WO2012162193A2 - Manipulating plant sensitivity to light - Google Patents

Manipulating plant sensitivity to light Download PDF

Info

Publication number
WO2012162193A2
WO2012162193A2 PCT/US2012/038719 US2012038719W WO2012162193A2 WO 2012162193 A2 WO2012162193 A2 WO 2012162193A2 US 2012038719 W US2012038719 W US 2012038719W WO 2012162193 A2 WO2012162193 A2 WO 2012162193A2
Authority
WO
WIPO (PCT)
Prior art keywords
plant
family
sequences
polypeptide
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/038719
Other languages
French (fr)
Other versions
WO2012162193A3 (en
Inventor
Rajnish Khanna
Brent A. KRONMILLER
Oliver J. Ratcliffe
T. Lynne Reuber
Marie E. PETRACEK
Robert J. Meister
Sasha Preuss
Amanda MCCLERREN
Qungang Qi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Mendel Biotechnology Inc
Monsanto Co
Original Assignee
Mendel Biotechnology Inc
Monsanto Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Mendel Biotechnology Inc, Monsanto Co filed Critical Mendel Biotechnology Inc
Priority to US14/118,491 priority Critical patent/US20140380520A1/en
Publication of WO2012162193A2 publication Critical patent/WO2012162193A2/en
Anticipated expiration legal-status Critical
Publication of WO2012162193A3 publication Critical patent/WO2012162193A3/en
Priority to US15/802,397 priority patent/US20180155736A1/en
Priority to US17/404,842 priority patent/US20220042029A1/en
Priority to US18/465,595 priority patent/US20240124885A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • C12N15/8222Developmentally regulated expression systems, tissue, organ specific, temporal or spatial regulation
    • C12N15/8223Vegetative tissue-specific promoters
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • C12N15/8222Developmentally regulated expression systems, tissue, organ specific, temporal or spatial regulation
    • C12N15/8223Vegetative tissue-specific promoters
    • C12N15/8225Leaf-specific, e.g. including petioles, stomata
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • C12N15/8222Developmentally regulated expression systems, tissue, organ specific, temporal or spatial regulation
    • C12N15/8223Vegetative tissue-specific promoters
    • C12N15/8229Meristem-specific, e.g. nodal, apical
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • C12N15/8245Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine involving modified carbohydrate or sugar alcohol metabolism, e.g. starch biosynthesis
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • C12N15/8245Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine involving modified carbohydrate or sugar alcohol metabolism, e.g. starch biosynthesis
    • C12N15/8246Non-starch polysaccharides, e.g. cellulose, fructans, levans
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • C12N15/8273Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for drought, cold, salt resistance
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A40/00Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
    • Y02A40/10Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
    • Y02A40/146Genetically Modified [GMO] plants, e.g. transgenic plants

Definitions

  • the claimed invention in the field of functional genomics and characterization of plant genes for the improvement of plants, was made by or on behalf of Mendel Biotechnology, Inc. and Monsanto Company as a result of activities undertaken within the scope of a joint research agreement in effect on or before the date the claimed invention was made.
  • the present disclosure relates to plant genomics and plant improvement.
  • a plant's traits including its biochemical, developmental, or phenotypic characteristics that enhance yield or tolerance to various abiotic stresses, may be controlled through a number of cellular processes.
  • One important way to manipulate that control is through transcriptional regulators - proteins that influence the expression of a particular gene or sets of genes.
  • Transgenic plants that comprise cells having altered levels of at least one selected transcriptional regulator, for example, possess advantageous or desirable traits.
  • Strategies for manipulating traits by altering a plant cell's transcriptional regulator content can therefore result in plants and crops with commercially valuable properties.
  • the present disclosure identifies B-box genes that modify plant sensitivity to light. Manipulating light signaling processes through altering the expression/activities of these genes in plants will lead to enhanced agronomic characteristics, for example, increased crop yield and improved stress tolerance. Altering the expression/activity of the B-box genes of the present disclosure may also provide plants with altered levels of ureides, altered levels of hexose sugars, altered sucrose phosphate synthase (SPS) activity, altered levels of starch, and delayed senescence.
  • SPS sucrose phosphate synthase
  • the present disclosure pertains to polynucleotide and polypeptide sequences provided herein and in the Sequence Listing.
  • the present disclosure further pertains to nucleic acid constructs containing and/or expressing or suppressing the polynucleotide sequences provided herein and in the Sequence Listing, individually or in combination, either driven by a ubiquitously expressed, a stress- or a chemical- inducible, a tissue specific, a development specific or a diurnally-regulated promoter.
  • the present disclosure also pertains to transgenic plants with increased or decreased activities of one or more of the proteins provided herein and in the Sequence Listing, or encoded by the nucleic acid constructs containing and/or expressing or suppressing the polynucleotide sequences provided herein and in the Sequence Listing.
  • the transgenic plants may exhibit changes in light sensitivity, resulting in improved vigor, improved yield and growth, and improved ability to cope with abiotic stresses compared to the wild type or other control plants. This approach can be combined with other growth-promoting factors to expand the benefits.
  • the present disclosure also provides methods for the selection and production of transgenic plants transformed with the disclosed B-box sequences or closely-related orthologs or paralogs.
  • the selection may be made by identification in a plant (that is, a mature plant, a seed, a plant part, a seedling, plant tissue, plant cell, etc.) of the presence of a transgene or heterologous sequence that was transformed into the transgenic plant, or by an altered trait in the transgenic plant such as improved yield or increased tolerance to an abiotic stress, such as low nitrogen conditions, cold, water deprivation or drought, etc.
  • Sequence Listing provides exemplary polynucleotide and polypeptide sequences. The traits associated with the use of the sequences are included in the Examples.
  • Figure 1 shows light-responsiveness of Arabidopsis seedlings transformed with 35S::AtBBX28 (G1481):cMYC (AtBBX28 is provided as SEQ ID NO: 2).
  • Several independently transformed lines were grown in red light and mean hypocotyl lengths of 20-30 seedlings of each line are plotted with the empty- vector control (pMEN 65) and seedlings overexpressing BBX32 (G1988 OE; SEQ ID NO: 430).
  • the dotted line marks the hypocotyl length of the control (pMEN 65; SEQ ID NO: 428).
  • FIG. 2 shows AtBBX28 (G1481, SEQ ID NO: 2) suppressing transcriptional activity of AtBBX21 (G1482, SEQ ID NO: 56) in protoplast co-transfection assays.
  • Protoplasts were co- transformed with prCHS: :GUS reporter and either CAT (control) alone, or HA:AtBBX21 (G1482) with one CAT, HA: BBX32, or HA:AtBBX28 (G1481).
  • GUS is ⁇ -glucuronidase
  • CAT chloramphenicol acetyltransferase
  • HA hemagglutinin protein-fusion tag (Niman et al., 1983).
  • RGA relative GUS activity.
  • FIG. 3 Arabidopsis plant lines transformed with AtBBX25 (G1894, SEQ ID NO: 154; Fig. 3A), AtBBX24 (G329, SEQ ID NO: 152; Fig. 3B), AtBBX30 (G1478, SEQ ID NO: 40; Fig. 3C) and AtBBX18 (G1881, SEQ ID NO: 202; Fig. 3D) were grown in red light and mean hypocotyl lengths (HL) of 20-30 seedlings of each line are plotted with the control.
  • AtBBX25 G1894, SEQ ID NO: 154; Fig. 3A
  • AtBBX24 G329, SEQ ID NO: 152; Fig. 3B
  • AtBBX30 G1478, SEQ ID NO: 40; Fig. 3C
  • AtBBX18 G1881, SEQ ID NO: 202; Fig. 3D
  • FIG. 4 Arabidopsis plant lines transformed with AtBBX7 (G2440, SEQ ID NO: 104; Fig. 4A), AtBBX26 (G1486, SEQ ID NO: 52; Fig. 4B), AtBBX19 (G902, SEQ ID NO: 200; Fig. 4C) and AtBBX20 (G1888, SEQ ID NO: 54; Fig. 4D) were grown in red light and mean hypocotyl lengths of 20- 30 seedlings of each line are plotted with the control.
  • AtBBX7 G2440, SEQ ID NO: 104; Fig. 4A
  • AtBBX26 G1486, SEQ ID NO: 52; Fig. 4B
  • AtBBX19 G902, SEQ ID NO: 200; Fig. 4C
  • AtBBX20 G1888, SEQ ID NO: 54; Fig. 4D
  • Figures 5A-5E present an alignment of AtBBX25 (G1894, AT2G31380.1 ; SEQ ID NO: 154), AtBBX24 (G329, AT1G06040.1 ; SEQ ID NO: 152) and closely related sequences.
  • Figures 6A-6D represent an alignment of AtBBX19 (G902, AT4G38960.1 ; SEQ ID NO: 200), AtBBX18 (G1881, AT2G21320.1 ; SEQ ID NO: 202) and closely related sequences.
  • Figure 7 shows an alignment of AtBBX30 (G1478, AT4G15248.1 ; SEQ ID NO: 40) and closely related sequences.
  • Figures 8A-8F present an alignment of AtBBX28 (G1481, AT4G27310.1 ; SEQ ID NO: 2) and AtBBX29 (G900, AT5G54470.1 ; SEQ ID NO: 4) and closely related sequences.
  • Figures 9A-9G displays an alignment of AtBBX20 (G1888, AT4G39070.1 ; SEQ ID NO: 54) and AtBBX21 (G1482, AT1G75540.1 ; SEQ ID NO: 56) and closely related sequences.
  • Figures 10A-10I show an alignment of AtBBX7 (G2440, AT3G07650.1, SEQ ID NO: 104), AtBBX8 (G1479, AT5G48250.1 ; SEQ ID NO: 106) and closely related sequences.
  • Figure 11 shows microarray data from field grown soybean plants. Microarrays performed on tissues sampled throughout the day from the field demonstrated that 219 genes showed 2-fold or greater changes in abundance in transgenic events transformed with ⁇ . ⁇ 32 relative to the control and that the majority of these changes occurred around dawn.
  • Figures 12A-12E shows a phylogenetic tree of the Arabidopsis thaliana and Glycine max B-box family, which contains 61 B-box sequences from soybean and 32 horn Arabidopsis.
  • Phylogenetic analysis of the B-box sequences shows that the sequences are clustered into structural groups(St) and clades (C).H refers to Arabidopsis homolog, N refers to other names.
  • Figures 13A-13D shows a phylogenetic tree for 61 B-box sequences from soybean. Phylogenetic analysis of the B-box sequences shows that these sequences are clustered into structural groups (St) and clades (C).
  • TP refers to time of peak expression.
  • SP refers to whether or not a shift in peak expression was observed in transgenic soybean plants expressing BBX32 (Y for yes and N for no).
  • the first and second circles represent the first and the second B-box domain respectively; the rectangle represents the CCT domain.
  • Figure 14 represents the single B-box clade in Arabidopsis thaliana and Glycine max.
  • the Arabidopsis thaliana genome contains seven single B-box domain genes while the paleopolyploid Glycine max genome contains thirteen single B-box genes.
  • Phylogenetic analysis indicates that GmBBX52 and GmBBX53 are orthologs of the Arabidopsis thaliana ⁇ 32 gene.
  • Figure 15 shows AtBBX32 and GmBBX62 interaction in vivo in soybean cotyledon protoplasts.
  • Luminex co-immunoprecipitation was performed using antibody against GFP (A).
  • the reciprocal co-IP was conducted using antibody against Hag tag (B).
  • Components within the co-precipitated protein complexes were probed with biotinylated anti-Flag (A) and anti-GFP (B) antibodies, and subsequently detected with a fluorescently labeled R-phycoerythrin.
  • MFI stands for Median Fluorescence Intensity. ** Mean differs significantly from controls at p ⁇ 0.05.
  • Figure 16 demonstrates that AtBBX32 interacts directly with GmBBX62 via in vitro pull-down assay. Pull-down reactions were carried out using recombinant flag-GmBBX62 and soluble AtBBX32 extracts from wheat germ in vitro translation system. Protein bound to flag-GmBBX62 was washed, separated on SDS-PAGE and immunoblotted with anti-flag antibody (A) and anti-AtBBX32 antibody (B).Lane 1, flag-GmBBX62; la, AtBBX32 wheat germ extract; 2, anti-flag antibody bound beads only; 3, AtBBX32 only, no flag-GmBBX62; 4, flag-GmBBX62+AtBBX32.
  • A anti-flag antibody
  • B anti-AtBBX32 antibody
  • FIG. 17 shows AtBBX32 and GmBBX39 interaction in soybean protoplasts.
  • Luminex co-IP assays were performed on extracts from soybean cotyledon protoplasts co-expressing AtBBX32 fused to GFP and GmBBX39 fused to the Myc epitope.
  • MFI stands for Median Fluorescence Intensity. * denotes p ⁇ 0.001.
  • the present disclosure relates to polynucleotides and polypeptides for modifying phenotypes of plants, particularly those associated with increased abiotic stress tolerance and increased yield with respect to a control plant (for example, a wild-type plant).
  • various information sources are referred to and/or are specifically incorporated.
  • the information sources include scientific journal articles, patent documents, textbooks, and World Wide Web browser-inactive page addresses. While the reference to these information sources clearly indicates that they can be used by one of skill in the art, each and every one of the information sources cited herein are specifically incorporated in their entirety, whether or not a specific mention of "incorporation by reference” is noted. The contents and teachings of each and every one of the information sources can be relied on, used to make and use the disclosed embodiments.
  • a plant cell includes a plurality of such plant cells
  • a reference to “a stress” is a reference to one or more stresses and equivalents thereof known to those skilled in the art, and so forth.
  • Polynucleotide is a nucleic acid molecule comprising a plurality of polymerized nucleotides, e.g., at least about 15 consecutive polymerized nucleotides.
  • a polynucleotide may be a nucleic acid, oligonucleotide, nucleotide, or any fragment thereof.
  • a polynucleotide comprises a nucleotide sequence encoding a polypeptide (or protein) or a domain or fragment thereof.
  • the polynucleotide may comprise a promoter, an intron, an enhancer region, a polyadenylation site, a translation initiation site, 5' or 3' untranslated regions, a reporter gene, a selectable marker, or the like.
  • the polynucleotide can be single- stranded or double-stranded DNA or RNA.
  • the polynucleotide optionally comprises modified bases or a modified backbone.
  • the polynucleotide can be, e.g., genomic DNA or RNA, a transcript (such as an mRNA), a cDNA, a PCR product, a cloned DNA, a synthetic DNA or RNA, or the like.
  • the polynucleotide can be combined with carbohydrate, lipids, protein, or other materials to perform a particular activity such as transformation or form a useful composition such as a peptide nucleic acid (PNA).
  • PNA peptide nucleic acid
  • the polynucleotide can comprise a sequence in either sense or antisense orientations. "Oligonucleotide” is substantially equivalent to the terms amplimer, primer, oligomer, element, target, and probe and is preferably single-stranded.
  • a "recombinant polynucleotide” is a polynucleotide that is not in its native state, e.g., the polynucleotide comprises a nucleotide sequence not found in nature, or the polynucleotide is in a context other than that in which it is naturally found, e.g., separated from nucleotide sequences with which it typically is in proximity in nature, or adjacent (or contiguous with) nucleotide sequences with which it typically is not in proximity.
  • the sequence at issue can be cloned into a vector, or otherwise recombined with one or more additional nucleic acid.
  • isolated polynucleotide is a polynucleotide, whether naturally occurring or recombinant, that is present outside the cell in which it is typically found in nature, whether purified or not.
  • an isolated polynucleotide is subject to one or more enrichment or purification procedures, e.g., cell lysis, extraction, centrifugation, precipitation, or the like.
  • Gene refers to the partial or complete coding sequence of a gene, its complement, and its 5' or 3' untranslated regions.
  • a gene is also a functional unit of inheritance, and in physical terms is a particular segment or sequence of nucleotides along a molecule of DNA (or RNA, in the case of RNA viruses) involved in producing a polypeptide chain. The latter may be subjected to subsequent processing such as chemical modification or folding to obtain a functional protein or polypeptide.
  • a gene may be isolated, partially isolated, or found with an organism's genome.
  • a transcriptional regulator gene encodes a transcriptional regulator polypeptide, which may be functional or require processing to function as an initiator of transcription.
  • genes may be defined by the cis-trans test, a genetic test that determines whether two mutations occur in the same gene and that may be used to determine the limits of the genetically active unit (Rieger et al., 1976).
  • a gene generally includes regions preceding ("leaders”; upstream) and following ("trailers”; downstream) the coding region.
  • a gene may also include intervening, non-coding sequences, referred to as "introns", located between individual coding segments, referred to as "exons”. Most genes have an associated promoter region, a regulatory sequence 5' of the transcription initiation codon (there are some genes that do not have an identifiable promoter). The function of a gene may also be regulated by enhancers, operators, and other regulatory elements.
  • polypeptide is an amino acid sequence comprising a plurality of consecutive polymerized amino acid residues e.g., at least about 15 consecutive polymerized amino acid residues.
  • a polypeptide comprises a polymerized amino acid residue sequence that is a transcriptional regulator or a domain or portion or fragment thereof.
  • the polypeptide may comprise: (i) a localization domain; (ii) an activation domain; (iii) a repression domain; (iv) an oligomerization domain; (v) a protein-protein interaction domain; (vi) a DNA-binding domain; or the like.
  • the polypeptide optionally comprises modified amino acid residues, naturally occurring amino acid residues not encoded by a codon, or non-naturally occurring amino acid residues.
  • Protein refers to an amino acid sequence, oligopeptide, peptide, polypeptide or portions thereof whether naturally occurring or synthetic.
  • a “recombinant polypeptide” is a polypeptide produced by translation of a recombinant polynucleotide.
  • a “synthetic polypeptide” is a polypeptide created by consecutive polymerization of isolated amino acid residues using methods well known in the art.
  • the isolated polypeptide is separated from other cellular components with which it is typically associated, e.g., by any of the various protein purification methods herein.
  • Homology refers to sequence similarity between a reference sequence and at least a fragment of a newly sequenced clone insert or its encoded amino acid sequence.
  • Identity or similarity refers to sequence similarity between two polynucleotide sequences or between two polypeptide sequences, with identity being a more strict comparison.
  • the phrases “percent identity” and “% identity” refer to the percentage of sequence similarity found in a comparison of two or more polynucleotide sequences or two or more polypeptide sequences.
  • Sequence similarity refers to the percent similarity in base pair sequence (as determined by any suitable method) between two or more polynucleotide sequences. Two or more sequences can be anywhere from 0-100% similar, or any integer value between 0-100%. Identity or similarity can be determined by comparing a position in each sequence that may be aligned for purposes of comparison.
  • a degree of similarity or identity between polynucleotide sequences is a function of the number of identical, matching or corresponding nucleotides at positions shared by the polynucleotide sequences.
  • a degree of identity of polypeptide sequences is a function of the number of identical amino acids at corresponding positions shared by the polypeptide sequences.
  • a degree of homology or similarity of polypeptide sequences is a function of the number of amino acids at corresponding positions shared by the polypeptide sequences.
  • “Alignment” refers to a number of nucleotide bases or amino acid residue sequences aligned by lengthwise comparison so that components in common (i.e., nucleotide bases or amino acid residues at corresponding positions) may be visually and readily identified. The fraction or percentage of components in common is related to the homology or identity between the sequences. Alignments such as those of Figures 4A-4F may be used to identify conserved domains and relatedness within these domains. An alignment may suitably be determined by means of computer programs known in the art, such as MACVECTOR software, 1999 (Accelrys, Inc., San Diego, CA).
  • a “conserved domain” or “conserved region” as used herein refers to a region in heterologous polynucleotide or polypeptide sequences where there is a relatively high degree of sequence identity between the distinct sequences.
  • a "B-box zinc finger” domain such as is found in a polypeptide member of B-box zinc finger family, is an example of a conserved domain.
  • a conserved domain is preferably at least nine base pairs (bp) in length.
  • a conserved domain with respect to presently disclosed polypeptides refers to a domain within a polypeptide family that exhibits a higher degree of sequence homology, such as at least about 56%, 57%.
  • a fragment or domain can be referred to as outside a conserved domain, outside a consensus sequence, or outside a consensus DNA -binding site that is known to exist or that exists for a particular polypeptide class, family, or sub-family.
  • the fragment or domain will not include the exact amino acids of a consensus sequence or consensus DNA-binding site of a transcriptional regulator class, family or sub-family, or the exact amino acids of a particular transcriptional regulator consensus sequence or consensus DNA-binding site.
  • a particular fragment, region, or domain of a polypeptide, or a polynucleotide encoding a polypeptide can be "outside a conserved domain” if all the amino acids of the fragment, region, or domain fall outside of a defined conserved domain(s) for a polypeptide or protein. Sequences having lesser degrees of identity but comparable biological activity are considered to be equivalents.
  • conserved domains may be identified as regions or domains of identity to a specific consensus sequence (see, for example, Riechmann et al., 2000a, 2000b). Thus, by using alignment methods well known in the art, the conserved domains of the plant polypeptides, for example, for the B-box zinc finger proteins (Putterill et al., 1995), may be determined.
  • the conserved domains for many of the disclosed polypeptide sequences are listed in Table 1. Also, the polypeptides of Table 1 have conserved domains specifically indicated by amino acid coordinate start and stop sites. A comparison of the regions of these polypeptides allows one of skill in the art (see, for example, Reeves and Nissen, 1990, 1995) to identify domains or conserved domains for any of the polypeptides listed or referred to in this disclosure.
  • “Complementary” refers to the natural hydrogen bonding by base pairing between purines and pyrimidines.
  • sequence A-C-G-T (5' -> 3') forms hydrogen bonds with its complements A-C-G-T (5' -> 3') or A-C-G-U (5' -> 3')-
  • Two single-stranded molecules may be considered partially complementary, if only some of the nucleotides bond, or "completely complementary” if all of the nucleotides bond.
  • the degree of complementarity between nucleic acid strands affects the efficiency and strength of hybridization and amplification reactions.
  • “Fully complementary” refers to the case where bonding occurs between every base pair and its complement in a pair of sequences, and the two sequences have the same number of nucleotides.
  • highly stringent or “highly stringent condition” refer to conditions that permit hybridization of DNA strands whose sequences are highly complementary, wherein these same conditions exclude hybridization of significantly mismatched DNAs.
  • Polynucleotide sequences capable of hybridizing under stringent conditions with the disclosed, orthologous or paralogous polynucleotides may be, for example, variants of the disclosed polynucleotide sequences, including allelic or splice variants, or sequences that encode orthologs or paralogs of presently disclosed polypeptides.
  • Nucleic acid hybridization methods are disclosed in detail by Kashima et al., 1985; Sambrook et al., 1989; and by Haymes et al., 1985; which references are incorporated herein by reference.
  • stringency is determined by the temperature, ionic strength, and concentration of denaturing agents (e.g., formamide) used in a hybridization and washing procedure (for a more detailed description of establishing and determining stringency, see the section "Identifying Polynucleotides or
  • nucleic Acids by Hybridization The degree to which two nucleic acids hybridize under various conditions of stringency is correlated with the extent of their similarity.
  • similar nucleic acid sequences from a variety of sources such as within a plant's genome (as in the case of paralogs) or from another plant (as in the case of orthologs) that may perform similar functions can be isolated on the basis of their ability to hybridize with known related polynucleotide sequences.
  • Numerous variations are possible in the conditions and means by which nucleic acid hybridization can be performed to isolate related polynucleotide sequences having similarity to sequences known in the art and are not limited to those explicitly disclosed herein.
  • Such an approach may be used to isolate polynucleotide sequences having various degrees of similarity with disclosed polynucleotide sequences, such as, for example, encoded transcriptional regulators having 56% or greater identity with the conserved domain of disclosed sequences.
  • orthologs and paralogs are defined below in the section entitled “Orthologs and Paralogs”.
  • orthologs and paralogs are evolutionarily related genes that have similar sequences and functions.
  • Orthologs are structurally related genes in different species that are derived by a speciation event.
  • Paralogs are structurally related genes within a single species that are derived by a duplication event.
  • equivalog describes members of a set of homologous proteins that are conserved with respect to function since their last common ancestor. Related proteins are grouped into equivalog families, and otherwise into protein families with other hierarchically defined homology types. This definition is provided at the Institute for Genomic Research (TIGR) World Wide Web (www) website, “tigr.org” under the heading “Terms associated with TIGRFAMs”.
  • variable refers to molecules with some differences, generated synthetically or naturally, in their base or amino acid sequences as compared to a reference (native) polynucleotide or polypeptide, respectively. These differences include substitutions, insertions, deletions or any desired combinations of such changes in a native polynucleotide of amino acid sequence.
  • polynucleotide variants differences between presently disclosed polynucleotides and polynucleotide variants are limited so that the nucleotide sequences of the former and the latter are closely similar overall and, in many regions, identical. Due to the degeneracy of the genetic code, differences between the former and latter nucleotide sequences may be silent (i.e., the amino acids encoded by the polynucleotide are the same, and the variant polynucleotide sequence encodes the same amino acid sequence as the presently disclosed polynucleotide.
  • Variant nucleotide sequences may encode different amino acid sequences, in which case such nucleotide differences will result in amino acid substitutions, additions, deletions, insertions, truncations or fusions with respect to the similar disclosed polynucleotide sequences. These variations may result in polynucleotide variants encoding polypeptides that share at least one functional characteristic. The degeneracy of the genetic code also dictates that many different variant polynucleotides can encode identical and/or substantially similar polypeptides in addition to those sequences illustrated in the Sequence Listing.
  • compositions and methods are a variant of a nucleic acid listed in the Sequence Listing, that is, one having a sequence that differs from the one of the polynucleotide sequences in the Sequence Listing, or a complementary sequence, that encodes a functionally equivalent polypeptide (i.e., a polypeptide having some degree of equivalent or similar biological activity) but differs in sequence from the sequence in the Sequence Listing, due to degeneracy in the genetic code.
  • polymorphisms that may or may not be readily detectable using a particular oligonucleotide probe of the polynucleotide encoding polypeptide, and improper or unexpected hybridization to allelic variants, with a locus other than the normal chromosomal locus for the polynucleotide sequence encoding polypeptide.
  • allelic variant or “polynucleotide allelic variant” refers to any of two or more alternative forms of a gene occupying the same chromosomal locus. Allelic variation arises naturally through mutation, and may result in phenotypic polymorphism within populations. Gene mutations may be "silent” or may encode polypeptides having altered amino acid sequence.
  • Allelic variant and “polypeptide allelic variant” may also be used with respect to polypeptides, and in this case the terms refer to a polypeptide encoded by an allelic variant of a gene.
  • splice variant or “polynucleotide splice variant” as used herein refers to alternative forms of RNA transcribed from a gene. Splice variation naturally occurs as a result of alternative sites being spliced within a single transcribed RNA molecule or between separately transcribed RNA molecules, and may result in several different forms of mRNA transcribed from the same gene. Thus, splice variants may encode polypeptides having different amino acid sequences, which may or may not have similar functions in the organism. "Splice variant” or “polypeptide splice variant” may also refer to a polypeptide encoded by a splice variant of a transcribed mRNA.
  • polynucleotide variants may also refer to polynucleotide sequences that encode paralogs and orthologs of the presently disclosed polypeptide sequences.
  • Polypeptide variants may refer to polypeptide sequences that are paralogs and orthologs of the presently disclosed polypeptide sequences.
  • polypeptide sequence variants Differences between presently disclosed polypeptides and polypeptide variants are limited so that the sequences of the former and the latter are closely similar overall and, in many regions, identical.
  • Presently disclosed polypeptide sequences and similar polypeptide variants may differ in amino acid sequence by one or more substitutions, additions, deletions, fusions and truncations, which may be present in any combination. These differences may produce silent changes and result in functionally equivalent polypeptides.
  • any of a variety of polynucleotide sequences is capable of encoding the disclosed polypeptides and homolog polypeptides.
  • a polypeptide sequence variant may have "conservative" changes, wherein a substituted amino acid has similar structural or chemical properties.
  • Deliberate amino acid substitutions may thus be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues, as long as a significant amount of the functional or biological activity of the polypeptide is retained.
  • negatively charged amino acids may include aspartic acid and glutamic acid
  • positively charged amino acids may include lysine and arginine
  • amino acids with uncharged polar head groups having similar hydrophilicity values may include leucine, isoleucine, and valine; glycine and alanine; asparagine and glutamine; serine and threonine; and phenylalanine and tyrosine.
  • a variant may have "non-conservative" changes, e.g., replacement of a glycine with a tryptophan. Similar minor variations may also include amino acid deletions or insertions, or both.
  • Related polypeptides may comprise, for example, additions and/or deletions of one or more N-linked or O-linked glycosylation sites, or an addition and/or a deletion of one or more cysteine residues.
  • Guidance in determining which and how many amino acid residues may be substituted, inserted or deleted without abolishing functional or biological activity may be found using computer programs well known in the art, for example, DNASTAR software (see US Patent No. 5,840,544).
  • “Fragment” with respect to a polynucleotide refers to a clone or any part of a polynucleotide molecule that retains a usable, functional characteristic.
  • Useful fragments include oligonucleotides and polynucleotides that may be used in hybridization or amplification technologies or in the regulation of replication, transcription or translation.
  • a "polynucleotide fragment” refers to any subsequence of a polynucleotide, typically, of at least about 9 consecutive nucleotides, preferably at least about 30 nucleotides, more preferably at least about 50 nucleotides, of any of the sequences provided herein.
  • Exemplary polynucleotide fragments are the first sixty consecutive nucleotides of the polynucleotides listed in the Sequence Listing. Exemplary fragments also include fragments that comprise a region that encodes a conserved domain of a polypeptide. Exemplary fragments also include fragments that comprise a conserved domain of a polypeptide. Exemplary fragments include fragments that comprise a conserved domain of a polypeptide, for example, any of SEQ ID NOs 235-427.
  • Fragments may also include subsequences of polypeptides and protein molecules, or a subsequence of the polypeptide. Fragments may have uses in that they may have antigenic potential.
  • the fragment or domain is a subsequence of the polypeptide which performs at least one biological function of the intact polypeptide in substantially the same manner, or to a similar extent, as does the intact polypeptide.
  • a polypeptide fragment can comprise a recognizable structural motif or functional domain such as a DNA-binding site or domain that binds to a DNA promoter region, an activation domain, or a domain for protein-protein interactions, and may initiate transcription.
  • Fragments can vary in size from as few as 3 amino acid residues to the full length of the intact polypeptide, but are preferably at least about 30 amino acid residues in length and more preferably at least about 60 amino acid residues in length.
  • plant includes whole plants, shoot vegetative organs/structures (for example, leaves, stems and tubers), roots, flowers and floral organs/structures (for example, bracts, sepals, petals, stamens, carpels, anthers and ovules), seed (including embryo, endosperm, and seed coat) and fruit (the mature ovary), plant tissue (for example, vascular tissue, ground tissue, and the like) and cells (for example, guard cells, egg cells, and the like), and progeny of same.
  • the class of plants that can be used in the disclosed methods is generally as broad as the class of higher and lower plants amenable to
  • transformation techniques including angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, horsetails, psilophytes, lycophytes, bryophytes, and multicellular algae (see for example, Figure 1, adapted from Daly et al., 2001, Figure 2, adapted from Ku et al., 2000; and see also Tudge, 2000).
  • control plant refers to a plant cell, seed, plant component, plant tissue, plant organ or whole plant used to compare against transgenic or genetically modified plant for the purpose of identifying an enhanced phenotype in the transgenic or genetically modified plant.
  • a control plant may in some cases be a transgenic plant line that comprises an empty vector or marker gene, but does not contain the recombinant polynucleotide of the present disclosure that is expressed in the transgenic or genetically modified plant being evaluated.
  • a control plant may in other cases be a progeny of a hemizygous transgenic plant line that does not contain the recombinant DNA, known as a negative segregant or negative isoline.
  • a control plant is a plant of the same line or variety as the transgenic or genetically modified plant being tested.
  • a suitable control plant would include a genetically unaltered or non-transgenic plant of the parental line used to generate a transgenic plant herein.
  • a "transgenic plant” refers to a plant that contains genetic material not found in a wild-type plant of the same species, variety or cultivar.
  • the genetic material may include a transgene, an insertional mutagenesis event (such as by transposon or T-DNA insertional mutagenesis), an activation tagging sequence, a mutated sequence, a homologous recombination event or a sequence modified by chimeraplasty.
  • the foreign genetic material has been introduced into the plant by human manipulation, but any method can be used as one of skill in the art recognizes.
  • a transgenic plant may contain an expression vector or cassette.
  • the expression cassette typically comprises a polypeptide-encoding or polypeptide-suppressing sequence operably linked to (i.e., under regulatory control of) appropriate inducible, tissue-enhanced, tissue-specific, diurnally regulated or constitutive regulatory sequences that allow for the controlled expression of the polypeptide.
  • the expression cassette can be introduced into a plant by transformation or by breeding after transformation of a parent plant.
  • a plant refers to a whole plant as well as to a plant part, such as seed, fruit, leaf, or root, plant tissue, plant cells or any other plant material, e.g., a plant explant, as well as to progeny thereof, and to in vitro systems that mimic biochemical or cellular components or processes in a cell.
  • a constitutive promoter is active under most environmental conditions and in most plant parts.
  • Tissue-enhanced also referred to as tissue -preferred
  • tissue-specific also referred to as tissue -preferred
  • cell type-specific and inducible promoters constitute non-constitutive promoters.
  • Promoters under developmental control include promoters that preferentially initiate transcription in certain tissues, such as xylem, leaves, roots, or seeds. Such promoters are examples of tissue-enhanced or tissue-preferred promoters (see US patent 7,365, 186).
  • Tissue-enhanced promoters can be found upstream and operatively linked to DNA sequences normally transcribed in higher levels in certain plant tissues or specifically in certain plant tissues, respectively.
  • Cell-enhanced tissue-enhanced
  • tissue-specific regulation thus refer to the control of gene or protein expression, for example, by a promoter, which drives expression that is not necessarily totally restricted to a single type of cell or tissue, but where expression is elevated in particular cells or tissues to a greater extent than in other cells or tissues within the organism, and in the case of tissue-specific regulation, in a manner that is primarily elevated in a specific tissue.
  • Tissue-enhanced or preferred promoters have been described in, for example, US Patent No. 7,365,186, or US Patent No. 7,619, 133.
  • a “condition-enhanced” promoter refers to a promoter that activates a gene in response to a particular environmental stimulus, for example, an abiotic stress, infection caused by a pathogen, light treatment, chemical stimulus, etc., and that drives expression in a unique pattern which may include expression in specific cell and/or tissue types within the organism (as opposed to a constitutive expression pattern in all cell types of an organism at all times).
  • a "diurnal promoter” is useful for regulating changes in the timing of gene expression to a specific time of day. Usually genes that are diurnally-regulated peak at the same time in the day/night cycle. Genes that are under the regulation of diurnal promoters exhibit altered expression profiles under the control of a circadian oscillator mostly during the switch time of light to dark but also with diurnal oscillations that persist within a period close to 24 hour day/night cycle. Diurnal regulation is subject to environmental inputs such as light and temperature and the coordination by the circadian clock.
  • Wild type or wild-type, as used herein, refers to a plant cell, seed, plant component, plant part, plant tissue, plant organ or whole plant that has not been genetically modified or treated in an experimental sense. Wild-type cells, seeds, components, parts, tissues, organs or whole plants may be used as controls to compare levels of expression and the extent and nature of trait modification with cells, tissue or plants of the same species in which a polypeptide's expression is altered, e.g., in that it has been knocked out, overexpressed, or ectopically expressed.
