting biomineralization), inorganic material-binding polypeptides, three-dimensional scaffold-forming polypeptides, collagen, chitosan, amphiphilic peptides, protein-binding polypeptides, enamelin-derived polypeptides, tuftelin-derived peptides, statherin-derived polypeptides, dentin-derived polypeptides, bone sialoprotein-derived polypeptides, osteocalcin-derived polypeptides, osteopontin-derived polypeptides, proteins with caries inhibitory activity, casein, and bone morphogenetic-derived polypeptides.
- anti-microbial polypeptides inhibiting bacterial infection
- compositions described herein generally comprise a combination of a compound described herein and a pharmaceutically acceptable carrier, diluent, or excipient. Such compositions are substantially free of non-pharmaceutically acceptable components, i.e., contain amounts of non-pharmaceutically acceptable components lower than permitted by US regulatory requirements at the time of filing this application.
- the composition further optionally comprises an additional pharmaceutically acceptable carrier, diluent, or excipient.
- the pharmaceutical compositions described herein are solid pharmaceutical compositions (e.g., tablet, capsules, etc.).
- compositions can be prepared in a manner well known in the pharmaceutical art, and can be administered by any suitable route.
- the pharmaceutical compositions and formulations are designed for topical administration, and may include ointments, lotions, creams, pastes, gels, drops, sprays, liquids and powders.
- Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
- compositions can be in any suitable form, including but not limited to tablets, pills, powders, lozenges, sachets, cachets, elixirs, suspensions, emulsions, solutions, syrups, aerosols (as a solid or in a liquid medium), ointments containing, for example, up to 10% by weight of the active compound, soft and hard gelatin capsules, sterile injectable solutions, and sterile packaged powders.
- the pharmaceutical compositions are in the form of a dental care product, including but not limited to toothpaste, toothpowders, mouthwash, dental floss, liquid dentifrices, dental tablets, topical gels, troches, chewing gums, dental pastes, gingival massage creams, gargle tablets, lozenges, and food products.
- a dental care product including but not limited to toothpaste, toothpowders, mouthwash, dental floss, liquid dentifrices, dental tablets, topical gels, troches, chewing gums, dental pastes, gingival massage creams, gargle tablets, lozenges, and food products.
- oral care products comprising any embodiment or combination of embodiments of the polypeptides, recombinant fusion proteins, and/or compositions of the invention.
- Such oral care products can be used, for example, in treating dental disease.
- the present invention provides isolated nucleic acids encoding an ADP or fusion polypeptide of the present invention.
- the isolated nucleic acid sequence may comprise RNA or DNA.
- isolated nucleic acids are those that have been removed from their normal surrounding nucleic acid sequences in the genome or in cDNA sequences.
- Such isolated nucleic acid sequences may comprise additional sequences useful for promoting expression and/or purification of the encoded protein, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals. It will be apparent to those of skill in the art, based on the teachings herein, what nucleic acid sequences will encode the polypeptides of the invention.
- the present invention provides recombinant expression vectors comprising the isolated nucleic acid of any aspect of the invention operatively linked to a suitable control sequence.
- “Recombinant expression vector” includes vectors that operatively link a nucleic acid coding region or gene to any control sequences capable of effecting expression of the gene product.
- "Control sequences" operably linked to the nucleic acid sequences of the invention are nucleic acid sequences capable of effecting the expression of the nucleic acid molecules. The control sequences need not be contiguous with the nucleic acid sequences, so long as they function to direct the expression thereof.
- intervening untranslated yet transcribed sequences can be present between a promoter sequence and the nucleic acid sequences and the promoter sequence can still be considered "operably linked" to the coding sequence.
- Other such control sequences include, but are not limited to, polyadenylation signals, termination signals, and ribosome binding sites.
- Such expression vectors can be of any type known in the art, including but not limited plasmid and viral-based expression vectors.
- control sequence used to drive expression of the disclosed nucleic acid sequences in a mammalian system may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive).
- inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive.
- the construction of expression vectors for use in transfecting prokaryotic cells is also well known in the art, and thus can be accomplished via standard techniques. (See, for example, Sambrook, Fritsch, and Maniatis, in: Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1989; Gene Transfer and Expression Protocols, pp.
- the expression vector must be replicable in the host organisms either as an episome or by integration into host chromosomal DNA.
- the expression vector comprises a plasmid.
- the invention is intended to include other expression vectors that serve equivalent functions, such as viral vectors.
- the present invention provides host cells that have been transfected with the recombinant expression vectors disclosed herein, wherein the host cells can be either prokaryotic or eukaryotic.
- the cells can be transiently or stably transfected.
- transfection of expression vectors into prokaryotic and eukaryotic cells can be accomplished via any technique known in the art, including but not limited to standard bacterial transformations, calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection.
- a method of producing a polypeptide according to the invention is an additional part of the invention.
- the method comprises the steps of (a) culturing a host according to this aspect of the invention under conditions conducive to the expression of the polypeptide, and (b) optionally, recovering the expressed polypeptide.
- the expressed polypeptide can be recovered from the cell free extract, but preferably they are recovered from the culture medium.
- the present invention provides methods for treating dental disease, comprising administering to a subject in need thereof an amount effective to treat the dental disease of the polypeptide, recombinant fusion protein, composition, pharmaceutical composition or oral care product of any embodiment or combination of embodiments of the invention.
- the inventors have discovered that the polypeptides of the invention can be used to treat a variety of dental diseases. While not being bound by a specific mechanism of action, the inventors believe that the polypeptides of the invention direct mineralization of dental lesions to form a "dento-mimetic" mineral layer, which also serves to reduce dental hypersensitivity and bacterial infiltration. It is further believed that some of the polypeptides exert their activity via binding to hydroxyapatite (HA) surfaces on the tooth to kinetically promote remineralization, occluding of dentin tubules to prevent/limit stimulants from reaching the tubules, and/or rebuilding lost mineral to create a physical barrier against bacteria. Thus, the methods of the invention provide a great improvement over prior art methods for treating dental disease.
- HA hydroxyapatite
- the subject may be any subject that can contract dental disease, including but not limited to mammals.
- the mammal is a human, dog, cat, horse, cow, sheep, goat, pig, or other pet or food/dairy animal.
- the subject is a human.
- dental disease is any disease or condition affecting the teeth, gums, or other tissues of the mouth that involves (directly or indirectly) demineralization (i.e.: loss of mineral content on the surface of the tooth.
- demineralization i.e.: loss of mineral content on the surface of the tooth.
- tooth is in a cycle of demineralization and remineralization through the exchange of ions between the surface of the tooth and the surrounding saliva.
- the rate of demineralization exceeds the rate of remineralization, it leads to dental disease.
- Demineralization is a major cause of most dental diseases. Loss of mineral can be caused by any means, including but not limited to acidic diet, dry mouth, tooth whitening, abrasion and bacterial plaque formation.
- Such dental diseases may include, but are not limited to, periodontitis, tooth erosion, hypersensitivity, dental caries (also known as tooth decay/cavities), dental fluorosis, tooth resorption, craniomaxillofacial bone disease, and gingival recession.
- Periodontitis is a set of inflammatory diseases affecting the periodontium, i.e., the tissues that surround and support the teeth. Periodontitis involves progressive loss of the alveolar bone around the teeth, and if left untreated, can lead to the loosening and subsequent loss of teeth. Periodontitis is caused by microorganisms that adhere to and grow on the tooth's surfaces, along with an overly aggressive immune response against these microorganisms.
- tooth demineralization or “tooth erosion” is erosion of tooth enamel. This erosion may be caused by any number of factors, including bacterial infection, teeth grinding, abrasion, erosion, and abfraction.
- hyposensitivity is an increased exposure to the environment of nerves inside the dentin of teeth, causing an increased nerve response, which can be mild to severe.
- the sensitivity may be caused by any factor, including but not limited to wear, tooth decay or exposed tooth roots.
- dental caries is an infectious disease usually bacterial in origin that causes demineralization of the hard tissues (enamel, dentin and cementum) and destruction of the organic matter of the tooth.
- the bacteria most commonly responsible for dental cavities are Streptococcus mutans and Lactobacillus. If left untreated, dental caries can lead to pain, tooth loss and systemic infection.
- fluorosis is a developmental disturbance of dental enamel caused by excessive exposure to high concentrations of fluoride during tooth development. The risk of fluoride overexposure is greatest between the ages of 3 months and 8 years. In its mild forms, fluorosis often appears as unnoticeable, tiny white streaks or specks in the enamel of the tooth. In its most severe form, tooth appearance is marred by discoloration or brown markings. The enamel may be pitted, rough and hard to clean. The spots and stains left by fluorosis are permanent and may darken over time.
- tooth resorption is a process by which all or part of a tooth structure is lost.
- the root surface is lost; this can be caused, for example, by chronic inflammation, cysts, tumors, trauma, reimplantation of a tooth, or by unknown causes.
- Internal resorption involved resorption of dentin and pulpal walls centrally within the root canal; the cause can sometimes be attributed to tooth trauma, but often there is no known cause.
- gingival recession is root (cementum) that is exposed to the environment as a result of retraction of the gumline from the crown of the teeth.
- Cementum is a calcified tissue that supports attachment of the tooth to mandibular or maxillar bone through periodontal ligaments. Exposed cementum can result in resorption of cementum and exposure of the underlying dentin, therefore, hypersensitivity and pain.
- “craniomaxillofacial bone disease” refers to disease of dental bone structures.
- "treating dental disease” means accomplishing one or more of the following: (a) reducing the severity of the dental disease; (b) limiting or preventing development of symptoms characteristic of the dental disease(s) being treated; (c) inhibiting worsening of symptoms characteristic of the dental disease(s) being treated; (d) limiting or preventing recurrence of the dental disease(s) in patients that have previously had the disorder(s); (e) limiting or preventing recurrence of symptoms in patients that were previously symptomatic for the dental disease(s); and (f) limiting development of the dental disease in a subject at risk of developing the dental disease, or not yet showing the clinical effects of the dental disease.