  • a “trait” refers to a physiological, morphological, biochemical, or physical characteristic of a plant or particular plant material or cell. In some instances, this characteristic is visible to the human eye, such as seed or plant size, or can be measured by biochemical techniques, such as detecting the protein, starch, or oil content of seed or leaves, or by observation of a metabolic or physiological process, e.g. by measuring tolerance to water deprivation or particular salt or sugar concentrations, or by the observation of the expression level of a gene or genes, e.g., by employing Northern analysis, RT-PCR, microarray gene expression assays, or reporter gene expression systems, or by agricultural observations such as hyperosmotic stress tolerance or yield. Any technique can be used to measure the amount of, comparative level of, or difference in any selected chemical compound or macromolecule in the transgenic plants, however.
  • Trait modification refers to a detectable difference in a characteristic in a plant ectopically expressing a polynucleotide or polypeptide of the present disclosure relative to a plant not doing so, such as a wild-type plant.
  • the trait modification can be evaluated quantitatively.
  • the trait modification can entail at least about a 2% increase or decrease, or an even greater difference, in an observed trait as compared with a control or wild-type plant. It is known that there can be natural variations in the modified trait. Therefore, the trait modification observed entails a change of the normal distribution and magnitude of the trait in the plants as compared to control or wild-type plants.
  • the plants When two or more plants have “similar morphologies”, “substantially similar morphologies”, “a morphology that is substantially similar”, or are “morphologically similar”, the plants have comparable forms or appearances, including analogous features such as overall dimensions, height, width, mass, root mass, shape, glossiness, leaf color, stem diameter, leaf size, leaf dimension, leaf density, internode distance or length, branching, root branching, number and form of inflorescences, and other macroscopic characteristics, and the individual plants are not readily distinguishable based on morphological characteristics alone.
  • Modulates refers to a change in activity (biological, chemical, or immunological) or lifespan resulting from specific binding between a molecule and either a nucleic acid molecule or a protein.
  • transcript profile refers to the expression levels of a set of genes in a cell in a particular state, particularly by comparison with the expression levels of that same set of genes in a cell of the same type in a reference state. For example, the expression level of a set of genes in a cell in which a particular polypeptide is overexpressed or suppressed can be compared to the expression level of the same set of genes in a cell that has normal levels of that polypeptide.
  • the transcript profile can be presented as a list of those genes whose expression level is significantly different between the two treatments, and the difference ratios. Differences and similarities between expression levels may also be evaluated and calculated using statistical and clustering methods.
  • knockout refers to a plant, plant cell, or plant tissue having a disruption in at least one gene, where the disruption results in a reduced or abolished expression or activity of the polypeptide encoded by that gene compared to a control plant, cell, or tissue.
  • a knockout or suppression can occur in different ways, including but not limited to: decreasing levels of a protein; suppressing a mutation that has resulted in decreased activity of a protein; suppressing the production of an inhibitory agent; elevating, reducing or eliminating the level of substrate that an enzyme requires for activity; producing a new protein; and activating a normally silent gene, to accumulate a product that does not normally increase under natural conditions.
  • the suppressor can be another mutation on a different gene, a suppressor mutation on the same gene but located some distance from the first mutation, or a suppressor in the cytoplasm that has generated due to a change in non-chromosomal DNA.
  • the knockout can be the result of, for example, genomic disruptions, including transposons, tilling, and homologous recombination, antisense constructs, sense constructs, RNA silencing constructs, or RNA interference.
  • a T-DNA insertion within a gene is an example of a genotypic alteration that may abolish expression of that gene.
  • a recombinant expression cassette can be made.
  • the recombinant cassette can comprise a promoter that is functional in a plant cell and that is operably-linked to a polynucleotide that when expressed in a plant cell is transcribed into a polynucleotide molecule that suppresses the level of an endogenous protein in the plant cell relative to a control.
  • the polynucleotide molecule can be, for example, a dsRNA that is processed into siRNAs that targets a messenger RNA encoding the protein; a miRNA that targets a messenger RNA encoding the protein; a trans-acting small interfering RNA (ta- siRNA) that is processed into siRNAs and that targets a messenger RNA encoding the protein; and a cleavage blocker of a miRNA or a miRNA decoy of a miRNA, which both lead to decreased activity of a miRNA.
  • ta- siRNA trans-acting small interfering RNA
  • Ectopic expression or altered expression in reference to a polynucleotide indicates that the pattern of expression in, e.g., a transgenic plant or plant tissue, is different from the expression pattern in a wild-type plant or plant tissue or a reference plant or plant tissue of the same species.
  • a polynucleotide or polypeptide is expressed in a cell or tissue type other than a cell or tissue type in which the sequence is expressed in the wild-type plant, or by expression at a time other than at the time the sequence is expressed in the wild-type plant, or by a response to different inducible agents, such as hormones or environmental signals, or at different expression levels (either higher or lower) compared with those found in a wild-type plant.
  • the term also refers to altered expression patterns that are produced by lowering the levels of expression to below the detection level or completely abolishing expression.
  • the resulting expression pattern can be transient or stable, constitutive or inducible.
  • the term "ectopic expression or altered expression” further may relate to altered activity levels resulting from the interactions of the polypeptides with exogenous or endogenous modulators or from interactions with factors or as a result of the chemical modification of the polypeptides.
  • overexpression refers to a greater expression level of a gene in a plant, plant cell or plant tissue, compared to expression in a wild-type plant, cell or tissue, at any developmental or temporal stage for the gene. Overexpression can occur when, for example, the genes encoding one or more polypeptides are under the control of a strong promoter (e.g., the cauliflower mosaic virus 35S transcription initiation region). Overexpression may also be under the control of a heterologous promoter, or an inducible or tissue specific promoter. Thus, overexpression may occur throughout a plant, in specific tissues of the plant, or in the presence or absence of particular environmental signals, depending on the promoter used.
  • a strong promoter e.g., the cauliflower mosaic virus 35S transcription initiation region
  • Overexpression may also be under the control of a heterologous promoter, or an inducible or tissue specific promoter. Thus, overexpression may occur throughout a plant, in specific tissues of the plant, or in the presence or absence of particular environmental signals, depending on the promoter used.
  • Overexpression may take place in plant cells normally lacking expression of polypeptides functionally equivalent or identical to the present polypeptides. Overexpression may also occur in plant cells where endogenous expression of the present polypeptides or functionally equivalent molecules normally occurs, but such normal expression is at a lower level. Overexpression thus results in a greater than normal production, or "overproduction" of the polypeptide in the plant, cell or tissue.
  • transcription regulating region refers to a DNA regulatory sequence that regulates the expression of one or more genes in a plant with a transcriptional regulator having one or more specific binding domains that binds to a DNA regulatory sequence.
  • Transcriptional regulators possess a conserved domain.
  • the transcriptional regulators also comprise an amino acid subsequence that forms a transcription activation domain that regulates expression of one or more abiotic stress tolerance genes in a plant when the transcriptional regulator binds to the regulating region.
  • “Increased yield” or “improved yield” or “increased plant yield” refers to increased plant growth, increased crop growth, increased biomass, increased grain yield, and/or increased plant product production, and is dependent to some extent on temperature, plant size, organ size, planting density, light, water and nutrient availability, and how the plant copes with various stresses, such as through temperature acclimation and water or nutrient use efficiency.
  • Plant density refers to the number of plants that can be grown per acre. For crop species, planting or population density varies from crop to crop, from one growing region to another, and from year to year. Using corn as an example, the average prevailing density in 2000 was in the range of 20,000 - 25,000 plants per acre in Missouri, USA. A desirable higher population density (a measure of yield) would be at least 22,000 plants per acre, and a more desirable higher population density would be at least 28,000 plants per acre, more preferably at least 34,000 plants per acre, and even more preferably at least 40,000 plants per acre.
  • the average prevailing densities per acre of a few other examples of crop plants in the USA in the year 2000 were: wheat 1,000,000-1,500,000; rice 650,000-900,000; soybean 150,000- 200,000, canola 260,000-350,000, sunflower 17,000-23,000 and cotton 28,000-55,000 plants per acre (Cheikh et al., 2003, in U.S. Patent Application No. 20030101479).
  • a desirable higher population density for each of these examples, as well as other valuable species of plants, would be at least 10% higher than the average prevailing density or yield.
  • a transcriptional regulator may include, but is not limited to, any polypeptide that can activate or repress transcription of a single gene or a number of genes.
  • transcriptional regulators can be identified by the presence of a region or domain of structural similarity or identity to a specific consensus sequence or the presence of a specific consensus DNA-binding motif (see, for example, Riechmann et al., 2000a).
  • the plant transcriptional regulators of the present disclosure belong to the B-box zinc finger family (Putterill et al., 1995) and are putative transcriptional regulators.
  • transcriptional regulators are involved in cell differentiation and proliferation and the regulation of growth. Accordingly, one skilled in the art would recognize that by expressing the present sequences in a plant, one may change the expression of autologous genes or induce the expression of introduced genes. By affecting the expression of similar autologous sequences in a plant that have the biological activity of the present sequences, or by introducing the present sequences into a plant, one may alter a plant's phenotype to one with improved traits related to osmotic stresses.
  • the disclosed sequences may also be used to transform a plant and introduce desirable traits not found in the wild-type cultivar or strain. Plants may then be selected for those that produce the most desirable degree of over- or under - expression of target genes of interest and coincident trait improvement.
  • sequences of the present disclosure and closely related orthologous or paralogous sequences may be from any species, particularly plant species, in a naturally occurring form or from any source whether natural, synthetic, semi-synthetic or recombinant.
  • the disclosed sequences may also include fragments of the present amino acid sequences.
  • amino acid sequence is recited to refer to an amino acid sequence of a naturally occurring protein molecule, "amino acid sequence” and like terms are not meant to limit the amino acid sequence to the complete native amino acid sequence associated with the recited protein molecule.
  • the disclosed polynucleotides and polypeptides have a variety of additional uses. These uses include their use in the recombinant production (i.e., expression) of proteins; as regulators of plant gene expression, as diagnostic probes for the presence of complementary or partially complementary nucleic acids (including for detection of natural coding nucleic acids); as substrates for further reactions, e.g., mutation reactions, PCR reactions, or the like; as substrates for cloning e.g., including digestion or ligation reactions; and for identifying exogenous or endogenous modulators of the transcriptional regulators.
  • the polynucleotide can be, e.g., genomic DNA or RNA, a transcript (such as an mRNA), a cDNA, a PCR product, a cloned DNA, a synthetic DNA or RNA, or the like.
  • the polynucleotide can comprise a sequence in either sense or antisense orientations.
  • transgenic plants comprising isolated polynucleotides encoding transcriptional regulators may also modify expression of endogenous genes, polynucleotides, and proteins. Examples include Peng et al., 1997, and Peng et al., 1999). In addition, many others have demonstrated that an Arabidopsis transcriptional regulator expressed in an exogenous plant species elicits the same or very similar phenotypic response. See, for example, Fu et al., 2001 ; Nandi et al., 2000; Coupland, 1995; and Weigel and Nilsson, 1995).
  • Mandel et al., 1992b, and Suzuki et al., 2001 teach that a transcriptional regulator expressed in another plant species elicits the same or very similar phenotypic response of the endogenous sequence, as often predicted in earlier studies of Arabidopsis transcriptional regulators in Arabidopsis (see Mandel et al., 1992a; Suzuki et al., 2001).
  • Other examples include Miiller et al., 2001 ; Kim et al., 2001 ; Kyozuka and Shimamoto, 2002; Boss and Thomas, 2002; He et al., 2000; and Robson et al., 2001).
  • CBF1 which, when overexpressed in transgenic plants, increased plant freezing tolerance.
  • Jaglo et al., 2001 further identified sequences in Brassica napus which encode CBF-like genes and showed that transcripts for these genes accumulated rapidly in response to low temperature. Transcripts encoding CBF-like proteins were also found to accumulate rapidly in response to low temperature in wheat, as well as in tomato.
  • An alignment of the CBF proteins from Arabidopsis, B. napus, wheat, rye, and tomato revealed the presence of conserved consecutive amino acid residues which bracket the AP2/EREBP DNA binding domains of the proteins and distinguish them from other members of the AP2 EREBP protein family (Jaglo et al., 2001).
  • Transcriptional regulators mediate cellular responses and control traits through altered expression of genes containing cis-acting nucleotide sequences that are targets of the introduced transcriptional regulator. It is well appreciated in the art that the effect of a transcriptional regulator on cellular responses or a cellular trait is determined by the particular genes whose expression is either directly or indirectly (e.g., by a cascade of transcriptional regulator binding events and transcriptional changes) altered by transcriptional regulator binding. In a global analysis of transcription comparing a standard condition with one in which a transcriptional regulator is overexpressed, the resulting transcript profile associated with transcriptional regulator overexpression is related to the trait or cellular process controlled by that transcriptional regulator.
  • the PAP2 gene and other genes in the MYB family have been shown to control anthocyanin biosynthesis through regulation of the expression of genes known to be involved in the anthocyanin biosynthetic pathway (Bruce et al., 2000; and Borevitz et al., 2000).
  • the present disclosure includes putative transcriptional regulators, and isolated or recombinant polynucleotides encoding the polypeptides, or novel sequence variant polypeptides or polynucleotides encoding novel variants of polypeptides derived from the specific sequences provided in the Sequence Listing; the disclosed recombinant polynucleotides may be incorporated in expression vectors for the purpose of producing transformed plants. Also provided are methods for modifying yield from a plant by modifying the mass, size or number of plant organs or seed of a plant by controlling a number of cellular processes, and for increasing a plant's resistance to abiotic stresses. These methods are based on the ability to alter the expression of critical regulatory molecules that may be conserved between diverse plant species. Related conserved regulatory molecules may be originally discovered in a model system such as Arabidopsis and homologous, functional molecules then discovered in other plant species. The latter may then be used to confer increased yield or abiotic stress tolerance in diverse plant species.
  • Exemplary polynucleotides encoding the polypeptides provided in Table 1 and Table 2 were identified in the Arabidopsis thaliana GenBank database using publicly available sequence analysis programs and parameters, and an in-house proprietary database. Sequences initially identified were then further characterized to identify sequences comprising specified sequence strings corresponding to sequence motifs present in families of known polypeptides. Additional disclosed polynucleotides were identified by screening Arabidopsis thaliana and/or other plant cDNA libraries with probes
  • polynucleotides and polypeptides can be used to improve desirable characteristics of plants.
  • the disclosed polynucleotides were also ectopically expressed in overexpressor plant cells and the changes in the expression levels of a number of genes, polynucleotides, and/or proteins of the plant cells observed. Therefore, the polynucleotides and polypeptides can be used to change expression levels of genes, polynucleotides, and/or proteins of plants or plant cells.
  • the instant disclosure provides a novel method involving new gene technologies to improve plant yield. It is expected that either individually or in a combination with other genes or promoters, these novel methods will provide significantly higher improvements compared to previous methods.
  • Plants have evolved to sense the direction, color, intensity and duration of the incumbent light signals. Plants use this information to redirect their growth and developmental processes to optimize light absorption by promoting elongation growth under low light.
  • Several genes have been implicated in playing roles in light signaling mechanisms regulating plant growth and development. Here, light responsiveness of young seedlings overexpressing some of the individual B-box genes to determine their roles in light signaling was examined. There is precedent that suppressing light signaling leads to crop improvement (US Patent No. 7,692,067).
  • the instant disclosure identifies several Arabidopsis thaliana B-box genes which can function negatively in light signaling and it is expected that either independently or in combination with other genes (such as with AtBBX32, GmBBX52 or GmBBX53) or specific promoters, these polynucleotides and their encoded polypeptides will provide significantly improved yield benefits and resistance to abiotic stress. It is also expected that these polynucleotides and their encoded polypeptides will provide plants with altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence (International Application No.
  • the instant disclosure also identifies several Glycine max B-box genes. Some of the encoded polypeptides of these Glycine max genes may interact with AtBBX32, or may be overexpressed or suppressed, in transgenic soybean plants overexpressing AtBBX32. Some of the encoded polypeptides of these Glycine max genes may interact with GmBBX52 in transgenic soybean plants overexpressing GmBBX52.
  • AtBBX32 and its soybean homologs modulates a variety of traits including yield
  • GmBBX52 and GmBBX53 modulates a variety of traits including yield
  • BBX32 is a B-box zinc finger protein with homology to the CONSTANS family of
  • BBX32 transcriptional regulators. BBX32 is expressed in many tissues and may be diurnally regulated.
  • constitutive expression of BBX32 in Arabidopsis modulates plant growth processes, including elongation of hypocotyls, extended petioles and upheld leaves, early flowering; enhanced root and/or shoot growth in phosphate-limited media; more secondary roots on control media, enhanced growth and reduced anthocyanin in low nitrogen high sucrose media supplemented with glutamine, enhanced root growth on salt-containing media, and enhanced root growth on polyethylene glycol-containing media, as compared to control plants.
  • BBX32 overexpression in soybean plants has been shown to result in a statistically significant increase in yield in field trials (see US Patent No. 7,692,067) as compared to controls that do not contain the BBX32 polynucleotide.
  • BBX32 in Arabidopsis produced several phenotypes consistent with a role of this gene in light regulated development and possibly diurnal or circadian regulated processes.
  • Light exerts a major influence in the initiation and maintenance (resetting) of the plant circadian processes.
  • Early seedling development is light dependent (de-etiolation) and is marked by inhibition of hypocotyl cell elongation along with cotyledon expansion and greening.
  • Light controls morphological changes throughout the life of the plant, either directly or by regulating circadian gene expression. Some of these changes include petiole development, control of growth rate and flowering. It is likely that the ectopic expression of BBX32 product affects light signaling and/or circadian processes.
  • BBX32 is involved in photomorphogenesis and regulating plant growth and development. Hence, its overexpression may improve plant vigor, thus explaining the yield enhancements seen in 35S: :BBX32 soybean plants.
  • AtBBX25 (G1894) clade (clade identifier G1894):
  • Os/Os04g41560 48.1% to 5-42 a CDACEAAAATVVCCA 270 82% .2 G1894 DEAALCARCDVEIHA (31/38)
  • Gm/Glymal3g4 58.1% to 5-42 a CDVCERAPATVICCAD 278 95% 1980.1 G1894 EAALCAKCDVEVHAA (36/38) NKLASKH
  • AtBBX20 (G1888) clade (clade identifier G1888):
  • Os/Os04g45690 37.7% to 5-42 a CDVCAAEAASVFCCA 308 79% .1 G1888 DEAALCDACDRRVHS (30/38)
  • AtBBX26 (G1486) clade (clade identifier G1486):
  • AtBBX30 (G1478) or AtBBX31 (G1929) clade (clade identifier G1478):
  • AtBBX7 (G2440) or AtBBX8 (G1479) clade (clade identifier G2440):
  • AtBBX19 (G902) or AtBBX18 (G1881) clade (clade identifier G902):
  • Table 1 At - Arabidopsis thaliana; Gm - Glycine max; Os - Oryza sativa; Pt - Populus trichocarpa; SI - Solarium lycopersicum; Zm - Zea mays.
  • Exemplary polynucleotides encoding the polypeptides of soybean B-box proteins (GmBBX) as represented in Table 2 were identified from yeast two hybrid screens and from phylogenetic analysis.
  • Homologous sequences as described above can comprise orthologous or paralogous sequences.
  • Several different methods are known by those of skill in the art for identifying and defining these functionally homologous sequences.
  • General methods for identifying orthologs and paralogs, including phylogenetic methods, sequence similarity and hybridization methods, are described herein; an ortholog or paralog, including equivalogs, may be identified by one or more of the methods described below.
  • gene duplication may cause two copies of a particular gene, giving rise to two or more genes with similar sequence and often similar function known as paralogs.
  • a paralog is therefore a similar gene formed by duplication within the same species.
  • Paralogs typically cluster together or in the same clade (a group of similar genes) when a gene family phylogeny is analyzed using programs such as CLUSTAL (Thompson et al., 1994; Higgins et al., 1996). Groups of similar genes can also be identified with pair-wise BLAST analysis (Feng and Doolittle, 1987).
  • a clade of very similar MADS domain transcriptional regulators from Arabidopsis all share a common function in flowering time (Ratcliffe et al., 2001), and a group of very similar AP2 domain transcriptional regulators from Arabidopsis are involved in tolerance of plants to freezing (Gilmour et al., 1998).
  • Analysis of groups of similar genes with similar function that fall within one clade can yield sub-sequences that are particular to the clade.
  • consensus sequences can not only be used to define the sequences within each clade, but define the functions of these genes; genes within a clade may contain paralogous sequences, or orthologous sequences that share the same function (see also, for example, Mount, 2001).
  • Transcriptional regulator gene sequences are conserved across diverse eukaryotic species lines (Goodrich et al., 1993; Lin et al., 1991 ; Sadowski et al., 1988). Plants are no exception to this observation; diverse plant species possess transcriptional regulators that have similar sequences and functions. Speciation, the production of new species from a parental species, gives rise to two or more genes with similar sequence and similar function. These genes, termed orthologs, often have an identical function within their host plants and are often interchangeable between species without losing function. Because plants have common ancestors, many genes in any plant species will have a corresponding orthologous gene in another plant species.
  • orthologous sequences can be placed into the phylogenetic tree and their relationship to genes from the species of interest can be determined. Orthologous sequences can also be identified by a reciprocal BLAST strategy. Once an orthologous sequence has been identified, the function of the ortholog can be deduced from the identified function of the reference sequence.
  • transcriptional regulators including:
  • AP2 family Arabidopsis G47 (found in US Patent No. 7, 135,616), a phylogenetically-related sequence from soybean, and two phylogenetically-related homologs from rice all can confer greater tolerance to drought, hyperosmotic stress, or delayed flowering as compared to control plants;
  • CAAT family Arabidopsis G481 (found in PCT patent publication WO2004076638), and numerous phylogenetically-related sequences from dicots and monocots can confer greater tolerance to drought-related stress as compared to control plants;
  • polypeptides that are phylogenetically related to disclosed polypeptides may have conserved domains that share at least 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or about 100% amino acid sequence identity to the listed sequences, for example, SEQ ID NOs: 235-427, and have similar functions in that the disclosed and closely related polypeptides may, when overexpressed, confer at least one trait selected from the group consisting
  • sequences that are closely related to the disclosed polynucleotide sequences will typically share at least about 30% or at least 40%, at least 41 %, at least 42%, at least 43%, at least 44%, at least 45%, at least 46%, at least 47%, at least 48%, or at least 49% nucleotide sequence identity, preferably at least about 50%, at least 51 %, at least 52%, at least 53%, at least 54%, at least 55%, at least 56%, at least 57%, at least 58%, or at least 59% nucleotide sequence identity, or at least 60%, or at least 61%, or at least 62%, or at least 63%, or at least 64%, or at least 65%, or at least 66%, or at least 67%, or at least 68%, or at least 69%, or at least 70%, or at least 71%, or at least 72%, or at least 73%, or at least 74%, or at least 75%, or at least 76%, or
  • the degeneracy of the genetic code enables major variations in the nucleotide sequence of a polynucleotide while maintaining the amino acid sequence of the encoded protein.
  • Polynucleotides that encode polypeptides that are closely-related, that is, orthologous or paralogous, to the disclosed polypeptide sequences will be identifiable by having at least any of the percentage identities provided in this paragraph.
  • sequences that are closely related to the disclosed polypeptide sequences will typically share at least about 30% or at least 40%, at least 41 %, at least 42%, at least 43%, at least 44%, at least 45%, at least 46%, at least 47%, at least 48%, or at least 49% amino acid sequence identity, preferably at least about 50%, at least 51%, at least 52%, at least 53%, at least 54%, at least 55%, at least 56%, at least 57%, at least 58%, or at least 59% nucleotide sequence identity, or at least 60%, or at least 61%, or at least 62%, or at least 63%, or at least 64%, or at least 65%, or at least 66%, or at least 67%, or at least 68%, or at least 69%, or at least 70%, or at least 71%, or at least 72%, or at least 73%, or at least 74%, or at least 75%, or at least 76%, or at least 77%, or at least 78%
  • Polypeptides, or their domains, that are closely-related, that is, orthologous or paralogous, to the disclosed polypeptide sequences, or their domains, will be identifiable by having at least any of the percentage identities provided in this paragraph.
  • Percent identity can be determined electronically, e.g., by using the MEGALIGN program (DNASTAR, Inc. Madison, Wis.).
  • the MEGALIGN program can create alignments between two or more sequences according to different methods, for example, the clustal method (see, for example, Higgins and Sharp, 1988).
  • the clustal algorithm groups sequences into clusters by examining the distances between all pairs. The clusters are aligned pairwise and then in groups.
  • Other alignment algorithms or programs may be used, including FASTA, BLAST, or ENTREZ, FASTA and BLAST, and which may be used to calculate percent similarity. These are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, WI), and can be used with or without default settings.
  • the percent identity of two sequences can be determined by the GCG program with a gap weight of 1, e.g., each amino acid gap is weighted as if it were a single amino acid or nucleotide mismatch between the two sequences (see USPN 6,262,333).
  • HSPs high scoring sequence pairs
  • Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
  • M forward score for a pair of matching residues; always > 0
  • N penalty score for mismatching residues; always ⁇ 0.
  • a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • W wordlength
  • E expectation
  • the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, 1989).
  • sequence identity refers to the % sequence identity generated from a tBlastx using the NCBI version of the algorithm at the default settings using gapped alignments with the filter "off (see, for example, internet website at www.ncbi.nlm.nih.gov/).
  • an alignment program that permits gaps in the sequence is utilized to align the sequences.
  • the Smith-Waterman is one type of algorithm that permits gaps in sequence alignments (see Shpaer, 1997).
  • the GAP program using the Needleman and Wunsch alignment method can be utilized to align sequences.
  • An alternative search strategy uses MPSRCH software, which runs on a MASPAR computer.
  • MPSRCH uses a Smith- Waterman algorithm to score sequences on a massively parallel computer. This approach improves ability to pick up distantly related matches, and is especially tolerant of small gaps and nucleotide sequence errors.
  • Nucleic acid-encoded amino acid sequences can be used to search both protein and DNA databases.
  • the percentage similarity between two polypeptide sequences is calculated by dividing the length of sequence A, minus the number of gap residues in sequence A, minus the number of gap residues in sequence B, into the sum of the residue matches between sequence A and sequence B, times one hundred. Gaps of low or of no similarity between the two amino acid sequences are not included in determining percentage similarity. Percent identity between polynucleotide sequences can also be counted or calculated by other methods known in the art, e.g., the Jotun Hein method (see, for example, Hein, 1990). Identity between sequences can also be determined by other methods known in the art, e.g., by varying hybridization conditions (see US Patent Application No. 20010010913).
  • the present disclosure provides methods for identifying a sequence similar or paralogous or orthologous or homologous to one or more polynucleotides as noted herein, or one or more target polypeptides encoded by the polynucleotides, or otherwise noted herein and may include linking or associating a given plant phenotype or gene function with a sequence.
  • a sequence database is provided (locally or across an internet or intranet) and a query is made against the sequence database using the relevant sequences herein and associated plant phenotypes or gene functions.
  • polynucleotide sequences or one or more polypeptides encoded by the polynucleotide sequences may be used to search against a BLOCKS (Bairoch et al., 1997), PFAM, and other databases which contain previously identified and annotated motifs, sequences and gene functions.
  • a further method for identifying or confirming that specific homologous sequences control the same function is by comparison of the transcript profile(s) obtained upon overexpression or knockout of two or more related polypeptides.
  • transcript profiles are diagnostic for specific cellular states, one skilled in the art will appreciate that genes that have a highly similar transcript profile (e.g., with greater than 50% regulated transcripts in common, or with greater than 70% regulated transcripts in common, or with greater than 90% regulated transcripts in common) will have highly similar functions.
  • Fowler and Thomashow, 2002 have shown that three paralogous AP2 family genes (CBF1, CBF2 and CBF3) are induced upon cold treatment, and each of which can condition improved freezing tolerance, and all have highly similar transcript profiles.
  • methods using manual alignment of sequences similar or homologous to one or more polynucleotide sequences or one or more polypeptides encoded by the polynucleotide sequences may be used to identify regions of similarity and B-box zinc finger domains.
  • Such manual methods are well-known of those of skill in the art and can include, for example, comparisons of tertiary structure between a polypeptide sequence encoded by a polynucleotide that comprises a known function and a polypeptide sequence encoded by a polynucleotide sequence that has a function not yet determined.
  • Such examples of tertiary structure may comprise predicted alpha helices, beta-sheets, amphipathic helices, leucine zipper motifs, zinc finger motifs, proline-rich regions, cysteine repeat motifs, and the like.
  • Orthologs and paralogs of presently disclosed polypeptides may be cloned using compositions provided by the present disclosure according to methods well known in the art.
  • cDNAs can be cloned using mRNA from a plant cell or tissue that expresses one of the present sequences. Appropriate mRNA sources may be identified by interrogating Northern blots with probes designed from the present sequences, after which a library is prepared from the mRNA obtained from a positive cell or tissue.
  • Polypeptide-encoding cDNA is then isolated using, for example, PCR, using primers designed from a presently disclosed gene sequence, or by probing with a partial or complete cDNA or with one or more sets of degenerate probes based on the disclosed sequences.
  • the cDNA library may be used to transform plant cells. Expression of the cDNAs of interest is detected using, for example, microarrays, Northern blots, quantitative PCR, or any other technique for monitoring changes in expression. Genomic clones may be isolated using similar techniques to those.
  • orthologs of the Arabidopsis polypeptide sequences and their functionally similar orthologs are listed in Tables 1 and 2 and in the Sequence Listing.
  • the present disclosure encompasses isolated nucleotide sequences that are phylogenetically and structurally similar to sequences listed in the Sequence Listing and can function in a plant by increasing yield and/or and abiotic stress tolerance when ectopically expressed in a plant.
  • Polynucleotides homologous to the sequences illustrated in the Sequence Listing and tables can be identified, e.g., by hybridization to each other under stringent or under highly stringent conditions.
  • Polynucleotides that encode polypeptides that are closely -related, that is, orthologous or paralogous, to the disclosed polypeptide sequences may be identifiable by their ability to hybridize to the disclosed polynucleotides under high stringency conditions, including the high stringency conditions provided herein.
  • Single stranded polynucleotides hybridize when they associate based on a variety of well characterized physical-chemical forces, such as hydrogen bonding, solvent exclusion, base stacking and the like.
  • the stringency of hybridization reflects the degree of sequence identity of the nucleic acids involved, such that the higher the stringency, the more similar are the two polynucleotide strands. Stringency is influenced by a variety of factors, including temperature, salt concentration and composition, organic and non-organic additives, solvents, etc. present in both the hybridization and wash solutions and incubations (and number thereof), as described in more detail in the references cited below (e.g., Sambrook et al., 1989; Berger and Kimmel, 1987; and Anderson and Young, 1985).
  • polynucleotide sequences that are capable of hybridizing to the claimed polynucleotide sequences, including any of the polynucleotides within the
  • T m The melting temperature
  • T m (° C) 79.8+18.5(log [Na+])+0.58(% G+Q+ 0.12(%G+C) 2 - 0.35(% formamide) - 820/L
  • L is the length of the duplex formed
  • [Na+] is the molar concentration of the sodium ion in the hybridization or washing solution
  • % G+C is the percentage of (guanine+cytosine) bases in the hybrid.
  • approximately 1° C is required to reduce the melting temperature for each 1 % mismatch.
  • Hybridization experiments are generally conducted in a buffer of pH between 6.8 to 7.4, although the rate of hybridization is nearly independent of pH at ionic strengths likely to be used in the hybridization buffer (Anderson and Young, 1985).
  • one or more of the following may be used to reduce non-specific hybridization: sonicated salmon sperm DNA or another non-complementary DNA, bovine serum albumin, sodium pyrophosphate, sodium dodecylsulfate (SDS), polyvinyl-pyrrolidone, ficoll and Denhardt's solution.
  • Dextran sulfate and polyethylene glycol 6000 act to exclude DNA from solution, thus raising the effective probe DNA concentration and the hybridization signal within a given unit of time.
  • conditions of even greater stringency may be desirable or required to reduce non-specific and/or background hybridization. These conditions may be created with the use of higher temperature, lower ionic strength and higher concentration of a denaturing agent such as formamide.
  • Stringency conditions can be adjusted to screen for moderately similar fragments such as homologous sequences from distantly related organisms, or to highly similar fragments such as genes that duplicate functional enzymes from closely related organisms.
  • the stringency can be adjusted either during the hybridization step or in the post-hybridization washes.
  • Salt concentration, formamide concentration, hybridization temperature and probe lengths are variables that can be used to alter stringency (as described by the formula above). As a general guidelines high stringency is typically performed at T m -5°C to T m -20° C, moderate stringency at T m -20°C to T m -35° C and low stringency at T m - 35°C to T m -50°C for duplex >150 base pairs.
  • Hybridization may be performed at low to moderate stringency (25-50°C below T m ), followed by post-hybridization washes at increasing stringencies.
  • Maximum rates of hybridization in solution are determined empirically to occur at T m -25°C for DNA- DNA duplex and T m -15°C for RNA-DNA duplex.
  • the degree of dissociation may be assessed after each wash step to determine the need for subsequent, higher stringency wash steps.
  • High stringency conditions may be used to select for nucleic acid sequences with high degrees of identity to the disclosed sequences.
  • An example of stringent hybridization conditions obtained in a filter- based method such as a Southern or Northern blot for hybridization of complementary nucleic acids that have more than 100 complementary residues is about 5°C to 20°C lower than the thermal melting point (T m ) for the specific sequence at a defined ionic strength and pH.
  • Conditions used for hybridization may include about 0.02 M to about 0.15 M sodium chloride, about 0.5% to about 5% casein, about 0.02% SDS or about 0.1% N-laurylsarcosine, about 0.001 M to about 0.03 M sodium citrate, at hybridization temperatures between about 50° C and about 70° C.
  • high stringency conditions are about 0.02 M sodium chloride, about 0.5% casein, about 0.02% SDS, about 0.001 M sodium citrate, at a temperature of about 50°C.
  • Nucleic acid molecules that hybridize under stringent conditions will typically hybridize to a probe based on either the entire DNA molecule or selected portions, e.g., to a unique subsequence, of the DNA.
  • Stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate. Increasingly stringent conditions may be obtained with less than about 500 mM NaCl and 50 mM trisodium citrate, to even greater stringency with less than about 250 mM NaCl and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, whereas high stringency hybridization may be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37°C, and most preferably of at least about 42°C with formamide present. Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS) and ionic strength, are well known to those skilled in the art. Various levels of stringency are accomplished by combining these various conditions as needed.
  • SDS sodium dodecyl sulfate
  • washing steps that follow hybridization may also vary in stringency; the post-hybridization wash steps primarily determine hybridization specificity, with the most critical factors being temperature and the ionic strength of the final wash solution. Wash stringency can be increased by decreasing salt concentration or by increasing temperature. Stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
  • hybridization and wash conditions that may be used to bind and remove polynucleotides with less than the desired homology to the nucleic acid sequences or their complements that encode the present polypeptides include, for example: 6X SSC at 65° C;
  • wash steps of even greater stringency, including about 0.2x SSC, 0.1% SDS at 65°C and washing twice, each wash step being about 30 minutes, or about 0.1 x SSC, 0.1% SDS at 65°C and washing twice for 30 minutes.
  • the temperature for the wash solutions will ordinarily be at least about 25° C, and for greater stringency at least about 42° C.
  • Hybridization stringency may be increased further by using the same conditions as in the hybridization steps, with the wash temperature raised about 3° C to about 5° C, and stringency may be increased even further by using the same conditions except the wash temperature is raised about 6° C to about 9° C.