- an “amount effective” refers to an amount of the polypeptide that is effective for treating and/or limiting dental disease.
- the polypeptides are typically formulated as a pharmaceutical composition, such as those disclosed above, and can be administered via any suitable route, including orally, parentally, by inhalation spray, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles.
- the pharmaceutical compositions and formulations are topically administration, such as in the form of ointments, lotions, creams, pastes, gels, drops, sprays, liquids and powders.
- compositions may be necessary or desirable.
- Dosage regimens can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
- a suitable dosage range may, for instance, be 0.1 ug/kg-100 mg/kg body weight; alternatively, it may be 0.5 ug kg to 50 mg/kg; 1 ug/kg to 25 mg/kg, or 5 ug/kg to 10 mg/kg body weight.
- the polypeptides can be delivered in a single bolus, or may be administered more than once (e.g., 2, 3, 4, 5, or more times) as determined by an attending physician.
- polypeptide may be any embodiment or combination of embodiments of the first, second, or third aspects of the invention.
- ADPs comprise or consist of
- the methods comprise administering a polypeptide comprising or consisting of the amino acid sequence
- the ADP administered comprises or consists of (PGYIN(L/F)SYE(K/N)SHSQAIN(TA ⁇ )DRTA) 1 _ 1 o (SEQ ID NO: 24) (ADP5), or a functional equivalent thereof.
- the administered ADP 5 comprises or consists of (PGYINFSYENSHSQArNVDRTA)i_io (SEQ ID NO: 6)(ADP5H), (PGYINLSYEKSHSQArNTDRTA)i_io (SEQ ID NO: 7) (ADP5M), or a functional equivalent thereof.
- the polypeptide comprises or consists of an ADP5 mutant, selected from the group consisting of
- polypeptide comprises or consists of
- ADP5, ADP5M, ADP5H, or any of the variations thereof is present in 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies.
- ADP5, ADP5M, ADP5H, or any of the variations there is present in 1 copy.
- ADP5 is shown in the examples that follow to mimic the mineralization promotion effect of the wild type amelogenin protein on a given solid surface, including dentin on human tooth, rapidly, and thus can be used in any of the methods disclosed herein.
- the ADP5 comprises or consists of ADP5H, or any of the variations thereof, preferably in one copy.
- the methods comprise administering a polypeptide comprising or consisting of the amino acid sequence
- ADP7 QPMMPVPG(H/Q)HSMTP(T/I)QH) 1 _ 10 (SEQ ID NO: 4)
- ADP7 comprises or consists of
- ADP7H (HPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQH)i_io (SEQ ID NO: 9) (ADP7H), or a functional equivalent thereof.
- ADP 7, ADP7M, or ADP7H is present in 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies.
- ADP7, ADP7M, or ADPH7 is present in 1 copy.
- the ADP7 comprises or consists of ADP7H, preferably in one copy.
- the polypeptide for use in the methods comprises or consists of the amino acid sequence WP(A/S)TDKTKREEVD)!_ 10 (SEQ ID NO: 1) (ADP3), or a functional equivalent thereof.
- ADP3 comprises or consists of ((WPATDKTKREEVD)i_io (SEQ ID NO: 10) (ADP3M) or (WPSTDKTKREEVD)!_ 10 (SEQ ID NO: 11) (ADP3H), or a functional equivalent thereof.
- ADP3, ADP3M, or ADP3H is present in 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies.
- ADP3, ADP3M, or ADP3H is present in 1 copy.
- the ADP3 comprises or consists of ADP3H, preferably in one copy.
- polypeptide for use in the methods comprises or consists of a polypeptide selected from the group consisting of selected from the group consisting of
- the recited polypeptides may be present in 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies, preferably 1 copy.
- Cementum is the outer-, mineralized-tissue on the tooth root. It is part of the system of periodontal tissue that anchors the tooth to the bone. Periodontal disease results from the destructive behavior of the host elicited by an infectious biofilm adhering to the tooth root and left untreated, may lead to tooth loss. Tissue specific extracellular-matrix proteins for repairing damaged mineralized tissues of the teeth have been limited to date in therapeutic applications. Here, we describe a novel protocol for identifying peptide sequences from native proteins associated with controlling hydroxyapatite biomineralization.
- amelogenin as a case study and a bioinformatics scoring matrix, we identified similarity regions, for amelogenin with a set of hydroxyapatite-binding peptides, previously selected by phage display. Among these regions, referred to as amelogenin derived peptides, a 22-amino acids long peptide (ADP5) was shown to facilitate cell-free formation of a cementum-like hydroxyapatite mineral layer on demineralized human root dentin that, in turn, supported attachment of periodontal ligament cells in vitro. Our findings have several implications in peptide-assisted mineral formation that mimics biomineralization events.
- HAp hydroxyapatite
- ECM extracellular matrix
- PAM 250 was modified to compensate for the relative abundance of amino acids within the libraries used to select the HAp-binding peptides (HABP) and for the codon usage of the host organism (E. coli K12 ER2738) used to amplify the phages.
- HABP HAp-binding peptides
- E. coli K12 ER2738 codon usage of the host organism
- each segment was compared with each HABP and was given a similarity score.
- regions that demonstrated high similarity scores against both libraries were overlapped. These coinciding high similarity regions were picked as the putative strong binding regions (see Supporting Information). In the same way, coinciding low similarity regions were picked as the putative weak binding regions. These regions were then refined by protein structure prediction, Ca +2 ion binding domain predictions and meta-functional signature analyses (see Supporting Information). A schematic description of the design process is shown in Figure la.
- rM180 amelogenin was created as described previously by Moradian-Oldak and colleagues (24).
- the ADPs were synthesized by standard solid phase peptide synthesis technique on Wang resin using F-moc chemistry and HBTU activation.
- CSBio 336s (CSBio, USA) automated peptide synthesizer was used for the synthesis.
- the resulting resin-bound peptides were cleaved and side-chain-deprotected using Reagent K (trifluoroacetic acid /thioanisole/H 2 0/phenol/ethanedithiol (87.5:5:5:2.5)) and, precipitated by cold ether.
- Reagent K trifluoroacetic acid /thioanisole/H 2 0/phenol/ethanedithiol (87.5:5:5:2.5)
- the oscillation electronic circuit was a typical Collpits oscillator, which had a buffer amplifier. A 12 V DC current was applied to the oscillator circuit to drive the crystal, and the frequency was measured with a Hewlett-Packard 53131 A frequency counter sampling at 225 Hz (Universal Counter, Agilent Technologies). After the crystal was mounted in the cell, they were cleaned and dried with high-purity nitrogen gas and used immediately. To establish a stable baseline, a sufficient amount of buffer solution was introduced into the cell before adding the peptide. The frequency change of the crystal in pure buffer solution was recorded for 30 to 60 minutes. After this, the desired amount of ADPs was introduced into the cell and the frequency change was recorded continuously.
- the cementum-root stock blocks were prepared from single rooted, extracted adult teeth collected at the University of Washington Dental School clinics. No individual identifiers were used and the use of such material complied with the Institutional Review Board guidelines.
- the teeth were kept in 70% ethanol solution at 4°C until the specimens were prepared. Cylindrical blocks of 4 mm diameter were cut from the acellular cementum, close to the cementoenamel junction using a trephine bur.
- the teeth were kept immersed in 70% ethanol-phosphate buffered saline (PBS) during the cutting to prevent heat damage due to friction.
- the cut cylindrical blocks were cleaned of contaminating material using PBS and demineralized with 35% phosphoric acid gel for 10 seconds.
- the specimens were stored in 70% ethanol-PBS solution at 4°C until used.
- the samples were prepared by first infiltrating from the top of the cementomimetic layer with room-temperature-cure epoxy (Allied High Tech, Inc., U.S.A.) to provide a continuous volume for indentation characterization. After the epoxy was cured, the sample was ground to expose the interior in the cross-section of the specimen, then ultra-microtomed to achieve a smooth surface for nanoindentation.
- room-temperature-cure epoxy Allied High Tech, Inc., U.S.A.
- hPDL periodontal ligament
- FBS fetal bovine serum
- PSG 2mM glutamine
- the confluent hPDL cells were suspended with 0.05% Trypsin- EDTA and counted using a hemocytometer.
- the equilibrated tooth specimens were placed in 24-well plates, with 4 specimens per well performed in triplicates.
- the suspended hPDL cells were prepared in serum-free DMEM and 3xl0 4 cells per well were seeded on top of the specimens.
- the specimens were incubated with the cells for 2 hours at 37°C and 5% C02 atmosphere. After two hours the specimens were rinsed with the media and cells remaining on the surface were recovered from the surface of the specimen with 0.05% trypsin-EDTA.
- the cells so obtained were counted using CyQUANT cell proliferation assay kit (Invitrogen, USA).
- hPDL cells were prepared the same way as described above for the cell adhesion assays.
- the specimens were equilibrated in media and placed in 24 well plates, 4 specimens per well and performed in triplicate wells.
- the suspended hPDL cells were prepared in serum-free DMEM and 3xl0 4 cells per well were seeded on top of the specimens. After 24 hours, the specimens were rinsed and transferred into new plates to prevent possible contamination of the cells that grow on the bottom of the plate.
- the cells were maintained in a water-jacketed incubator at 37°C in 5% C02 saturated to H 2 O and the media was exchanged every 48 hrs 2 with DMEM supplemented with 2% FBS.
- HAp-forming peptides that operate as mineral synthesizers and control deposition of a confluent nanostructured HAp layer.
- the procedure for designing these peptides is schematically described in Figure 1.
- Using a phage display approach we combinatorially selected more than 100 HABP from a 7-amino acid and a 12-amino acid phage peptide library and characterized their binding affinity to the HAp mineral under near-physiological conditions (22). Since not all of the peptides selected have the same affinity to HAp, we next categorized them into three classes as strong-, moderate-, and weak-binding peptides.
- amelogenin-derived peptides (ADP3, ADP6) corresponding to the previously proposed putative mineral-binding regions near the C-terminus (25-28), non- mineral interactive (e.g., low similarity score) regions (ADP5, ADP8) and finally ADP7, a peptide that included ADPl, ADP2 and ADP8 (Fig. le and Table 1).
- the HAp-binding affinities of these peptides were examined via quartz crystal microbalance (QCM) and their propensity to control formation of calcium phosphates was carried out via in vitro solution mineralization assays and ex vivo tooth remineralization experiments.
- the dissociation constants (KD) of the peptides were determined.
- the KD is an equilibrium constant that represents the concentration necessary to achieve 50% surface coverage.
- Experimental binding assays demonstrated that ADP1, ADP2, ADP4 and ADP7 exhibit strong affinity to HAp with K D values on the order of ⁇ , as was predicted by the similarity analysis (Fig. 2a, Table 1).
- the binding affinities of the ADP3, ADP6, ADP5 and ADP8 were lower as predicted, with ADP5 having a significantly lower KD (50mM).
- Human cementum discs were prepared as described in "Materials and Methods" and as illustrated in figure 3. Fluorescent microscopy analysis with fluorescein-labeled ADP5 (fADP5) showed that the ADP5 readily adsorbs on the demineralized surface of human root stock cementum and remains on the surface after extensive washing. Since the microscope was calibrated to the emission of the control samples, the background emission was eliminated in both samples. The human samples after cleaning and etching reveal the expected dentinal tubules characteristic of the dentinoenamel junction, with diameters about ⁇ are clearly visible on the f-ADP5 coated samples (See Supporting Information, Figure V)
- ADP5 resulted in a substantial difference in the re-mineralization profiles of the human root stock cementum surface as observed via SEM and energy-dispersive x-ray spectroscopy (EDXS) analysis.
- EDXS energy-dispersive x-ray spectroscopy
- Elemental composition analysis by EDS showed no observable Ca or P peaks from the control sample containing no peptide, where, in contrast, substantial Ca and P peaks were observed from the ADP5 coated samples (Fig. 4a,b inserts, respectively).
- Both SEM and TEM cross-sectional analysis showed that ADP5 yielded a 10-15 ⁇ thick mineral layer that appears to be well integrated with the underlying dentin (Fig. 4c,d).
- the thickness of the cell-free biomimetic cementum layer compares well to the thickness of native human acellular cementum.
- the cementomimetic mineral layer exhibited comparable elastic modulus and hardness to the native human cementum (35). The large standard deviation observed for the cemenotomimetic layer was noted and was likely due to the less
- hPDL cells grow more efficiently on the biomimetic mineralized surfaces compared to non-mineralized control surfaces. At the end of 15 days, hPDL cells have reached more than twice the number cells on the biomimetic mineralized surfaces compared to the control surface (Fig. 4f). This data suggests that the cementomimetic mineral layer provides both a favorable environment for the hPDL cells to attach and to proliferate. Fluorescence imaging showed that, after initial adhesion, the cells organize their cytoskeleton on the mineral layer better (Fig. 4h) than the same cells growing on control surfaces (Fig. 4g).
- biomolecules such as citrate
- a similar effect may be responsible, due to the relatively high affinity of ADP7 to the mineral surface. Binding of a peptide on a crystal surface is determined by both the conformation (side chain availability) of the peptide and the atomic configuration of the crystal at the binding interface (43-45).
- HAp instead of other metastable CaP phases, such as ACP, OCP or TCP, in the presence of ADP7 is due to a specific conformation of the peptide and the arrangement of Ca and P sites on the crystal surface that maximizes the binding energy and, in turn, reduces the interfacial energy barrier required to overcome phase transformation.
- ADP5 may be the region responsible for increased mineralization kinetics through increasing local super-saturation
- ADP7 may be the region responsible for favoring the phase transformation towards HAp through altering the interfacial energy.
- answers to these questions are the focus of another ongoing study.
- ADP5 By restricting a structural analysis to but a small domain of a larger protein, such as that defined by ADP5, it is possible to expand our understanding of structure-function relationships, portending the capacity to decipher a relationship between a peptide and a chemical precipitate, and then to use such information for their practical utility to engineer material formation technologies (e.g., bio-manufacturing).
- material formation technologies e.g., bio-manufacturing.
- strong binding affinity of a peptide to an inorganic solid is not necessarily an indication of its mineral formation capability.
- the cementomimetic layer formed by ADP5 has a clinical application potential to repair diseased root surfaces, both those caused by caries and periodontal disease, and to promote regeneration of periodontal tissue, reducing the morbidity associated with tooth loss.
- Amelogenin protein exhibits a modular design: Implications for form and function. Connective Tissue Research 2003; 44: 47-51. Dunglas C, Septier D, Paine ML, Snead ML, Goldberg M. Ultrastructure of forming enamel in mouse bearing a transgene that disrupt amelogenin assembly domains. Journal of Dental Research 2001 Apr; 80(4): 1278-1278.
- Ph.D. Phage Display Peptide Library Kits (c7c and 12) were used as the biocombinatorial library (New England BioLabs Inc., USA) and synthetic HA powder was used as the target substrate (a generous gift from Ivan Transevica Institute, Department of Materials Science, Ukraine). Prior to exposing to the peptide - phage library, the HA powder was cleaned by ultrasonication in a 1/1 methanol/acetone mixture followed by ultrasonication in isopropanol.
- Cleaned HA powder was incubated with the phage-peptide library overnight in a potassium phosphate/sodium carbonate (PC) buffer (pH 7.4), containing 0.1% detergent (Tween 20 and Tween 80, Merck, USA) at room temperature with constant rotation.
- the detergent prevents non-specific interactions between phage particles and enables individual phage particle to powder surface interaction to occur.
- the powder was washed several times with PC buffer containing 0.1% detergent to remove any non-specifically or weakly bound phage particles from the HA surface.
- the phages remaining on the HA surface were then eluted by 0.2 M Glycine HC1 (pH 2.2) solution, followed by ultrasonication. Eluted phage were transferred to an early-log phase E.coli ER2738 culture and amplified for 4 hours. The amplified phage are isolated by polyethylene glycol (PEG) precipitation.
- PEG polyethylene glycol
- the phage obtained from each round of selection are plated on LB-Agar media containing 5-bromo-4-chloro-3-indolyl-P-D-galactopyranoside (Xgal) and isopropyl- ⁇ -D-thiogalactopyranosid (IPTG) in serial dilutions to obtain single phage plaques.
- Xgal 5-bromo-4-chloro-3-indolyl-P-D-galactopyranoside
- IPTG isopropyl- ⁇ -D-thiogalactopyranosid
- the binding affinity of each clone was assessed by immunofluorescence fluorescence microscopy and enzyme-linked immunosorbent assay (ELISA).
- ELISA enzyme-linked immunosorbent assay
- cleaned HAp powder was incubated overnight with selected monoclonal phages at 10 11 PFU/mL concentration in PC buffer containing 0.1% detergent at room temperature and with constant rotation. Wild type M13mpl9 bacteriophage with no random peptides displayed on the pill protein was used as negative control. After incubation, the powder was washed three times with the same buffer.
- the phage remaining bound to the surface are labeled with mouse anti-M13 IgG (Amersham Biosciences, USA) and Alexa Fluor 488-anti-mouse IgG2a conjugate (Invitrogen Corporation, USA).
- the powder suspension was transferred to a microscope slide and observed using a TE 300L microscope (Nikon, Japan).
- the approximate surface coverage of the phage particles was calculated using MetaMorph Imaging System Ver. 6.2 (Photometries UK Ltd., UK, formerly Universal Imaging Co., USA) by comparing the approximate surface area of the powder in the bright field image to the approximate phage coverage in the fluorescence image.
- HAp powder was incubated overnight with selected monoclonal phages at 10 11 PFU/ml concentration in PBS buffer containing 2% BSA at room temperature with constant rotation. Wild type M13mp 19 bacteriophage, displaying no peptides on the p(III) protein, was used as negative control. The powder was washed 3 times with PBS buffer containing 0.05% detergent. After the washing, the bound phages on the surface were labeled with horseradish peroxidase (HRP)-anti-M13 IgG conjugates
- HRP horseradish peroxidase
- Contemporary protein structure prediction methods use known structures as variable length templates for construction assembly. We have developed an initial set of incomplete structure alignments in the form of meta-predictions using 3D- Jury (web site).
- protinfo.compbio.washington.edu/protinfo_abcmfr (2) (RAMP: A suite of programs to aid in the modeling of protein structure and function (web site compbio.- washington.edu/ramp/) (3).
- RAMP A suite of programs to aid in the modeling of protein structure and function (web site compbio.- washington.edu/ramp/) (3).
- I-TASSER server web site zhang.bioinformatics.ku.edu/I-TASSER
- RAPDF all-atom conditional probability discriminatory function
- the Meta-Functional Signature (MFS) method comprises five sub-scores. The compilation of these scores was trained on two databases of functionally important residues (9) using a simple logit model (web site protinfo.compbio.washington.edu/mfs). (10-12) The MFS method can also be applied without structural analysis, using only scores based on sequence information, hidden Markov model (HMM), State-to-Step Ratio (SSR), and amino acid type (AA_type), to produce highly accurate identification of amino acids known to be important to function. (10)
- HMM hidden Markov model
- SSR State-to-Step Ratio
- AA_type amino acid type
- SSR The evolutionary context for a region is modeled by creating a phylogenetic tree for the sequence surrounding each amino acid in a protein, using multiple sequence alignments of PSI-BLAST results (13). The root of the tree represents the theoretical ancestral sequence, while each leaf of the tree represents a PSI-BLAST result sequence.
- SSR describes the ratio of the number of different amino acids presenting at a position across the multiple sequence alignments, to the total number of changes between the input protein and the base sequence within the phylogenetic tree.