  • wash steps may be performed at a lower temperature, e.g., 50° C.
  • An example of a low stringency wash step employs a solution and conditions of at least 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS over 30 minutes. Greater stringency may be obtained at 42° C in 15 mM NaCl, with 1.5 mM trisodium citrate, and 0.1% SDS over 30 minutes. Even higher stringency wash conditions are obtained at 65° C -68° C in a solution of 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Wash procedures will generally employ at least two final wash steps. Additional variations on these conditions will be readily apparent to those skilled in the art (see, for example, US Patent Application No. 20010010913).
  • Stringency conditions can be selected such that an oligonucleotide that is perfectly
  • complementary to the coding oligonucleotide hybridizes to the coding oligonucleotide with at least about a 5-10x higher signal to noise ratio than the ratio for hybridization of the perfectly complementary oligonucleotide to a nucleic acid encoding a polypeptide known as of the filing date of the application. It may be desirable to select conditions for a particular assay such that a higher signal to noise ratio, that is, about 15x or more, is obtained.
  • a subject nucleic acid will hybridize to a unique coding oligonucleotide with at least a 2x or greater signal to noise ratio as compared to hybridization of the coding oligonucleotide to a nucleic acid encoding known polypeptide.
  • the particular signal will depend on the label used in the relevant assay, e.g., a fluorescent label, a colorimetric label, a radioactive label, or the like.
  • Labeled hybridization or PCR probes for detecting related polynucleotide sequences may be produced by oligolabeling, nick translation, end-labeling, or PCR amplification using a labeled nucleotide.
  • polynucleotide sequences that are capable of hybridizing to the claimed polynucleotide sequences, including any of the polynucleotides within the Sequence Listing, and fragments thereof under various conditions of stringency (see, for example, Wahl and Berger, 1987, pages 399-407; and Kimmel, 1987).
  • full length cDNA, orthologs, and paralogs of the present nucleotide sequences may be identified and isolated using well-known methods.
  • the cDNA libraries, orthologs, and paralogs of the present nucleotide sequences may be screened using hybridization methods to determine their utility as hybridization target or amplification probes.
  • the instant disclosure includes any of a variety of polynucleotide sequences provided in the Sequence Listing or capable of encoding polypeptides that function similarly to those provided in the Sequence Listing. Due to the degeneracy of the genetic code, many different polynucleotides can encode identical and/or substantially similar polypeptides in addition to those sequences illustrated in the Sequence Listing.
  • Nucleic acids having a sequence that differs from the sequences shown in the Sequence Listing, or complementary sequences, that encode functionally equivalent peptides (that is, peptides having some degree of equivalent or similar biological activity) but differ in sequence from the sequence shown in the sequence listing due to degeneracy in the genetic code, are also within the scope of the instant disclosure and claims.
  • Altered polynucleotide sequences encoding polypeptides include those sequences with deletions, insertions, or substitutions of different nucleotides, resulting in a polynucleotide encoding a polypeptide with at least one functional characteristic of the instant polypeptides. Included within this definition are polymorphisms which may or may not be readily detectable using a particular oligonucleotide probe of the polynucleotide encoding the instant polypeptides, and improper or unexpected hybridization to allelic variants, with a locus other than the normal chromosomal locus for the polynucleotide sequence encoding the instant polypeptides.
  • substitutions, deletions and insertions introduced into the sequences provided in the Sequence Listing are also envisioned. Such sequence modifications can be engineered into a sequence by site-directed mutagenesis (for example, Olson et al., Smith et al., Zhao et al., and other articles in Wu, 1993), or the other methods known in the art or noted herein. Amino acid substitutions are typically of single residues; insertions usually will be on the order of about from 1 to 10 amino acid residues; and deletions will range about from 1 to 30 residues.
  • deletions or insertions are made in adjacent pairs, for example, a deletion of two residues or insertion of two residues. Substitutions, deletions, insertions or any combination thereof can be combined to arrive at a sequence.
  • the mutations that are made in the polynucleotide encoding the transcriptional regulator should not place the sequence out of reading frame and should not create complementary regions that could produce secondary mRNA structure.
  • the polypeptide encoded by the DNA performs the desired function.
  • Conservative substitutions are those in which at least one residue in the amino acid sequence has been removed and a different residue inserted in its place. Such substitutions generally are made in accordance with the Table 3 when it is desired to maintain the activity of the protein. Table 3 shows amino acids which can be substituted for an amino acid in a protein and which are typically regarded as conservative substitutions.
  • polypeptides provided in the Sequence Listing have a novel activity, such as, for example, regulatory activity. Although all conservative amino acid substitutions (for example, one basic amino acid substituted for another basic amino acid) in a polypeptide will not necessarily result in the polypeptide retaining its activity, it is expected that many of these conservative mutations would result in the polypeptide retaining its activity. Most mutations, conservative or non-conservative, made to a protein but outside of a conserved domain required for function and protein activity will not affect the activity of the protein to any great extent.
  • a number of constructs were used to modulate the activity of the disclosed sequences.
  • An individual project was defined as the analysis of lines for a particular construct (for example, this might include any of the disclosed lines that constitutively overexpress a disclosed B-box polypeptide sequence).
  • a full-length wild-type version of a gene was directly fused to a promoter that drove its expression in transgenic plants.
  • a promoter could be the native promoter of that gene, or the CaMV 35S promoter.
  • a promoter that drives tissue specific or conditional expression could be used in similar studies.
  • expression of a given polynucleotide from a particular promoter was achieved by either a direct-promoter fusion construct in which that sequence was cloned directly behind the promoter of interest, or by a two-component expression system.
  • a direct fusion approach has the advantage of allowing for simple genetic analysis if a given promoter-polynucleotide line is to be crossed into different genetic backgrounds at a later date.
  • the two-component method potentially allows for greater versatility in the creation of various promoter-gene combinations, and has the potential for generating stronger expression to be obtained via an amplification of transcription.
  • Transformation of plants and plant parts by Agrobacterium-mediated transformation can be practiced using a recombinant DNA construct, vector or cassette with the genetic elements as shown in Table 5 for dicots and Table 6 for monocots.
  • the disclosed recombinant polynucleotides in the Sequence Listing "MBI_0120PCT_ST25" may be incorporated in such recombinant DNA constructs.
  • the elements in a recombinant DNA construct provided in Tables 5 and 6 are only examples of different elements that can be used for the purpose of producing transgenic plants that have incorporated the polynucleotides. Other elements can be used as well in combination with the polynucleotides of the present disclosure to achieve trait modification.
  • a base recombinant DNA construct specifically useful for inserting a recombinant expression cassette into a chromosome in a nucleus in a dicot plant by Agrobacterium-mediated transformation is provided in Table 5.
  • Table 5 describes the function of the segment of the vector, column 2 provides a short name of a discrete genetic element and column 3 provides a more detailed description of the element.
  • Table 5 Example of an expression vector useful for transformation of dicot plants and plant parts.
  • T-AG tu.nos functions to direct polyadenylation of the mRNA.
  • T-Gb.E6-3b sea-island cotton.
  • OR-Ec.oriV-RK2 The vegetative origin of replication from plasmid RK2.
  • CR-Ec.aadA-SPC/STR conferring spectinomycin and streptomycin resistance.
  • Table 6 An example of an expression vector that may be used to transform a monocot plant by Agrobacterium- ediated transformation is provided in Table 6.
  • column 1 describes the function of the segment of the vector
  • column 2 provides a short name of the discrete genetic elements
  • column 3 provides a more detailed description of the elements.
  • T-AGRtu.nos A 3' non-translated region of the nopaline synthase
  • CR-Ec.rop Coding region for repressor of primer from the ColEl plasmid. Expression of this gene product interferes with primer binding at the origin of replication, keeping plasmid copy number low.
  • OR-Ec.ori-ColEl The minimal origin of replication from the E. coli
  • CR-Ec.aadA-SPC/STR Coding region for Tn7 adenylyltransferase conferring spectinomycin and streptomycin resistance.
  • primers for PCR amplification of the protein coding nucleotides are designed at or near the start and stop codons of the coding sequence, in order to eliminate most of the 5' and 3' untranslated regions.
  • the protein coding nucleotides are inserted into the base vector in the gene of interest expression cassette at an insertion site, i.e. between the intron element and the polyadenylation element (Table 5 or Table 6, depending on whether the plant to be transformed is a dicot or monocot, respectively).
  • the amplified protein coding nucleotides may be assembled in a sense and antisense arrangement and inserted into the base expression vector at the insertion site in the gene of interest expression cassette (Table 5 or Table 6, depending on whether the plant to be transformed is a dicot or monocot, respectively) to provide transcribed RNA that will form a double-stranded RNA for RNA interference suppression of the protein.
  • Expression vectors for suppressing a protein identified in Tables 1 and 2 may also be designed to insert an expression cassette that expresses (a) a miRNA that targets the gene for suppression, (b) a messenger RNA that is translated to the target protein and has a synthetic miRNA recognition site that would result in down-modulation of the target protein, (c) an RNA that forms a dsRNA and that is processed into siRNAs that effect down regulation of the target protein, (d) a ssRNA that forms a ta-siRNA which results in the production of siRNAs that effect down-modulation of the target protein.
  • an expression cassette that expresses (a) a miRNA that targets the gene for suppression, (b) a messenger RNA that is translated to the target protein and has a synthetic miRNA recognition site that would result in down-modulation of the target protein, (c) an RNA that forms a dsRNA and that is processed into siRNAs that effect down regulation of the target protein, (d) a ssRNA that forms
  • Crop species that overexpress or suppress the disclosed and closely related polypeptides may produce plants with increased water deprivation or drought tolerance, cold and/or nutrient tolerance and/or yield in both stressed and non-stressed conditions.
  • polynucleotide sequences listed in the Sequence Listing recombined into, for example, one of the disclosed expression vector, or another suitable expression vector such as one comprising a sequence that is closely related to the instantly disclosed sequences, may be transformed into a plant for the purpose of modifying plant traits such as improved yield and/or quality.
  • the expression vector may contain a constitutive promoter, an inducible promoter, a diurnally-regulated promoter, a tissue-enhanced promoter, a tissue-preferred promoter, or a tissue-specific promoter operably linked to the polynucleotide.
  • the expression vector may be introduced into a variety of plants by means well known in the art such as, for example, direct DNA transfer or Agrobacterium tumefaciens-mediated transformation. It is now a routine to produce transgenic plants from most dicot plants (see Weissbach and Weissbach, 1989; Gelvin et al., 1990; Herrera-Estrella et al., 1983; Bevan, 1984; and Klee, 1985). Methods for analysis of traits are routine in the art and examples are disclosed above. There are a substantial number of alternatives to Agrobacterium-mediated transformation protocols.
  • microprojectile- mediated transformation in which DNA on the surface of microprojectile particles is driven into plant tissues with a biolistic device (see, for example, Sanford et al., 1987; Christou et al., 1992; Sanford, 1993; Klein et al., 1987; U.S. Pat. No. 5,015,580 (Christou et al, issued May 14, 1991); and U.S. Pat. No. 5,322,783 (Tomes et al., issued Jun. 21, 1994)).
  • sonication methods see, for example, Zhang et al., 1991
  • direct uptake of DNA into protoplasts using CaCl 2 precipitation, polyvinyl alcohol or poly-L-ornithine see, for example, Hain et al., 1985; Draper et al., 1982
  • liposome or spheroplast fusion see, for example, Deshayes et al., 1985; Christou et al., 1987
  • electroporation of protoplasts and whole cells and tissues see, for example, Donn et al., 1990; D'Halluin et al., 1992; and Spencer et al., 1994
  • Transformation of Arabidopsis was performed by an Agrobacterium-mediated protocol based on the method of Bechtold and Pelletier, 1998. Unless otherwise specified, all experimental work was done using the Columbia ecotype.
  • Plant preparation Arabidopsis seeds were sown on mesh covered pots. The seedlings were thinned so that 6-10 evenly spaced plants remained on each pot 10 days after planting. The primary bolts were cut off a week before transformation to break apical dominance and encourage auxiliary shoots to form. Transformation was typically performed at 4-5 weeks after sowing.
  • Bacterial culture preparation Bacterial culture preparation. Agrobacterium stocks were inoculated from single colony plates or from glycerol stocks and grown with the appropriate antibiotics until saturation. On the morning of transformation, the saturated cultures were centrifuged and bacterial pellets were re-suspended in Infiltration Media (0.5X MS, IX B5 Vitamins, 5% sucrose, 1 mg/ml benzylaminopurine riboside, 200 ⁇ /L Silwet L77) until an A600 reading of 0.8 was reached.
  • Infiltration Media 0.5X MS, IX B5 Vitamins, 5% sucrose, 1 mg/ml benzylaminopurine riboside, 200 ⁇ /L Silwet L77
  • Transformation and seed harvest The Agrobacterium solution was poured into dipping containers. All flower buds and rosette leaves of the plants were immersed in this solution for 30 seconds. The plants were laid on their side and wrapped to keep the humidity high. The plants were kept this way overnight at 4° C and then the pots were turned upright, unwrapped, and moved to the growth racks.
  • the plants were maintained on the growth rack under 24-hour light until seeds were ready to be harvested. Seeds were harvested when 80% of the siliques of the transformed plants were ripe
  • hypocotyl lengths were measured from digital images of 20-30 seedlings per line and compared to appropriate controls. Mean values of hypocotyl length were plotted with standard errors to determine whether increased expression of each of the B-box genes resulted in elongated hypocotyls, suggesting a negative role in light signaling.
  • Transformation of tomato plants may be conducted using the protocols of Koornneef et al, 1986, and in U.S. Patent No. 6,613,962. The latter method is described briefly here.
  • Eight day old cotyledon explants are precultured for 24 hours in Petri dishes containing a feeder layer of Petunia hybrida suspension cells plated on MS medium with 2% (w/v) sucrose and 0.8% agar supplemented with 10 ⁇ ⁇ -naphthalene acetic acid and 4.4 ⁇ 6-benzylaminopurine.
  • the explants are then infected with a diluted overnight culture of Agrobacterium tumefaciens containing an expression vector comprising a disclosed or orthologous or paralogous polynucleotide for 5-10 minutes, blotted dry on sterile filter paper and cocultured for 48 hours on the original feeder layer plates.
  • Overnight cultures of Agrobacterium tumefaciens are diluted in liquid MS medium with 2% (w/v/) sucrose, pH 5.7) to an OD 60 o of 0.8.
  • the cotyledon explants are transferred to Petri dishes with selective medium comprising MS medium with 4.56 ⁇ zeatin, 67.3 ⁇ vancomycin, 418.9 ⁇ cefotaxime and 171.6 ⁇ kanamycin sulfate, and cultured under the culture conditions described above.
  • the explants are subcultured every three weeks onto fresh medium. Emerging shoots are dissected from the underlying callus and transferred to glass jars with selective medium without zeatin to form roots. The formation of roots in a kanamycin sulfate-containing medium is a positive indication of a successful transformation. Transformation of Soybean Plants
  • Transformation of soybean plants may be conducted using the methods found in, for example, Miki et al., 1993, and U.S. Patent Nos. 5,914,451, 5,824,877 and 6,384,301.
  • soybean seeds are imbibed overnight and the meristem explants excised.
  • Soybean explants are mixed with induced Agrobacterium cells from a strain containing plasmid DNA with the gene of interest cassette and a plant selectable marker cassette no later than 14 hours from the time of initiation of seed imbibition, and wounded using sonication.
  • explants are placed in co-culture for 2-5 days at which point they are transferred to selection media for 6-8 weeks to allow selection and growth of transgenic shoots.
  • Resistant shoots are harvested approximately 6-8 weeks and placed into selective rooting media for 2-3 weeks.
  • Shoots producing roots are transferred to the greenhouse and potted in soil. Shoots that remain healthy on selection, but do not produce roots are transferred to non- selective rooting media for an additional two weeks. Roots from any shoots that produce roots off selection are tested for expression of the plant selectable marker before they are transferred to the greenhouse and potted in soil.
  • Transformation of cotton plants may be performed as generally described in WO0036911, U.S. Patent Nos. 5,846,797, 7,790,460 and 7,947,869.
  • Transformation of rapeseed/canola plants may be performed as described in U.S. Patent Publication No. 2010/0218271.
  • transformation of cotyledonary petioles and hypocotyls of 5-6 day old young canola seedlings are used as explants for tissue culture and transformed according to Babic et al., 1998.
  • Tissues from in vitro grown canola seedlings are prepared and inoculated with overnight-grown Agrobacterium cells containing plasmid DNA with the gene of interest cassette and a plant selectable marker cassette. Following co-cultivation with Agrobacterium, the infected tissues are allowed to grow on selection to promote growth of transgenic shoots, followed by growth of roots from the transgenic shoots. The selected plantlets are then transferred to the greenhouse and potted in soil. Molecular characterizations are performed to confirm the presence of the gene of interest, and its expression in transgenic plants and progenies. Progeny transgenic plants are selected from a population of transgenic canola events under specified growing conditions and are compared with control canola plants.
  • Control canola plants are substantially the same canola genotype but without the recombinant DNA, for example, either a parental canola plant of the same genotype that is not transformed with the identical recombinant DNA or a negative isoline of the transformed plant.
  • Progeny transgenic plants and seed of the transformed plant cells are screened for decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased secondary rooting, greater cold tolerance, greater tolerance to water deprivation or drought, reduced stomatal conductance, altered C/N sensing, increased tolerance to nitrogen limited conditions, greater late season growth and vigor, greater number of primary nodes, greater late season canopy coverage, increased tolerance to hyperosmotic stress, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels starch, and delayed senescence.
  • the transformed plant may be crossed with itself or a plant from the same line, a non-transformed or wild-type plant, or another transformed plant from a different transgenic line of plants.
  • Crossing provides the advantages of producing new and often stable transgenic varieties. Genes and their conferred traits may be moved into distinct lines of plants using traditional backcrossing techniques well known in the art.
  • Cereal plants such as, but not limited to, corn, wheat, rice, sorghum, sugarcane, or barley, may be transformed with the present polynucleotide sequences, including monocot or dicot-derived sequences such as those presented in the present Tables, cloned into an expression vector such as the one described in Table 6 or pGA643 containing a kanamycin-resistance marker or a herbicide-tolerance marker such as a glyphosate-tolerance marker, and expressed constitutively under, for example, the CaMV 35S or COR15 promoters, or with tissue-specific, tissue-enhanced, tissue preferred, diurnally-regulated or inducible promoters.
  • the expression vectors may be one found in the Sequence Listing (for example, pMEN65, SEQ ID NO: 428), or any other suitable expression vector may be similarly used.
  • the expression vector may be introduced into a variety of cereal plants by means well known in the art including direct DNA transfer or Agrobacterium tumefaciens-mediated transformation.
  • the latter approach may be accomplished by a variety of means, including, for example, that of U.S. Patent No. 5,591,616, in which monocotyledon callus is transformed by contacting the dedifferentiating tissue with the Agrobacterium containing the expression vector.
  • the sample tissues are immersed in a suspension of 3xl0 "9 cells of Agrobacterium containing the expression vector for 3-10 minutes.
  • the callus material is cultured on solid medium at 25°C in the dark for several days.
  • the calli grown on this medium are transferred to fresh Regeneration medium at 2-3 week intervals(2 or 3 times) until shoots develop.
  • Shoots are then transferred to Shoot-Elongation medium every 2-3 weeks. Healthy-looking shoots are transferred to rooting medium and after roots have developed, the plants are placed into moist potting soil.
  • corn plants of a readily transformable line are grown in the greenhouse and ears are harvested when the embryos are 1.5 to 2.0 mm in length. Ears are surface sterilized by spraying or soaking the ears in 80% ethanol, followed by air drying. Immature embryos are isolated from individual kernels on surface sterilized ears. Prior to inoculation of maize cells, Agrobacterium cells are grown overnight at room temperature. Immature maize embryo cells are inoculated with Agrobacterium shortly after excision, and incubated at room temperature with Agrobacterium for 5-20 minutes. Immature embryo plant cells are then co-cultured with Agrobacterium for 1 to 3 days at 23°C in the dark.
  • Co-cultured embryos are transferred to selection media and cultured for approximately two weeks to allow embryogenic callus to develop.
  • Embryogenic callus is transferred to culture medium containing a selective agent and subcultured at about two week intervals.
  • Transformed plant cells are recovered 6 to 8 weeks after initiation of selection.
  • transformation and selection is placed on media to initiate shoot development into plantlets which are transferred to potting soil for initial growth in a growth chamber at 26°C followed by a mist bench before transplanting to 5 inch pots where plants are grown to maturity.
  • the regenerated plants are self-fertilized and seed is harvested for use in one or more methods to select seeds, seedlings or progeny second generation transgenic plants (R2 plants) or hybrids, e.g. by selecting transgenic plants exhibiting an enhanced trait as compared to a control plant.
  • the transformed plants are analyzed for the presence of the NPTII or other marker protein by ELISA, using the ELISA NPTII kit from 5Prime-3Prime Inc. (Boulder, CO), or for the presence of the transgene by PCR.
  • Examples of wheat transformation are illustrated in US Patent Nos. 6, 153,812 (microprojectile bombardment method) and 7,026,528 (Agrobacterium- ediated method).
  • DNA transfer methods such as the microprojectile method can be used for corn (Fromm et al., 1990; Gordon-Kamm et al., 1990; Ishida, 1990), wheat (Vasil et al., 1992; Vasil et al., 1993; Weeks et al., 1993), and rice (Christou, 1991 ; Hiei et al., 1994; Aldemita and Hodges, 1996; and Hiei et al., 1997).
  • embryogenic cells derived from immature scutellum tissues are the preferred cellular targets for transformation (Hiei et al., 1997; Vasil, 1994). After microprojectile bombardment the tissues are selected on selection medium to identify the transgenic embryogenic cells (Gordon-Kamm et al., 1990). Transgenic plants are regenerated by standard corn regeneration techniques (Fromm et al., 1990; Gordon-Kamm et al., 1990).
  • polynucleotides in the instant sequence listing can be introduced into a plant in combination with other disclosed polynucleotide sequences, or with other polynucleotide sequences of interest (that is, the polynucleotides may be "stacked" within the plant) for the purpose of producing plants with enhanced or multiple useful traits.
  • a single plant may thus comprise and ectopically express, overexpress, or suppress one or more of the disclosed polynucleotide sequences and/or their encoded polypeptides.
  • AtBBX32 was physically associated with GmBBX62 in vivo (Example V)
  • introduction and co-expression of both AtBBX32 and GmBBX62 in a transgenic plant may provide the transgenic plant with enhanced traits.
  • stacking of the disclosed polynucleotide sequences may be used to create one or more transgenic plants with at least one useful trait, said traits including, for example (but not limited to), decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased secondary rooting, greater cold tolerance, greater tolerance to water deprivation or drought, reduced stomatal conductance, altered C N sensing, increased tolerance to nitrogen limiting conditions, improved late season growth and vigor, greater number of nodes, greater late season canopy coverage, increased tolerance to hyperosmotic stress, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence, as compared to a control plant that does not ectopically express or overexpress the disclosed polynucleotide sequences.
  • traits including, for example (but not limited to), decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased secondary rooting, greater cold tolerance, greater tolerance
  • the combinations of polynucleotides introduced into target plants may also include multiple copies of any one of the disclosed polynucleotides.
  • the disclosed polynucleotides may also be stacked with any other polynucleotide or combination of polynucleotide to produce transgenic plants with one or more useful trait combinations, including, for example (but not limited to), one or more of the traits listed in the previous paragraph, and possibly herbicide resistance (e.g., glyphosate resistance), disease resistance or tolerance, increased tolerance to heat, increased tolerance to oxidative stress, increased oil content, male sterility, lodging resistance, early flowering and/or development, delayed flowering and/or development, extended flowering and/or development time, traits desirable for chemical processing, and/or improved digestibility.
  • herbicide resistance e.g., glyphosate resistance
  • the combinations of polynucleotides within an individual plant can be introduced through a variety of means. This may include, for example, transforming a target plant with two or more nucleic acid sequences of interest at the same time or at different times, or introducing the two or more nucleic acid sequences of interest by different means such as a combination of transformation and breeding, where the nucleic acid sequences may be integrated into one or more loci.
  • the two sequence cassettes can be contained in separate expression vectors (trans), where one of the expression vectors comprises a trans-acting element.
  • a trans-acting element is a DNA sequence that controls transcriptional activity of a target gene through a diffusible gene product such as a protein, microRNA, or other diffusible repressor or activator.
  • the regulated target gene may include a polynucleotide of the instant Sequence Listing.
  • the two sequence cassettes can be contained in the same expression vector (cis).
  • Introducing the sequences at the same time into a plant may be referred to as co-transformation, simultaneous transformation, or parallel transformation.
  • Combinations of recombinant polynucleotides can also be introduced into a plant through subsequent, serial or super-transformation or re- transformation, that is, by providing a transgenic plant previously transformed with one polynucleotide of interest, and transforming the same plant with one or more distinct recombinant polynucleotides.
  • a transgenic plant exhibiting one or more desired traits can be used as a target plant to introduce additional traits by super- transformation.
  • polynucleotide sequences including one or more of the disclosed polynucleotide sequences
  • the polynucleotide sequences can be transformed into the plant at any time and in any order.
  • a method of stacking genes in a plant combines transformation with breeding methods.
  • a plant that has been transformed with at least one polynucleotide sequence of interest may be cross-bred with a transgenic or non-transformed plant in order to stack more than one gene in the plant.
  • Expression of the polynucleotide sequences can be regulated by the same promoter or by different promoters.
  • an expression vector or cassette that will suppress the expression of a polynucleotide of interest. This may be combined with any combination of other suppression vectors or cassettes or overexpression vectors or cassettes to generate a desirable combination of traits in the plant, including traits disclosed in this Example.
  • EXAMPLE IV Expression and Analysis of Increased Yield and/or Abiotic Stress Tolerance in non-Arabidopsis Species or Crop Plants
  • BBX32 decreases light sensitivity of plants when the polypeptide is overexpressed in the plants, including in plants other than Arabidopsis (e.g., crop plants).
  • BBX32 has been shown to improve crop performance and acts to repress the transcriptional activity of another B-box protein, AtBBX21 (G1482, SEQ ID NO: 56) on its native target promoter (prCHS) sequences (unpublished data).
  • the instantly disclosed results provide evidence that HA: AtBBX28 (G1481) inhibited the transcriptional activity of HA: AtBBX21 to levels similar to the repression by HA:BBX32 ( Figure 2), suggesting that AtBBX28 is able to act as a repressor like BBX32.
  • AtBBX28 may have common targets with BBX32 ( Figure 2) or it may act on specific targets independently of BBX32.
  • Relationships between the disclosed sequences in the present disclosure may be recognized by comparing structural similarity, for example, determined by a disclosed percentage identity to full length protein or their conserved domains, or by hybridization to a disclosed polynucleotide sequence.
  • Northern blot analysis, RT-PCR or microarray analysis of the regenerated, transformed plants may be used to show expression of a polypeptide of the present disclosure, or related orthologous or paralogous sequences that are capable of inducing increased yield or increased tolerance to abiotic stresses, including water deprivation, cold, and low nitrogen conditions.
  • the transformed plant may be crossed with itself or a plant from the same line, a non-transformed or wild-type plant, or another transformed plant from a different transgenic line of plants.
  • polypeptides including closely-related orthologs
  • the functions of specific polypeptides may be analyzed and may be further characterized and incorporated into crop plants.
  • the ectopic overexpression of these sequences may be regulated using constitutive, inducible, or tissue specific regulatory elements.
  • polynucleotide and polypeptide sequences derived from monocots may be used to transform both monocot and dicot plants, and those derived from dicots (e.g., the Arabidopsis and soy genes) may be used to transform either group, although it is expected that some of these sequences will function best if the gene is transformed into a plant from the same group from which the sequence is derived.
  • seeds of these transgenic plants may be subjected to germination assays to measure sucrose sensing, severe desiccation or drought.
  • Methods that may be used to measure relative sucrose sensing, severe desiccation tolerance or drought tolerance in genetically altered (for example, over-expressing) and control plants are as follows.
  • sucrose sensing germination assays may be conducted in growth media containing 9.4% sucrose with Arabidopsis overexpressors of BBX32 and closely-related sequences. Growing the plants under controlled temperature and humidity on sterile medium produces uniform plant material that has not been exposed to additional stresses (such as water stress) which could cause variability in the results obtained. Where possible, assay conditions are originally tested in a blind experiment with controls that have phenotypes related to the condition tested.
  • seed for all experiments Prior to plating, seed for all experiments are surface sterilized in the following manner: (1) 5 minute incubation with mixing in 70 % ethanol, (2) 20 minute incubation with mixing in 30% bleach, 0.01 % triton-X 100, (3) 5X rinses with sterile water, (4) Seeds are re-suspended in 0.1 % sterile agarose and stratified at 4° C for 3-4 days. Germination assays follow modifications of the same basic protocol. Sterile seeds are sown on the conditional media that has a basal composition of 80% MS + Vitamins.
  • Plates are incubated at 22° C under 24-hour light (120-130 ⁇ m s ) in a growth chamber. Evaluation of germination and seedling vigor is performed five days after planting.
  • the soil drought assay (performed in clay pots) is based on that described by Haake et al., 2002.
  • Seeds are sterilized by a 2 minute ethanol treatment followed by 20 minutes in 30% bleach / 0.01 % Tween and five washes in distilled water. Seeds were sown to MS agar in 0.1% agarose and stratified for three days at 4° C, before transfer to growth cabinets with a temperature of 22 °C. After seven days of growth on selection plates, seedlings are transplanted to 3.5 inch diameter clay pots containing 80g of a 50:50 mix of vermiculite:perlite topped with 80g of ProMix. Typically, each pot contains 14 seedlings, and plants of the transgenic line being tested are in separate pots to the wild-type controls. Pots containing the transgenic line versus control pots are interspersed in the growth room,
  • Plants overexpressing the disclosed, orthologous or paralogous sequences may be found to be more tolerant to high sucrose by having better germination, longer radicles, and more cotyledon expansion.
  • Disclosed or orthologous or paralogous sequences, or other sequences closely related to the disclosed B-box polynucleotides and B-box polypeptides, may also be used to generate transgenic plants that are more tolerant to nitrogen-limiting conditions or cold than control plants.
  • B-box polynucleotides and B-box polypeptides may contribute to increased yield of commercially available plants.
  • BBX32 overexpressors have been shown to increase yield of plants in the apparent absence of significantly obvious abiotic stress, as evidenced by including increased height, increased early season vigor and estimated stand count, and increased late season canopy coverage observed in soy plants overexpressing BBX32.
  • disclosed B-box polynucleotides and B-box polypeptides, and closely related orthologs and paralogs will also improve yield in plants relative to control plants, including in leguminous species, even in the absence of overt abiotic stresses.
  • sequences and/or the sequences provided in the Sequence Listing may be introduced into plants other than Arabidopsis (e.g., crop plants), and by expressing said sequences may thus be made more tolerant than controls to water deprivation assays, nitrogen-limiting conditions or cold, and/or produce greater yield. It is expected that said plants under these conditions are greener, more vigorous, will have better survival rates than controls, or will recover better from these treatments than control plants.
  • the data presented herein present the results obtained in experiments with polynucleotides and polypeptides that may be expressed in plants in order to obtain advantageous traits in said plants including improved yield under non-stressed or low stress conditions, or for reduced yield losses under biotic and abiotic stress conditions.
  • Arabidopsis seedlings ectopically expressing ⁇ 32 showed increased hypocotyl growth rates and altered transcription of genes associated with light regulated signal transduction and photosynthesis.
  • Soybean plants ectopically expressing AtBBX32 were taller, tended to have more nodes, pods, and flowers, greater late season canopy coverage, improved late season vigor, in some cases had thicker stems, and ultimately had significantly higher broad acre yield than wild-type soybean plants did (e.g., see Creelman et al., US Patent No. 7,692,067).
  • G4004 also referred to as Glycine max BBX53 or GmBBX53, and listed as SEQ ID NO: 432 or 532
  • GmBBX52 variant SEQ ID NO: 434
  • GmBBX52 (SEQ ID NO: 530) were identified as the soybean orthologs of the Arabidopsis ⁇ 32 gene. Like AtBBX32, both soybean genes contain a single N-terminus B-box domain. Both soybean genes had diurnal oscillations in transcript abundance. Arabidopsis plants overexpressing either
  • GmBBX52 or GmBBX53 displayed increased hypocotyl growth rates and altered transcription of genes associated with light regulated signal transduction and photosynthesis, similar to plant lines
  • GmBBX52/GmBBX53- miRNA constructs and four independent events from the GmBBX53 over- expression construct were tested in broad acre yield trials.
  • Lines ectopically over- expressing GmBBX52 yielded, on average, 6.1 % more bushels per acre than did wild-type control plants, while the top performing line yielded 9.0% more bushels per acre.
  • Lines ectopically over-expressing GmBBX53 yielded 4.1 % higher than the wild-type control, while the top event improved yield by 6.7% over the wild-type control.
  • miRNA mediated suppression of GmBBX52 and GmBBX53 transcript levels led to a significant decrease in GmBBX52 RNA levels and decreased yield.
  • GmBBX52/GmBBX53-miRNA lines yielded, on average, 5.5% fewer bushels per acre than control lines while the lowest yielding line across the eight produced 11.8% fewer bushels per acre relative to controls.
  • AtBBX28 overexpressing AtBBX28 are hyposensitive to red light implying that AtBBX28 functions negatively in light signal transduction.
  • BBX32 improves crop performance and is thought to repress the transcriptional activity of another B-box protein, AtBBX21 (SEQ ID NO: 56) on its native target promoter (prCHS) sequences (unpublished data).
  • AtBBX28 SEQ ID NO: 2
  • prCHS native target promoter
  • HA: AtBBX28 inhibited the transcriptional activity of HA:AtBBX21 to levels similar to the repression by HA: BBX32 ( Figure 2).
  • AtBBX28 is able to act as a repressor like BBX32.
  • AtBBX28 may have common targets with BBX32 ( Figure 2) or it may act on specific targets independently of BBX32.
  • B-box proteins were analyzed for their potential roles in light signaling. Seedlings of several independently transformed Arabidopsis lines transformed with B-box genes were grown under red light to examine the effects on hypocotyl length. As seen in Figures 3 and 4, we identified 8 additional B-box genes which, when constitutively expressed, produced longer hypocotyls in light. The levels of expression of these genes in the transgenic lines are not yet known, but as expected the magnitude of the hypocotyl length phenotype varied greatly between independent transformants of the same gene.
  • AtBBX25 (G1894, SEQ ID NO: 154), AtBBX26 (G1486, SEQ ID NO: 52), AtBBX30 (G1478, SEQ ID NO: 40), AtBBX7 (G2440, SEQ ID NO: 104), AtBBX24 (G329, SEQ ID NO: 152), AtBBX20 (G1888, SEQ ID NO: 54), AtBBX19 (G902, SEQ ID NO: 200), and AtBBX18
  • G1881, SEQ ID NO: 202 function to suppress light signaling.
  • One or more of these genes can be used to alter light sensitivity leading to increased crop yield and stress tolerance.
  • AtBBX32 modulates expression of soybean BBX proteins
  • a microarray analysis was performed to examine the expression of ⁇ 32 on the modulation of gene expression in field grown soybean sampled at five time points: 3:00 am, 6:00 am (dawn), 9:00 am, noon, and 3:00 pm.
  • the expression of ⁇ 32 in soybean affected the abundance of specific gene transcripts with the majority of these changes in gene expression occurring at dawn as shown in Figure 11.
  • GmBBX52 and GmBBX53 are orthologs of the Arabidopsis thaliana ⁇ 32 gene.
  • Sequences that are orthologous, i.e., full length sequences or modified sequences that share significant sequence identity or similarity, to those provided in the Sequence Listing, may be derived from any of a wide variety of plants, including but not limited to, the plant families Myrtaceae, Pinaceae, Salicaceae, Leguminosae, Umbelliferae, Cruciferae, Curcurbitaceae, Solanaceae, Brassicaceae, or from the plants Arabidopsis thaliana, soybean, potato, cotton, rape, oilseed rape (including canola), sunflower, alfalfa, clover; or fruits and vegetables, such as banana, blackberry, blueberry, strawberry, and raspberry, cantaloupe, carrot, cauliflower, coffee, cucumber, eggplant, mint, grapes, honeydew, lettuce, mango, melon, onion, papaya, peas, beans, peppers, pineapple, pumpkin, spinach, squash, tobacco, tomato, tomatillo, watermelon, rosaceous
  • homologous sequences may be derived from plants that are evolutionarily-related to crop plants, but which may not have yet been used as crop plants. Examples include deadly nightshade (Atropa belladond), related to tomato; jimson weed ⁇ Datura strommium), related to peyote; and teosinte (Zea species), related to corn (maize).
  • deadly nightshade Atropa belladond
  • jimson weed ⁇ Datura strommium related to peyote
  • teosinte Zea species
  • Transgenic plants or plant cells, or plant explants, or plant tissues
  • incorporating the disclosed polynucleotides and expressing the disclosed polypeptides or orthologs of the disclosed polypeptides can be produced by a variety of well-established techniques as described in the Examples. After construction of a nucleic acid vector, including an expression vector or cassette, including one or more
  • polynucleotides encoding one or more B-box transcriptional regulators or B-box transcriptional regulator orthologs standard techniques can be used to introduce the vector into a plant, a plant cell, a plant explant or a plant tissue of interest.
  • the plant cell, explant or tissue can be regenerated to produce a transgenic plant.
  • the plant can be any higher plant, including gymnosperms, monocotyledonous and
  • Curcurbitaceae (melons and cucumber), Poaceae (formerly Gramineae, including wheat, corn, rice, barley, millet, etc.), Solanaceae (potato, tomato, tobacco, peppers, etc.), and various other crops. See protocols described in Ammirato et al., 1984; Shimamoto et al. 1989; Fromm et al., 1990; and Vasil et al., 1990).
  • a yeast 2-hybrid (Y2H) screen was carried out using full length and truncatecL iBBX32 and the soy orthologGmBBX52 as baits in a total of 6 screens against a soybean cDNA library (Table 7).
  • the six BBX32 baits from Table 7 were subcloned into pUC vectors and then recloned as LexA fusion constructs for use in Y2H screens. Most bait constructs were prepared in the pB27 background, which placed the LexA gene at the N terminus of the bait sequence.
  • vector backbones include pB29 for C terminal LexA fusions and pB6 for N terminal Gal4 fusions.
  • Two control screens were also performed using GmCOPl-like protein and GmPABP-like (Poly A binding protein) protein as baits (data not shown).
  • a random primed library was made from total RNA isolated from wild-type non-transgenic V5 soy leaves harvested at 4 hr intervals during a 14 hr diurnal cycle as well as from dark germinated soy seedlings.
  • the two uppermost leaf tri-foliates, shoot, and meristem tissues were harvested from V5 stage soy plants at 3 am, 7 am, 11 am, 3 pm, 7 pm, and 11 pm.
  • Whole seedlings were collected at a single time point. All tissues were harvested from plants grown in the growth chamber where lights were turned on at 5 am and off at 7 pm.
  • RNA was isolated from all tissues for preparation of a cDNA library in the appropriate prey vector. The two-hybrid screens were performed by Hybrigenics Services.
  • Contigs are defined as an interacting fragment of a particular sequence. Separate contigs may represent overlapping portions of the same mRNA. Furthermore, some contigs identified in separate screens may be identical, thus reducing the total number of contigs identified.
  • Translated BLAST searches against the public database revealed approximately 45 groups of contigs and 57 single contigs (including 333 different contigs) with similarity to Arabidopsis genes. An additional three contig groups did not show significant homology to publicly available gene sequences. Six contig groups did not show significant homology to genes within the Arabidopsis genome nor to the map to known soy genes. Of the remaining single contigs that map to soy gene sequences, approximately 107 showed no matches to known plant genes. Table 7. Bait insert sequences tested against the soy DNA library described above. Italicized sequence
  • BBX32 functions through interactions with other proteins.
  • these data indicate that, like BBX32, these genes may modulate a variety of traits, including yield, when overexpressed or suppressed in plants.
  • AiBBX32 putative interacting proteins from the yeast 2 hybrid screens were identified and are further described in the phylo genetic tree in Figures 12 and 13.
  • Several possible interacting proteins of GmBBX52 were also identified from yeast 2 hybrid screens.
  • GmG1481(GmBBX62) was identified and is proposed to function in protein-protein stabilization and could facilitate light signaling in leaves, roots and nodules.
  • the interaction of BBX32 with B-box proteins may also help in stabilizing the nuclear complex. Together such a complex could lead to altered gene expression of key regulatory and metabolic genes resulting in enhanced vigor, growth and yield.
  • AtBBX32 and GmBBX62 are physically associated in vivo
  • AtBBX32::GFP and Flag::GmBBX62 fusion proteins were transiently co-expressed in soybean protoplasts. Soybean protoplasts were isolated from 4-6 mm cotyledons and transformed as described by Abel and Theologis, 1994. Approximately lxlO 6 protoplasts were transformed in 15 mL Falcon conical tubes with 90 ⁇ g of Qiagen prepped plasmid DNA.
  • Protoplasts were then incubated at 22 °C for 18 to 24 hours, and harvested at 150 x g for 3 minutes and lysed with lysis buffer (50 mM Tris pH 7.8, 150 mM NaCl, 1 % Triton-X 100 and Complete Protease Inhibitor (Roche) for 1 hr on ice with vortex mixing every 15 min.
  • the lysate was centrifuged for 5 min at 3000 x g and soluble fractions were retained for use in Luminex-based co- immunoprecipitation assays.
  • Luminex co-immunoprecipitation (co-IP) assay was carried out using the miniaturized sandwich immunoassay and co-IP method with modifications, Poetz et al., 2009. This combination of co-IP and sandwich immunoassay allows the relative quantification of components of the complex. Briefly, antibodies for GFP (MBL International, D153-3) and FLAG (Bethyl Laboratories, A190-101A) were covalently coupled to carboxylated fluorescent microspheres (Luminex) according to the manufacturer' s protocol. Fifty ⁇ of protoplast cell lysate (above) was aliquoted to three different wells in a 96 well clear flat-bottom plate (Bio-Rad) for Luminex assays.
  • reporter NeutrAvidin R-phycoerythrin 100 ⁇ was added to each well and incubated for 30 minutes with subsequent washing. Each well was resuspended in 100 ⁇ of PBST buffer before plates were analyzed using FLEX MAP 3D system (Luminex Corp, Austin, TX). Approximately 100 beads were measured per sample to determine the median fluorescence intensity (MFI).
  • MFI median fluorescence intensity
  • AtBBX32 binds GmBBX62 in vitro
  • AtBBX32 within the protein complex was detected with anti-AiBBX32 antibody from FLAG: :GmBBX62 beads but not from the negative controls ( Figure 16B), demonstrating that FLAG: :GmBBX62 can bind to AtBBX32 in vitro.
  • Bead-based co-IP assays with Luminex on-bead detection method was used to confirm the interaction between the AtBBX32 and GmBBX39 proteins. Pairs of potential interacting proteins were co-expressed in soybean cotyledon protoplasts as described above.
  • Luminex carboxylated fluorescent microspheres
  • Biotinylated antibodies for GFP (Abeam, ab6658), Myc (Bethyl Laboratories cat # A190-104B)and FLAG (Bethyl laboratories, A190- 101B) were used for detection of interacting proteins in the miniaturized sandwich immunoassay.
  • NeutrAvidin R-phycoerythrin was used as the reporter assay reagent (Invitrogen, A2660).
  • Protein input for BBX32: :GFP and interactions were detected using the miniaturized sandwich immunoassay and co-IP method (Poetz, et ah, 2009).Protein complexes were captured from extracts on antibody-conjugated beads, and the bound partner proteins were detected with biotinylated antibodies. NeutrAvidin R-phycoerythrin provided a fluorescence read-out for the quantity of bound detection antibody. Interacting proteins were defined as pairs of potential interacting proteins that yielded a greater median fluorescence intensity (MFI) than any of the controls (single protein expressed or untransformed cells) with a p-value ⁇ 0.001 and a change in MFI that was 4-fold or greater when compared to each of the controls.
  • MFI median fluorescence intensity
  • BBX32::GFP was co- expressed with FLAG: :GmBBX39 in soybean cotyledon protoplasts.
  • Expression analyses on one replicate of each treatment using either Luminex (BBX32::GFP) or Western blot (FLAG: :BBX39) detection confirmed that each protein was expressed at detectable levels (data not shown).
  • BBX32::GFP and FLAG: :BBX39 co-precipitated with either anti-GFP or anti- FLAG beads ( Figure 17).
  • BBX32::GFP did not co-IP with anti-FLAG beads in the absence of

Landscapes

  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Nutrition Science (AREA)
  • Botany (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The present disclosure identifies new genes which have the potential to increase broad acre yield in crops. This disclosure is based upon our fundamental knowledge of light signal transduction and our understanding of the roles these genes play in regulating plant growth and development in response to light. Transgenic plants with gain- or loss-of-function of one of these genes, or in combination, are expected to show significant improvements in broad acre yield and stress tolerance.

Description

MANIPULATING PLANT SENSITIVITY TO LIGHT
JOINT RESEARCH AGREEMENT
The claimed invention, in the field of functional genomics and characterization of plant genes for the improvement of plants, was made by or on behalf of Mendel Biotechnology, Inc. and Monsanto Company as a result of activities undertaken within the scope of a joint research agreement in effect on or before the date the claimed invention was made.
CROSS REFERENCE TO RELATED APPLICATION
This application claims priority to U. S. Provisional Application Ser. No. 61/488,592 (filed on May 20, 2011), which is incorporated by reference herein in its entirety.
RELEVANT FIELD
The present disclosure relates to plant genomics and plant improvement.
BACKGROUND
A plant's traits, including its biochemical, developmental, or phenotypic characteristics that enhance yield or tolerance to various abiotic stresses, may be controlled through a number of cellular processes. One important way to manipulate that control is through transcriptional regulators - proteins that influence the expression of a particular gene or sets of genes. Transgenic plants that comprise cells having altered levels of at least one selected transcriptional regulator, for example, possess advantageous or desirable traits. Strategies for manipulating traits by altering a plant cell's transcriptional regulator content can therefore result in plants and crops with commercially valuable properties.
SUMMARY
The present disclosure identifies B-box genes that modify plant sensitivity to light. Manipulating light signaling processes through altering the expression/activities of these genes in plants will lead to enhanced agronomic characteristics, for example, increased crop yield and improved stress tolerance. Altering the expression/activity of the B-box genes of the present disclosure may also provide plants with altered levels of ureides, altered levels of hexose sugars, altered sucrose phosphate synthase (SPS) activity, altered levels of starch, and delayed senescence.
The present disclosure pertains to polynucleotide and polypeptide sequences provided herein and in the Sequence Listing. The present disclosure further pertains to nucleic acid constructs containing and/or expressing or suppressing the polynucleotide sequences provided herein and in the Sequence Listing, individually or in combination, either driven by a ubiquitously expressed, a stress- or a chemical- inducible, a tissue specific, a development specific or a diurnally-regulated promoter.
The present disclosure also pertains to transgenic plants with increased or decreased activities of one or more of the proteins provided herein and in the Sequence Listing, or encoded by the nucleic acid constructs containing and/or expressing or suppressing the polynucleotide sequences provided herein and in the Sequence Listing. The transgenic plants may exhibit changes in light sensitivity, resulting in improved vigor, improved yield and growth, and improved ability to cope with abiotic stresses compared to the wild type or other control plants. This approach can be combined with other growth-promoting factors to expand the benefits.
The present disclosure also provides methods for the selection and production of transgenic plants transformed with the disclosed B-box sequences or closely-related orthologs or paralogs. The selection may be made by identification in a plant (that is, a mature plant, a seed, a plant part, a seedling, plant tissue, plant cell, etc.) of the presence of a transgene or heterologous sequence that was transformed into the transgenic plant, or by an altered trait in the transgenic plant such as improved yield or increased tolerance to an abiotic stress, such as low nitrogen conditions, cold, water deprivation or drought, etc.
The present disclosure is also directed to transgenic seed produced by any of the transgenic plants of the present disclosure, including transgenic plants ectopically expressing or suppressing SEQ ID NO: 2N, where N=l-117, or 218-275, or ectopically expressing a polypeptide that regulates transcription and the polypeptide comprises a conserved domain of any of SEQ ID NO: 235-427, and to methods for selecting and/or making the disclosed transgenic plants and transgenic seeds.
Brief Description of the Sequence Listing and Drawings
The Sequence Listing provides exemplary polynucleotide and polypeptide sequences. The traits associated with the use of the sequences are included in the Examples.
Incorporation of the Sequence Listing. The copy of the Sequence Listing, being submitted electronically with this patent application, provided under 37 CFR § 1.821-1.825, is a read-only memory computer-readable file in ASCII text format. The Sequence Listing is named "MBI_0120PCT_ST25". The electronic file of the Sequence Listing was created on May 16, 2012, and is (724,396 bytes in size (707 kilobytes in size as measured in MS-WINDOWS). The Sequence Listing is herein incorporated by reference in its entirety.
Figure 1 shows light-responsiveness of Arabidopsis seedlings transformed with 35S::AtBBX28 (G1481):cMYC (AtBBX28 is provided as SEQ ID NO: 2). Several independently transformed lines were grown in red light and mean hypocotyl lengths of 20-30 seedlings of each line are plotted with the empty- vector control (pMEN 65) and seedlings overexpressing BBX32 (G1988 OE; SEQ ID NO: 430). The dotted line marks the hypocotyl length of the control (pMEN 65; SEQ ID NO: 428).
Figure 2 shows AtBBX28 (G1481, SEQ ID NO: 2) suppressing transcriptional activity of AtBBX21 (G1482, SEQ ID NO: 56) in protoplast co-transfection assays. Protoplasts were co- transformed with prCHS: :GUS reporter and either CAT (control) alone, or HA:AtBBX21 (G1482) with one CAT, HA: BBX32, or HA:AtBBX28 (G1481). Note that GUS is β -glucuronidase, CAT is chloramphenicol acetyltransferase, and HA is hemagglutinin protein-fusion tag (Niman et al., 1983). RGA = relative GUS activity.
In Figures 3 and 4, the light-responsiveness of Arabidopsis seedlings of independently transformed lines is plotted as measures of hypocotyl length for the various plant lines. The dotted line marks the hypocotyl length of the control. Vertical axes are measured hypocotyl length (HL; in millimeters). An asterisk above the bars in Figs. 3 and 4 indicates a p-value < 0.05, and a double asterisk a p-value <0.01.
Figure 3. Arabidopsis plant lines transformed with AtBBX25 (G1894, SEQ ID NO: 154; Fig. 3A), AtBBX24 (G329, SEQ ID NO: 152; Fig. 3B), AtBBX30 (G1478, SEQ ID NO: 40; Fig. 3C) and AtBBX18 (G1881, SEQ ID NO: 202; Fig. 3D) were grown in red light and mean hypocotyl lengths (HL) of 20-30 seedlings of each line are plotted with the control.
Figure 4. Arabidopsis plant lines transformed with AtBBX7 (G2440, SEQ ID NO: 104; Fig. 4A), AtBBX26 (G1486, SEQ ID NO: 52; Fig. 4B), AtBBX19 (G902, SEQ ID NO: 200; Fig. 4C) and AtBBX20 (G1888, SEQ ID NO: 54; Fig. 4D) were grown in red light and mean hypocotyl lengths of 20- 30 seedlings of each line are plotted with the control.
For Figures 5A-5E, Figures 6A-6D, Figure 7, Figures 8A-8F, Figures 9A-9G and Figures 10A-10I, the SEQ ID NOs of the sequences appear in parentheses to the right of the sequence identifiers. In these Figures, an asterisk below any column indicates amino acid identity within the column. A colon indicates that the column is comprised of conservatively-related amino acid residues. A period indicates semi-conservatively-related amino acid residues.
Figures 5A-5E present an alignment of AtBBX25 (G1894, AT2G31380.1 ; SEQ ID NO: 154), AtBBX24 (G329, AT1G06040.1 ; SEQ ID NO: 152) and closely related sequences.
Figures 6A-6D represent an alignment of AtBBX19 (G902, AT4G38960.1 ; SEQ ID NO: 200), AtBBX18 (G1881, AT2G21320.1 ; SEQ ID NO: 202) and closely related sequences.
Figure 7 shows an alignment of AtBBX30 (G1478, AT4G15248.1 ; SEQ ID NO: 40) and closely related sequences.
Figures 8A-8F present an alignment of AtBBX28 (G1481, AT4G27310.1 ; SEQ ID NO: 2) and AtBBX29 (G900, AT5G54470.1 ; SEQ ID NO: 4) and closely related sequences.
Figures 9A-9G displays an alignment of AtBBX20 (G1888, AT4G39070.1 ; SEQ ID NO: 54) and AtBBX21 (G1482, AT1G75540.1 ; SEQ ID NO: 56) and closely related sequences.
Figures 10A-10I show an alignment of AtBBX7 (G2440, AT3G07650.1, SEQ ID NO: 104), AtBBX8 (G1479, AT5G48250.1 ; SEQ ID NO: 106) and closely related sequences.
Figure 11 shows microarray data from field grown soybean plants. Microarrays performed on tissues sampled throughout the day from the field demonstrated that 219 genes showed 2-fold or greater changes in abundance in transgenic events transformed with Λί.ΒΒΧ32 relative to the control and that the majority of these changes occurred around dawn.
Figures 12A-12E shows a phylogenetic tree of the Arabidopsis thaliana and Glycine max B-box family, which contains 61 B-box sequences from soybean and 32 horn Arabidopsis. Phylogenetic analysis of the B-box sequences shows that the sequences are clustered into structural groups(St) and clades (C).H refers to Arabidopsis homolog, N refers to other names.
Figures 13A-13D shows a phylogenetic tree for 61 B-box sequences from soybean. Phylogenetic analysis of the B-box sequences shows that these sequences are clustered into structural groups (St) and clades (C).A Y (yes) under I indicates a putative interactor of AtBBX32 (I (At)) or GmBBX52 (I (Gm)) based on Y2H analyses; T represents tissue of expression where L, 1 = leaf; C, c = cotyledon; A, a = all tissues; S, s = seed; F, f = flowers; N, n= nodules; P, p =pod; R, r = root; NR = not represented in TxP, where bold upper-case letters represent high expression; upper-case letters represent moderate expression, and lower-case letters represent average expression. TP refers to time of peak expression. SP refers to whether or not a shift in peak expression was observed in transgenic soybean plants expressing BBX32 (Y for yes and N for no). CD refers to at least 1.5 fold(except where *~1.2-1.4 fold) change in expression at dawn in transgenic soybean plants expressing BBX32, where I =induced; S = suppressed. The first and second circles represent the first and the second B-box domain respectively; the rectangle represents the CCT domain.
Figure 14 represents the single B-box clade in Arabidopsis thaliana and Glycine max. The Arabidopsis thaliana genome contains seven single B-box domain genes while the paleopolyploid Glycine max genome contains thirteen single B-box genes. Phylogenetic analysis indicates that GmBBX52 and GmBBX53 are orthologs of the Arabidopsis thaliana ΛίΒΒΧ32 gene.
Figure 15 shows AtBBX32 and GmBBX62 interaction in vivo in soybean cotyledon protoplasts. Luminex co-immunoprecipitation (co-IP) was performed using antibody against GFP (A). The reciprocal co-IP was conducted using antibody against Hag tag (B). Components within the co-precipitated protein complexes were probed with biotinylated anti-Flag (A) and anti-GFP (B) antibodies, and subsequently detected with a fluorescently labeled R-phycoerythrin. MFI stands for Median Fluorescence Intensity. ** Mean differs significantly from controls at p<0.05.
Figure 16 demonstrates that AtBBX32 interacts directly with GmBBX62 via in vitro pull-down assay. Pull-down reactions were carried out using recombinant flag-GmBBX62 and soluble AtBBX32 extracts from wheat germ in vitro translation system. Protein bound to flag-GmBBX62 was washed, separated on SDS-PAGE and immunoblotted with anti-flag antibody (A) and anti-AtBBX32 antibody (B).Lane 1, flag-GmBBX62; la, AtBBX32 wheat germ extract; 2, anti-flag antibody bound beads only; 3, AtBBX32 only, no flag-GmBBX62; 4, flag-GmBBX62+AtBBX32.
Figure 17 shows AtBBX32 and GmBBX39 interaction in soybean protoplasts. Luminex co-IP assays were performed on extracts from soybean cotyledon protoplasts co-expressing AtBBX32 fused to GFP and GmBBX39 fused to the Myc epitope. A: IP with anti-GFP, detection with anti-Myc. B: IP with anti-Myc, detection with anti-GFP. MFI stands for Median Fluorescence Intensity. * denotes p < 0.001.
DETAILED DESCRIPTION
The present disclosure relates to polynucleotides and polypeptides for modifying phenotypes of plants, particularly those associated with increased abiotic stress tolerance and increased yield with respect to a control plant (for example, a wild-type plant). Throughout this disclosure, various information sources are referred to and/or are specifically incorporated. The information sources include scientific journal articles, patent documents, textbooks, and World Wide Web browser-inactive page addresses. While the reference to these information sources clearly indicates that they can be used by one of skill in the art, each and every one of the information sources cited herein are specifically incorporated in their entirety, whether or not a specific mention of "incorporation by reference" is noted. The contents and teachings of each and every one of the information sources can be relied on, used to make and use the disclosed embodiments.
As used herein and in the appended claims, the singular forms "a", "an", and "the" include the plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to "a plant cell" includes a plurality of such plant cells, and a reference to "a stress" is a reference to one or more stresses and equivalents thereof known to those skilled in the art, and so forth.
DEFINITIONS
"Polynucleotide" is a nucleic acid molecule comprising a plurality of polymerized nucleotides, e.g., at least about 15 consecutive polymerized nucleotides. A polynucleotide may be a nucleic acid, oligonucleotide, nucleotide, or any fragment thereof. In many instances, a polynucleotide comprises a nucleotide sequence encoding a polypeptide (or protein) or a domain or fragment thereof. Additionally, the polynucleotide may comprise a promoter, an intron, an enhancer region, a polyadenylation site, a translation initiation site, 5' or 3' untranslated regions, a reporter gene, a selectable marker, or the like. The polynucleotide can be single- stranded or double-stranded DNA or RNA. The polynucleotide optionally comprises modified bases or a modified backbone. The polynucleotide can be, e.g., genomic DNA or RNA, a transcript (such as an mRNA), a cDNA, a PCR product, a cloned DNA, a synthetic DNA or RNA, or the like. The polynucleotide can be combined with carbohydrate, lipids, protein, or other materials to perform a particular activity such as transformation or form a useful composition such as a peptide nucleic acid (PNA). The polynucleotide can comprise a sequence in either sense or antisense orientations. "Oligonucleotide" is substantially equivalent to the terms amplimer, primer, oligomer, element, target, and probe and is preferably single-stranded.
A "recombinant polynucleotide" is a polynucleotide that is not in its native state, e.g., the polynucleotide comprises a nucleotide sequence not found in nature, or the polynucleotide is in a context other than that in which it is naturally found, e.g., separated from nucleotide sequences with which it typically is in proximity in nature, or adjacent (or contiguous with) nucleotide sequences with which it typically is not in proximity. For example, the sequence at issue can be cloned into a vector, or otherwise recombined with one or more additional nucleic acid.
An "isolated polynucleotide" is a polynucleotide, whether naturally occurring or recombinant, that is present outside the cell in which it is typically found in nature, whether purified or not. Optionally, an isolated polynucleotide is subject to one or more enrichment or purification procedures, e.g., cell lysis, extraction, centrifugation, precipitation, or the like.
"Gene" or "gene sequence" refers to the partial or complete coding sequence of a gene, its complement, and its 5' or 3' untranslated regions. A gene is also a functional unit of inheritance, and in physical terms is a particular segment or sequence of nucleotides along a molecule of DNA (or RNA, in the case of RNA viruses) involved in producing a polypeptide chain. The latter may be subjected to subsequent processing such as chemical modification or folding to obtain a functional protein or polypeptide. A gene may be isolated, partially isolated, or found with an organism's genome. By way of example, a transcriptional regulator gene encodes a transcriptional regulator polypeptide, which may be functional or require processing to function as an initiator of transcription.
Operationally, genes may be defined by the cis-trans test, a genetic test that determines whether two mutations occur in the same gene and that may be used to determine the limits of the genetically active unit (Rieger et al., 1976). A gene generally includes regions preceding ("leaders"; upstream) and following ("trailers"; downstream) the coding region. A gene may also include intervening, non-coding sequences, referred to as "introns", located between individual coding segments, referred to as "exons". Most genes have an associated promoter region, a regulatory sequence 5' of the transcription initiation codon (there are some genes that do not have an identifiable promoter). The function of a gene may also be regulated by enhancers, operators, and other regulatory elements.
A "polypeptide" is an amino acid sequence comprising a plurality of consecutive polymerized amino acid residues e.g., at least about 15 consecutive polymerized amino acid residues. In many instances, a polypeptide comprises a polymerized amino acid residue sequence that is a transcriptional regulator or a domain or portion or fragment thereof. Additionally, the polypeptide may comprise: (i) a localization domain; (ii) an activation domain; (iii) a repression domain; (iv) an oligomerization domain; (v) a protein-protein interaction domain; (vi) a DNA-binding domain; or the like. The polypeptide optionally comprises modified amino acid residues, naturally occurring amino acid residues not encoded by a codon, or non-naturally occurring amino acid residues.
"Protein" refers to an amino acid sequence, oligopeptide, peptide, polypeptide or portions thereof whether naturally occurring or synthetic.
A "recombinant polypeptide" is a polypeptide produced by translation of a recombinant polynucleotide. A "synthetic polypeptide" is a polypeptide created by consecutive polymerization of isolated amino acid residues using methods well known in the art. An "isolated polypeptide," whether a naturally occurring or a recombinant polypeptide, is more enriched in (or out of) a cell than the polypeptide in its natural state in a wild-type cell, e.g., more than about 5% enriched, more than about 10% enriched, or more than about 20%, or more than about 50%, or more, enriched, i.e., alternatively denoted: 105%, 110%, 120%, 150% or more, enriched relative to wild type standardized at 100%. Such an enrichment is not the result of a natural response of a wild-type plant. Alternatively, or additionally, the isolated polypeptide is separated from other cellular components with which it is typically associated, e.g., by any of the various protein purification methods herein.
"Homology" refers to sequence similarity between a reference sequence and at least a fragment of a newly sequenced clone insert or its encoded amino acid sequence.
"Identity" or "similarity" refers to sequence similarity between two polynucleotide sequences or between two polypeptide sequences, with identity being a more strict comparison. The phrases "percent identity" and "% identity" refer to the percentage of sequence similarity found in a comparison of two or more polynucleotide sequences or two or more polypeptide sequences. "Sequence similarity" refers to the percent similarity in base pair sequence (as determined by any suitable method) between two or more polynucleotide sequences. Two or more sequences can be anywhere from 0-100% similar, or any integer value between 0-100%. Identity or similarity can be determined by comparing a position in each sequence that may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same nucleotide base or amino acid, then the molecules are identical at that position. A degree of similarity or identity between polynucleotide sequences is a function of the number of identical, matching or corresponding nucleotides at positions shared by the polynucleotide sequences. A degree of identity of polypeptide sequences is a function of the number of identical amino acids at corresponding positions shared by the polypeptide sequences. A degree of homology or similarity of polypeptide sequences is a function of the number of amino acids at corresponding positions shared by the polypeptide sequences.
"Alignment" refers to a number of nucleotide bases or amino acid residue sequences aligned by lengthwise comparison so that components in common (i.e., nucleotide bases or amino acid residues at corresponding positions) may be visually and readily identified. The fraction or percentage of components in common is related to the homology or identity between the sequences. Alignments such as those of Figures 4A-4F may be used to identify conserved domains and relatedness within these domains. An alignment may suitably be determined by means of computer programs known in the art, such as MACVECTOR software, 1999 (Accelrys, Inc., San Diego, CA).
A "conserved domain" or "conserved region" as used herein refers to a region in heterologous polynucleotide or polypeptide sequences where there is a relatively high degree of sequence identity between the distinct sequences. A "B-box zinc finger" domain, such as is found in a polypeptide member of B-box zinc finger family, is an example of a conserved domain. With respect to polynucleotides encoding presently disclosed polypeptides, a conserved domain is preferably at least nine base pairs (bp) in length. A conserved domain with respect to presently disclosed polypeptides refers to a domain within a polypeptide family that exhibits a higher degree of sequence homology, such as at least about 56%, 57%. 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or about 100% sequence identity to a conserved domain of a disclosed polypeptide (e.g., SEQ ID NOs: 235-427). Sequences that possess or encode for conserved domains that meet these criteria of percentage identity, and that have comparable biological activity to the present polypeptide sequences, thus being members of the BBX32 clade polypeptides, are encompassed by the present disclosure. A fragment or domain can be referred to as outside a conserved domain, outside a consensus sequence, or outside a consensus DNA -binding site that is known to exist or that exists for a particular polypeptide class, family, or sub-family. In this case, the fragment or domain will not include the exact amino acids of a consensus sequence or consensus DNA-binding site of a transcriptional regulator class, family or sub-family, or the exact amino acids of a particular transcriptional regulator consensus sequence or consensus DNA-binding site. Furthermore, a particular fragment, region, or domain of a polypeptide, or a polynucleotide encoding a polypeptide, can be "outside a conserved domain" if all the amino acids of the fragment, region, or domain fall outside of a defined conserved domain(s) for a polypeptide or protein. Sequences having lesser degrees of identity but comparable biological activity are considered to be equivalents.
As one of ordinary skill in the art recognizes, conserved domains may be identified as regions or domains of identity to a specific consensus sequence (see, for example, Riechmann et al., 2000a, 2000b). Thus, by using alignment methods well known in the art, the conserved domains of the plant polypeptides, for example, for the B-box zinc finger proteins (Putterill et al., 1995), may be determined.
The conserved domains for many of the disclosed polypeptide sequences are listed in Table 1. Also, the polypeptides of Table 1 have conserved domains specifically indicated by amino acid coordinate start and stop sites. A comparison of the regions of these polypeptides allows one of skill in the art (see, for example, Reeves and Nissen, 1990, 1995) to identify domains or conserved domains for any of the polypeptides listed or referred to in this disclosure.
"Complementary" refers to the natural hydrogen bonding by base pairing between purines and pyrimidines. For example, the sequence A-C-G-T (5' -> 3') forms hydrogen bonds with its complements A-C-G-T (5' -> 3') or A-C-G-U (5' -> 3')- Two single-stranded molecules may be considered partially complementary, if only some of the nucleotides bond, or "completely complementary" if all of the nucleotides bond. The degree of complementarity between nucleic acid strands affects the efficiency and strength of hybridization and amplification reactions. "Fully complementary" refers to the case where bonding occurs between every base pair and its complement in a pair of sequences, and the two sequences have the same number of nucleotides.
The terms "highly stringent" or "highly stringent condition" refer to conditions that permit hybridization of DNA strands whose sequences are highly complementary, wherein these same conditions exclude hybridization of significantly mismatched DNAs. Polynucleotide sequences capable of hybridizing under stringent conditions with the disclosed, orthologous or paralogous polynucleotides may be, for example, variants of the disclosed polynucleotide sequences, including allelic or splice variants, or sequences that encode orthologs or paralogs of presently disclosed polypeptides. Nucleic acid hybridization methods are disclosed in detail by Kashima et al., 1985; Sambrook et al., 1989; and by Haymes et al., 1985; which references are incorporated herein by reference.
In general, stringency is determined by the temperature, ionic strength, and concentration of denaturing agents (e.g., formamide) used in a hybridization and washing procedure (for a more detailed description of establishing and determining stringency, see the section "Identifying Polynucleotides or
Nucleic Acids by Hybridization", below). The degree to which two nucleic acids hybridize under various conditions of stringency is correlated with the extent of their similarity. Thus, similar nucleic acid sequences from a variety of sources, such as within a plant's genome (as in the case of paralogs) or from another plant (as in the case of orthologs) that may perform similar functions can be isolated on the basis of their ability to hybridize with known related polynucleotide sequences. Numerous variations are possible in the conditions and means by which nucleic acid hybridization can be performed to isolate related polynucleotide sequences having similarity to sequences known in the art and are not limited to those explicitly disclosed herein. Such an approach may be used to isolate polynucleotide sequences having various degrees of similarity with disclosed polynucleotide sequences, such as, for example, encoded transcriptional regulators having 56% or greater identity with the conserved domain of disclosed sequences.
The terms "paralog" and "ortholog" are defined below in the section entitled "Orthologs and Paralogs". In brief, orthologs and paralogs are evolutionarily related genes that have similar sequences and functions. Orthologs are structurally related genes in different species that are derived by a speciation event. Paralogs are structurally related genes within a single species that are derived by a duplication event.
The term "equivalog" describes members of a set of homologous proteins that are conserved with respect to function since their last common ancestor. Related proteins are grouped into equivalog families, and otherwise into protein families with other hierarchically defined homology types. This definition is provided at the Institute for Genomic Research (TIGR) World Wide Web (www) website, "tigr.org" under the heading "Terms associated with TIGRFAMs".
In general, the term "variant" refers to molecules with some differences, generated synthetically or naturally, in their base or amino acid sequences as compared to a reference (native) polynucleotide or polypeptide, respectively. These differences include substitutions, insertions, deletions or any desired combinations of such changes in a native polynucleotide of amino acid sequence.
With regard to polynucleotide variants, differences between presently disclosed polynucleotides and polynucleotide variants are limited so that the nucleotide sequences of the former and the latter are closely similar overall and, in many regions, identical. Due to the degeneracy of the genetic code, differences between the former and latter nucleotide sequences may be silent (i.e., the amino acids encoded by the polynucleotide are the same, and the variant polynucleotide sequence encodes the same amino acid sequence as the presently disclosed polynucleotide. Variant nucleotide sequences may encode different amino acid sequences, in which case such nucleotide differences will result in amino acid substitutions, additions, deletions, insertions, truncations or fusions with respect to the similar disclosed polynucleotide sequences. These variations may result in polynucleotide variants encoding polypeptides that share at least one functional characteristic. The degeneracy of the genetic code also dictates that many different variant polynucleotides can encode identical and/or substantially similar polypeptides in addition to those sequences illustrated in the Sequence Listing.