- HMM We have compiled a HMM from the multiple sequence alignments described above, using the HMMER package (14). We then have compared emission frequency estimates from the HMM model with the amino acid background frequency given by karlin.c of the BLAST program package (13), to produce the HMM relative entropy score for each amino acid position (15).
- Structural Stability scores - virtual mutations - We have evaluated the importance of each residue to the structural stability of the protein by performing a series of virtual mutations to the 19 alternate amino acids, modeling induced changes in tertiary structure, and comparing simulated energy function scores (RAPDF; (5)) for the mutation set for each residue.
- RAPDF spread the variation of RAPDF scores across all possible mutants for the residue, indicates the structural volatility of the position, and therefore the contribution of the position to stability.
- the RAPDF dif structural stability score represents the sum of the simple differences between the RAPDF score for the input structure and all 19 alternatives, which indicates the effect of the naturally occurring amino acid identity on stabilization of the structure (11).
- the structural stability score was implemented both within MFS and used separately for identifying fold bearing regions not likely to contribute to function but may create specific conformations important to function for the regions they span.
- AP alkaline phosphatase
- the reaction was started by adding 1.4 x 10 ⁇ 6 g/mL bacterial AP (Invitrogen, U.S.A.) to the solution.
- the reaction was carried at 37°C, and samples were collected at times 0.25-, 1-, 3-, 16- and 24-hr.
- the phosphate released in each solution was measured using PiPer Phosphate Assay Kit (Invitrogen Co., U.S.A.) and plotted against time.
- mineralization solutions containing 24 mM Ca 2+ and 14.4mM ⁇ -GV and 0.4 mM peptide was prepared in 25 mM Tris-HCl buffer (pH 7.4).
- a mineralization solution containing no peptide was prepared as the negative control.
- Samples for electron microscopy analysis were prepared by placing a 10 ⁇ ⁇ aliquot from the reaction solution onto a carbon coated TEM grid. After 1 min, liquid on the TEM grid was carefully wicked away and the grids were vacuum-dried for 5 min. The dried grids were stored in a desiccated container until analyzed. SEM imaging was performed at 10 kV using a JSM 7000F (JEOL, Japan) SEM in secondary electron imaging mode. TEM imaging and electron diffraction analysis were performed using an EMS 420T TEM (FEI, Inc., USA; formerly Philips, The Netherlands) operated at 120 kV.
- the bundle-like assemblies appeared to be better organized in the case of rM180, which is consistent with the self-assembly properties of amelogenin and the in vitro mineralization behavior of recombinant amelogenin (20-22).
- the particles formed in the presence of ADP5 were much smaller spherulites with a less electron-dense core and smaller radiating crystals.
- the smaller particles sizes in the presence of ADP5 may be due to its nucleation dominated regime, as observed from in data describing the mineralization kinetics.
- the crystallographic analysis via XRD spectroscopy also confirmed the morphological differences were due to different crystal structure.
- Example 2 Inherent antibacterial properties of the calcium phosphate mineral (Tin-Ooet al, Archives of Orofacial Sciences, 2007. 2: p. 41-44; Ingram, et al, Plastic and Reconstructive Surgery, 1996. 98(6): p. 1 119-1 119; Owadally, Endodontics & Dental Traumatology, 1994. 10(5): p. 228-232) may also create a less viable environment for bacterial colonization and result in a decrease in bacterial colonization. To test this, preliminary experiments were carried out on the peptide-formed mineral layer with 5 * . epidermidis, a potent biofilm forming bacteria.
- Bacterial viability assays clearly show that the mineral layer exhibits a bactericidal effect (data not shown).
- the live bacteria were stained green, while the dead bacteria were stained red since the red dye can only penetrate compromised cell walls.
- the percent of the dead bacteria on the mineral layer was much higher than that of on exposed dentin.
- the total bacterial coverage on the bare dentin and the peptide-formed mineral was 41% and 58% respectively. Although the total bacterial coverage was higher on the mineral layer, 40% of the bacteria were dead, while on bare dentin, only ⁇ 6% of the bacteria were dead.
- the observed effect has significant implications in preventing further infiltration of exposed dentin tubules and arresting tooth resorption.
- the peptide-formed mineral layer exhibits an opposite effect on eukaryotic cells such as PDL fibroblasts and cementoblasts, as shown above
- S. epidermidis culture was adjusted to an optical density of 1.0 (approximately lxlO 8 cells/ml) and the cell suspension was placed in all wells with the previously prepared mineralized specimens and non-mineralized control specimens. The bacteria were incubated for 2.5 h at 37°C. Loosely adherent bacteria were removed by gently rinsing the wells three times with PBS. Adherent bacteria were stained using Live/Dead BacLightTM Bacterial Viability stain kit (Invitrogen, USA) according to the manufacturer's protocol.
- Excess liquid was aspirated from surfaces and cells viewed with an epifluorescent microscope (Zeiss Axioskop 2, Jena, Germany) equipped with an Optronics MagnaFireTM Digital Camera System (Optronics, Goleta, CA), a lOOx oil immersion objective, and appropriate filters. Five random fields were selected per well and imaged using the MagnaFireTM software program. Bacteria coverage was quantified with the aid of ImageJTM software.
- the two adjacent pairs of oppositely charged residues (E9-K10 and D19-R20) in ADP5 may be responsible for attracting soluble Ca +2 and PO 4 "3 and creating an increased local super-saturation in the proximity of the polypeptide.
- the amino acid sequences of the mutant peptides generated are listed in Table 4.
- biomineralization This may be useful if one wants to control this rate, for example, for shape formation of a biomineralized entity.
- ADP7 Fragments of ADP7;
- the strong interaction between the polypeptide and the mineral indicate that a change in the mineral-solution interfacial energy is significant in the formation of HA in preference to OCP.
- the formation of HA is a rather complicated process and can occur via different routes.
- ACP directly transforms into HA.
- the ACP formed at elevated pH is structurally less defined but more similar to HA compared to those form at lower pH, thus, energetically it is more favorable to transform into HA.
- Below pH 9 below pH 9, however, the transformation is more complicated, where an ACP to OCP transformation precedes an OCP to HA transformation.
- ACP particles forming below pH 9 have more defined structures with randomly positioned ordered clusters resembling hydrated OCP-like structures. [1] Therefore, ACP to OCP transformation is more favorable below pH 9. Later, an OCP to HA transformation may occur under the right conditions, mainly by the hydrolysis of the OCP. [3]
- the strong interaction between the polypeptide and the mineral indicate that a change in the mineral-solution interfacial energy is involved in the mineralization behavior observed with ADP7.
- the fact that the HA precipitation was only observed in ADP7 and none of the other strong binders, i.e. : ADP 1, ADP2 and ADP4 indicates that binding alone is not responsible for the observed effect.
- ADP7 may act as a heterogeneous nucleation site for the HA, thus, promoting the precipitation of HA in preference to other phases, possibly through molecular recognition.
- ADP7 comprises of the strong binders ADP1 and ADP2 and the weak binding region, with ADP8 in between.
- ADP7 promotes the precipitation of HA in preference to OCP
- the binding and biomineralization behaviors of ADP5 and ADP7 imply an interesting mechanism for amelogenin mediated mineralization during the formation of enamel.