Also within the scope of the disclosed compositions and methods is a variant of a nucleic acid listed in the Sequence Listing, that is, one having a sequence that differs from the one of the polynucleotide sequences in the Sequence Listing, or a complementary sequence, that encodes a functionally equivalent polypeptide (i.e., a polypeptide having some degree of equivalent or similar biological activity) but differs in sequence from the sequence in the Sequence Listing, due to degeneracy in the genetic code. Included within this definition are polymorphisms that may or may not be readily detectable using a particular oligonucleotide probe of the polynucleotide encoding polypeptide, and improper or unexpected hybridization to allelic variants, with a locus other than the normal chromosomal locus for the polynucleotide sequence encoding polypeptide. "Allelic variant" or "polynucleotide allelic variant" refers to any of two or more alternative forms of a gene occupying the same chromosomal locus. Allelic variation arises naturally through mutation, and may result in phenotypic polymorphism within populations. Gene mutations may be "silent" or may encode polypeptides having altered amino acid sequence. "Allelic variant" and "polypeptide allelic variant" may also be used with respect to polypeptides, and in this case the terms refer to a polypeptide encoded by an allelic variant of a gene.
"Splice variant" or "polynucleotide splice variant" as used herein refers to alternative forms of RNA transcribed from a gene. Splice variation naturally occurs as a result of alternative sites being spliced within a single transcribed RNA molecule or between separately transcribed RNA molecules, and may result in several different forms of mRNA transcribed from the same gene. Thus, splice variants may encode polypeptides having different amino acid sequences, which may or may not have similar functions in the organism. "Splice variant" or "polypeptide splice variant" may also refer to a polypeptide encoded by a splice variant of a transcribed mRNA.
As used herein, "polynucleotide variants" may also refer to polynucleotide sequences that encode paralogs and orthologs of the presently disclosed polypeptide sequences. "Polypeptide variants" may refer to polypeptide sequences that are paralogs and orthologs of the presently disclosed polypeptide sequences.
Differences between presently disclosed polypeptides and polypeptide variants are limited so that the sequences of the former and the latter are closely similar overall and, in many regions, identical. Presently disclosed polypeptide sequences and similar polypeptide variants may differ in amino acid sequence by one or more substitutions, additions, deletions, fusions and truncations, which may be present in any combination. These differences may produce silent changes and result in functionally equivalent polypeptides. Thus, it will be readily appreciated by those of skill in the art, that any of a variety of polynucleotide sequences is capable of encoding the disclosed polypeptides and homolog polypeptides. A polypeptide sequence variant may have "conservative" changes, wherein a substituted amino acid has similar structural or chemical properties. Deliberate amino acid substitutions may thus be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues, as long as a significant amount of the functional or biological activity of the polypeptide is retained. For example, negatively charged amino acids may include aspartic acid and glutamic acid, positively charged amino acids may include lysine and arginine, and amino acids with uncharged polar head groups having similar hydrophilicity values may include leucine, isoleucine, and valine; glycine and alanine; asparagine and glutamine; serine and threonine; and phenylalanine and tyrosine. More rarely, a variant may have "non-conservative" changes, e.g., replacement of a glycine with a tryptophan. Similar minor variations may also include amino acid deletions or insertions, or both. Related polypeptides may comprise, for example, additions and/or deletions of one or more N-linked or O-linked glycosylation sites, or an addition and/or a deletion of one or more cysteine residues. Guidance in determining which and how many amino acid residues may be substituted, inserted or deleted without abolishing functional or biological activity may be found using computer programs well known in the art, for example, DNASTAR software (see US Patent No. 5,840,544).
"Fragment", with respect to a polynucleotide, refers to a clone or any part of a polynucleotide molecule that retains a usable, functional characteristic. Useful fragments include oligonucleotides and polynucleotides that may be used in hybridization or amplification technologies or in the regulation of replication, transcription or translation. A "polynucleotide fragment" refers to any subsequence of a polynucleotide, typically, of at least about 9 consecutive nucleotides, preferably at least about 30 nucleotides, more preferably at least about 50 nucleotides, of any of the sequences provided herein. Exemplary polynucleotide fragments are the first sixty consecutive nucleotides of the polynucleotides listed in the Sequence Listing. Exemplary fragments also include fragments that comprise a region that encodes a conserved domain of a polypeptide. Exemplary fragments also include fragments that comprise a conserved domain of a polypeptide. Exemplary fragments include fragments that comprise a conserved domain of a polypeptide, for example, any of SEQ ID NOs 235-427.
Fragments may also include subsequences of polypeptides and protein molecules, or a subsequence of the polypeptide. Fragments may have uses in that they may have antigenic potential. In some cases, the fragment or domain is a subsequence of the polypeptide which performs at least one biological function of the intact polypeptide in substantially the same manner, or to a similar extent, as does the intact polypeptide. For example, a polypeptide fragment can comprise a recognizable structural motif or functional domain such as a DNA-binding site or domain that binds to a DNA promoter region, an activation domain, or a domain for protein-protein interactions, and may initiate transcription.
Fragments can vary in size from as few as 3 amino acid residues to the full length of the intact polypeptide, but are preferably at least about 30 amino acid residues in length and more preferably at least about 60 amino acid residues in length.
The term "plant" includes whole plants, shoot vegetative organs/structures (for example, leaves, stems and tubers), roots, flowers and floral organs/structures (for example, bracts, sepals, petals, stamens, carpels, anthers and ovules), seed (including embryo, endosperm, and seed coat) and fruit (the mature ovary), plant tissue (for example, vascular tissue, ground tissue, and the like) and cells (for example, guard cells, egg cells, and the like), and progeny of same. The class of plants that can be used in the disclosed methods is generally as broad as the class of higher and lower plants amenable to
transformation techniques, including angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, horsetails, psilophytes, lycophytes, bryophytes, and multicellular algae (see for example, Figure 1, adapted from Daly et al., 2001, Figure 2, adapted from Ku et al., 2000; and see also Tudge, 2000).
A "control plant" as used in the present disclosure refers to a plant cell, seed, plant component, plant tissue, plant organ or whole plant used to compare against transgenic or genetically modified plant for the purpose of identifying an enhanced phenotype in the transgenic or genetically modified plant. A control plant may in some cases be a transgenic plant line that comprises an empty vector or marker gene, but does not contain the recombinant polynucleotide of the present disclosure that is expressed in the transgenic or genetically modified plant being evaluated. A control plant may in other cases be a progeny of a hemizygous transgenic plant line that does not contain the recombinant DNA, known as a negative segregant or negative isoline. In general, a control plant is a plant of the same line or variety as the transgenic or genetically modified plant being tested. A suitable control plant would include a genetically unaltered or non-transgenic plant of the parental line used to generate a transgenic plant herein.
A "transgenic plant" refers to a plant that contains genetic material not found in a wild-type plant of the same species, variety or cultivar. The genetic material may include a transgene, an insertional mutagenesis event (such as by transposon or T-DNA insertional mutagenesis), an activation tagging sequence, a mutated sequence, a homologous recombination event or a sequence modified by chimeraplasty. Typically, the foreign genetic material has been introduced into the plant by human manipulation, but any method can be used as one of skill in the art recognizes.
A transgenic plant may contain an expression vector or cassette. The expression cassette typically comprises a polypeptide-encoding or polypeptide-suppressing sequence operably linked to (i.e., under regulatory control of) appropriate inducible, tissue-enhanced, tissue-specific, diurnally regulated or constitutive regulatory sequences that allow for the controlled expression of the polypeptide. The expression cassette can be introduced into a plant by transformation or by breeding after transformation of a parent plant. A plant refers to a whole plant as well as to a plant part, such as seed, fruit, leaf, or root, plant tissue, plant cells or any other plant material, e.g., a plant explant, as well as to progeny thereof, and to in vitro systems that mimic biochemical or cellular components or processes in a cell.
A constitutive promoter is active under most environmental conditions and in most plant parts. Tissue-enhanced (also referred to as tissue -preferred), tissue-specific, cell type-specific, and inducible promoters constitute non-constitutive promoters. Promoters under developmental control include promoters that preferentially initiate transcription in certain tissues, such as xylem, leaves, roots, or seeds. Such promoters are examples of tissue-enhanced or tissue-preferred promoters (see US patent 7,365, 186). Tissue-enhanced promoters can be found upstream and operatively linked to DNA sequences normally transcribed in higher levels in certain plant tissues or specifically in certain plant tissues, respectively. "Cell-enhanced", "tissue-enhanced", or "tissue-specific" regulation thus refer to the control of gene or protein expression, for example, by a promoter, which drives expression that is not necessarily totally restricted to a single type of cell or tissue, but where expression is elevated in particular cells or tissues to a greater extent than in other cells or tissues within the organism, and in the case of tissue- specific regulation, in a manner that is primarily elevated in a specific tissue. Tissue-enhanced or preferred promoters have been described in, for example, US Patent No. 7,365,186, or US Patent No. 7,619, 133.
A "condition-enhanced" promoter refers to a promoter that activates a gene in response to a particular environmental stimulus, for example, an abiotic stress, infection caused by a pathogen, light treatment, chemical stimulus, etc., and that drives expression in a unique pattern which may include expression in specific cell and/or tissue types within the organism (as opposed to a constitutive expression pattern in all cell types of an organism at all times).
A "diurnal promoter" is useful for regulating changes in the timing of gene expression to a specific time of day. Usually genes that are diurnally-regulated peak at the same time in the day/night cycle. Genes that are under the regulation of diurnal promoters exhibit altered expression profiles under the control of a circadian oscillator mostly during the switch time of light to dark but also with diurnal oscillations that persist within a period close to 24 hour day/night cycle. Diurnal regulation is subject to environmental inputs such as light and temperature and the coordination by the circadian clock.
"Wild type" or "wild-type", as used herein, refers to a plant cell, seed, plant component, plant part, plant tissue, plant organ or whole plant that has not been genetically modified or treated in an experimental sense. Wild-type cells, seeds, components, parts, tissues, organs or whole plants may be used as controls to compare levels of expression and the extent and nature of trait modification with cells, tissue or plants of the same species in which a polypeptide's expression is altered, e.g., in that it has been knocked out, overexpressed, or ectopically expressed.
A "trait" refers to a physiological, morphological, biochemical, or physical characteristic of a plant or particular plant material or cell. In some instances, this characteristic is visible to the human eye, such as seed or plant size, or can be measured by biochemical techniques, such as detecting the protein, starch, or oil content of seed or leaves, or by observation of a metabolic or physiological process, e.g. by measuring tolerance to water deprivation or particular salt or sugar concentrations, or by the observation of the expression level of a gene or genes, e.g., by employing Northern analysis, RT-PCR, microarray gene expression assays, or reporter gene expression systems, or by agricultural observations such as hyperosmotic stress tolerance or yield. Any technique can be used to measure the amount of, comparative level of, or difference in any selected chemical compound or macromolecule in the transgenic plants, however.
"Trait modification", "modified trait" or "altered trait" refers to a detectable difference in a characteristic in a plant ectopically expressing a polynucleotide or polypeptide of the present disclosure relative to a plant not doing so, such as a wild-type plant. In some cases, the trait modification can be evaluated quantitatively. For example, the trait modification can entail at least about a 2% increase or decrease, or an even greater difference, in an observed trait as compared with a control or wild-type plant. It is known that there can be natural variations in the modified trait. Therefore, the trait modification observed entails a change of the normal distribution and magnitude of the trait in the plants as compared to control or wild-type plants.
When two or more plants have "similar morphologies", "substantially similar morphologies", "a morphology that is substantially similar", or are "morphologically similar", the plants have comparable forms or appearances, including analogous features such as overall dimensions, height, width, mass, root mass, shape, glossiness, leaf color, stem diameter, leaf size, leaf dimension, leaf density, internode distance or length, branching, root branching, number and form of inflorescences, and other macroscopic characteristics, and the individual plants are not readily distinguishable based on morphological characteristics alone.
"Modulates" refers to a change in activity (biological, chemical, or immunological) or lifespan resulting from specific binding between a molecule and either a nucleic acid molecule or a protein.
The term "transcript profile" refers to the expression levels of a set of genes in a cell in a particular state, particularly by comparison with the expression levels of that same set of genes in a cell of the same type in a reference state. For example, the expression level of a set of genes in a cell in which a particular polypeptide is overexpressed or suppressed can be compared to the expression level of the same set of genes in a cell that has normal levels of that polypeptide. The transcript profile can be presented as a list of those genes whose expression level is significantly different between the two treatments, and the difference ratios. Differences and similarities between expression levels may also be evaluated and calculated using statistical and clustering methods.
With regard to gene knockouts as used herein, the term "knockout" or "suppression" refers to a plant, plant cell, or plant tissue having a disruption in at least one gene, where the disruption results in a reduced or abolished expression or activity of the polypeptide encoded by that gene compared to a control plant, cell, or tissue. A knockout or suppression can occur in different ways, including but not limited to: decreasing levels of a protein; suppressing a mutation that has resulted in decreased activity of a protein; suppressing the production of an inhibitory agent; elevating, reducing or eliminating the level of substrate that an enzyme requires for activity; producing a new protein; and activating a normally silent gene, to accumulate a product that does not normally increase under natural conditions. The suppressor can be another mutation on a different gene, a suppressor mutation on the same gene but located some distance from the first mutation, or a suppressor in the cytoplasm that has generated due to a change in non-chromosomal DNA. The knockout can be the result of, for example, genomic disruptions, including transposons, tilling, and homologous recombination, antisense constructs, sense constructs, RNA silencing constructs, or RNA interference. A T-DNA insertion within a gene is an example of a genotypic alteration that may abolish expression of that gene. To knockout or suppress a gene, a recombinant expression cassette can be made. For example, the recombinant cassette can comprise a promoter that is functional in a plant cell and that is operably-linked to a polynucleotide that when expressed in a plant cell is transcribed into a polynucleotide molecule that suppresses the level of an endogenous protein in the plant cell relative to a control. The polynucleotide molecule can be, for example, a dsRNA that is processed into siRNAs that targets a messenger RNA encoding the protein; a miRNA that targets a messenger RNA encoding the protein; a trans-acting small interfering RNA (ta- siRNA) that is processed into siRNAs and that targets a messenger RNA encoding the protein; and a cleavage blocker of a miRNA or a miRNA decoy of a miRNA, which both lead to decreased activity of a miRNA. Examples of such RNAi-mediated gene suppression approaches are disclosed in US Patent Application Publication 2009/61288019, which is incorporated herein by reference.
"Ectopic expression or altered expression" in reference to a polynucleotide indicates that the pattern of expression in, e.g., a transgenic plant or plant tissue, is different from the expression pattern in a wild-type plant or plant tissue or a reference plant or plant tissue of the same species. For example, a polynucleotide or polypeptide is expressed in a cell or tissue type other than a cell or tissue type in which the sequence is expressed in the wild-type plant, or by expression at a time other than at the time the sequence is expressed in the wild-type plant, or by a response to different inducible agents, such as hormones or environmental signals, or at different expression levels (either higher or lower) compared with those found in a wild-type plant. The term also refers to altered expression patterns that are produced by lowering the levels of expression to below the detection level or completely abolishing expression. The resulting expression pattern can be transient or stable, constitutive or inducible. In reference to a polypeptide, the term "ectopic expression or altered expression" further may relate to altered activity levels resulting from the interactions of the polypeptides with exogenous or endogenous modulators or from interactions with factors or as a result of the chemical modification of the polypeptides.
The term "overexpression" as used herein refers to a greater expression level of a gene in a plant, plant cell or plant tissue, compared to expression in a wild-type plant, cell or tissue, at any developmental or temporal stage for the gene. Overexpression can occur when, for example, the genes encoding one or more polypeptides are under the control of a strong promoter (e.g., the cauliflower mosaic virus 35S transcription initiation region). Overexpression may also be under the control of a heterologous promoter, or an inducible or tissue specific promoter. Thus, overexpression may occur throughout a plant, in specific tissues of the plant, or in the presence or absence of particular environmental signals, depending on the promoter used. Overexpression may take place in plant cells normally lacking expression of polypeptides functionally equivalent or identical to the present polypeptides. Overexpression may also occur in plant cells where endogenous expression of the present polypeptides or functionally equivalent molecules normally occurs, but such normal expression is at a lower level. Overexpression thus results in a greater than normal production, or "overproduction" of the polypeptide in the plant, cell or tissue.
The term "transcription regulating region" refers to a DNA regulatory sequence that regulates the expression of one or more genes in a plant with a transcriptional regulator having one or more specific binding domains that binds to a DNA regulatory sequence. Transcriptional regulators possess a conserved domain. The transcriptional regulators also comprise an amino acid subsequence that forms a transcription activation domain that regulates expression of one or more abiotic stress tolerance genes in a plant when the transcriptional regulator binds to the regulating region.
"Increased yield" or "improved yield" or "increased plant yield" refers to increased plant growth, increased crop growth, increased biomass, increased grain yield, and/or increased plant product production, and is dependent to some extent on temperature, plant size, organ size, planting density, light, water and nutrient availability, and how the plant copes with various stresses, such as through temperature acclimation and water or nutrient use efficiency.
"Planting density" refers to the number of plants that can be grown per acre. For crop species, planting or population density varies from crop to crop, from one growing region to another, and from year to year. Using corn as an example, the average prevailing density in 2000 was in the range of 20,000 - 25,000 plants per acre in Missouri, USA. A desirable higher population density (a measure of yield) would be at least 22,000 plants per acre, and a more desirable higher population density would be at least 28,000 plants per acre, more preferably at least 34,000 plants per acre, and even more preferably at least 40,000 plants per acre. The average prevailing densities per acre of a few other examples of crop plants in the USA in the year 2000 were: wheat 1,000,000-1,500,000; rice 650,000-900,000; soybean 150,000- 200,000, canola 260,000-350,000, sunflower 17,000-23,000 and cotton 28,000-55,000 plants per acre (Cheikh et al., 2003, in U.S. Patent Application No. 20030101479). A desirable higher population density for each of these examples, as well as other valuable species of plants, would be at least 10% higher than the average prevailing density or yield. DESCRIPTION OF THE SPECIFIC EMBODIMENTS
Transcriptional Regulators Modify Expression of Endogenous Genes
A transcriptional regulator may include, but is not limited to, any polypeptide that can activate or repress transcription of a single gene or a number of genes. As one of ordinary skill in the art recognizes, transcriptional regulators can be identified by the presence of a region or domain of structural similarity or identity to a specific consensus sequence or the presence of a specific consensus DNA-binding motif (see, for example, Riechmann et al., 2000a). The plant transcriptional regulators of the present disclosure belong to the B-box zinc finger family (Putterill et al., 1995) and are putative transcriptional regulators.
Generally, transcriptional regulators are involved in cell differentiation and proliferation and the regulation of growth. Accordingly, one skilled in the art would recognize that by expressing the present sequences in a plant, one may change the expression of autologous genes or induce the expression of introduced genes. By affecting the expression of similar autologous sequences in a plant that have the biological activity of the present sequences, or by introducing the present sequences into a plant, one may alter a plant's phenotype to one with improved traits related to osmotic stresses. The disclosed sequences may also be used to transform a plant and introduce desirable traits not found in the wild-type cultivar or strain. Plants may then be selected for those that produce the most desirable degree of over- or under - expression of target genes of interest and coincident trait improvement.
The sequences of the present disclosure and closely related orthologous or paralogous sequences may be from any species, particularly plant species, in a naturally occurring form or from any source whether natural, synthetic, semi-synthetic or recombinant. The disclosed sequences may also include fragments of the present amino acid sequences. Where "amino acid sequence" is recited to refer to an amino acid sequence of a naturally occurring protein molecule, "amino acid sequence" and like terms are not meant to limit the amino acid sequence to the complete native amino acid sequence associated with the recited protein molecule.
In addition to methods for modifying a plant phenotype by employing one or more of the disclosed polynucleotides and polypeptides, the disclosed polynucleotides and polypeptides have a variety of additional uses. These uses include their use in the recombinant production (i.e., expression) of proteins; as regulators of plant gene expression, as diagnostic probes for the presence of complementary or partially complementary nucleic acids (including for detection of natural coding nucleic acids); as substrates for further reactions, e.g., mutation reactions, PCR reactions, or the like; as substrates for cloning e.g., including digestion or ligation reactions; and for identifying exogenous or endogenous modulators of the transcriptional regulators. The polynucleotide can be, e.g., genomic DNA or RNA, a transcript (such as an mRNA), a cDNA, a PCR product, a cloned DNA, a synthetic DNA or RNA, or the like. The polynucleotide can comprise a sequence in either sense or antisense orientations.
Expression of genes that encode polypeptides that modify expression of endogenous genes, polynucleotides, and proteins are well known in the art. In addition, transgenic plants comprising isolated polynucleotides encoding transcriptional regulators may also modify expression of endogenous genes, polynucleotides, and proteins. Examples include Peng et al., 1997, and Peng et al., 1999). In addition, many others have demonstrated that an Arabidopsis transcriptional regulator expressed in an exogenous plant species elicits the same or very similar phenotypic response. See, for example, Fu et al., 2001 ; Nandi et al., 2000; Coupland, 1995; and Weigel and Nilsson, 1995).
In another example, Mandel et al., 1992b, and Suzuki et al., 2001 , teach that a transcriptional regulator expressed in another plant species elicits the same or very similar phenotypic response of the endogenous sequence, as often predicted in earlier studies of Arabidopsis transcriptional regulators in Arabidopsis (see Mandel et al., 1992a; Suzuki et al., 2001). Other examples include Miiller et al., 2001 ; Kim et al., 2001 ; Kyozuka and Shimamoto, 2002; Boss and Thomas, 2002; He et al., 2000; and Robson et al., 2001).
In yet another example, Gilmour et al., 1998, teach an Arabidopsis API transcriptional regulator,
CBF1, which, when overexpressed in transgenic plants, increased plant freezing tolerance. Jaglo et al., 2001) further identified sequences in Brassica napus which encode CBF-like genes and showed that transcripts for these genes accumulated rapidly in response to low temperature. Transcripts encoding CBF-like proteins were also found to accumulate rapidly in response to low temperature in wheat, as well as in tomato. An alignment of the CBF proteins from Arabidopsis, B. napus, wheat, rye, and tomato revealed the presence of conserved consecutive amino acid residues which bracket the AP2/EREBP DNA binding domains of the proteins and distinguish them from other members of the AP2 EREBP protein family (Jaglo et al., 2001).
Transcriptional regulators mediate cellular responses and control traits through altered expression of genes containing cis-acting nucleotide sequences that are targets of the introduced transcriptional regulator. It is well appreciated in the art that the effect of a transcriptional regulator on cellular responses or a cellular trait is determined by the particular genes whose expression is either directly or indirectly (e.g., by a cascade of transcriptional regulator binding events and transcriptional changes) altered by transcriptional regulator binding. In a global analysis of transcription comparing a standard condition with one in which a transcriptional regulator is overexpressed, the resulting transcript profile associated with transcriptional regulator overexpression is related to the trait or cellular process controlled by that transcriptional regulator. For example, the PAP2 gene and other genes in the MYB family have been shown to control anthocyanin biosynthesis through regulation of the expression of genes known to be involved in the anthocyanin biosynthetic pathway (Bruce et al., 2000; and Borevitz et al., 2000).
Consequently, it is evident to one skilled in the art that similarity of transcript profile upon
overexpression of different transcriptional regulators would indicate similarity of transcriptional regulator function.
The Disclosed Polypeptides and Polynucleotides
The present disclosure includes putative transcriptional regulators, and isolated or recombinant polynucleotides encoding the polypeptides, or novel sequence variant polypeptides or polynucleotides encoding novel variants of polypeptides derived from the specific sequences provided in the Sequence Listing; the disclosed recombinant polynucleotides may be incorporated in expression vectors for the purpose of producing transformed plants. Also provided are methods for modifying yield from a plant by modifying the mass, size or number of plant organs or seed of a plant by controlling a number of cellular processes, and for increasing a plant's resistance to abiotic stresses. These methods are based on the ability to alter the expression of critical regulatory molecules that may be conserved between diverse plant species. Related conserved regulatory molecules may be originally discovered in a model system such as Arabidopsis and homologous, functional molecules then discovered in other plant species. The latter may then be used to confer increased yield or abiotic stress tolerance in diverse plant species.
Exemplary polynucleotides encoding the polypeptides provided in Table 1 and Table 2 were identified in the Arabidopsis thaliana GenBank database using publicly available sequence analysis programs and parameters, and an in-house proprietary database. Sequences initially identified were then further characterized to identify sequences comprising specified sequence strings corresponding to sequence motifs present in families of known polypeptides. Additional disclosed polynucleotides were identified by screening Arabidopsis thaliana and/or other plant cDNA libraries with probes
corresponding to known polypeptides under low stringency hybridization conditions. Additional sequences, including full length coding sequences, were subsequently recovered by the rapid amplification of cDNA ends (RACE) procedure using a commercially available kit according to the manufacturer' s instructions. Where necessary, multiple rounds of RACE are performed to isolate 5' and 3' ends. The full-length cDNA was then recovered by a routine end-to-end polymerase chain reaction (PCR) using primers specific to the isolated 5' and 3' ends. Exemplary sequences are provided in the Sequence Listing.
Many of the sequences in the Sequence Listing, derived from diverse plant species, have been ectopically expressed in overexpressor plants. The changes in the characteristic(s) or trait(s) of the plants were then observed and found to confer increased yield and/or increased abiotic stress tolerance.
Therefore, the polynucleotides and polypeptides can be used to improve desirable characteristics of plants.
The disclosed polynucleotides were also ectopically expressed in overexpressor plant cells and the changes in the expression levels of a number of genes, polynucleotides, and/or proteins of the plant cells observed. Therefore, the polynucleotides and polypeptides can be used to change expression levels of genes, polynucleotides, and/or proteins of plants or plant cells. General Considerations Related to Improving Plant Yield
The instant disclosure provides a novel method involving new gene technologies to improve plant yield. It is expected that either individually or in a combination with other genes or promoters, these novel methods will provide significantly higher improvements compared to previous methods.
Plants have evolved to sense the direction, color, intensity and duration of the incumbent light signals. Plants use this information to redirect their growth and developmental processes to optimize light absorption by promoting elongation growth under low light. Several genes have been implicated in playing roles in light signaling mechanisms regulating plant growth and development. Here, light responsiveness of young seedlings overexpressing some of the individual B-box genes to determine their roles in light signaling was examined. There is precedent that suppressing light signaling leads to crop improvement (US Patent No. 7,692,067).
The instant disclosure identifies several Arabidopsis thaliana B-box genes which can function negatively in light signaling and it is expected that either independently or in combination with other genes (such as with AtBBX32, GmBBX52 or GmBBX53) or specific promoters, these polynucleotides and their encoded polypeptides will provide significantly improved yield benefits and resistance to abiotic stress. It is also expected that these polynucleotides and their encoded polypeptides will provide plants with altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence (International Application No. PCT/US2012/029885).It is further expected that the functionally similar orthologs or paralogs of these polynucleotides and their encoded polypeptides, either expressed individually or in combination with other polynucleotides and their encoded polypeptides, will lead to plants with higher yield advantages, improved stress tolerance, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence.
The instant disclosure also identifies several Glycine max B-box genes. Some of the encoded polypeptides of these Glycine max genes may interact with AtBBX32, or may be overexpressed or suppressed, in transgenic soybean plants overexpressing AtBBX32. Some of the encoded polypeptides of these Glycine max genes may interact with GmBBX52 in transgenic soybean plants overexpressing GmBBX52. Since expression of AtBBX32 and its soybean homologs, GmBBX52 and GmBBX53, modulates a variety of traits including yield, it is expected that either independently or in combination with other genes (such as with AtBBX32, GmBBX52 or GmBBX53) or specific promoters, altering the levels of these polynucleotides and their encoded polypeptides will provide plants with significantly improved yield benefits, resistance to abiotic stress, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence. It is also expected that the functionally similar orthologs or paralogs of these polynucleotides and their encoded polypeptides, either expressed individually or in combination with other polynucleotides and their encoded polypeptides, will lead to plants with higher yield advantages, improved stress tolerance, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence. Background Information for BBX32, the BBX32 Clade, and Related Sequences
BBX32 is a B-box zinc finger protein with homology to the CONSTANS family of
transcriptional regulators. BBX32 is expressed in many tissues and may be diurnally regulated.
As disclosed below in the Examples, constitutive expression of BBX32 in Arabidopsis modulates plant growth processes, including elongation of hypocotyls, extended petioles and upheld leaves, early flowering; enhanced root and/or shoot growth in phosphate-limited media; more secondary roots on control media, enhanced growth and reduced anthocyanin in low nitrogen high sucrose media supplemented with glutamine, enhanced root growth on salt-containing media, and enhanced root growth on polyethylene glycol-containing media, as compared to control plants. BBX32 overexpression in soybean plants has been shown to result in a statistically significant increase in yield in field trials (see US Patent No. 7,692,067) as compared to controls that do not contain the BBX32 polynucleotide.
As noted in the Examples presented below, overexpression of BBX32 in Arabidopsis produced several phenotypes consistent with a role of this gene in light regulated development and possibly diurnal or circadian regulated processes. Light exerts a major influence in the initiation and maintenance (resetting) of the plant circadian processes. Early seedling development is light dependent (de-etiolation) and is marked by inhibition of hypocotyl cell elongation along with cotyledon expansion and greening. Light controls morphological changes throughout the life of the plant, either directly or by regulating circadian gene expression. Some of these changes include petiole development, control of growth rate and flowering. It is likely that the ectopic expression of BBX32 product affects light signaling and/or circadian processes. Based upon the observations described above, it is clear that BBX32 is involved in photomorphogenesis and regulating plant growth and development. Hence, its overexpression may improve plant vigor, thus explaining the yield enhancements seen in 35S: :BBX32 soybean plants.
Table 1. Conserved domains and potentially valuable morphological traits of B-box sequences
Column 1 Column 2 Column 3 Column 4 Column 5 Column 6 Column 7
PolySpecies/ GID Percent Amino acid Domain sequence SEQ ID Percent peptide No. identity of coordinates NO: of identity of SEQ ID polypeptide of domain domain domain in
NO: to clade column 5 identifier (no.