- ADP5 may be the region responsible for increased mineralization kinetics through increasing local
- ADP7 may be the region responsible for favoring the phase
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Birds (AREA)
- General Engineering & Computer Science (AREA)
- Oral & Maxillofacial Surgery (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Physics & Mathematics (AREA)
- Immunology (AREA)
- Plant Pathology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Cosmetics (AREA)
Abstract
Description
Claims
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020137033983A KR20140056187A (en) | 2011-05-27 | 2012-05-25 | Reagents and methods for treating dental disease |
| JP2014512155A JP2014517693A (en) | 2011-05-27 | 2012-05-25 | Reagents and methods for treating dental diseases |
| US14/117,595 US9290555B2 (en) | 2011-05-27 | 2012-05-25 | Reagents and methods for treating dental disease |
| BR112013030381-6A BR112013030381B1 (en) | 2011-05-27 | 2012-05-25 | ORAL CARE PRODUCT |
| US15/015,360 US9809633B2 (en) | 2011-05-27 | 2016-02-04 | Reagents and methods for treating dental disease |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161490757P | 2011-05-27 | 2011-05-27 | |
| US61/490,757 | 2011-05-27 | ||
| US201161509986P | 2011-07-20 | 2011-07-20 | |
| US61/509,986 | 2011-07-20 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/117,595 A-371-Of-International US9290555B2 (en) | 2011-05-27 | 2012-05-25 | Reagents and methods for treating dental disease |
| US15/015,360 Division US9809633B2 (en) | 2011-05-27 | 2016-02-04 | Reagents and methods for treating dental disease |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012166626A1 true WO2012166626A1 (en) | 2012-12-06 |
| WO2012166626A8 WO2012166626A8 (en) | 2014-01-03 |
Family
ID=46208844
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/039650 Ceased WO2012166626A1 (en) | 2011-05-27 | 2012-05-25 | Reagents and methods for treating dental disease |
Country Status (5)
| Country | Link |
|---|---|
| US (2) | US9290555B2 (en) |
| JP (2) | JP2014517693A (en) |
| KR (1) | KR20140056187A (en) |
| BR (1) | BR112013030381B1 (en) |
| WO (1) | WO2012166626A1 (en) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2013177368A (en) * | 2012-01-30 | 2013-09-09 | Hiroshima Univ | Human amelogenin partial peptide |
| US9290555B2 (en) | 2011-05-27 | 2016-03-22 | University Of Washington Through Its Center For Commercialization | Reagents and methods for treating dental disease |
| WO2016115283A3 (en) * | 2015-01-13 | 2016-09-09 | University Of Washington Through Its Center For Commercialization | Reagents and methods for whitening teeth |
| JP2017502995A (en) * | 2014-01-17 | 2017-01-26 | ストラウマン ホールディング アーゲー | Method for producing enhanced stability EMD |
| WO2017072105A1 (en) * | 2015-10-26 | 2017-05-04 | Basf Se | Oral care products and methods comprising hydroxyapatite binding proteins |
| WO2017072104A1 (en) * | 2015-10-26 | 2017-05-04 | Basf Se | Oral care products and methods comprising antifreeze proteins |
| WO2017123986A1 (en) * | 2016-01-13 | 2017-07-20 | University Of Washington | Reagents and methods for mineralization of tooth enamel |
| CN108348440A (en) * | 2015-10-26 | 2018-07-31 | 巴斯夫欧洲公司 | Oral care products and methods comprising HLPS |
| US11617711B2 (en) * | 2018-08-30 | 2023-04-04 | University Of Washington | Compositions and methods for dental care |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9962465B2 (en) * | 2015-07-07 | 2018-05-08 | University Of Southern California | Amelogenin-chitosan hydrogel for dentin hypersensitivity |
| JP6962707B2 (en) * | 2017-05-19 | 2021-11-05 | プリマハム株式会社 | Detergent composition |
| EP3831360A1 (en) * | 2019-12-04 | 2021-06-09 | Credentis AG | Personal dental care product for preventing demineralisation |
| JP7813706B2 (en) | 2020-01-03 | 2026-02-13 | ザ ユナイテッド ステイツ オブ アメリカ, アズ リプレゼンテッド バイ ザ セクレタリー, デパートメント オブ ヘルス アンド ヒューマン サービシーズ | Topically administered TNAP to promote periodontal health |
| CN116848129A (en) * | 2021-02-16 | 2023-10-03 | 香港大学 | Antibacterial and mineralizing compositions and methods of use |
| CN113321710B (en) * | 2021-05-27 | 2022-07-05 | 吉林大学 | Polypeptide with function of promoting enamel structural mineralization and regeneration |
| WO2024081656A1 (en) * | 2022-10-14 | 2024-04-18 | Ohio State Innovation Foundation | Bone sialoprotein compositions and methods of using thereof |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000006734A1 (en) * | 1998-07-29 | 2000-02-10 | Northwestern University | Chondrogenic and osteogenic inducing molecule |
| US6677306B1 (en) * | 1998-07-29 | 2004-01-13 | Northwestern University | Chondrogenic and osteogenic inducing molecule |
| WO2008021290A2 (en) * | 2006-08-09 | 2008-02-21 | Homestead Clinical Corporation | Organ-specific proteins and methods of their use |
| WO2011077086A2 (en) * | 2009-12-22 | 2011-06-30 | Ucl Business Plc | Agents having tissue generative activity |
| WO2011073447A9 (en) * | 2009-12-18 | 2012-03-29 | Straumann Holding Ag | Emd c-depleted |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BRPI9908182C1 (en) | 1998-02-27 | 2021-05-25 | Biora Ab | matrix protein compositions for wound healing |
| JP4638653B2 (en) | 2000-08-16 | 2011-02-23 | アコロジックス インコーポレイテッド | Dental products containing bone growth-promoting peptides |
| CN100346823C (en) * | 2001-09-14 | 2007-11-07 | 比奥拉比奥埃克斯公司 | Enamel matrix protein compositions for modulating immune response |
| US7132015B2 (en) * | 2002-02-20 | 2006-11-07 | University Of Southern California | Materials for dental and biomedical application |
| CN1982453A (en) * | 2005-12-12 | 2007-06-20 | 杨淑伟 | Use of human gene and its encoded polypeptide |
| WO2009157869A1 (en) * | 2008-06-27 | 2009-12-30 | Straumann Holding Ag | Enamel matrix derivative fraction c |
| US20100070200A1 (en) | 2008-09-17 | 2010-03-18 | Mehmet Sarikaya | Method and system for designing polypeptides and polypeptide-like polymers with specific chemical and physical characteristics |
| BR112013030381B1 (en) | 2011-05-27 | 2021-10-26 | University Of Washington Through Its Center For Commercialization | ORAL CARE PRODUCT |
| JP6134146B2 (en) * | 2012-01-30 | 2017-05-24 | 国立大学法人広島大学 | Human amelogenin partial peptide |
| US20140186273A1 (en) * | 2012-12-27 | 2014-07-03 | University Of Southern California | Chitosan -Amelogenin Hydrogel for In Situ Enamel Growth |
| EP3244913A4 (en) | 2015-01-13 | 2018-08-15 | University of Washington through its Center for Commercialization | Reagents and methods for whitening teeth |
-
2012
- 2012-05-25 BR BR112013030381-6A patent/BR112013030381B1/en not_active IP Right Cessation
- 2012-05-25 US US14/117,595 patent/US9290555B2/en not_active Expired - Fee Related
- 2012-05-25 WO PCT/US2012/039650 patent/WO2012166626A1/en not_active Ceased
- 2012-05-25 KR KR1020137033983A patent/KR20140056187A/en not_active Ceased
- 2012-05-25 JP JP2014512155A patent/JP2014517693A/en active Pending
-
2016
- 2016-02-04 US US15/015,360 patent/US9809633B2/en active Active
- 2016-08-29 JP JP2016166830A patent/JP2017012188A/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000006734A1 (en) * | 1998-07-29 | 2000-02-10 | Northwestern University | Chondrogenic and osteogenic inducing molecule |
| US6677306B1 (en) * | 1998-07-29 | 2004-01-13 | Northwestern University | Chondrogenic and osteogenic inducing molecule |
| WO2008021290A2 (en) * | 2006-08-09 | 2008-02-21 | Homestead Clinical Corporation | Organ-specific proteins and methods of their use |
| WO2011073447A9 (en) * | 2009-12-18 | 2012-03-29 | Straumann Holding Ag | Emd c-depleted |
| WO2011077086A2 (en) * | 2009-12-22 | 2011-06-30 | Ucl Business Plc | Agents having tissue generative activity |
Non-Patent Citations (95)
| Title |
|---|
| "Ambion 1998 Catalog", AUSTIN, TX |
| "Gene Transfer and Expression Protocols", THE HUMANA PRESS INC., pages: 109 - 128 |
| "Methods in Enzymology", 1990, ACADEMIC PRESS, INC., article "Guide to Protein Purification" |
| "Methods in Enzymology", vol. 185, ACADEMIC PRESS, article "Gene Expression Technology" |
| ACHILLES W; JOCKEL U; SCHAPER A; BURK M; RIEDMILLER H: "In-vitro Formation of Urinary Stones - Generation of Spherulites of Calcium-Phosphate in Gel and Overgrowth with Calcium-Oxalate Using a New Flow Model of Crystallization", SCANNING MICROSCOPY, vol. 9, no. 2, June 1995 (1995-06-01), pages 577 - 586 |
| ALTSCHUL SF; MADDEN TL; SCHAFFER AA; ZHANG JH; ZHANG Z; MILLER W ET AL.: "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", NUCLEIC ACIDS RES, vol. 25, no. 17, September 1997 (1997-09-01), pages 3389 - 3402, XP002905950, DOI: doi:10.1093/nar/25.17.3389 |
| AOBA T; MORENO EC; KRESAK M; TANABE T: "Possible roles of partial sequences at N-and C-termini of amelogenin in protein-enamel mineral interaction", JOURNAL OF DENTAL RESEARCH, vol. 68, no. 9, September 1989 (1989-09-01), pages 1331 - 1336, XP002544490 |
| ARYS A; JEDWAB J; PIREAUX JJ; PHILIPPART C; DOUROV N: "Brushite in the Pulp of Primary Molars", JOURNAL OF ORAL PATHOLOGY & MEDICINE, vol. 18, no. 7, August 1989 (1989-08-01), pages 371 - 376 |
| AUSTIN, TX: "Ambion 1998 Catalog" |
| BARTLETT JD; GANSS B; GOLDBERG M; MORADIAN-OLDAK J; PAINE ML; SNEAD ML ET AL.: "3. Protein-protein interactions of the developing enamel matrix", CURR TOP DEV BIOL, vol. 74, 2006, pages 57 - 115 |
| BENIASH E; SIMMER JP; MARGOLIS HC: "The effect of recombinant mouse amelogenins on the formation and organization of hydroxyapatite crystals in vitro", J STR-UCT BIOL, vol. 149, no. 2, February 2005 (2005-02-01), pages 182 - 190, XP004726004, DOI: doi:10.1016/j.jsb.2004.11.001 |
| BENIASH E; SIMMER JP; MARGOLIS HC: "The effect of recombinant mouse amelogenins on the formation and organization of hydroxyapatite crystals in vitro", J STRUCT BIOL, vol. 149, no. 2, February 2005 (2005-02-01), pages 182 - 190, XP004726004, DOI: doi:10.1016/j.jsb.2004.11.001 |
| BERMAN GP; JAMES DFV; HUGHES RJ; GULLEY MS; HOLZSCHEITER MH; LOPEZ GV: "Dynamical stability and quantum chaos of ions in a linear trap", PHYSICAL REVIEW A, vol. 61, no. 2, February 2000 (2000-02-01) |
| BOSKEY A; SPEVAK L; TAN M; DOTY SB; BUTLER WT: "Dentin sialoprotein (DSP) has limited effects on in vitro apatite formation and growth", CALCIFIED TISSUE INT, vol. 67, no. 6, December 2000 (2000-12-01), pages 472 - 478 |
| BROWN, W.E. ET AL.: "Crystallographic and Chemical Relations between Octacalcium Phosphate and Hydroxyapatite", NATURE, vol. 196, no. 4859, 1962, pages 1050 - 1052 |
| CAPRIOTTI LA; BEEBE TP; SCHNEIDER JP: "Hydroxyapatite surface-induced peptide folding", JAM CHEM SOC, vol. 129, no. 16, April 2007 (2007-04-01), pages 5281 - 5287 |
| CHELLIAH V; CHEN L; BLUNDELL TL; LOVELL SC: "Distinguishing structural and functional restraints in evolution in order to identify interaction sites", JOURNAL OF MOLECULAR BIOLOGY, vol. 342, no. 5, October 2004 (2004-10-01), pages 1487 - 1504, XP004844930, DOI: doi:10.1016/j.jmb.2004.08.022 |
| CHENG G; QIAN B; SAMUDRALA R; BAKER D: "Improvement in protein functional site prediction by distinguishing structural and functional constraints on protein family evolution using computational design", NUCLEIC ACIDS RES, vol. 33, no. 18, 2005, pages 5861 - 5867 |
| CHENG G; SAMUDRALA R: "An all-atom geometrical knowledge-based scoringfunction to predict protein metal ion binding sites", AFFINITIES AND SPECIFICITIES |
| DELGADO S ET AL: "Amelogenin, the major protein of tooth enamel: A new phylogenetic marker for ordinal mammal relationships", MOLECULAR PHYLOGENETICS AND EVOLUTION, ORLANDO, FL, US, vol. 47, no. 2, 1 May 2008 (2008-05-01), pages 865 - 869, XP022622910, ISSN: 1055-7903, [retrieved on 20080202], DOI: 10.1016/J.YMPEV.2008.01.025 * |
| DU C; FALINI G; FERMANI S; ABBOTT C; MORADIAN-OLDAK J: "Supramolecular assembly of amelogenin nanospheres into birefringent microribbons", SCIENCE, vol. 307, no. 5714, 4 March 2005 (2005-03-04), pages 1450 - 1454 |
| DUNGLAS C; SEPTIER D; PAINE ML; SNEAD ML; GOLDBERG M: "Ultrastructure of forming enamel in mouse bearing a transgene that disrupt amelogenin assembly domains", JOURNAL OF DENTAL RESEARCH, vol. 80, no. 4, April 2001 (2001-04-01), pages 1278 - 1278 |
| EANES, E.D.; J.L. MEYER: "Maturation of Cratalline Calcium Phosphates in Aqueous Suspensions at Physiologic pH", CALCIFIED TISSUE RESEARCH, vol. 23, no. 3, 1977, pages 259 - 269 |
| EDDY SR: "Hidden Markov models and genome sequence analysis", FASEB JOURNAL, vol. 12, no. 8, April 1998 (1998-04-01), pages 103 |
| ELANGOVAN S; MARGOLIS HC; OPPENHEIM FG; BENIASH E: "Conformational changes in salivary proline-rich protein 1 upon adsorption to calcium phosphate crystalsle", LANGMUIR, vol. 23, no. 22, October 2007 (2007-10-01), pages 11200 - 11205 |
| FAN D; IIJIMA M; BROMLEY KM; YANG X; MATHEW S; MORADIAN-OLDAK J: "The cooperation of enamelin and amelogenin in controlling octacalcium phosphate crystal morphology", CELLS .TISSUES ORGANS, vol. 194, no. 2-4, 2011, pages 194 - 198 |
| FAN Y; SUN Z; MORADIAN-OLDAK J: "Controlled remineralization of enamel in the presence of amelogenin and fluoride", BIOMATERIALS, vol. 30, no. 4, February 2009 (2009-02-01), pages 478 - 483, XP025693603, DOI: doi:10.1016/j.biomaterials.2008.10.019 |
| FAN, G.C. ET AL.: "Regulation of myocardial function by histidine-rich, calcium-binding protein", AMERICAN JOURNAL OF PHYSIOLOGY-HEART AND CIRCULATORY PHYSIOLOGY, vol. 287, no. 4, 2004, pages H 1705 - H 1711 |
| FRIDDLE RW; BATTLE K; TRUBETSKOY V; TAO JH; SALTER EA; MORADIAN-OLDAK J: "Single-Molecule Determination of the Face-Specific Adsorption of Amelogenin's C-Terminus on Hydroxyapatite", ANGEWANDTE CHEMIE-INTERNATIONAL EDITION, vol. 50, no. 33, 2011, pages 7541 - 7545, XP055035784, DOI: doi:10.1002/anie.201100181 |
| GAJJERAMAN S; NARAYANAN K; HAO JJ; QIN CL; GEORGE A: "Matrix macromolecules in hard tissues control the nucleation and hierarchical assembly of hydroxyapatite", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 282, no. 2, January 2007 (2007-01-01), pages 1193 - 1204 |
| GAY IC; CHEN S; MACDOUGALL M: "Isolation and characterization of multipotent human periodontal ligament stem cells", ORTHODONTICS & CRANIOFACIAL RESEARCH, vol. 10, no. 3, August 2007 (2007-08-01), pages 149 - 160, XP009166376, DOI: doi:10.1111/j.1601-6343.2007.00399.x |
| GINALSKI K; ELOFSSON A; FISCHER D; RYCHLEWSKI L: "3D-Jury: a simple approach to improve protein structure predictions", BIOINFORMATICS, vol. 19, no. 8, May 2003 (2003-05-01), pages 1015 - 1018 |
| GOLDBERG HA; WARNER KJ; LI MC; HUNTER GK: "Binding of bone sialoprotein, osteopontin and synthetic polypeptides to hydroxyapatite", CONNECTIVE TISSUE RESEARCH, vol. 42, no. 1, 2001, pages 25 - 37, XP008053436, DOI: doi:10.3109/03008200109014246 |
| GREGORY, K.N. ET AL.: "Histidine-rich Ca binding protein: a regulator of sarcoplasmic reticulum calcium sequestration and cardiac function", JOURNAL OF MOLECULAR AND CELLULAR CARDIOLOGY, vol. 40, no. 5, 2006, pages 653 - 665, XP024949706, DOI: doi:10.1016/j.yjmcc.2006.02.003 |
| GU LS; KIM YK; LIU Y; TAKAHASHI K; ARUN S; WIMMER CE ET AL.: "Immobilization of a phosphonated analog of matrix phosphoproteins within cross-linked collagen as a templating mechanism for biomimetic mineralization", ACTA BIOMATER, vol. 7, no. 1, January 2011 (2011-01-01), pages 268 - 277, XP027448768, DOI: doi:10.1016/j.actbio.2010.07.036 |
| GUNGORMUS M; FONG H; KIM IW; EVANS JS; TAMERLER C; SARIKAYA M: "Regulation of in vitro calcium phosphate mineralization by combinatorially selected hydroxyapatite-binding peptides", BIOMACROMOLECULES, vol. 9, no. 3, March 2008 (2008-03-01), pages 966 - 973, XP055035687, DOI: doi:10.1021/bm701037x |
| GUNGORMUS MUSTAFA ET AL: "Cementomimetics-constructing a cementum-like biomineralized microlayer via amelogenin-derived peptides.", INTERNATIONAL JOURNAL OF ORAL SCIENCE JUN 2012 LNKD- DOI:10.1038/IJOS.2012.40 PUBMED:22743342, vol. 4, no. 2, June 2012 (2012-06-01), pages 69 - 77, XP002682010, ISSN: 1674-2818 * |
| HANSON FONG ET AL: "Enamel Structure Properties Controlled by Engineered Proteins in Transgenic Mice", JOURNAL OF BONE AND MINERAL RESEARCH, vol. 18, no. 11, 1 November 2003 (2003-11-01), pages 2052 - 2059, XP055035694, ISSN: 0884-0431, DOI: 10.1359/jbmr.2003.18.11.2052 * |
| HE G; DAHL T; VEIS A; GEORGE A: "Dentin matrix protein 1 initiates hydroxyapatite formation in vitro", CONNECTIVE TISSUE RESEARCH, vol. 44, 2003, pages 240 - 245 |
| HO SP; YU B; YUN W; MARSHALL GW; RYDER MI; MARSHALL SJ: "Structure, chemical composition and mechanical properties of human and rat cementum and its interface with root dentin", ACTA BIOMATER, vol. 5, no. 2, February 2009 (2009-02-01), pages 707 - 718, XP025840110, DOI: doi:10.1016/j.actbio.2008.08.013 |
| HUNG LH; NGAN SC; LIU T; SAMUDRALA R: "PROTINFO: new algorithms for enhanced protein structure predictions", NUCLEIC ACIDS RES, vol. 33, July 2005 (2005-07-01), pages W77 - W80 |
| IIJIMA M; MORADIAN-OLDAK J: "Interactions of Amelogenins with Octacalcium Phosphate Crystal Faces Are Dose Dependent", CALCIF TISSUE INT, 23 January 2004 (2004-01-23) |
| INGRAM ET AL., PLASTIC AND RECONSTRUCTIVE SURGERY, vol. 98, no. 6, 1996, pages 1119 - 1119 |
| INNIS ET AL.: "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| IVANOVSKI S; GRONTHOS S; SHI S; BARTOLD PM: "Stem cells in the periodontal ligament", ORAL DISEASES, vol. 12, no. 4, July 2006 (2006-07-01), pages 358 - 363, XP055134759, DOI: doi:10.1111/j.1601-0825.2006.01253.x |