identical residues)
AtBBX28 (G1481)clade (clade identifier G1481):
2 At G1481 100.0% to 5-41 CDLCNGVAPvMYCESD 235 100%
G1481 QASLCWDCDGKVHG (37/37)
ANFLVAKH
4 At G900 48.4% to 6-42 CELCCGVAPvMYCESD 236 95%
G1481 QASLCWDCDGKVHG (35/37)
ANFLVAKH
6 Zm/ACN33981. 35.3% to 28-64 CELCGAAARVYCGAD 237 65% 1 G1481 EATLCWGCDAQVHGA (24/37)
NFLVAPvH
8 Pt Pt_568988 37.1% to 89-125 CELCGSSAPvMYCESD 238 84%
G1481 QASLCWDCDEKVHTA (31/37) NFLVAKH
10 Pt Pt_571834 26.5% to 4-40 CELCKNPARTYCESDE 239 73%
G1481 ANLCWNCDTKVHGA (27/37)
NFLVAPvH
12 Pt Pt_582065 35.4% to 4-40 CELCGS S ARMFCES D Q 240 81%
G1481 ASLCWDCDEKVHSAN (30/37)
FLVAKH
14 Pt Pt_758524 28.3% to 4-40 CELCDSFAQMHCESD 241 65%
G1481 QAILCSACDAYVHSAN (24/37)
FLAAKH
16 Os/Os08g08120 34.8% to 24-60 CELCGAAARVYCGAD 242 65% .1 G1481 EATLCWGCDAQVHGA (24/37)
NFLVARH
18 Os/Os08g08120 36.0% to 24-60 CELCGAAARVYCGAD 243 65% .2 G1481 EATLCWGCDAQVHGA (24/37)
NFLVARH
20 Os/Os08g08120 36.3% to 24-60 CELCGAAARVYCGAD 244 65% .3 G1481 EATLCWGCDAQVHGA (24/37)
NFLVARH
22 Gm/Glyma06g3 41.0% to 8-44 CVLCEKRAMMLCDSD 245 70% 9810.1 G1481 QAKLCWECDEKVHSA (26/37)
NFLVAKH
24 Gm/Glyma06g4 38.9% to 4-40 CELCKVPARIFCESDQ 246 76% 5620.1 G1481 ASLCWDCDAKVHSAN (28/37)
FLVARH
26 Gm/G4015 23.7% to 6-42 CELCHQLASLYCPSDS 247 59%
G1481 AFLCFHCDAAVHAAN (22/37)
FLVARH
28 Gm/Glyma09g3 21.0% to 6-42 CALCKKRAMMLCDSD 248 70% 5960.1 G1481 QAKLCWECDEKVHSA (26/37)
NFLVAKH
30 Gm/Glymal2gl 37.1% to 4-40 CELCKVPARIFCESDQ 249 76% 1230.1 G1481 ASLCWDCDAKVHSAN (28/37)
FLVARH
32 Gm/Glymal2g3 41.5% to 4-40 CELCKLPARTFCESDQ 250 78% 2470.1 G1481 ASLCWDCDAKVHGA (29/37)
NFLVARH
34 Gm/G4014 38.1% to 4-40 CELCNS P AKLFCES D Q 251 73%
G1481 ASLCWKCDAKVHSAN (27/37)
FLVTKH
36 Gm/G4016 39.6% to 4-40 CELCKLPARTFCESDQ 252 76%
G1481 ASLCWDCDAKVHGA (28/37)
NFLVERH
38 Gm/Glymal5g0 37.2% to 4-40 CELCNS P AKLFCES D Q 253 73% 7140.1 G1481 ASLCWECDAKVHSAN (27/37)
FLVTKH
AtBBX25 (G1894) clade (clade identifier G1894):
152 At G329 69.2% to 5-42a CDVCEKAPATVICCAD 254 87%
G1894 EAALCPQCDIEIHAAN (33/38)
KLASKH
152 At G329 69.2% to 57-94b CDICQEKAAFIFCVED 255 84%
G1894 RALLCRDCDESIHVAN (32/38)
SRSANH
154 At G1894 100.0% to 5-42a CDVCEKAPATLICCAD 256 100%
G1894 EAALCAKCDVEVHAA (38/38)
NKLASKH
154 At G1894 100.0% to 57-94b CDICLEKAAFIFCVEDR 257 100%
G1894 ALLCRDCDEATHAPN (38/38)
TRSANH
156 Zm/ACF84591. 50.0% to 5-42a CDACEGAAATVVCCA 258 82% 1 G1894 DEAALCA CDVEIHA (31/38)
ANKLASKH
Zm/ACF84591. 50.0% to 57-94b CDVCQEKAAFIFCVED 259 74% 1 G1894 RALFCQDCDEPIHVPG (28/38)
TLSGNH
Zm/ACF86823. 50.4% to 5-42a CDACEGAAATVVCCA 260 82% 1 G1894 DEAALCARCDVEIHA (31/38)
ANKLASKH
Zm/ACF86823. 50.4% to 57-94b CDVCQEKAAFIFCVED 261 76% 1 G1894 RALFCRDCDEPIHVPG (29/38)
TLSGNH
Zm/CAW36812 50.4% to 5-42a CDACEGAAATVVCCA 262 82% .1 G1894 DEAALCARCDVEIHA (31/38)
ANKLASKH
Zm/CAW36812 50.4% to 57-94b CDVCQEKAAFIFCVED 263 76% .1 G1894 RALFCRDCDEPIHVPG (29/38)
TLSGNH
Pt Pt_216458 45.4% to 5-42a CDVCEKAPATVICCAD 264 92%
G1894 EAALCEKCDIEVHAAN (35/38)
KLASKH
Pt Pt_216458 45.4% to 57-94b CDICQEKAAFIFCVED 265 76%
G1894 R ALFCRDCDEPIHS AG (29/38)
SLSANH
Pt Pt_827145 62.7% to 5-42a CDVCEKAPATVICCAD 266 95%
G1894 EAALCAKCDIEVHAA (36/38)
NKLASKH
Pt Pt_827145 62.7% to 57-94b CDICQEKAAFIFCVED 267 76%
G1894 R ALFCRDCDEPIHS AG (29/38)
SLSANH
Os/Os02g39360 49.6% to 5-42a CDACESAAAAVVCCA 268 79% .1 G1894 DEAALCAACDVEVHA (30/38)
ANKLAGKH
Os/Os02g39360 49.6% to 57-94b CDVCQEKAAFIFCVED 269 76% .1 G1894 RALFCRDCDEPIHVPG (29/38)
TLSGNH
Os/Os04g41560 48.1% to 5-42a CDACEAAAATVVCCA 270 82% .2 G1894 DEAALCARCDVEIHA (31/38)
ANKLASKH
Os/Os04g41560 48.1% to 58-95b CDVCQEKAAFIFCVED 271 76% .2 G1894 RALFCRDCDEPIHVPG (29/38)
TLSGNH
Os/Os04g41560 41.8% to 5-42a CDACEAAAATVVCCA 272 82% .4 G1894 DEAALCARCDVEIHA (31/38)
ANKLASKH
Os/Os04g41560 41.8% to 58-95b CDVCQEKAAFIFCVED 273 76% .4 G1894 RALFCRDCDEPIHVPG (29/38)
TLSGNH
Gm/Glymal lgl 58.9% to 5-42a CDVCEKAPATVICCAD 274 97% 3570 G1894 EAALCAKCDVEVHAA (37/38)
NKLASKH
Gm/Glymal lgl 58.9% to 57-94b CDICQDKPAFIFCVED 275 68% 3570.1 G1894 RALFCKDCDEPIHLAS (26/38)
SLSANH
Gm/Glymal2g0 58.7% to 5-42a CDVCEKAPATVICCAD 276 97% 5570.1 G1894 EAALCAKCDVEVHAA (37/38)
NKLASKH
Gm/Glymal2g0 58.7% to 57-94b CDICQDKPAFIFCVED 277 68% 5570.1 G1894 RALFCKDCDEPIHLAS (26/38)
SLSANH
Gm/Glymal3g4 58.1% to 5-42a CDVCERAPATVICCAD 278 95% 1980.1 G1894 EAALCAKCDVEVHAA (36/38) NKLASKH
190 Gm/Glymal3g4 58.1% to 57-94b CDICQDKPAFIFCVED 279 68% 1980.1 G1894 RALFCQDCDEPIHSAG (26/38)
SLSANH
192 Gm/Glymal3g4 39.1% to 24-57a QDKPAFIFCVEDRALF 280 35% 1980.2 G1894 CQDCDEPIHSAGSLSA (12/34)
NH
192 Gm/Glymal3g4 39.1% to 25-57 DKPAFIFCVEDRALFC 281 67% 1980.2 G1894 QDCDEPIHSAGSLSAN (22/33)
H
194 Gm/Glymal3g4 39.1% to 24-57a QDKPAFIFCVEDRALF 282 35% 1980.3 G1894 CQDCDEPIHSAGSLSA (12/34)
NH
194 Gm/Glymal3g4 39.1% to 25-57 DKPAFIFCVEDRALFC 283 67% 1980.3 G1894 QDCDEPIHSAGSLSAN (22/33)
H
196 Gm/Glymal5g0 57.9% to 5-42a CDVCERAPATVICCAD 284 95% 3400.1 G1894 EAALCAKCDVEVHAA (36/38)
NKLASKH
196 Gm/Glymal5g0 57.9% to 57-94b CDICQDKPAFIFCVED 285 68% 3400.1 G1894 RALFCQDCDEPIHSAG (26/38)
SLSANH
198 S1/AAS67368 58.2% to 5-42a CDVCEKAQATVICCA 286 92%
G1894 DEAALCAKCDIEVHA (35/38)
ANKLASKH
198 S1/AAS67368 58.2% to 57-94b CDICQDKAAFIFCVED 287 68%
G1894 RALFCKDCDEAIHSAS (26/38)
SLAKNH
AtBBX20 (G1888) clade (clade identifier G1888):
54 At G1888 100.0% to 5-42a C AVCDKEE AS VFCCA 288 100%
G1888 DEAALCNGCDRHVHF (38/38)
ANKLAGKH
54 At G1888 100.0% to 58-95b CDICGERRALLFCQED 289 100%
G1888 RAILCRECDIPIHQANE (38/38)
HTKKH
56 At G1482 37.4% to 5-42a CD VCDKEE AS VFCTA 290 79%
G1888 DEASLCGGCDHQVHH (30/38)
ANKLASKH
56 At G1482 37.4% to 60-97b CDICQDKKALLFCQQD 291 74%
G1888 RAILCKDCDSSIHAAN (28/38)
EHTKKH
58 Zm/ACG44133. 40.7% to 5-42a CDVCAAEAAS VFCCA 292 76% 1 G1888 DEAALCDACDDRVHR (29/38)
ANKLAGKH
58 Zm/ACG44133. 40.7% to 61-98b CDICQERRGFLFCKED 293 71% 1 G1888 RAILCRECDAPVHSAN (27/38)
DMTRRH
60 Zm/CAW36814 44.4% to 5-42a CDVCAAEAAS VFCCA 294 76% .1 G1888 DEAALCDACDDRVHR (29/38)
ANKLAGKH
60 Zm/CAW36814 44.4% to 61-98b CDICQERRGFLFCKED 295 71% .1 G1888 RAILCRECDAPVHSAN (27/38)
DMTRRH
68 Pt Pt_195637 51.0% to 5-42a CDVCDNVEATVFCCA 296 76%
G1888 DEAALCDGCDHRVHH (29/38)
ANKLASKH
68 Pt Pt_195637 51.0% to 58-95b CDICQERRALLFCQED 297 89%
G1888 RAILCRECDLPIHKAN (34/38)
EHTQKH
70 Pt Pt_550941 39.5% to 5-42a CD VCNKEE AS VFCTA 298 76% G1888 DEAALCDTCDHPvVHH (29/38)
ANKLASKH
Pt Pt_550941 39.5% to 58-95b CDICQEKRAFLFCQQD 299 82%
G1888 RAILCRECDGPIHTAN (31/38)
EHTQKH
Pt Pt_801530 38.2% to 5-42a CDVCSKEEASVFCTAD 300 76%
G1888 EAALCDTCDHRVHHA (29/38)
NKLASKH
Pt Pt_801530 38.2% to 58-95b CDICQDKRAFLFCQQD 301 76%
G1888 RAILCRDCDGPIHTAN (29/38)
EHTQKH
Pt Pt_804174 54.5% to 5-42a CDVCDKVEATVFCCA 302 76%
G1888 DEAALCDGCDHRVHH (29/38)
ANTLASKH
Pt Pt_804174 54.5% to 58-95b CDICQERRAVLFCQED 303 84%
G1888 RAILCRECDLPIHKVN (32/38)
EHTQKH
Os/Os02g43170 37.5% to 5-42a CDVCAAEAASVFCCA 304 76% .1 G1888 DEAALCDACDHRVHR (29/38)
ANKLAGKH
Os/Os02g43170 37.5% to 65-102b CDICQEKRGFLFCKED 305 68% .1 G1888 RAILCRECDVPVHTAS (26/38)
ELTMRH
Os/Os02g43170 43.4% to 5-42a CDVCAAEAASVFCCA 306 76% .2 G1888 DEAALCDACDHRVHR (29/38)
ANKLAGKH
Os/Os02g43170 43.4% to 65-102b CDICQEKRGFLFCKED 307 68% .2 G1888 RAILCRECDVPVHTAS (26/38)
ELTMRH
Os/Os04g45690 37.7% to 5-42a CDVCAAEAASVFCCA 308 79% .1 G1888 DEAALCDACDRRVHS (30/38)
ANKLAGKH
Os/Os04g45690 37.7% to 63-100b CDICQEKRGFLFCKED 309 63% .1 G1888 RAILCRECDVTVHTTS (24/38)
ELTRRH
Os/G5159 37.7% to 5-42a CDVCAAEAASVFCCA 310 79%
G1888 DEAALCDACDRRVHS (30/38)
ANKLAGKH
Os/G5159 37.7% to 63-100b CDICQEKRGFLFCKED 311 63%
G1888 RAILCRECDVTVHTTS (24/38)
ELTRRH
Os/Os06g49880 31.8% to 5-42a CDVCAAEPAAVLCCA 312 68% .1 G1888 DEAALCSACDRRVHR (26/38)
ANRLASKH
Os/Os06g49880 31.8% to 66-103b CDVCREKRGLVFCVE 313 66% .1 G1888 DRAILCADCDEPIHSA (25/38)
NDLTAKH
Os/Os06g49880 31.9% to 5-42a CDVCAAEPAAVLCCA 314 68% .2 G1888 DEAALCSACDRRVHR (26/38)
ANRLASKH
Os/Os06g49880 31.9% to 66-103b CDVCREKRGLVFCVE 315 66% .2 G1888 DRAILCADCDEPIHSA (25/38)
NDLTAKH
G/mGlyma04gO 40.1% to 5-42a CAVCDKVEASVFCSA 316 79% 1120.1 G1888 DEAALCHSCDRTIHHA (30/38)
NKLATKH
G/mGlyma04gO 40.1% to 58-95b CDICQERRAYLFCQED 317 84% 1120.1 G1888 RALLCRECDVPIHRAN (32/38)
EHTQKH
Gm/G5365 39.4% to 5-42a CDVCNKHQASFFCTA 318 71%
G1888 DEAALCDGCDHRVHH (27/38) ANKLASKH
90 Gm/G5365 39.4% to 58-95b CDVCQERRAFVFCQQ 319 71%
G1888 DRAILCKECDVPIHSA (27/38)
NDLTKNH
92 Gm/Glyma04g0 41.7% to 5-42a CDVCNKHQASFFCTA 320 71% 2960.2 G1888 DEAALCDGCDHRVHH (27/38)
ANKLASKH
92 Gm/Glyma04g0 41.7% to 58-95b CDVCQERRAFVFCQQ 321 71% 2960.2 G1888 DRAILCKECDVPIHSA (27/38)
NDLTKNH
94 Gm/Glyma06g0 49.4% to 5-42a CDVCDKVEASVFCPA 322 76% 1140.1 G1888 DEAALCHSCDRTIHRA (29/38)
NKLATKH
94 Gm/Glyma06g0 49.4% to 58-95b CDICQERRAYLFCQED 323 84% 1140.1 G1888 RALLCRECDVPIHRAN (32/38)
EHTQKH
96 Gm/G5367 39.1% to 5-42a CDVCNKQQASLFCTA 324 71%
G1888 DEAALCDGCDHRVHH (27/38)
ANKLASKH
96 Gm/G5367 39.1% to 58-95b CDVCQERRAFVFCQQ 325 68%
G1888 DRAILCKECDVPVHSA (26/38)
NDLTKNH
98 Gm/Glymal lgl 40.8% to 5-42a CDVCHNEVASFFCPSD 326 63% 2060.1 G1888 EASLCHACDRTIHHAN (24/38)
KLADKH
98 Gm/Glymal lgl 40.8% to 58-95b CDICHERRAYLFCKED 327 82% 2060.1 G1888 RAILCRECDLSIHGVN (31/38)
EHTKKH
100 Gm/G5396 43.0% to 5-42a CDVCNKHEASVFCTA 328 76%
G1888 DEAALCDGCDHRVHH (29/38)
ANKLASKH
100 Gm/G5396 43.0% to 58-95b CDICQERRAFTFCQQD 329 76%
G1888 RAILCKECDVSIHSAN (29/38)
EHTLKH
102 Gm/G5400 43.0% to 5-42a CDVCNKHEASVFCTA 330 76%
G1888 DEAALCDGCDHRVHH (29/38)
ANKLASKH
102 Gm/G5400 43.0% to 58-95b CDICQERRAFTFCQQD 331 76%
G1888 RAILCKECDVSIHSAN (29/38)
EHTLKH
AtBBX26 (G1486) clade (clade identifier G1486):
52 At G1486 100.0% to 5-41 CHTCRHVTAVIHCVTE 332 100%
G1486 ALNFCLTCDNLRHHN (37/37)
NIHAEH
AtBBX30 (G1478) or AtBBX31 (G1929) clade (clade identifier G1478):
40 At G1478 100.0% to 32-68 CELCGENATVYCEAD 333 100%
G1478 AAFLCRKCDRWVHSA (37/37)
NFLARRH
42 At G1929 62.3% to 31-67 CELCDGDASVFCEADS 334 78%
G1478 AFLCRKCDRWVHGAN (29/37)
FLAWRH
44 Pt Pt_562313 43.2% to 32-68 CELCGSRASLYCQAD 335 73%
G1478 DAFLCQKCDKWVHG (27/37)
ANFLAQRH
46 Pt Pt_594447 44.1% to 31-67 CELCGSRATLYCQAD 336 76%
G1478 HAFLCQKCDGWVHG (28/37)
ANFLALRH
48 Gm/Glymal2g3 43.8% to 30-66 CELCGLQASLYCQAD 337 68% 2230.1 G1478 DAYLCKKCDKRVHEA (25/37) NFLALPvH
50 Gm/G4019 40.6% to 30-66 CELCGLQASLYCQAD 338 70%
G1478 DAYLCPvKCDKPvVHEA (26/37)
NFLALRH
AtBBX7 (G2440) or AtBBX8 (G1479) clade (clade identifier G2440):
104 At G2440 100.0% to 5-42a CDFCGEQRSMVYCRS 339 100%
G2440 DAACLCLSCDRSVHSA (38/38)
NALSKRH
104 At G2440 100.0% to 48-94b CERCNAQPATVRCVE 340 96%
G2440 ERVSLCQNCDWS GHN (45/47)
NSNN SSSSSTSPQQ
H
104 At G2440 100.0% to 315-356° RN AVMRYKEKKKA 341 100%
G2440 RKFDKR VR Y AS RK AR (42/42)
ADVRRRVKGRFVK
106 At G1479 70.1% to 5-42a CDFCGEQRSMVYCRS 342 97%
G2440 DAACLCLSCDRNVHS (37/38)
ANALSKRH
106 At G1479 70.1% to 48-87b CERCN AQP AS VRC S DE 343 80%
G2440 R VSLCQNCDWS GHDG (32/40)
KNSTTTSHH
106 At G1479 70.1% to 316-357° RNNAVMRYKEKKKA 344 95%
G2440 RKFDKR VRYVSRKER (40/42)
ADVRRRVKGRFVK
108 Zm/ACF80403. 49.6% to 5-42a CGFCGKQRSMIYCRSD 345 87% 1 G2440 AASLCLSCDRSVHSAN (33/38)
ALSRRH
108 Zm/ACF80403. 49.6% to 48-85b CDRCGLQPASVRCLED 346 55% 1 G2440 NTSLCQNCDWNGHDA (21/38)
ASGASGH
108 Zm/ACF80403. 49.6% to 349-390° RDSALTRYKEKKKKR 347 76% 1 G2440 MFDKKIRYASRKARA (32/42)
DVRKRVKGRFIK
110 Zm/ACG34885. 50.4% to 5-42a CDFCGEQRSMVYCRS 348 92% 1 G2440 DAASLCLSCDRNVHS (35/38)
AN ALSRRH
110 Zm/ACG34885. 50.4% to 48-85b CDRC AS QP AM VRCL A 349 58% 1 G2440 ENASLCQNCDWNGHI (22/38)
AGSSSAGH
110 Zm/ACG34885. 50.4% to 350-391° RDSALTRYKEKKMRR 350 79% 1 G2440 KFDKKIRYASRKARA (33/42)
DVRKRVKGRFVK
114 Zm/ACN25813. 47.1% to 5-42a CDFCGKQRSMIYCRSD 351 87% 1 G2440 AASLCLSCDRNVHSA (33/38)
NALSRRH
114 Zm/ACN25813. 47.1% to 48-85b CDRCGSQPASVRCLED 352 55% 1 G2440 NASLCQNCDWNGHD (21/38)
AESGASGH
114 Zm/ACN25813. 47.1% to 372-391° YASRKARADVRKRVK 353 90% 1 G2440 GRFIK (18/20)
120 Pt Pt_247140 59.7% to 5-42a CDFCGEQRSMVYCRS 354 95%
G2440 DAASLCLSCDRNVHS (36/38)
ANALSKRH
120 Pt Pt_247140 59.7% to 48-85b CERCNS QP AL VRC AEE 355 74%
G2440 RISLCQNCDWIGHGTS (28/38)
TSASTH
120 Pt Pt_247140 59.7% to 322-363° RS D A VMR YKEKKKTR 356 86%
G2440 MFEKK VR Y AS RK AR A (36/42)
DVRRRVKGRFVK
122 Pt Pt_409151 59.9% to 5-42a CDFCGEQRSMVYCRS 357 95% G2440 DAACLCLSCDQIVHSA (36/38)
NALSK H
122 Pt Pt_409151 59.9% to 48-85b CEPvCNS QP AL VRR VEE 358 71%
G2440 RISLCQNCDWMGYGS (27/38)
STSASTH
122 Pt Pt_409151 59.9% to 322-363° RSDAVKRYMEKKKTR 359 83%
G2440 KEEKKVRY AS RKARA (35/42)
DVRRRVKGRFVK
124 Os/Os02g49230 51.7% to 5-42a CDFCREQRSMVYCRS 360 89% .1 G2440 DAASLCLSCDRNVHS (34/38)
ANALSRRH
124 Os/Os02g49230 51.7% to 48-85b CDRCVGQPAAVRCLE 361 61% .1 G2440 ENTSLCQNCDWNGHG (23/38)
AASSAAGH
124 Os/Os02g49230 51.7% to 350-391° RDNALTRYKEKKKRR 362 83% .1 G2440 KFDKKIRYASRKARA (35/42)
DVRKRVKGRFVK
126 Os/Os02g49230 44.2% to 78-115a CDFCREQRSMVYCRS 363 89% .2 G2440 DAASLCLSCDRNVHS (34/38)
ANALSRRH
126 Os/Os02g49230 44.2% to 121-158b CDRCVGQPAAVRCLE 364 61% .2 G2440 ENTSLCQNCDWNGHG (23/38)
AASSAAGH
126 Os/Os02g49230 44.2% to 423-464° RDNALTRYKEKKKRR 365 83% .2 G2440 KFDKKIRYASRKARA (35/42)
DVRKRVKGRFVK
128 Os/Os02g49230 51.7% to 5-42a CDFCREQRSMVYCRS 366 89% .3 G2440 DAASLCLSCDRNVHS (34/38)
ANALSRRH
128 Os/Os02g49230 51.7% to 48-85b CDRCVGQPAAVRCLE 367 61% .3 G2440 ENTSLCQNCDWNGHG (23/38)
AASSAAGH
128 Os/Os02g49230 51.7% to 350-391° RDNALTRYKEKKKRR 368 83% .3 G2440 KFDKKIRYASRKARA (35/42)
DVRKRVKGRFVK
130 Os/Os02g49230 51.7% to 5-42a CDFCREQRSMVYCRS 369 89% .4 G2440 DAASLCLSCDRNVHS (34/38)
ANALSRRH
130 Os/Os02g49230 51.7% to 48-85b CDRCVGQPAAVRCLE 370 61% .4 G2440 ENTSLCQNCDWNGHG (23/38)
AASSAAGH
130 Os/Os02g49230 51.7% to 350-391° RDNALTRYKEKKKRR 371 83% .4 G2440 KFDKKIRYASRKARA (35/42)
DVRKRVKGRFVK
132 Os/Os02g49230 51.8% to 5-42a CDFCREQRSMVYCRS 372 89% .5 G2440 DAASLCLSCDRNVHS (34/38)
ANALSRRH
132 Os/Os02g49230 51.8% to 48-85b CDRCVGQPAAVRCLE 373 61% .5 G2440 ENTSLCQNCDWNGHG (23/38)
AASSAAGH
132 Os/Os02g49230 51.8% to 349-390° RDNALTRYKEKKKRR 374 83% .5 G2440 KFDKKIRYASRKARA (35/42)
DVRKRVKGRFVK
134 Os/Os02g49230 51.7% to 5-42a CDFCREQRSMVYCRS 375 89% .6 G2440 DAASLCLSCDRNVHS (34/38)
ANALSRRH
134 Os/Os02g49230 51.7% to 48-85b CDRCVGQPAAVRCLE 376 61% .6 G2440 ENTSLCQNCDWNGHG (23/38)
AASSAAGH
134 Os/Os02g49230 51.7% to 350-391° RDNALTRYKEKKKRR 377 83% .6 G2440 KFDKKIRYASRKARA (35/42) DVRKRVKGRFVK
136 Os/Os06gl9444 51.7% to 5-42a CDFCGEQRSMVYCRS 378 92% .1 G2440 DAASLCLSCDRNVHS (35/38)
ANALSRRH
136 Os/Os06gl9444 51.7% to 48-85b CDRC AS QP AM VRCL V 379 58% .1 G2440 ENASLCQNCDWNGHS (22/38)
AGSSAAGH
136 Os/Os06gl9444 51.7% to 373-392° YASRKARADVRKRVK 380 95% .1 G2440 GRFVK (19/20)
138 Os/Os06gl9444 51.8% to 5-42a CDFCGEQRSMVYCRS 381 92% .2 G2440 DAASLCLSCDRNVHS (35/38)
ANALSRRH
138 Os/Os06gl9444 51.8% to 48-85b CDRC AS QP AM VRCL V 382 58% .2 G2440 ENASLCQNCDWNGHS (22/38)
AGSSAAGH
138 Os/Os06gl9444 51.8% to 372-391° YASRKARADVRKRVK 383 95% .2 G2440 GRFVK (19/20)
140 Gm/Glyma02g3 56.3% to 5-42a CDFCGDQRSLVYCRS 384 87% 8870.1 G2440 DSACLCLSCDRNVHSA (33/38)
NALSRRH
140 Gm/Glyma02g3 56.3% to 48-85b CERCNSQPAFVRSVEE 385 68% 8870.1 G2440 KISLCQNCDWLGHGTS (26/38)
PSSSMH
140 Gm/Glyma02g3 56.3% to 348-389° RSNAVMRYKEKKKTR 386 88% 8870.1 G2440 KFEKKVRY AS RKARA (37/42)
DVRKRVKGRFVK
142 Gm/Glymal3gl 36.6% to
1590.1 G2440
142 Gm/Glymal3gl 36.6% to
1590.1 G2440
142 Gm/Glymal3gl 36.6% to 224-265° RSNAVMRYKEKKKTR 387 90% 1590.1 G2440 MFDKKVRYASRKARA (38/42)
DVRRRVKGRFVK
144 Gm/Glymal4g3 55.3% to 5-42a CDFCGDQRSLVYCRS 388 89% 6930.1 G2440 DAACLCLSCDRNVHS (34/38)
ANALSRRH
144 Gm/Glymal4g3 55.3% to 48-85b CERCNS QP AF VRC VDE 389 68% 6930.1 G2440 KISLCQNCDWLGHGTS (26/38)
PSSSTH
144 Gm/Glymal4g3 55.3% to 354-395° RSNAVMRYKEKKKTR 390 88% 6930.1 G2440 KFEKKVRY AS RKARA (37/42)
DVRKRVKGRFVK
146 Gm/Glymal4g3 55.3% to 5-42a CDFCGDQRSLVYCRS 391 89% 6930.2 G2440 DAACLCLSCDRNVHS (34/38)
ANALSRRH
146 Gm/Glymal4g3 55.3% to 48-85b CERCNS QP AF VRC VDE 392 68% 6930.2 G2440 KISLCQNCDWLGHGTS (26/38)
PSSSTH
146 Gm/Glymal4g3 55.3% to 354-395° RSNAVMRYKEKKKTR 393 88% 6930.2 G2440 KFEKKVRY AS RKARA (37/42)
DVRKRVKGRFVK
148 Gm/Glyma20g0 37.4% to
7050.1 G2440
148 Gm/Glyma20g0 37.4% to
7050.1 G2440
148 Gm/Glyma20g0 37.4% to 226-267° RSNAVMRYKEKKKTR 394 90% 7050.1 G2440 MFDKKVRYASRKARA (38/42)
DVRRRVKGRFVK
150 Gm/Glyma20g0 37.4% to
7050.2 G2440
150 Gm/Glyma20g0 37.4% to 7050.2 G2440
150 Gm/Glyma20g0 37.4% to 226-267° SNAVM YKEKKKT 395 90% 7050.2 G2440 MFDKKVRYASRKARA (38/42)
DVRRRVKGRFVK
AtBBX19 (G902) or AtBBX18 (G1881) clade (clade identifier G902):
200 At G902 100.0% to 5-42a CDACENAAAIIFCAAD 396 100%
G902 EAALCRPCDEKVHMC (38/38)
NKLASRH
200 At G902 100.0% to 56-91b CDICENAPAFFYCEIDG 397 100%
G902 S SLCLQCDM V VH VGG (36/36)
KRTH
202 At G1881 70.1% to 5-42a CDACESAAAIVFCAAD 398 87%
G902 EAALCCSCDEKVHKC (33/38)
NKLASRH
202 At G1881 70.1% to 56-91b CDICENAPAFFYCEIDG 399 100%
G902 S SLCLQCDM VVH VGG (36/36)
KRTH
204 Zm/ACF85933. 57.5% to 5-42a CDVCESAPAVLFCAA 400 87% 1 G902 DEAALCRPCDEKVHM (33/38)
CNKLASRH
204 Zm/ACF85933. 57.5% to 56-91b CDICENSPAFFYCEIDG 401 89% 1 G902 TSLCLSCDMTVHVGG (32/36)
KRTH
208 Zm/ACL52378. 57.8% to 5-42a CDVCESAPAVLFCAA 402 87% 1 G902 DEAALCRPCDEKVHM (33/38)
CNKLASRH
208 Zm/ACL52378. 57.8% to 56-91b CDICENSPAFFYCEIDG 403 89% 1 G902 TSLCLSCDMTVHVGG (32/36)
KRTH
212 Pt Pt_648693 61.4% to 5-42a CDVCESAAAILFCAAD 404 89%
G902 EAALCRSCDEKVHMC (34/38)
NKLASRH
212 Pt Pt_648693 61.4% to 56-91b CDICEKAPAFFYCEIDG 405 94%
G902 S SLCLQCDMI VH VGG (34/36)
KRTH
214 Pt Pt_721866 61.0% to 5-42a CDVCESAAAILFCAAD 406 87%
G902 EAALCRSCDEKVHLC (33/38)
NKLASRH
214 Pt Pt_721866 61.0% to 56-91b CDICENAPAFFYCEIDG 407 97%
G902 S SLCLQCDMI VH VGG (35/36)
KRTH
216 Pt Pt_741179 54.5% to 5-42a CDACESAFAIVFCAAD 408 84%
G902 EAALCLACDKKVHMC (32/38)
NKLASRH
216 Pt Pt_741179 54.5% to 56-91b CDICENAPAFFYCETD 409 94%
G902 GSSLCLQCDMTVHVG (34/36)
GKRTH
218 Pt Pt_820080 56.2% to 5-42a CDACESAAAIVFCAAD 410 89%
G902 EAALCLACDEKVHMC (34/38)
NKLASRH
218 Pt Pt_820080 56.2% to 56-91b CDICENAPAFFYCETD 411 94%
G902 GSSLCLQCDMTVHVG (34/36)
GKRTH
220 Os/Os09g35880 57.1% to 5-42a CDVCESAPAVLFCVA 412 79% .1 G902 DEAALCRSCDEKVHM (30/38)
CNKLARRH
220 Os/Os09g35880 57.1% to 56-91b CDICENAPAFFYCEIDG 413 92% .1 G902 TSLCLSCDMTVHVGG (33/36)
KRTH
222 Gm/Glyma01g3 55.2% to 5-42a CDACESAAAIVFCAAD 414 92% 7370.1 G902 EAALC ACDEKVHMC (35/38)
NKLASRH
222 Gm/Glyma01g3 55.2% to 56-91b CDICENAPAFFYCETD 415 94% 7370.1 G902 GSSLCLQCDMIVHVG (34/36)
GKRTH
224 Gm/Glymal lgO 56.7% to 5-42a CDACESAAAIVFCAAD 416 92% 7930.1 G902 EAALCRACDEKVHMC (35/38)
NKLASRH
224 Gm/Glymal lgO 56.7% to 56-91b CDICENAPAFFYCETD 417 94% 7930.1 G902 GSSLCLQCDMIVHVG (34/36)
GKRTH
226 Gm/Glymal lgO 55.7% to 5-42a CDACESAAAIVFCAAD 418 92% 7930.2 G902 EAALCRACDEKVHMC (35/38)
NKLASRH
226 Gm/Glymal lgO 55.7% to 56-91b CDICENAPAFFYCETD 419 94% 7930.2 G902 GSSLCLQCDMIVHVG (34/36)
GKRTH
228 Gm/Glymal lgO 55.7% to 5-42a CDACESAAAIVFCAAD 420 92% 7930.3 G902 EAALCRACDEKVHMC (35/38)
NKLASRH
228 Gm/Glymal lgO 55.7% to 56-91b CDICENAPAFFYCETD 421 94% 7930.3 G902 GSSLCLQCDMIVHVG (34/36)
GKRTH
230 Gm/Glymal lgO 56.2% to 5-42a CDACESAAAIVFCAAD 422 92% 7930.4 G902 EAALCRACDEKVHMC (35/38)
NKLASRH
230 Gm/Glymal lgO 56.2% to 56-91b CDICENAPAFFYCETD 423 94% 7930.4 G902 GSSLCLQCDMIVHVG (34/36)
GKRTH
232 Gm/Glymal lgl 58.0% to 5-42a CDVCESAAAILFCAAD 424 82% 1850.1 G902 EAALCSACDHKIHMC (31/38)
NKLASRH
232 Gm/Glymal lgl 58.0% to 56-91b CDICENAPAFFYCEIDG 425 97% 1850.1 G902 S SLCLQCDMI VH VGG (35/36)
KRTH
234 Gm/Glymal2g0 62.2% to 5-42a CDVCESAAAIVFCAAD 426 82% 4130.1 G902 EAALCSACDHKIHMC (31/38)
NKLASRH
234 Gm/Glymal2g0 62.2% to 56-91b CDICENAPAFFYCEIDG 427 97% 4130.1 G902 S SLCLQCDMI VH VGG (35/36)
KRTH
Species abbreviations for Table 1 : At - Arabidopsis thaliana; Gm - Glycine max; Os - Oryza sativa; Pt - Populus trichocarpa; SI - Solarium lycopersicum; Zm - Zea mays.
a first B-box type ZF domain
b second B-box type ZF domain
° putative CCT nuclear localization domain
Exemplary polynucleotides encoding the polypeptides of soybean B-box proteins (GmBBX) as represented in Table 2 were identified from yeast two hybrid screens and from phylogenetic analysis.
Table 2. Gl cine max B-box ol nucleotide and ol e tide se uences (GmBBX).
Figure imgf000032_0001
441 442 GmBBX4 zf-B_box[2]::CCT
443 444 GmBBX5 zf-B_box[2]::CCT
445 446 GmBBX6 zf-B_box[2]::CCT
447 448 GmBBX7 zf-B_box[2]
449 450 GmBBXl l zf-B_box[2]::CCT
451 452 GmBBX12 zf-B_box[2]::CCT
453 454 GmBBX13 zf-B_box[l]::CCT
455 456 GmBBX14 zf-B_box[l]::CCT
457 458 GmBBX15 zf-B_box[l]::CCT
459 460 GmBBX16 zf-B_box[l]::CCT
461 462 GmBBX17 zf-B_box[l]::CCT
463 464 GmBBX18 zf-B_box[l]::CCT
465 466 GmBBX19 zf-B_box[2]::CCT
467 468 GmBBX20 zf-B_box[2]::CCT
469 470 GmBBX21 zf-B_box[2]::CCT
471 472 GmBBX22 zf-B_box[2]::CCT
473 474 GmBBX23 zf-B_box[2]
475 476 GmBBX24 zf-B_box[l]::CCT
477 478 GmBBX25 zf-B_box[2]::CCT
479 480 GmBBX26 zf-B_box[2]::CCT
481 482 GmBBX27 zf-B_box[2]
483 484 GmBBX28 zf-B_box[2]
485 486 GmBBX29 zf-B_box[2]::CCT
487 488 GmBBX30 zf-B_box[2]::CCT
489 490 GmBBX31 zf-B_box[2]
491 492 GmBBX33 zf-B_box[2]
493 494 GmBBX34 zf-B_box[2]
495 496 GmBBX35 zf-B_box[2]
497 498 GmBBX36 zf-B_box[2]
499 500 GmBBX37 zf-B_box[2]
501 502 GmBBX38 zf-B_box[2]
503 504 GmBBX39 zf-B_box[2]
505 506 GmBBX40 zf-B_box[2]
507 508 GmBBX41 zf-B_box[2]
509 510 GmBBX42 zf-B_box[2]
511 512 GmBBX43 zf-B_box[2]
513 514 GmBBX44 zf-B_box[2]
515 516 GmBBX45 zf-B_box[2]
517 518 GmBBX46 zf-B_box[2]
519 520 GmBBX47 zf-B_box[2]
521 522 GmBBX48 zf-B_box[2]
523 524 GmBBX49 zf-B_box[2]
525 526 GmBBX50 zf-B_box[l]
527 528 GmBBX51 zf-B_box[l]
529 530 GmBBX52 zf-B_box[l]
531 532 GmBBX53 zf-B_box[l]
533 534 GmBBX54 zf-B_box[l]
535 536 GmBBX55 zf-B_box[l]
537 538 GmBBX56 zf-B_box[l]
539 540 GmBBX57 zf-B_box[l]
541 542 GmBBX58 zf-B_box[l]
543 544 GmBBX59 zf-B_box[l]
545 546 GmBBX60 zf-B_box[l]
547 548 GmBBX61 zf-B_box[l] 549 550 GmBBX62 zf-B_box[l]
Abbreviations for Table 2
zf-B_box[l]: first B-box type zinc finger domain
zf-B_box[2]: second B-box type zinc finger domain
CCT: nuclear localization domain
Gm: Glycine max
Orthologs and Paralogs
Homologous sequences as described above can comprise orthologous or paralogous sequences. Several different methods are known by those of skill in the art for identifying and defining these functionally homologous sequences. General methods for identifying orthologs and paralogs, including phylogenetic methods, sequence similarity and hybridization methods, are described herein; an ortholog or paralog, including equivalogs, may be identified by one or more of the methods described below.
As described by Eisen, 1998, evolutionary information may be used to predict gene function. It is common for groups of genes that are homologous in sequence to have diverse, although usually related, functions. However, in many cases, the identification of homo logs is not sufficient to make specific predictions because not all homo logs have the same function. Thus, an initial analysis of functional relatedness based on sequence similarity alone may not provide one with a means to determine where similarity ends and functional relatedness begins. Fortunately, it is well known in the art that protein function can be classified using phylogenetic analysis of gene trees combined with the corresponding species. Functional predictions can be greatly improved by focusing on how the genes became similar in sequence (i.e., by evolutionary processes) rather than on the sequence similarity itself (Eisen, 1998). In fact, many specific examples exist in which gene function has been shown to correlate well with gene phylogeny (Eisen, 1998). Thus, "[t]he first step in making functional predictions is the generation of a phylogenetic tree representing the evolutionary history of the gene of interest and its homologs. Such trees are distinct from clusters and other means of characterizing sequence similarity because they are inferred by techniques that help convert patterns of similarity into evolutionary relationships ...After the gene tree is inferred, biologically determined functions of the various homologs are overlaid onto the tree. Finally, the structure of the tree and the relative phylogenetic positions of genes of different functions are used to trace the history of functional changes, which is then used to predict functions of [as yet] uncharacterized genes" (Eisen, supra).
Within a single plant species, gene duplication may cause two copies of a particular gene, giving rise to two or more genes with similar sequence and often similar function known as paralogs. A paralog is therefore a similar gene formed by duplication within the same species. Paralogs typically cluster together or in the same clade (a group of similar genes) when a gene family phylogeny is analyzed using programs such as CLUSTAL (Thompson et al., 1994; Higgins et al., 1996). Groups of similar genes can also be identified with pair-wise BLAST analysis (Feng and Doolittle, 1987). For example, a clade of very similar MADS domain transcriptional regulators from Arabidopsis all share a common function in flowering time (Ratcliffe et al., 2001), and a group of very similar AP2 domain transcriptional regulators from Arabidopsis are involved in tolerance of plants to freezing (Gilmour et al., 1998). Analysis of groups of similar genes with similar function that fall within one clade can yield sub-sequences that are particular to the clade. These sub-sequences, known as consensus sequences, can not only be used to define the sequences within each clade, but define the functions of these genes; genes within a clade may contain paralogous sequences, or orthologous sequences that share the same function (see also, for example, Mount, 2001).
Transcriptional regulator gene sequences are conserved across diverse eukaryotic species lines (Goodrich et al., 1993; Lin et al., 1991 ; Sadowski et al., 1988). Plants are no exception to this observation; diverse plant species possess transcriptional regulators that have similar sequences and functions. Speciation, the production of new species from a parental species, gives rise to two or more genes with similar sequence and similar function. These genes, termed orthologs, often have an identical function within their host plants and are often interchangeable between species without losing function. Because plants have common ancestors, many genes in any plant species will have a corresponding orthologous gene in another plant species. Once a phylogenic tree for a gene family of one species has been constructed using a program such as CLUSTAL (Thompson et al., 1994; Higgins et al., 1996) potential orthologous sequences can be placed into the phylogenetic tree and their relationship to genes from the species of interest can be determined. Orthologous sequences can also be identified by a reciprocal BLAST strategy. Once an orthologous sequence has been identified, the function of the ortholog can be deduced from the identified function of the reference sequence.
By using a phylogenetic analysis, one skilled in the art would recognize that the ability to predict similar functions conferred by closely-related polypeptides is predictable. This predictability has been confirmed by our own many studies in which we have found that a wide variety of polypeptides have orthologous or closely-related homologous sequences that function as does the first, closely-related reference sequence. For example, distinct transcriptional regulators, including:
(i) AP2 family Arabidopsis G47 (found in US Patent No. 7, 135,616), a phylogenetically-related sequence from soybean, and two phylogenetically-related homologs from rice all can confer greater tolerance to drought, hyperosmotic stress, or delayed flowering as compared to control plants;
(ii) CAAT family Arabidopsis G481 (found in PCT patent publication WO2004076638), and numerous phylogenetically-related sequences from dicots and monocots can confer greater tolerance to drought-related stress as compared to control plants;
(iii) Myb-related Arabidopsis G682 (found in PCT patent publication WO2004076638) and numerous phylogenetically-related sequences from dicots and monocots can confer greater tolerance to heat, drought-related stress, cold , and salt as compared to control plants;
(iv) WRKY family Arabidopsis G1274 (found in US patent 7,196,245) and numerous closely- related sequences from dicots and monocots have been shown to confer increased water deprivation tolerance, and
(v) AT-hook family soy sequence G3456 (found in US Patent publication US20040128712A1) and numerous phylogenetically-related sequences from dicots and monocots, increased biomass compared to control plants when these sequences are overexpressed in plants. The polypeptides sequences belong to distinct clades of polypeptides that include members from diverse species. In each case, most or all of the clade member sequences derived from both dicots and monocots have been shown to confer increased yield or tolerance to one or more abiotic stresses when the sequences were overexpressed. These studies each demonstrate that evolutionarily conserved genes from diverse species are likely to function similarly (i.e., by regulating similar target sequences and controlling the same traits), and that polynucleotides from one species may be transformed into closely- related or distantly-related plant species to confer or improve traits.
As shown in Table 1 and Table 2, polypeptides that are phylogenetically related to disclosed polypeptides, including SEQ ID NOs: 2n, where n=l to 117 or 218 to 275, may have conserved domains that share at least 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or about 100% amino acid sequence identity to the listed sequences, for example, SEQ ID NOs: 235-427, and have similar functions in that the disclosed and closely related polypeptides may, when overexpressed, confer at least one trait selected from the group consisting of decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased secondary rooting, greater cold tolerance, greater tolerance to water deprivation, reduced stomatal conductance, altered C N sensing, increased low nitrogen tolerance, greater late season growth and vigor, greater number of primary nodes, greater late season canopy coverage, increased tolerance to hyperosmotic stress, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence, as compared to a control plant.
At the nucleotide level, sequences that are closely related to the disclosed polynucleotide sequences will typically share at least about 30% or at least 40%, at least 41 %, at least 42%, at least 43%, at least 44%, at least 45%, at least 46%, at least 47%, at least 48%, or at least 49% nucleotide sequence identity, preferably at least about 50%, at least 51 %, at least 52%, at least 53%, at least 54%, at least 55%, at least 56%, at least 57%, at least 58%, or at least 59% nucleotide sequence identity, or at least 60%, or at least 61%, or at least 62%, or at least 63%, or at least 64%, or at least 65%, or at least 66%, or at least 67%, or at least 68%, or at least 69%, or at least 70%, or at least 71%, or at least 72%, or at least 73%, or at least 74%, or at least 75%, or at least 76%, or at least 77%, or at least 78%, or at least 79%, or at least 80%, or at least 81%, or at least 82%, or at least 83%, or at least 84%, or at least 85%, or at least 86%, or at least 87%, or at least 88%, or at least 89%, or at least 90%, or at least 91%, or at least 92%, or at least 93%, or at least 94%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or about 100% sequence identity to one or more of the listed full-length polynucleotide sequences, or to a polynucleotide sequence encoding a conserved domain of a listed polypeptide sequence. The degeneracy of the genetic code enables major variations in the nucleotide sequence of a polynucleotide while maintaining the amino acid sequence of the encoded protein. Polynucleotides that encode polypeptides that are closely-related, that is, orthologous or paralogous, to the disclosed polypeptide sequences will be identifiable by having at least any of the percentage identities provided in this paragraph.
At the polypeptide level, sequences that are closely related to the disclosed polypeptide sequences will typically share at least about 30% or at least 40%, at least 41 %, at least 42%, at least 43%, at least 44%, at least 45%, at least 46%, at least 47%, at least 48%, or at least 49% amino acid sequence identity, preferably at least about 50%, at least 51%, at least 52%, at least 53%, at least 54%, at least 55%, at least 56%, at least 57%, at least 58%, or at least 59% nucleotide sequence identity, or at least 60%, or at least 61%, or at least 62%, or at least 63%, or at least 64%, or at least 65%, or at least 66%, or at least 67%, or at least 68%, or at least 69%, or at least 70%, or at least 71%, or at least 72%, or at least 73%, or at least 74%, or at least 75%, or at least 76%, or at least 77%, or at least 78%, or at least 79%, or at least 80%, or at least 81%, or at least 82%, or at least 83%, or at least 84%, or at least 85%, or at least 86%, or at least 87%, or at least 88%, or at least 89%, or at least 90%, or at least 91%, or at least 92%, or at least 93%, or at least 94%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or about 100% sequence identity to one or more of the listed full-length polypeptide sequences, or to conserved domain of a listed full length sequence, or to a listed conserved domain, or to a listed polypeptide sequence but excluding or outside of the region(s) encoding a known consensus sequence or consensus DNA-binding site, or outside of the region(s) encoding one or all conserved domains.
Polypeptides, or their domains, that are closely-related, that is, orthologous or paralogous, to the disclosed polypeptide sequences, or their domains, will be identifiable by having at least any of the percentage identities provided in this paragraph.
Percent identity can be determined electronically, e.g., by using the MEGALIGN program (DNASTAR, Inc. Madison, Wis.). The MEGALIGN program can create alignments between two or more sequences according to different methods, for example, the clustal method (see, for example, Higgins and Sharp, 1988). The clustal algorithm groups sequences into clusters by examining the distances between all pairs. The clusters are aligned pairwise and then in groups. Other alignment algorithms or programs may be used, including FASTA, BLAST, or ENTREZ, FASTA and BLAST, and which may be used to calculate percent similarity. These are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, WI), and can be used with or without default settings. ENTREZ is available through the National Center for Biotechnology Information. In one embodiment, the percent identity of two sequences can be determined by the GCG program with a gap weight of 1, e.g., each amino acid gap is weighted as if it were a single amino acid or nucleotide mismatch between the two sequences (see USPN 6,262,333).
Software for performing BLAST analyses is publicly available, e.g., through the National Center for Biotechnology Information (see internet website at www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul, 1990; Altschul et al., 1993). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11 , an expectation (E) of 10, a cutoff of 100, M=5, N=-4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, 1989). Unless otherwise indicated for comparisons of predicted polynucleotides, "sequence identity" refers to the % sequence identity generated from a tBlastx using the NCBI version of the algorithm at the default settings using gapped alignments with the filter "off (see, for example, internet website at www.ncbi.nlm.nih.gov/).
Other techniques for alignment are described by Doolittle, 1996. Preferably, an alignment program that permits gaps in the sequence is utilized to align the sequences. The Smith-Waterman is one type of algorithm that permits gaps in sequence alignments (see Shpaer, 1997). Also, the GAP program using the Needleman and Wunsch alignment method can be utilized to align sequences. An alternative search strategy uses MPSRCH software, which runs on a MASPAR computer. MPSRCH uses a Smith- Waterman algorithm to score sequences on a massively parallel computer. This approach improves ability to pick up distantly related matches, and is especially tolerant of small gaps and nucleotide sequence errors. Nucleic acid-encoded amino acid sequences can be used to search both protein and DNA databases.
The percentage similarity between two polypeptide sequences, e.g., sequence A and sequence B, is calculated by dividing the length of sequence A, minus the number of gap residues in sequence A, minus the number of gap residues in sequence B, into the sum of the residue matches between sequence A and sequence B, times one hundred. Gaps of low or of no similarity between the two amino acid sequences are not included in determining percentage similarity. Percent identity between polynucleotide sequences can also be counted or calculated by other methods known in the art, e.g., the Jotun Hein method (see, for example, Hein, 1990). Identity between sequences can also be determined by other methods known in the art, e.g., by varying hybridization conditions (see US Patent Application No. 20010010913).
Thus, the present disclosure provides methods for identifying a sequence similar or paralogous or orthologous or homologous to one or more polynucleotides as noted herein, or one or more target polypeptides encoded by the polynucleotides, or otherwise noted herein and may include linking or associating a given plant phenotype or gene function with a sequence. In the methods, a sequence database is provided (locally or across an internet or intranet) and a query is made against the sequence database using the relevant sequences herein and associated plant phenotypes or gene functions.
In addition, one or more polynucleotide sequences or one or more polypeptides encoded by the polynucleotide sequences may be used to search against a BLOCKS (Bairoch et al., 1997), PFAM, and other databases which contain previously identified and annotated motifs, sequences and gene functions. Methods that search for primary sequence patterns with secondary structure gap penalties (Smith et al., 1992) as well as algorithms such as Basic Local Alignment Search Tool (BLAST; Altschul, 1990; Altschul et al., 1993), BLOCKS (Henikoff and Henikoff, 1991), Hidden Markov Models (HMM; Eddy, 1996; Sonnhammer et al., 1997), and the like, can be used to manipulate and analyze polynucleotide and polypeptide sequences encoded by polynucleotides. These databases, algorithms and other methods are well known in the art and are described in Ausubel et al., 1997, and in Meyers, 1995.
A further method for identifying or confirming that specific homologous sequences control the same function is by comparison of the transcript profile(s) obtained upon overexpression or knockout of two or more related polypeptides. Since transcript profiles are diagnostic for specific cellular states, one skilled in the art will appreciate that genes that have a highly similar transcript profile (e.g., with greater than 50% regulated transcripts in common, or with greater than 70% regulated transcripts in common, or with greater than 90% regulated transcripts in common) will have highly similar functions. Fowler and Thomashow, 2002, have shown that three paralogous AP2 family genes (CBF1, CBF2 and CBF3) are induced upon cold treatment, and each of which can condition improved freezing tolerance, and all have highly similar transcript profiles. Once a polypeptide has been shown to provide a specific function, its transcript profile becomes a diagnostic tool to determine whether paralogs or orthologs have the same function.
Furthermore, methods using manual alignment of sequences similar or homologous to one or more polynucleotide sequences or one or more polypeptides encoded by the polynucleotide sequences may be used to identify regions of similarity and B-box zinc finger domains. Such manual methods are well-known of those of skill in the art and can include, for example, comparisons of tertiary structure between a polypeptide sequence encoded by a polynucleotide that comprises a known function and a polypeptide sequence encoded by a polynucleotide sequence that has a function not yet determined. Such examples of tertiary structure may comprise predicted alpha helices, beta-sheets, amphipathic helices, leucine zipper motifs, zinc finger motifs, proline-rich regions, cysteine repeat motifs, and the like.
Orthologs and paralogs of presently disclosed polypeptides may be cloned using compositions provided by the present disclosure according to methods well known in the art. cDNAs can be cloned using mRNA from a plant cell or tissue that expresses one of the present sequences. Appropriate mRNA sources may be identified by interrogating Northern blots with probes designed from the present sequences, after which a library is prepared from the mRNA obtained from a positive cell or tissue. Polypeptide-encoding cDNA is then isolated using, for example, PCR, using primers designed from a presently disclosed gene sequence, or by probing with a partial or complete cDNA or with one or more sets of degenerate probes based on the disclosed sequences. The cDNA library may be used to transform plant cells. Expression of the cDNAs of interest is detected using, for example, microarrays, Northern blots, quantitative PCR, or any other technique for monitoring changes in expression. Genomic clones may be isolated using similar techniques to those.
Examples of orthologs of the Arabidopsis polypeptide sequences and their functionally similar orthologs are listed in Tables 1 and 2 and in the Sequence Listing. In addition to the sequences in Table 1, Table 2, and the Sequence Listing, the present disclosure encompasses isolated nucleotide sequences that are phylogenetically and structurally similar to sequences listed in the Sequence Listing and can function in a plant by increasing yield and/or and abiotic stress tolerance when ectopically expressed in a plant.
Since a significant number of these sequences are phylogenetically and sequentially related to each other and have been shown to increase yield from a plant and/or abiotic stress tolerance, one skilled in the art would predict that other similar, phylogenetically related sequences falling within the present clades of polypeptides would also perform similar functions when ectopically expressed.
Identifying Polynucleotides or Nucleic Acids by Hybridization
Polynucleotides homologous to the sequences illustrated in the Sequence Listing and tables can be identified, e.g., by hybridization to each other under stringent or under highly stringent conditions.
Polynucleotides that encode polypeptides that are closely -related, that is, orthologous or paralogous, to the disclosed polypeptide sequences may be identifiable by their ability to hybridize to the disclosed polynucleotides under high stringency conditions, including the high stringency conditions provided herein.
Single stranded polynucleotides hybridize when they associate based on a variety of well characterized physical-chemical forces, such as hydrogen bonding, solvent exclusion, base stacking and the like. The stringency of hybridization reflects the degree of sequence identity of the nucleic acids involved, such that the higher the stringency, the more similar are the two polynucleotide strands. Stringency is influenced by a variety of factors, including temperature, salt concentration and composition, organic and non-organic additives, solvents, etc. present in both the hybridization and wash solutions and incubations (and number thereof), as described in more detail in the references cited below (e.g., Sambrook et al., 1989; Berger and Kimmel, 1987; and Anderson and Young, 1985).
Encompassed by the present disclosure are polynucleotide sequences that are capable of hybridizing to the claimed polynucleotide sequences, including any of the polynucleotides within the
Sequence Listing, and fragments thereof under various conditions of stringency (see, for example, Wahl and Berger, 1987; and Kimmel, 1987). In addition to the nucleotide sequences listed in the Sequence Listing, full length cDNA, orthologs, and paralogs of the present nucleotide sequences may be identified and isolated using well-known methods. The cDNA libraries, orthologs, and paralogs of the present nucleotide sequences may be screened using hybridization methods to determine their utility as hybridization target or amplification probes. With regard to hybridization, conditions that are highly stringent, and means for achieving them, are well known in the art. See, for example, Sambrook et al., 1989; Berger, 1987, pages 467-469; and Anderson and Young, 1985).
Stability of DNA duplexes is affected by such factors as base composition, length, and degree of base pair mismatch. Hybridization conditions may be adjusted to allow DNAs of different sequence relatedness to hybridize. The melting temperature (Tm) is defined as the temperature when 50% of the duplex molecules have dissociated into their constituent single strands. The melting temperature of a perfectly matched duplex, where the hybridization buffer contains formamide as a denaturing agent, may be estimated by the following equations:
(I) DNA-DNA:
Tm(° C)=81.5+16.6(log [Na+])+0.41(% G+C)- 0.62(% formamide)-500/L
(II) DNA-RNA:
Tm(° C)=79.8+18.5(log [Na+])+0.58(% G+Q+ 0.12(%G+C)2- 0.5(% formamide) - 820/L
(III) RNA-RNA:
Tm(° C)=79.8+18.5(log [Na+])+0.58(% G+Q+ 0.12(%G+C)2- 0.35(% formamide) - 820/L where L is the length of the duplex formed, [Na+] is the molar concentration of the sodium ion in the hybridization or washing solution, and % G+C is the percentage of (guanine+cytosine) bases in the hybrid. For imperfectly matched hybrids, approximately 1° C is required to reduce the melting temperature for each 1 % mismatch.
Hybridization experiments are generally conducted in a buffer of pH between 6.8 to 7.4, although the rate of hybridization is nearly independent of pH at ionic strengths likely to be used in the hybridization buffer (Anderson and Young, 1985). In addition, one or more of the following may be used to reduce non-specific hybridization: sonicated salmon sperm DNA or another non-complementary DNA, bovine serum albumin, sodium pyrophosphate, sodium dodecylsulfate (SDS), polyvinyl-pyrrolidone, ficoll and Denhardt's solution. Dextran sulfate and polyethylene glycol 6000 act to exclude DNA from solution, thus raising the effective probe DNA concentration and the hybridization signal within a given unit of time. In some instances, conditions of even greater stringency may be desirable or required to reduce non-specific and/or background hybridization. These conditions may be created with the use of higher temperature, lower ionic strength and higher concentration of a denaturing agent such as formamide.
Stringency conditions can be adjusted to screen for moderately similar fragments such as homologous sequences from distantly related organisms, or to highly similar fragments such as genes that duplicate functional enzymes from closely related organisms. The stringency can be adjusted either during the hybridization step or in the post-hybridization washes. Salt concentration, formamide concentration, hybridization temperature and probe lengths are variables that can be used to alter stringency (as described by the formula above). As a general guidelines high stringency is typically performed at Tm-5°C to Tm-20° C, moderate stringency at Tm-20°C to Tm-35° C and low stringency at Tm- 35°C to Tm-50°C for duplex >150 base pairs. Hybridization may be performed at low to moderate stringency (25-50°C below Tm), followed by post-hybridization washes at increasing stringencies.
Maximum rates of hybridization in solution are determined empirically to occur at Tm-25°C for DNA- DNA duplex and Tm-15°C for RNA-DNA duplex. Optionally, the degree of dissociation may be assessed after each wash step to determine the need for subsequent, higher stringency wash steps.
High stringency conditions may be used to select for nucleic acid sequences with high degrees of identity to the disclosed sequences. An example of stringent hybridization conditions obtained in a filter- based method such as a Southern or Northern blot for hybridization of complementary nucleic acids that have more than 100 complementary residues is about 5°C to 20°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. Conditions used for hybridization may include about 0.02 M to about 0.15 M sodium chloride, about 0.5% to about 5% casein, about 0.02% SDS or about 0.1% N-laurylsarcosine, about 0.001 M to about 0.03 M sodium citrate, at hybridization temperatures between about 50° C and about 70° C. More preferably, high stringency conditions are about 0.02 M sodium chloride, about 0.5% casein, about 0.02% SDS, about 0.001 M sodium citrate, at a temperature of about 50°C. Nucleic acid molecules that hybridize under stringent conditions will typically hybridize to a probe based on either the entire DNA molecule or selected portions, e.g., to a unique subsequence, of the DNA.
Stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate. Increasingly stringent conditions may be obtained with less than about 500 mM NaCl and 50 mM trisodium citrate, to even greater stringency with less than about 250 mM NaCl and 25 mM trisodium citrate. Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, whereas high stringency hybridization may be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide. Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37°C, and most preferably of at least about 42°C with formamide present. Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS) and ionic strength, are well known to those skilled in the art. Various levels of stringency are accomplished by combining these various conditions as needed.
The washing steps that follow hybridization may also vary in stringency; the post-hybridization wash steps primarily determine hybridization specificity, with the most critical factors being temperature and the ionic strength of the final wash solution. Wash stringency can be increased by decreasing salt concentration or by increasing temperature. Stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
Thus, hybridization and wash conditions that may be used to bind and remove polynucleotides with less than the desired homology to the nucleic acid sequences or their complements that encode the present polypeptides include, for example: 6X SSC at 65° C;
50% formamide, 4X SSC at 42° C; or
0.5X SSC, 0.1 % SDS at 65° C;
with, for example, two wash steps of 10 - 30 minutes each. Useful variations on these conditions will be readily apparent to those skilled in the art.
A person of skill in the art would not expect substantial variation among polynucleotide species encompassed within the scope of the present disclosure because the highly stringent conditions set forth in the above formulae yield structurally similar polynucleotides.
If desired, one may employ wash steps of even greater stringency, including about 0.2x SSC, 0.1% SDS at 65°C and washing twice, each wash step being about 30 minutes, or about 0.1 x SSC, 0.1% SDS at 65°C and washing twice for 30 minutes. The temperature for the wash solutions will ordinarily be at least about 25° C, and for greater stringency at least about 42° C. Hybridization stringency may be increased further by using the same conditions as in the hybridization steps, with the wash temperature raised about 3° C to about 5° C, and stringency may be increased even further by using the same conditions except the wash temperature is raised about 6° C to about 9° C. For identification of less closely related homologs, wash steps may be performed at a lower temperature, e.g., 50° C.
An example of a low stringency wash step employs a solution and conditions of at least 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS over 30 minutes. Greater stringency may be obtained at 42° C in 15 mM NaCl, with 1.5 mM trisodium citrate, and 0.1% SDS over 30 minutes. Even higher stringency wash conditions are obtained at 65° C -68° C in a solution of 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Wash procedures will generally employ at least two final wash steps. Additional variations on these conditions will be readily apparent to those skilled in the art (see, for example, US Patent Application No. 20010010913).
Stringency conditions can be selected such that an oligonucleotide that is perfectly
complementary to the coding oligonucleotide hybridizes to the coding oligonucleotide with at least about a 5-10x higher signal to noise ratio than the ratio for hybridization of the perfectly complementary oligonucleotide to a nucleic acid encoding a polypeptide known as of the filing date of the application. It may be desirable to select conditions for a particular assay such that a higher signal to noise ratio, that is, about 15x or more, is obtained. Accordingly, a subject nucleic acid will hybridize to a unique coding oligonucleotide with at least a 2x or greater signal to noise ratio as compared to hybridization of the coding oligonucleotide to a nucleic acid encoding known polypeptide. The particular signal will depend on the label used in the relevant assay, e.g., a fluorescent label, a colorimetric label, a radioactive label, or the like. Labeled hybridization or PCR probes for detecting related polynucleotide sequences may be produced by oligolabeling, nick translation, end-labeling, or PCR amplification using a labeled nucleotide.
Encompassed by the present disclosure are polynucleotide sequences that are capable of hybridizing to the claimed polynucleotide sequences, including any of the polynucleotides within the Sequence Listing, and fragments thereof under various conditions of stringency (see, for example, Wahl and Berger, 1987, pages 399-407; and Kimmel, 1987). In addition to the nucleotide sequences in the Sequence Listing, full length cDNA, orthologs, and paralogs of the present nucleotide sequences may be identified and isolated using well-known methods. The cDNA libraries, orthologs, and paralogs of the present nucleotide sequences may be screened using hybridization methods to determine their utility as hybridization target or amplification probes.
Sequence Variations
It will readily be appreciated by those of skill in the art that the instant disclosure includes any of a variety of polynucleotide sequences provided in the Sequence Listing or capable of encoding polypeptides that function similarly to those provided in the Sequence Listing. Due to the degeneracy of the genetic code, many different polynucleotides can encode identical and/or substantially similar polypeptides in addition to those sequences illustrated in the Sequence Listing. Nucleic acids having a sequence that differs from the sequences shown in the Sequence Listing, or complementary sequences, that encode functionally equivalent peptides (that is, peptides having some degree of equivalent or similar biological activity) but differ in sequence from the sequence shown in the sequence listing due to degeneracy in the genetic code, are also within the scope of the instant disclosure and claims.
Altered polynucleotide sequences encoding polypeptides include those sequences with deletions, insertions, or substitutions of different nucleotides, resulting in a polynucleotide encoding a polypeptide with at least one functional characteristic of the instant polypeptides. Included within this definition are polymorphisms which may or may not be readily detectable using a particular oligonucleotide probe of the polynucleotide encoding the instant polypeptides, and improper or unexpected hybridization to allelic variants, with a locus other than the normal chromosomal locus for the polynucleotide sequence encoding the instant polypeptides.
Sequence alterations that do not change the amino acid sequence encoded by the polynucleotide are termed "silent" variations. With the exception of the codons ATG and TGG, encoding methionine and tryptophan, respectively, any of the possible codons for the same amino acid can be substituted by a variety of techniques, for example, site-directed mutagenesis, available in the art. Accordingly, any and all such variations of a sequence selected from the above tables are a feature of the disclosure.
In addition to silent variations, other conservative variations that alter one, or a few amino acids in the encoded polypeptide, can be made without altering the function of the polypeptide. For example, substitutions, deletions and insertions introduced into the sequences provided in the Sequence Listing are also envisioned. Such sequence modifications can be engineered into a sequence by site-directed mutagenesis (for example, Olson et al., Smith et al., Zhao et al., and other articles in Wu, 1993), or the other methods known in the art or noted herein. Amino acid substitutions are typically of single residues; insertions usually will be on the order of about from 1 to 10 amino acid residues; and deletions will range about from 1 to 30 residues. In preferred embodiments, deletions or insertions are made in adjacent pairs, for example, a deletion of two residues or insertion of two residues. Substitutions, deletions, insertions or any combination thereof can be combined to arrive at a sequence. The mutations that are made in the polynucleotide encoding the transcriptional regulator should not place the sequence out of reading frame and should not create complementary regions that could produce secondary mRNA structure. Preferably, the polypeptide encoded by the DNA performs the desired function.
Conservative substitutions are those in which at least one residue in the amino acid sequence has been removed and a different residue inserted in its place. Such substitutions generally are made in accordance with the Table 3 when it is desired to maintain the activity of the protein. Table 3 shows amino acids which can be substituted for an amino acid in a protein and which are typically regarded as conservative substitutions.
Table 3. Possible conservative amino acid substitutions
Figure imgf000045_0001
The polypeptides provided in the Sequence Listing have a novel activity, such as, for example, regulatory activity. Although all conservative amino acid substitutions (for example, one basic amino acid substituted for another basic amino acid) in a polypeptide will not necessarily result in the polypeptide retaining its activity, it is expected that many of these conservative mutations would result in the polypeptide retaining its activity. Most mutations, conservative or non-conservative, made to a protein but outside of a conserved domain required for function and protein activity will not affect the activity of the protein to any great extent.
EXAMPLES
It is to be understood that the present disclosure is not limited to the particular devices, machines, materials and methods described. Although particular embodiments are described, equivalent embodiments may be used to produce the instant compositions and practice the instant methods.
The disclosure, now being generally described, will be more readily understood by reference to the following examples, which are included merely for purposes of illustration of certain aspects and embodiments of the present disclosure and are not intended to limit claims to the instant compositions or methods. It will be recognized by one of skill in the art that a polypeptide that is associated with a particular first trait may also be associated with at least one other, unrelated and inherent second trait which was not predicted by the first trait.
EXAMPLE I. Vector and Cloning Information for Arabidopsis
A number of constructs were used to modulate the activity of the disclosed sequences. An individual project was defined as the analysis of lines for a particular construct (for example, this might include any of the disclosed lines that constitutively overexpress a disclosed B-box polypeptide sequence). In the present study, a full-length wild-type version of a gene was directly fused to a promoter that drove its expression in transgenic plants. Such a promoter could be the native promoter of that gene, or the CaMV 35S promoter. Alternatively, a promoter that drives tissue specific or conditional expression could be used in similar studies.
In the present study, expression of a given polynucleotide from a particular promoter was achieved by either a direct-promoter fusion construct in which that sequence was cloned directly behind the promoter of interest, or by a two-component expression system. A direct fusion approach has the advantage of allowing for simple genetic analysis if a given promoter-polynucleotide line is to be crossed into different genetic backgrounds at a later date. The two-component method, on the other hand, potentially allows for greater versatility in the creation of various promoter-gene combinations, and has the potential for generating stronger expression to be obtained via an amplification of transcription.
A list of constructs (PIDs) used to transform plants, indicating the promoter fragment that was used to drive the transgene and the cloning vector backbone, is provided in Table 4. Compilations of the sequences of promoter fragments and the expressed transgene sequences within the PIDs are provided in the Sequence Listing. The list of constructs presented in Table 4 is not intended to limit the instant description; other constructs that may be used to transform plants, and which may comprise useful promoter-gene combinations that are active in various tissues or in response to various or particular environmental conditions may also be envisioned.
Table 4. Sequences of promoter fragments and the expressed transgene sequences
Figure imgf000046_0001
Figure imgf000047_0001
EXAMPLE II. Transformation
Gruber et al., 1993, described several expression vectors and culture methods that may be used for cell or tissue transformation and subsequent regeneration.
Dicot and monocot expression vectors
Transformation of plants and plant parts by Agrobacterium-mediated transformation can be practiced using a recombinant DNA construct, vector or cassette with the genetic elements as shown in Table 5 for dicots and Table 6 for monocots. The disclosed recombinant polynucleotides in the Sequence Listing "MBI_0120PCT_ST25" may be incorporated in such recombinant DNA constructs. The elements in a recombinant DNA construct provided in Tables 5 and 6 are only examples of different elements that can be used for the purpose of producing transgenic plants that have incorporated the polynucleotides. Other elements can be used as well in combination with the polynucleotides of the present disclosure to achieve trait modification.
A base recombinant DNA construct specifically useful for inserting a recombinant expression cassette into a chromosome in a nucleus in a dicot plant by Agrobacterium-mediated transformation is provided in Table 5. In Table 5, column 1 describes the function of the segment of the vector, column 2 provides a short name of a discrete genetic element and column 3 provides a more detailed description of the element.
Table 5. Example of an expression vector useful for transformation of dicot plants and plant parts.
Figure imgf000047_0002
A 3' non- translated region of the nopaline synthase gene of Agrobacterium tumefaciens Ti plasmid which
T-AG tu.nos functions to direct polyadenylation of the mRNA.
Promoter for 35S RNA from CaMV containing a
P-CaMV.35S-enh duplication of the -90 to -350 region.
Gene of interest A polynucleotide or polypeptide-coding sequence in expression cassette GOI Tables 1 or 2
3' untranslated region from the fiber protein E6 gene of
T-Gb.E6-3b sea-island cotton.
Agrobacterium T-DNA Agro right border sequence, essential for transfer of T- transfer B-AGRtu.right border DNA.
OR-Ec.oriV-RK2 The vegetative origin of replication from plasmid RK2.
Coding region for repressor of primer from the ColEl plasmid. Expression of this gene product interferes with primer binding at the origin of replication, keeping
CR-Ec.rop plasmid copy number low.
The minimal origin of replication from the E. coli
Maintenance in E. coli OR-Ec.ori-ColEl plasmid ColEl.
P-Ec.aadA-SPC/STR Promoter for Tn7 adenylyltransferase (AAD (3"))
Coding region for Tn7 adenylyltransferase (AAD (3"))
CR-Ec.aadA-SPC/STR conferring spectinomycin and streptomycin resistance.
3' UTR from the Tn7 adenylyltransferase (AAD (3"))
T-Ec.aadA-SPC/STR gene of E. coli.
An example of an expression vector that may be used to transform a monocot plant by Agrobacterium- ediated transformation is provided in Table 6. In Table 6, column 1 describes the function of the segment of the vector, column 2 provides a short name of the discrete genetic elements and column 3 provides a more detailed description of the elements.
Table 6. Exam le of an ex ression vector useful for transformation of monocot lants and lant arts.
Figure imgf000048_0001
TS-At.ShkG-CTP2 Transit peptide region of Arabidopsis EPSPS
CR-AGRtu.aroA-CP4.nat Coding region for bacterial strain CP4 native aroA
gene.
T-AGRtu.nos A 3' non-translated region of the nopaline synthase
gene of Agrobacterium tumefaciens Ti plasmid which functions to direct polyadenylation of the mRNA.
Agrobacterium T- B-AGRtu.left border Agro left border sequence, essential for transfer of T- DNA transfer DNA.
Maintenance in E. OR-Ec.oriV-RK2 The vegetative origin of replication from plasmid RK2. coli
CR-Ec.rop Coding region for repressor of primer from the ColEl plasmid. Expression of this gene product interferes with primer binding at the origin of replication, keeping plasmid copy number low.
OR-Ec.ori-ColEl The minimal origin of replication from the E. coli
plasmid ColEl.
P-Ec.aadA-SPC/STR Promoter for Tn7 adenylyltransferase (AAD (3"))
CR-Ec.aadA-SPC/STR Coding region for Tn7 adenylyltransferase (AAD (3")) conferring spectinomycin and streptomycin resistance.
T-Ec.aadA-SPC/STR 3' UTR from the Tn7 adenylyltransferase (AAD (3")) gene of E. coli.
To construct expression vectors for expressing a protein identified in Table 1 and Table 2, primers for PCR amplification of the protein coding nucleotides are designed at or near the start and stop codons of the coding sequence, in order to eliminate most of the 5' and 3' untranslated regions. The protein coding nucleotides are inserted into the base vector in the gene of interest expression cassette at an insertion site, i.e. between the intron element and the polyadenylation element (Table 5 or Table 6, depending on whether the plant to be transformed is a dicot or monocot, respectively).
To construct expression vectors for suppressing a protein identified in Tables 1 and 2, the amplified protein coding nucleotides may be assembled in a sense and antisense arrangement and inserted into the base expression vector at the insertion site in the gene of interest expression cassette (Table 5 or Table 6, depending on whether the plant to be transformed is a dicot or monocot, respectively) to provide transcribed RNA that will form a double-stranded RNA for RNA interference suppression of the protein. Expression vectors for suppressing a protein identified in Tables 1 and 2 may also be designed to insert an expression cassette that expresses (a) a miRNA that targets the gene for suppression, (b) a messenger RNA that is translated to the target protein and has a synthetic miRNA recognition site that would result in down-modulation of the target protein, (c) an RNA that forms a dsRNA and that is processed into siRNAs that effect down regulation of the target protein, (d) a ssRNA that forms a ta-siRNA which results in the production of siRNAs that effect down-modulation of the target protein.