| JIANG WG; CHU XB; WANG B; PAN HH; XU XR; TANG RK: "Biomimetically Triggered Inorganic Crystal Transformation by Biomolecules: A New Understanding of Biomineralization", JOURNAL OFPHYSICAL CHEMISTLY B, vol. 113, no. 31, August 2009 (2009-08-01), pages 10838 - 10844 |
| KIM J; AROLA DD; GU LS; KIM YK; MAI S; LIU Y ET AL.: "Functional biomimetic analogs help remineralize apatite-depleted demineralized resin-infiltrated dentin via a bottom-up approach", ACTA BIOMATER, vol. 6, no. 7, July 2010 (2010-07-01), pages 2740 - 2750, XP027052707 |
| KODAKA T; HIRAYAMA A; MORI R; SANO T: "Spherulitic brushite stones in the dental pulp of a cow", JOURNAL OFELECTRON MICROSCOPY, vol. 47, no. 1, 1998, pages 57 - 65 |
| LAKSMINARAYANAN R; BROMLEY KM; LEI YP; SNEAD ML; MORADIAN-OLDAK J: "Perturbed amelogenin secondary structure leads to uncontrolled aggregation in amelogenesis imperfecta mutant proteins", JBIOL CHEM |
| LE NORCY E; KWAK SY; WIEDEMANN-BIDLACK FB; BENIASH E; YAMAKOSHI Y; SIMMER JP ET AL.: "Potential Role of the Amelogenin N-Terminus in the Regulation of Calcium Phosphate Formation in vitro", CELLS TISSUES ORGANS, vol. 194, no. 2-4, 2011, pages 188 - 193 |
| LIU T; GUERQUIN M; SAMUDRALA R: "Improving the accuracy of template-based predictions by mixing and matching between initial models", BMC STRUCTURAL BIOLOGY, May 2008 (2008-05-01), pages 8 |
| LOWENSTAM HA: "Minerals Formed by Organisms", SCIENCE, vol. 211, no. 4487, 1981, pages 1126 - 1131 |
| LOWENSTAM HA; WEINER S: "On Biomineralization", 1989, OXFORD UNIVERSITY PRESS |
| LOWENSTAM HA; WEINER S: "On biomineralization", vol. IX, 1989, OXFORD UNIVERSITY PRESS, pages: 324 |
| MANN S.: "Biomineralization: Principles and Concepts in Bioinorganic Materials Chemistry", 2001, OXFORD UNIVERSITY PRESS |
| MARGOLIS HC; BENIASH E; FOWLER CE: "Role of macromolecular assembly of enamel matrix proteins in enamel formation", JOURNAL OF DENTAL RESEARCH, vol. 85, no. 9, September 2006 (2006-09-01), pages 775 - 793 |
| MASICA DL; GRAY JJ: "Solution- and Adsorbed-State Structural Ensembles Predicted for the Statherin-Hydroxyapatite System", BIOPHYS J, vol. 96, no. 8, April 2009 (2009-04-01), pages 3082 - 3091 |
| MEYER, J.L.; C.C. WEATHERALL: "Amorphous to crystalline calcium phosphate phase transformation at elevated pH", JOURNAL OF COLLOID AND INTERFACE SCIENCE, vol. 89, no. 1, 1982, pages 257 - 267, XP024186322, DOI: doi:10.1016/0021-9797(82)90139-4 |
| MORADIAN-OLDAK J; PAINE ML; LEI YP; FINCHAM AG; SNEAD ML: "Carboxy- and amino- terminal domains of amelogenin are involved in the supramolecular self-assembly", JOURNAL OF DENTAL RESEARCH, vol. 79, 2000, pages 513 - 513 |
| MORADIAN-OLDAK J; PAINE ML; LEI YP; FINCHAM AG; SNEAD ML: "Self-assembly properties of recombinant engineered amelogenin proteins analyzed by dynamic light scattering and atomic force microscopy", J STRUCT BIO1, vol. 131, no. 1, July 2000 (2000-07-01), pages 27 - 37 |
| MORADIAN-OLDAK J; PAINE ML; LEI YP; FINCHAM AG; SNEAD ML: "Self-assembly properties of recombinant engineered amelogenin proteins analyzed by dynamic light scattering and atomic force microscopy", J STRUCT BIOL, vol. 131, no. 1, July 2000 (2000-07-01), pages 27 - 37 |
| NAGATOMO K; KOMAKI M; SEKIYA I; SAKAGUCHI Y; NOGUCHI K; ODA S ET AL.: "Stem cell properties of human periodontal ligament cells", JOURNAL OF PERIODONTAL RESEARCH, vol. 41, no. 4, August 2006 (2006-08-01), pages 303 - 310 |
| OREN EE; TAMERLER C; SAHIN D; HNILOVA M; SEKER UOS; SARIKAYA M ET AL.: "A novel knowledge-based approach to design inorganic-binding peptides", BIOINFORMATICS, vol. 23, no. 21, November 2007 (2007-11-01), pages 2816 - 2822, XP055060875, DOI: doi:10.1093/bioinformatics/btm436 |
| OWADALLY, ENDODONTICS & DENTAL TRAUMATOLOGY, vol. 10, no. 5, 1994, pages 228 - 232 |
| PAINE ML; LUO W; ZHU DH; BRINGAS P; SNEAD ML: "Functional domains for amelogenin revealed by compound genetic defects", JOURNAL OF BONE AND MINERAL RESEARCH, vol. 18, no. 3, March 2003 (2003-03-01), pages 466 - 472 |
| PAMPENA DA; ROBERTSON KA; LITVINOVA O; LAJOIE G; GOLDBERG HA; HUNTER GK: "Inhibition of hydroxyapatite formation by osteopontin phosphopeptides", BIOCHEM J, vol. 378, March 2004 (2004-03-01), pages 1083 - 1087, XP002463486, DOI: doi:10.1042/BJ20031150 |
| PATHAK, R.K.; R.G.W. ANDERSON; S.L. HOFMANN: "Histidine-rich calcium binding protein, a sarcoplasmic reticulum protein of striated muscle, is also abundant in arteriolar smooth muscle cells", JOURNAL OF MUSCLE RESEARCH AND CELL MOTILITY, vol. 13, no. 3, 1992, pages 366 - 376 |
| PUGACH MK; LI Y; SUGGS C; WRIGHT JT; ARAGON MA; YUAN ZA ET AL.: "The Amelogenin C-Terminus Is Required for Enamel Development", JOURNAL OF DENTAL RESEARCH, vol. 89, no. 2, February 2010 (2010-02-01), pages 165 - 169 |
| QIU SR; WIERZBICKI A; ORME CA; CODY AM; HOYER JR; NANCOLLAS GH ET AL.: "Molecular modulation of calcium oxalate crystallization by osteopontin and citrate", PROC NATL ACAD SCI USA, vol. 101, no. 7, February 2004 (2004-02-01), pages 1811 - 1815, XP002463489, DOI: doi:10.1073/pnas.0307900100 |
| R.I. FRESHNEY: "Culture of Animal Cells: A Manual of Basie Technique", 1987, LISS, INC. |
| R.I. FRESHNEY: "Culture ofAnimal Cells: A Manual ofBasic Technique", 1987, LISS, INC. |
| RAYMOND W. FRIDDLE ET AL: "Single-Molecule Determination of the Face-Specific Adsorption of Amelogenin's C-Terminus on Hydroxyapatite", ANGEWANDTE CHEMIE INTERNATIONAL EDITION, vol. 50, no. 33, 8 August 2011 (2011-08-08), pages 7541 - 7545, XP055035784, ISSN: 1433-7851, DOI: 10.1002/anie.201100181 * |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK ET AL.: "Molecular Cloning: A Laborcitoty Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK; FRITSCH; MANIATIS: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMUDRALA R; MOULT J: "An all-atom distance-dependent conditional probability discriminatory function for protein structure prediction", JOURNAL OF MOLECULAR BIOLOGY, vol. 275, no. 5, February 1998 (1998-02-01), pages 895 - 916, XP004461448, DOI: doi:10.1006/jmbi.1997.1479 |
| SAMUDRALA R; XIA Y; HUANG E; LEVITT M: "Ab initio protein structure prediction using a combined hierarchical approach", PROTEINS-STRUCTURE FUNCTION AND GENETICS, 1999, pages 194 - 198, XP001146416 |
| SARIKAYA M; AKSAY IA: "Biomimetics : design and processing of materials", vol. XI, 1995, AIP PRESS, pages: 285 |
| SEO BM; MIURA M; GRONTHOS S; BARTOLD PM; BATOULI S; BRAHIM J ET AL.: "Investigation of multipotent postnatal stem cells from human periodontal ligament", LANCET, vol. 364, no. 9429, July 2004 (2004-07-01), pages 149 - 155, XP005070189, DOI: doi:10.1016/S0140-6736(04)16627-0 |
| SEO BM; MIURA M; SONOYAMA W; COPPE C; STANYON R; SHI S: "Recovery of stem cells from cryopreserved periodontal ligament", JOURNAL OFDENTAL RESEARCH, vol. 84, no. 10, October 2005 (2005-10-01), pages 907 - 912, XP002414742 |
| SHAW WJ; CAMPBELL AA; PAINE ML; SNEAD ML: "The COOH terminus of the amelogenin, LRAP, is oriented next to the hydroxyapatite surface", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 279, no. 39, September 2004 (2004-09-01), pages 40263 - 40266 |
| SNEAD ML: "Amelogenin protein exhibits a modular design: Implications for form and function", CONNECTIVE TISSUE RESEARCH, vol. 44, 2003, pages 47 - 51 |
| SNEAD ML; ZHU DH; LEI YP; WHITE SN; SNEAD CM; LUO W ET AL.: "Protein self-assembly creates a nanoscale device for biomineralization", MATERIALS SCIENCE & ENGINEERING C-BIOMIMETIC AND SUPRAMOLECULAR SYSTEMS, vol. 26, no. 8, September 2006 (2006-09-01), pages 1296 - 1300, XP025137550, DOI: doi:10.1016/j.msec.2005.08.030 |
| SO CR; TAMERLER C; SARIKAYA M: "Adsorption, Diffusion, and Self-Assembly of an Engineered Gold-Binding Peptide on Au(111) Investigated by Atomic Force Microscopy", ANGEWANDTE CHEMIE-INTERNATIONAL EDITION, vol. 48, no. 28, 2009, pages 5174 - 5177 |
| TALLER A; GROHE B; ROGERS KA; GOLDBERG HA; HUNTER GK: "Specific adsorption of osteopontin and synthetic polypeptides to calcium oxalate monohydrate crystals", BIOPHYS J, vol. 93, no. 5, September 2007 (2007-09-01), pages 1768 - 1777 |
| TAUBMAN MA; VALVERDE P; HAN XZ; KAWAI T: "Immune response: The key to bone resorption in periodontal disease", JOURNAL OFPERIODONTOLOGY, vol. 76, no. 11, November 2005 (2005-11-01), pages 2033 - 2041 |
| TIN-OOET, ARCHIVES OF OROFACIAL SCIENCES, vol. 2, 2007, pages 41 - 44 |
| TYE CE; RATTRAY KR; WARNER KJ; GORDON JAR; SODEK J; HUNTER GK ET AL.: "Delineation of the hydroxyapatite-nucleating domains of bone sialoprotein", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 278, no. 10, March 2003 (2003-03-01), pages 7949 - 7955 |
| WANG K; HORST JA; CHENG G; NICKLE DC; SAMUDRALA R: "Protein Meta-Functional Signatures from Combining Sequence, Structure, Evolution, and Amino Acid Property Information", PLOS COMPUTATIONAL BIOLOGY, vol. 4, no. 9, September 2008 (2008-09-01) |
| WANG K; SAMUDRALA R: "FSSA: a novel method for identifying functional signatures from structural alignments", BIOINFORMATICS, vol. 21, no. 13, July 2005 (2005-07-01), pages 2969 - 2977 |
| WANG K; SAMUDRALA R: "Incorporating background frequency improves entropy-based residue conservation measures", BMC BIOINFORMATICS, August 2006 (2006-08-01), pages 7 |
| WAZEN RM; TYE CE; GOLDBERG HA; HUNTER GK; SMITH CE; NANCI A: "In vivo functional analysis of polyglutamic acid domains in recombinant bone sialoprotein", JOURNAL OF HISTOCHEMISTRY & CYTOCHEMISTLY, vol. 55, no. 1, January 2007 (2007-01-01), pages 35 - 42 |
| ZHANG H ET AL: "Full length amelogenin binds to cell surface LAMP-1 on tooth root/periodontium associated cells", ARCHIVES OF ORAL BIOLOGY, PERGAMON PRESS, OXFORD, GB, vol. 55, no. 6, 1 June 2010 (2010-06-01), pages 417 - 425, XP027051299, ISSN: 0003-9969, [retrieved on 20100410] * |
| ZHANG SF; GANGAL G; ULUDAG H: "Magic bullets' for bone diseases: progress in rational design of bone-seeking medicinal agents", CHEMICAL SOCIETY REVIEWS, vol. 36, no. 3, 2007, pages 507 - 531, XP009143816, DOI: doi:10.1039/B512310K |
| ZHANG Y: "Template-based modeling and free modeling by I-TASSER in CASP7", PROTEINS-STRUCTURE FUNCTION AND BIOINFORMATICS, vol. 69, 2007, pages 108 - 117 |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9290555B2 (en) | 2011-05-27 | 2016-03-22 | University Of Washington Through Its Center For Commercialization | Reagents and methods for treating dental disease |
| US9809633B2 (en) | 2011-05-27 | 2017-11-07 | University Of Washington Through Its Center For Commercialization | Reagents and methods for treating dental disease |
| JP2013177368A (en) * | 2012-01-30 | 2013-09-09 | Hiroshima Univ | Human amelogenin partial peptide |
| JP2017502995A (en) * | 2014-01-17 | 2017-01-26 | ストラウマン ホールディング アーゲー | Method for producing enhanced stability EMD |
| CN107427560A (en) * | 2015-01-13 | 2017-12-01 | 华盛顿大学商业中心 | Reagent and method for whitening teeth |
| WO2016115283A3 (en) * | 2015-01-13 | 2016-09-09 | University Of Washington Through Its Center For Commercialization | Reagents and methods for whitening teeth |
| CN107427560B (en) * | 2015-01-13 | 2021-06-15 | 华盛顿大学商业中心 | Agent and method for whitening teeth |
| US20180200172A1 (en) * | 2015-01-13 | 2018-07-19 | University Of Washington Through Its Center For Commercialization | Reagents and methods for whitening teeth |
| RU2745996C2 (en) * | 2015-10-26 | 2021-04-05 | Басф Се | Oral care products and methods containing hydroxyapatite-binding proteins |
| CN108348438B (en) * | 2015-10-26 | 2021-07-13 | 巴斯夫欧洲公司 | Oral care products and methods containing antifreeze protein |
| KR102780116B1 (en) | 2015-10-26 | 2025-03-11 | 바스프 에스이 | Oral care products and methods comprising floating proteins |
| CN108348438A (en) * | 2015-10-26 | 2018-07-31 | 巴斯夫欧洲公司 | Oral care products and methods comprising antifreeze proteins |
| CN108348439A (en) * | 2015-10-26 | 2018-07-31 | 巴斯夫欧洲公司 | Oral care products and methods comprising hydroxyapatite-bound proteins |
| CN108348440A (en) * | 2015-10-26 | 2018-07-31 | 巴斯夫欧洲公司 | Oral care products and methods comprising HLPS |
| US10507340B2 (en) | 2015-10-26 | 2019-12-17 | Basf Se | Oral care products and methods comprising AFPs |
| KR20180069058A (en) * | 2015-10-26 | 2018-06-22 | 바스프 에스이 | Oral care products and methods containing floating proteins |
| US10898739B2 (en) | 2015-10-26 | 2021-01-26 | Basf Se | Oral care products and methods comprising AFPs |
| RU2750748C2 (en) * | 2015-10-26 | 2021-07-02 | Басф Се | Products and methods for oral care containing antifreeze proteins |
| WO2017072104A1 (en) * | 2015-10-26 | 2017-05-04 | Basf Se | Oral care products and methods comprising antifreeze proteins |
| WO2017072105A1 (en) * | 2015-10-26 | 2017-05-04 | Basf Se | Oral care products and methods comprising hydroxyapatite binding proteins |
| WO2017123986A1 (en) * | 2016-01-13 | 2017-07-20 | University Of Washington | Reagents and methods for mineralization of tooth enamel |
| US10952940B2 (en) | 2016-01-15 | 2021-03-23 | University Of Washington | Reagents and methods for mineralization of tooth enamel |
| US20190380929A1 (en) * | 2016-01-15 | 2019-12-19 | University Of Washington | Reagents and methods for mineralization of tooth enamel |
| US11617711B2 (en) * | 2018-08-30 | 2023-04-04 | University Of Washington | Compositions and methods for dental care |
| EP3843700A4 (en) * | 2018-08-30 | 2023-09-06 | University of Washington | COMPOSITIONS AND METHODS OF DENTAL CARE |
Also Published As
| Publication number | Publication date |
|---|---|
| US9809633B2 (en) | 2017-11-07 |
| US9290555B2 (en) | 2016-03-22 |
| JP2017012188A (en) | 2017-01-19 |
| BR112013030381A2 (en) | 2017-08-08 |
| US20150065435A1 (en) | 2015-03-05 |
| BR112013030381B1 (en) | 2021-10-26 |
| JP2014517693A (en) | 2014-07-24 |
| WO2012166626A8 (en) | 2014-01-03 |
| US20160152672A1 (en) | 2016-06-02 |
| KR20140056187A (en) | 2014-05-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9809633B2 (en) | Reagents and methods for treating dental disease | |
| Gungormus et al. | Cementomimetics—constructing a cementum-like biomineralized microlayer via amelogenin-derived peptides | |
| Moradian-Oldak | Protein-mediated enamel mineralization | |
| Lacruz et al. | Dental enamel formation and implications for oral health and disease | |
| Ruan et al. | Amelogenin and enamel biomimetics | |
| Gungormus et al. | Regulation of in vitro calcium phosphate mineralization by combinatorially selected hydroxyapatite-binding peptides | |
| Yang et al. | How does bone sialoprotein promote the nucleation of hydroxyapatite? A molecular dynamics study using model peptides of different conformations | |
| Mukherjee et al. | Enhancing collagen mineralization with amelogenin peptide: toward the restoration of dentin | |
| Gulseren et al. | Dentin phosphoprotein mimetic peptide nanofibers promote biomineralization | |
| Tao et al. | Control of calcium phosphate nucleation and transformation through interactions of enamelin and amelogenin exhibits the “goldilocks effect” | |
| Yu et al. | An evolutionarily conserved subdomain in amelotin promotes amorphous calcium phosphate-to-hydroxyapatite phase transition | |
| Chu et al. | Remineralization efficacy of an amelogenin-based synthetic peptide on carious lesions | |
| Ling et al. | Structure–Activity Relationships of Hydroxyapatite-Binding Peptides | |
| Tao et al. | Sequence-defined energetic shifts control the disassembly kinetics and microstructure of amelogenin adsorbed onto hydroxyapatite (100) | |
| Moradian-Oldak et al. | Amelogenin supra-molecular assembly in vitro compared with the architecture of the forming enamel matrix | |
| Gopinathan et al. | The expanded amelogenin polyproline region preferentially binds to apatite versus carbonate and promotes apatite crystal elongation | |
| Melcher et al. | Accelerated nucleation of hydroxyapatite using an engineered hydrophobin fusion protein | |
| CN111647042B (en) | Bone reconstruction regulating polypeptide and application | |
| Buchko et al. | Residue-Specific Insights into the Intermolecular Protein–Protein Interfaces Driving Amelogenin Self-Assembly in Solution | |
| WO2021046498A1 (en) | Mitigation of peri-implantitis by design and stability of bifunctional peptides with antimicrobial properties | |
| Li et al. | Synthesis and structural characterization of morphologically distinct nanoscale hydroxyapatites | |
| Pandya et al. | Integrative temporo-spatial, mineralogic, spectroscopic, and proteomic analysis of postnatal enamel development in teeth with limited growth | |
| US20250213452A1 (en) | Bifunctional peptides for biomimetic reconstruction of silver diamine fluoride treated dental tissues | |
| Silverman et al. | Hydroxyapatite growth inhibition by osteopontin hexapeptide sequences | |
| Habelitz et al. | Self‐assembly and effect on crystal growth of the leucine‐rich amelogenin peptide |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12725993 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2014512155 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20137033983 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14117595 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013030381 Country of ref document: BR |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 12725993 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 112013030381 Country of ref document: BR Kind code of ref document: A2 Effective date: 20131126 |