Transformation of Dicots or Eudicots to Produce Increased Yield and/or Abiotic Stress Tolerance
Crop species that overexpress or suppress the disclosed and closely related polypeptides may produce plants with increased water deprivation or drought tolerance, cold and/or nutrient tolerance and/or yield in both stressed and non-stressed conditions. Thus, polynucleotide sequences listed in the Sequence Listing recombined into, for example, one of the disclosed expression vector, or another suitable expression vector such as one comprising a sequence that is closely related to the instantly disclosed sequences, may be transformed into a plant for the purpose of modifying plant traits such as improved yield and/or quality. The expression vector may contain a constitutive promoter, an inducible promoter, a diurnally-regulated promoter, a tissue-enhanced promoter, a tissue-preferred promoter, or a tissue-specific promoter operably linked to the polynucleotide.
The expression vector may be introduced into a variety of plants by means well known in the art such as, for example, direct DNA transfer or Agrobacterium tumefaciens-mediated transformation. It is now a routine to produce transgenic plants from most dicot plants (see Weissbach and Weissbach, 1989; Gelvin et al., 1990; Herrera-Estrella et al., 1983; Bevan, 1984; and Klee, 1985). Methods for analysis of traits are routine in the art and examples are disclosed above. There are a substantial number of alternatives to Agrobacterium-mediated transformation protocols. One such method is microprojectile- mediated transformation, in which DNA on the surface of microprojectile particles is driven into plant tissues with a biolistic device (see, for example, Sanford et al., 1987; Christou et al., 1992; Sanford, 1993; Klein et al., 1987; U.S. Pat. No. 5,015,580 (Christou et al, issued May 14, 1991); and U.S. Pat. No. 5,322,783 (Tomes et al., issued Jun. 21, 1994)). Alternatively, sonication methods (see, for example, Zhang et al., 1991); direct uptake of DNA into protoplasts using CaCl2 precipitation, polyvinyl alcohol or poly-L-ornithine (see, for example, Hain et al., 1985; Draper et al., 1982); liposome or spheroplast fusion (see, for example, Deshayes et al., 1985; Christou et al., 1987); and electroporation of protoplasts and whole cells and tissues (see, for example, Donn et al., 1990; D'Halluin et al., 1992; and Spencer et al., 1994) have been used to introduce foreign DNA and expression vectors into plants.
Transformation of Arabidopsis
Transformation of Arabidopsis was performed by an Agrobacterium-mediated protocol based on the method of Bechtold and Pelletier, 1998. Unless otherwise specified, all experimental work was done using the Columbia ecotype.
Plant preparation. Arabidopsis seeds were sown on mesh covered pots. The seedlings were thinned so that 6-10 evenly spaced plants remained on each pot 10 days after planting. The primary bolts were cut off a week before transformation to break apical dominance and encourage auxiliary shoots to form. Transformation was typically performed at 4-5 weeks after sowing.
Bacterial culture preparation. Agrobacterium stocks were inoculated from single colony plates or from glycerol stocks and grown with the appropriate antibiotics until saturation. On the morning of transformation, the saturated cultures were centrifuged and bacterial pellets were re-suspended in Infiltration Media (0.5X MS, IX B5 Vitamins, 5% sucrose, 1 mg/ml benzylaminopurine riboside, 200 μΙ/L Silwet L77) until an A600 reading of 0.8 was reached.
Transformation and seed harvest. The Agrobacterium solution was poured into dipping containers. All flower buds and rosette leaves of the plants were immersed in this solution for 30 seconds. The plants were laid on their side and wrapped to keep the humidity high. The plants were kept this way overnight at 4° C and then the pots were turned upright, unwrapped, and moved to the growth racks.
The plants were maintained on the growth rack under 24-hour light until seeds were ready to be harvested. Seeds were harvested when 80% of the siliques of the transformed plants were ripe
(approximately 5 weeks after the initial transformation). This seed was deemed TO seed, since it was obtained from the TO generation, and was later plated on selection plates (with either kanamycin or sulfonamide, see Example VI). Resistant plants that were identified on such selection plates comprised the Tl generation.
Several independently transformed lines with each gene were grown on MS-agar plates without sucrose. After stratification, a 3h white light treatment was used to synchronize germination, followed by 21 h of dark treatment, before transferring the plates to continuous red light (30-40
Figure imgf000051_0001
Hypocotyl lengths were measured from digital images of 20-30 seedlings per line and compared to appropriate controls. Mean values of hypocotyl length were plotted with standard errors to determine whether increased expression of each of the B-box genes resulted in elongated hypocotyls, suggesting a negative role in light signaling.
Transformation of Tomato Plants
Transformation of tomato plants may be conducted using the protocols of Koornneef et al, 1986, and in U.S. Patent No. 6,613,962. The latter method is described briefly here. Eight day old cotyledon explants are precultured for 24 hours in Petri dishes containing a feeder layer of Petunia hybrida suspension cells plated on MS medium with 2% (w/v) sucrose and 0.8% agar supplemented with 10 μΜ α-naphthalene acetic acid and 4.4 μΜ 6-benzylaminopurine. The explants are then infected with a diluted overnight culture of Agrobacterium tumefaciens containing an expression vector comprising a disclosed or orthologous or paralogous polynucleotide for 5-10 minutes, blotted dry on sterile filter paper and cocultured for 48 hours on the original feeder layer plates. Overnight cultures of Agrobacterium tumefaciens are diluted in liquid MS medium with 2% (w/v/) sucrose, pH 5.7) to an OD60o of 0.8.
Following cocultivation, the cotyledon explants are transferred to Petri dishes with selective medium comprising MS medium with 4.56 μΜ zeatin, 67.3 μΜ vancomycin, 418.9 μΜ cefotaxime and 171.6 μΜ kanamycin sulfate, and cultured under the culture conditions described above. The explants are subcultured every three weeks onto fresh medium. Emerging shoots are dissected from the underlying callus and transferred to glass jars with selective medium without zeatin to form roots. The formation of roots in a kanamycin sulfate-containing medium is a positive indication of a successful transformation. Transformation of Soybean Plants
Transformation of soybean plants may be conducted using the methods found in, for example, Miki et al., 1993, and U.S. Patent Nos. 5,914,451, 5,824,877 and 6,384,301.
For Agrobacterium mediated transformation, soybean seeds are imbibed overnight and the meristem explants excised. Soybean explants are mixed with induced Agrobacterium cells from a strain containing plasmid DNA with the gene of interest cassette and a plant selectable marker cassette no later than 14 hours from the time of initiation of seed imbibition, and wounded using sonication. Following wounding, explants are placed in co-culture for 2-5 days at which point they are transferred to selection media for 6-8 weeks to allow selection and growth of transgenic shoots. Resistant shoots are harvested approximately 6-8 weeks and placed into selective rooting media for 2-3 weeks. Shoots producing roots are transferred to the greenhouse and potted in soil. Shoots that remain healthy on selection, but do not produce roots are transferred to non- selective rooting media for an additional two weeks. Roots from any shoots that produce roots off selection are tested for expression of the plant selectable marker before they are transferred to the greenhouse and potted in soil.
Transformation of Cotton Plants
Transformation of cotton plants may be performed as generally described in WO0036911, U.S. Patent Nos. 5,846,797, 7,790,460 and 7,947,869.
Transformation of Canola Plants
Transformation of rapeseed/canola plants may be performed as described in U.S. Patent Publication No. 2010/0218271. Alternatively, transformation of cotyledonary petioles and hypocotyls of 5-6 day old young canola seedlings are used as explants for tissue culture and transformed according to Babic et al., 1998.
Tissues from in vitro grown canola seedlings are prepared and inoculated with overnight-grown Agrobacterium cells containing plasmid DNA with the gene of interest cassette and a plant selectable marker cassette. Following co-cultivation with Agrobacterium, the infected tissues are allowed to grow on selection to promote growth of transgenic shoots, followed by growth of roots from the transgenic shoots. The selected plantlets are then transferred to the greenhouse and potted in soil. Molecular characterizations are performed to confirm the presence of the gene of interest, and its expression in transgenic plants and progenies. Progeny transgenic plants are selected from a population of transgenic canola events under specified growing conditions and are compared with control canola plants. Control canola plants are substantially the same canola genotype but without the recombinant DNA, for example, either a parental canola plant of the same genotype that is not transformed with the identical recombinant DNA or a negative isoline of the transformed plant.
Obtaining and Screening Events
The above process is repeated to produce multiple events of transgenic soybean, cotton and canola plant cells that are transformed with recombinant DNA of the present disclosure. Progeny transgenic plants and seed of the transformed plant cells are screened for decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased secondary rooting, greater cold tolerance, greater tolerance to water deprivation or drought, reduced stomatal conductance, altered C/N sensing, increased tolerance to nitrogen limited conditions, greater late season growth and vigor, greater number of primary nodes, greater late season canopy coverage, increased tolerance to hyperosmotic stress, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels starch, and delayed senescence.
After a plant or plant cell is transformed (and the latter regenerated into a plant), the transformed plant may be crossed with itself or a plant from the same line, a non-transformed or wild-type plant, or another transformed plant from a different transgenic line of plants. Crossing provides the advantages of producing new and often stable transgenic varieties. Genes and their conferred traits may be moved into distinct lines of plants using traditional backcrossing techniques well known in the art.
Transformation of Monocots to Produce Increased Yield or Abiotic Stress Tolerance
Cereal plants such as, but not limited to, corn, wheat, rice, sorghum, sugarcane, or barley, may be transformed with the present polynucleotide sequences, including monocot or dicot-derived sequences such as those presented in the present Tables, cloned into an expression vector such as the one described in Table 6 or pGA643 containing a kanamycin-resistance marker or a herbicide-tolerance marker such as a glyphosate-tolerance marker, and expressed constitutively under, for example, the CaMV 35S or COR15 promoters, or with tissue-specific, tissue-enhanced, tissue preferred, diurnally-regulated or inducible promoters. The expression vectors may be one found in the Sequence Listing (for example, pMEN65, SEQ ID NO: 428), or any other suitable expression vector may be similarly used.
The expression vector may be introduced into a variety of cereal plants by means well known in the art including direct DNA transfer or Agrobacterium tumefaciens-mediated transformation. The latter approach may be accomplished by a variety of means, including, for example, that of U.S. Patent No. 5,591,616, in which monocotyledon callus is transformed by contacting the dedifferentiating tissue with the Agrobacterium containing the expression vector.
The sample tissues are immersed in a suspension of 3xl0"9 cells of Agrobacterium containing the expression vector for 3-10 minutes. The callus material is cultured on solid medium at 25°C in the dark for several days. The calli grown on this medium are transferred to fresh Regeneration medium at 2-3 week intervals(2 or 3 times) until shoots develop. Shoots are then transferred to Shoot-Elongation medium every 2-3 weeks. Healthy-looking shoots are transferred to rooting medium and after roots have developed, the plants are placed into moist potting soil.
For Agrobacterium- ediated transformation of corn embryo cells, corn plants of a readily transformable line are grown in the greenhouse and ears are harvested when the embryos are 1.5 to 2.0 mm in length. Ears are surface sterilized by spraying or soaking the ears in 80% ethanol, followed by air drying. Immature embryos are isolated from individual kernels on surface sterilized ears. Prior to inoculation of maize cells, Agrobacterium cells are grown overnight at room temperature. Immature maize embryo cells are inoculated with Agrobacterium shortly after excision, and incubated at room temperature with Agrobacterium for 5-20 minutes. Immature embryo plant cells are then co-cultured with Agrobacterium for 1 to 3 days at 23°C in the dark. Co-cultured embryos are transferred to selection media and cultured for approximately two weeks to allow embryogenic callus to develop. Embryogenic callus is transferred to culture medium containing a selective agent and subcultured at about two week intervals. Transformed plant cells are recovered 6 to 8 weeks after initiation of selection.
To regenerate transgenic corn plants a callus of transgenic plant cells resulting from
transformation and selection is placed on media to initiate shoot development into plantlets which are transferred to potting soil for initial growth in a growth chamber at 26°C followed by a mist bench before transplanting to 5 inch pots where plants are grown to maturity. The regenerated plants are self-fertilized and seed is harvested for use in one or more methods to select seeds, seedlings or progeny second generation transgenic plants (R2 plants) or hybrids, e.g. by selecting transgenic plants exhibiting an enhanced trait as compared to a control plant.
The transformed plants are analyzed for the presence of the NPTII or other marker protein by ELISA, using the ELISA NPTII kit from 5Prime-3Prime Inc. (Boulder, CO), or for the presence of the transgene by PCR.
Examples of wheat transformation are illustrated in US Patent Nos. 6, 153,812 (microprojectile bombardment method) and 7,026,528 (Agrobacterium- ediated method).
It is also routine to use other methods to produce transgenic plants of most cereal crops (Vasil, 1994) such as corn, wheat, rice, sorghum (Cassas et al., 1993), and barley (Wan and Lemeaux, 1994). DNA transfer methods such as the microprojectile method can be used for corn (Fromm et al., 1990; Gordon-Kamm et al., 1990; Ishida, 1990), wheat (Vasil et al., 1992; Vasil et al., 1993; Weeks et al., 1993), and rice (Christou, 1991 ; Hiei et al., 1994; Aldemita and Hodges, 1996; and Hiei et al., 1997). For most cereal plants, embryogenic cells derived from immature scutellum tissues are the preferred cellular targets for transformation (Hiei et al., 1997; Vasil, 1994). After microprojectile bombardment the tissues are selected on selection medium to identify the transgenic embryogenic cells (Gordon-Kamm et al., 1990). Transgenic plants are regenerated by standard corn regeneration techniques (Fromm et al., 1990; Gordon-Kamm et al., 1990).
EXAMPLE III. Stacking of the Disclosed Polynucleotides with Other Sequences of Interest, Including Other Disclosed Polynucleotides
It is envisioned that one or more of the polynucleotides in the instant sequence listing can be introduced into a plant in combination with other disclosed polynucleotide sequences, or with other polynucleotide sequences of interest (that is, the polynucleotides may be "stacked" within the plant) for the purpose of producing plants with enhanced or multiple useful traits. A single plant may thus comprise and ectopically express, overexpress, or suppress one or more of the disclosed polynucleotide sequences and/or their encoded polypeptides. For example, since it was shown that AtBBX32 was physically associated with GmBBX62 in vivo (Example V), introduction and co-expression of both AtBBX32 and GmBBX62 in a transgenic plant may provide the transgenic plant with enhanced traits. Therefore, stacking of the disclosed polynucleotide sequences may be used to create one or more transgenic plants with at least one useful trait, said traits including, for example (but not limited to), decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased secondary rooting, greater cold tolerance, greater tolerance to water deprivation or drought, reduced stomatal conductance, altered C N sensing, increased tolerance to nitrogen limiting conditions, improved late season growth and vigor, greater number of nodes, greater late season canopy coverage, increased tolerance to hyperosmotic stress, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence, as compared to a control plant that does not ectopically express or overexpress the disclosed polynucleotide sequences. The combinations of polynucleotides introduced into target plants may also include multiple copies of any one of the disclosed polynucleotides. The disclosed polynucleotides may also be stacked with any other polynucleotide or combination of polynucleotide to produce transgenic plants with one or more useful trait combinations, including, for example (but not limited to), one or more of the traits listed in the previous paragraph, and possibly herbicide resistance (e.g., glyphosate resistance), disease resistance or tolerance, increased tolerance to heat, increased tolerance to oxidative stress, increased oil content, male sterility, lodging resistance, early flowering and/or development, delayed flowering and/or development, extended flowering and/or development time, traits desirable for chemical processing, and/or improved digestibility.
The combinations of polynucleotides within an individual plant can be introduced through a variety of means. This may include, for example, transforming a target plant with two or more nucleic acid sequences of interest at the same time or at different times, or introducing the two or more nucleic acid sequences of interest by different means such as a combination of transformation and breeding, where the nucleic acid sequences may be integrated into one or more loci. The two sequence cassettes can be contained in separate expression vectors (trans), where one of the expression vectors comprises a trans-acting element. A trans-acting element is a DNA sequence that controls transcriptional activity of a target gene through a diffusible gene product such as a protein, microRNA, or other diffusible repressor or activator. The regulated target gene may include a polynucleotide of the instant Sequence Listing. Alternatively, the two sequence cassettes can be contained in the same expression vector (cis).
Introducing the sequences at the same time into a plant may be referred to as co-transformation, simultaneous transformation, or parallel transformation. Combinations of recombinant polynucleotides can also be introduced into a plant through subsequent, serial or super-transformation or re- transformation, that is, by providing a transgenic plant previously transformed with one polynucleotide of interest, and transforming the same plant with one or more distinct recombinant polynucleotides. In this method, a transgenic plant exhibiting one or more desired traits can be used as a target plant to introduce additional traits by super- transformation.
Thus, if the polynucleotide sequences (including one or more of the disclosed polynucleotide sequences) are introduced into plants by genetic transformation, the polynucleotide sequences can be transformed into the plant at any time and in any order.
Another method of stacking genes in a plant combines transformation with breeding methods. A plant that has been transformed with at least one polynucleotide sequence of interest (including one or more of the disclosed polynucleotide sequences) may be cross-bred with a transgenic or non-transformed plant in order to stack more than one gene in the plant.
Expression of the polynucleotide sequences can be regulated by the same promoter or by different promoters.
It may also be desirable to introduce an expression vector or cassette that will suppress the expression of a polynucleotide of interest. This may be combined with any combination of other suppression vectors or cassettes or overexpression vectors or cassettes to generate a desirable combination of traits in the plant, including traits disclosed in this Example.
EXAMPLE IV: Expression and Analysis of Increased Yield and/or Abiotic Stress Tolerance in non-Arabidopsis Species or Crop Plants
It has been shown that overexpression of a B-box polypeptide, BBX32 (Λί.ΒΒΧ32; SEQ ID NO:
430), decreases light sensitivity of plants when the polypeptide is overexpressed in the plants, including in plants other than Arabidopsis (e.g., crop plants). BBX32 has been shown to improve crop performance and acts to repress the transcriptional activity of another B-box protein, AtBBX21 (G1482, SEQ ID NO: 56) on its native target promoter (prCHS) sequences (unpublished data). The instantly disclosed results provide evidence that HA: AtBBX28 (G1481) inhibited the transcriptional activity of HA: AtBBX21 to levels similar to the repression by HA:BBX32 (Figure 2), suggesting that AtBBX28 is able to act as a repressor like BBX32. AtBBX28 may have common targets with BBX32 (Figure 2) or it may act on specific targets independently of BBX32.
In fact, a number of the disclosed polypeptide sequences, including those found in the Sequence Listing, including SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234,436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548 or 550 or orthologous sequences (as defined or claimed herein) that function in the same manner, may alter light sensitivity of plants when the sequences are overexpressed in the plants. It is expected that structurally similar orthologs and paralogs of the disclosed polypeptide sequences, which may be derived from diverse plant species, will also alter light sensitivity of plants when these orthologous and paralogous sequences are overexpressed. Furthermore, it is expected that the disclosed B-box polypeptide sequences, and structurally similar orthologs and paralogs of the disclosed B-box polypeptide sequences, can, at least in part and as a result of their altering light sensitivity, confer increased yield or increased tolerance to a number of abiotic stresses, including water deprivation or drought, cold, and nitrogen-limiting conditions, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence, relative to control plants, and thus may increase yield of crop or other commercially important plant species.
Relationships between the disclosed sequences in the present disclosure may be recognized by comparing structural similarity, for example, determined by a disclosed percentage identity to full length protein or their conserved domains, or by hybridization to a disclosed polynucleotide sequence. Northern blot analysis, RT-PCR or microarray analysis of the regenerated, transformed plants may be used to show expression of a polypeptide of the present disclosure, or related orthologous or paralogous sequences that are capable of inducing increased yield or increased tolerance to abiotic stresses, including water deprivation, cold, and low nitrogen conditions.
After a eudicot plant, dicot plant, monocot plant or plant cell has been transformed (and the latter regenerated into a plant) and shown to have increased tolerance to abiotic stresses, including water deprivation or drought, cold, and nitrogen-limiting conditions, that is, able to tolerate greater planting density with a coincident increase in yield, or tolerance to abiotic stress, or produce greater yield relative to a control plant in the absence of stress conditions or under stress conditions, the transformed plant may be crossed with itself or a plant from the same line, a non-transformed or wild-type plant, or another transformed plant from a different transgenic line of plants.
The functions of specific polypeptides, including closely-related orthologs, may be analyzed and may be further characterized and incorporated into crop plants. The ectopic overexpression of these sequences may be regulated using constitutive, inducible, or tissue specific regulatory elements. Genes that have been examined and have been shown to modify plant traits (including altered light sensitivity with predicted increased yield and/or abiotic stress tolerance) encode polypeptides found in the Sequence Listing. In addition to these sequences, it is expected that newly discovered polynucleotide and polypeptide sequences closely related to polynucleotide and polypeptide sequences found in the Sequence Listing can also confer alteration of traits in a similar manner to the sequences found in the Sequence Listing, when transformed into any of a considerable variety of plants of different species, and including dicots and monocots. The polynucleotide and polypeptide sequences derived from monocots (e.g., the rice sequences) may be used to transform both monocot and dicot plants, and those derived from dicots (e.g., the Arabidopsis and soy genes) may be used to transform either group, although it is expected that some of these sequences will function best if the gene is transformed into a plant from the same group from which the sequence is derived.
As an example of a first step to determine water deprivation-related tolerance, seeds of these transgenic plants may be subjected to germination assays to measure sucrose sensing, severe desiccation or drought. Methods that may be used to measure relative sucrose sensing, severe desiccation tolerance or drought tolerance in genetically altered (for example, over-expressing) and control plants are as follows.
For sucrose sensing, germination assays may be conducted in growth media containing 9.4% sucrose with Arabidopsis overexpressors of BBX32 and closely-related sequences. Growing the plants under controlled temperature and humidity on sterile medium produces uniform plant material that has not been exposed to additional stresses (such as water stress) which could cause variability in the results obtained. Where possible, assay conditions are originally tested in a blind experiment with controls that have phenotypes related to the condition tested.
Prior to plating, seed for all experiments are surface sterilized in the following manner: (1) 5 minute incubation with mixing in 70 % ethanol, (2) 20 minute incubation with mixing in 30% bleach, 0.01 % triton-X 100, (3) 5X rinses with sterile water, (4) Seeds are re-suspended in 0.1 % sterile agarose and stratified at 4° C for 3-4 days. Germination assays follow modifications of the same basic protocol. Sterile seeds are sown on the conditional media that has a basal composition of 80% MS + Vitamins.
-2 -1
Plates are incubated at 22° C under 24-hour light (120-130 μΕ m s ) in a growth chamber. Evaluation of germination and seedling vigor is performed five days after planting.
For severe desiccation (plate-based water deprivation) assays, seedlings are grown for 14 days on
MS+ Vitamins + 1% Sucrose at 22° C. Plates are opened in a sterile hood for 3 hr for hardening and then seedlings are removed from the media and dried for two hours in the sterile hood. After this time the plants are transferred back to plates and incubated at 22° C for recovery. The plants are then evaluated after five days.
The soil drought assay (performed in clay pots) is based on that described by Haake et al., 2002.
Previously, we have performed clay-pot assays on segregating T2 populations, sown directly to soil. However, in the current procedure, seedlings are first germinated on selection plates containing either kanamycin or sulfonamide.
Seeds are sterilized by a 2 minute ethanol treatment followed by 20 minutes in 30% bleach / 0.01 % Tween and five washes in distilled water. Seeds were sown to MS agar in 0.1% agarose and stratified for three days at 4° C, before transfer to growth cabinets with a temperature of 22 °C. After seven days of growth on selection plates, seedlings are transplanted to 3.5 inch diameter clay pots containing 80g of a 50:50 mix of vermiculite:perlite topped with 80g of ProMix. Typically, each pot contains 14 seedlings, and plants of the transgenic line being tested are in separate pots to the wild-type controls. Pots containing the transgenic line versus control pots are interspersed in the growth room,
-2 -1
maintained under 24-hour light conditions (18-23° C, and 90-100 μΕ m s ) and watered for a period of 14 days. Water is then withheld and pots are placed on absorbent paper for a period of 8-10 days in to apply a drought treatment. After this period, a visual qualitative "drought score" from 0-6 is assigned to record the extent of visible drought stress symptoms. A score of "6" corresponds to no visible symptoms whereas a score of "0" corresponds to extreme wilting and the leaves having a "crispy" texture. At the end of the drought period, pots are re-watered and scored after 5-6 days; the number of surviving plants in each pot is counted, and the proportion of the total plants in the pot that survived is calculated.
In a given experiment, six or more pots of a transgenic line are compared with six or more pots of the appropriate control. The mean drought score and mean proportion of plants surviving (survival rate) are calculated for both the transgenic line and the wild-type pots. In each case a j-value* is calculated, which indicates the significance of the difference between the two mean values. The results for each transgenic line across each planting for a particular project are then presented in a results table.
Calculation of p-values For the assays where control and experimental plants were in separate pots, survival is analyzed with a logistic regression to account for the fact that the random variable is a proportion between 0 and 1. The reported j-value is the significance of the experimental proportion contrasted to the control, based upon regressing the logit-transformed data. Drought score, being an ordered factor with no real numeric meaning, is analyzed with a non- parametric test between the experimental and control groups. The j-value is calculated with a Mann- Whitney rank-sum test.
Plants overexpressing the disclosed, orthologous or paralogous sequences may be found to be more tolerant to high sucrose by having better germination, longer radicles, and more cotyledon expansion.
Disclosed or orthologous or paralogous sequences, or other sequences closely related to the disclosed B-box polynucleotides and B-box polypeptides, may also be used to generate transgenic plants that are more tolerant to nitrogen-limiting conditions or cold than control plants.
All of these abiotic stress tolerances conferred by disclosed B-box polynucleotides and B-box polypeptides may contribute to increased yield of commercially available plants. BBX32 overexpressors have been shown to increase yield of plants in the apparent absence of significantly obvious abiotic stress, as evidenced by including increased height, increased early season vigor and estimated stand count, and increased late season canopy coverage observed in soy plants overexpressing BBX32. Thus, it is expected that disclosed B-box polynucleotides and B-box polypeptides, and closely related orthologs and paralogs, will also improve yield in plants relative to control plants, including in leguminous species, even in the absence of overt abiotic stresses.
It is expected that the disclosed methods may be applied to identify other useful and valuable sequences of the present polypeptide clades, and the sequences may be derived from a diverse range of plant species. These sequences and/or the sequences provided in the Sequence Listing may be introduced into plants other than Arabidopsis (e.g., crop plants), and by expressing said sequences may thus be made more tolerant than controls to water deprivation assays, nitrogen-limiting conditions or cold, and/or produce greater yield. It is expected that said plants under these conditions are greener, more vigorous, will have better survival rates than controls, or will recover better from these treatments than control plants.
EXAMPLE V. Results.
The data presented herein present the results obtained in experiments with polynucleotides and polypeptides that may be expressed in plants in order to obtain advantageous traits in said plants including improved yield under non-stressed or low stress conditions, or for reduced yield losses under biotic and abiotic stress conditions.
We have previously demonstrated that under a variety of conditions, including unstressed, nutrient stress, or osmotic stress conditions, Arabidopsis seedlings ectopically expressing ΛίΒΒΧ32 showed increased hypocotyl growth rates and altered transcription of genes associated with light regulated signal transduction and photosynthesis. Soybean plants ectopically expressing AtBBX32 were taller, tended to have more nodes, pods, and flowers, greater late season canopy coverage, improved late season vigor, in some cases had thicker stems, and ultimately had significantly higher broad acre yield than wild-type soybean plants did (e.g., see Creelman et al., US Patent No. 7,692,067). Based on a phylogenetic analysis of the soybean B-box family, G4004 (also referred to as Glycine max BBX53 or GmBBX53, and listed as SEQ ID NO: 432 or 532), GmBBX52 variant (SEQ ID NO: 434) and
GmBBX52 (SEQ ID NO: 530) were identified as the soybean orthologs of the Arabidopsis ΛίΒΒΧ32 gene. Like AtBBX32, both soybean genes contain a single N-terminus B-box domain. Both soybean genes had diurnal oscillations in transcript abundance. Arabidopsis plants overexpressing either
GmBBX52 or GmBBX53 displayed increased hypocotyl growth rates and altered transcription of genes associated with light regulated signal transduction and photosynthesis, similar to plant lines
overexpressing AtBBX32. In order to better understand the biological role of GmBBX52 and GmBBX53 genes on soybean yield, we generated constructs that would constitutively express either GmBBX52 or GmBBX53 or knockdown both GmBBX52 and GmBBX53 transcript levels. Eight independently generated plants from both the GmBBX52 constitutive over-expression construct and the
GmBBX52/GmBBX53- miRNA constructs and four independent events from the GmBBX53 over- expression construct were tested in broad acre yield trials. Lines ectopically over- expressing GmBBX52 yielded, on average, 6.1 % more bushels per acre than did wild-type control plants, while the top performing line yielded 9.0% more bushels per acre. Lines ectopically over-expressing GmBBX53 yielded 4.1 % higher than the wild-type control, while the top event improved yield by 6.7% over the wild-type control. In contrast, miRNA mediated suppression of GmBBX52 and GmBBX53 transcript levels led to a significant decrease in GmBBX52 RNA levels and decreased yield.
GmBBX52/GmBBX53-miRNA lines yielded, on average, 5.5% fewer bushels per acre than control lines while the lowest yielding line across the eight produced 11.8% fewer bushels per acre relative to controls. These data demonstrate that the ectopic expression of the soybean homologs of ΛίΒΒΧ32, GmBBX52 and GmBBX53, led to yield improvements similar to that of soybean plants expressing the Arabidopsis gene.
We then examined several independently transformed Arabidopsis lines overexpressing other disclosed B-box polynucleotides. The level of gene expression is expected to vary in each line, which is likely to result in a range of hypocotyl lengths. Lines with hypocotyl lengths similar to the controls are likely to lack any significant expression from the transgene. On the other hand, an increase in hypocotyl length may be attributed to the transgene, either through an indirect effect or directly through overexpression of the specific B-box transgene. Increased hypocotyl lengths of multiple independent transformants of the same gene can be used to correlate the reduced light responsiveness to increased gene expression. Using this method, a number of independent Arabidopsis transgenic lines carrying 35S::AtBBX28:cMYC were found to have longer hypocotyls than control lines transformed with an empty vector control (pMEN 65), and some of the 35S: :AtBBX28:cMYC lines had hypocotyl lengths similar to BBX32 -over-expressing seedlings (Figure 1). These data suggest that seedlings
overexpressing AtBBX28 are hyposensitive to red light implying that AtBBX28 functions negatively in light signal transduction.
BBX32 improves crop performance and is thought to repress the transcriptional activity of another B-box protein, AtBBX21 (SEQ ID NO: 56) on its native target promoter (prCHS) sequences (unpublished data). To test whether AtBBX28 (SEQ ID NO: 2) can also repress gene expression, we co- transformed prCHS::GUS reporter constructs with HA:AtBBX21 or in combination with HA:AtBBX28, HA: BBX32 or CAT (used as control) in Arabidopsis. Our results show that HA: AtBBX28 inhibited the transcriptional activity of HA:AtBBX21 to levels similar to the repression by HA: BBX32 (Figure 2). These data suggest that AtBBX28 is able to act as a repressor like BBX32. AtBBX28 may have common targets with BBX32 (Figure 2) or it may act on specific targets independently of BBX32.
Other B-box proteins were analyzed for their potential roles in light signaling. Seedlings of several independently transformed Arabidopsis lines transformed with B-box genes were grown under red light to examine the effects on hypocotyl length. As seen in Figures 3 and 4, we identified 8 additional B-box genes which, when constitutively expressed, produced longer hypocotyls in light. The levels of expression of these genes in the transgenic lines are not yet known, but as expected the magnitude of the hypocotyl length phenotype varied greatly between independent transformants of the same gene. These results indicate that AtBBX25 (G1894, SEQ ID NO: 154), AtBBX26 (G1486, SEQ ID NO: 52), AtBBX30 (G1478, SEQ ID NO: 40), AtBBX7 (G2440, SEQ ID NO: 104), AtBBX24 (G329, SEQ ID NO: 152), AtBBX20 (G1888, SEQ ID NO: 54), AtBBX19 (G902, SEQ ID NO: 200), and AtBBX18
(G1881, SEQ ID NO: 202) function to suppress light signaling. One or more of these genes can be used to alter light sensitivity leading to increased crop yield and stress tolerance.
AtBBX32 modulates expression of soybean BBX proteins
A microarray analysis was performed to examine the expression of ΛίΒΒΧ32 on the modulation of gene expression in field grown soybean sampled at five time points: 3:00 am, 6:00 am (dawn), 9:00 am, noon, and 3:00 pm. The expression of ΛίΒΒΧ32 in soybean affected the abundance of specific gene transcripts with the majority of these changes in gene expression occurring at dawn as shown in Figure 11.
Phylogenetic analyses of the Arabidopsis thaliana and Glycine max B-box gene families were conducted for the purpose of identifying functional similarities of proteins in the B-box family (Figures 12, 13 and 14). The phyogenetic trees were generated using an in-house proprietary database and clustalW analysis clusters to group sequences based on the domain structure of the proteins. The genomes of both species contain large families of B-box domain genes; the Arabidopsis genome contains 32 predicted B-box domain proteins, while the paleopolyploid soybean genome contains 61 B-box containing genes. The phylogenetic analysis conducted using 32 B-box sequences from Arabidopsis thaliana and 61 B-box sequences from Glycine max grouped the Arabidopsis and soybean sequences into five structural groups and seventeen clades (Figure 12). A phylogenetic tree specific for the 61 B-box sequences from soybean is shown in Figure 13. Two of the soybean B-box sequences showed a shift in the time of peak expression. Three sequences were induced significantly at dawn and thirteen were down-regulated in the Λί.ΒΒΧ32 transgenic soybean plants (Figure 13). A single B-box clade is further represented in Figure 14 for Arabidopsis thaliana and Glycine max sequences. Within the phylogenetic grouping of AtBBX32-like single B-box domain containing genes, thirteen B-box genes from Glycine max grouped with seven Arabidopsis single B-box genes. Phylogenetic analysis indicates that
GmBBX52 and GmBBX53 are orthologs of the Arabidopsis thaliana ΛίΒΒΧ32 gene.
Utilities of B-box polynucleotides, polypeptides and phylogenetically-related sequences
Based on the data obtained in the instantly disclosed Examples, a total of nine Arabidopsis B-box genes and several GmBBX genes that function negatively in light signaling have been identified, and it is expected that either independently or in combination with other genes or specific promoters (for example, heterologous promoters, or constitutive, inducible, diurnally-regulated, tissue-enhanced, tissue-preferred, or tissue-specific promoters), these genes will provide significantly improved yield benefits and resistance to abiotic stress.
Sequences that are orthologous, i.e., full length sequences or modified sequences that share significant sequence identity or similarity, to those provided in the Sequence Listing, may be derived from any of a wide variety of plants, including but not limited to, the plant families Myrtaceae, Pinaceae, Salicaceae, Leguminosae, Umbelliferae, Cruciferae, Curcurbitaceae, Solanaceae, Brassicaceae, or from the plants Arabidopsis thaliana, soybean, potato, cotton, rape, oilseed rape (including canola), sunflower, alfalfa, clover; or fruits and vegetables, such as banana, blackberry, blueberry, strawberry, and raspberry, cantaloupe, carrot, cauliflower, coffee, cucumber, eggplant, mint, grapes, honeydew, lettuce, mango, melon, onion, papaya, peas, beans, peppers, pineapple, pumpkin, spinach, squash, tobacco, tomato, tomatillo, watermelon, rosaceous fruits (such as apple, peach, pear, cherry and plum), vegetable brassicas (such as broccoli, cabbage, cauliflower, Brussels sprouts, and kohlrabi), barley; rye; millet; sorghum; currant; avocado; citrus fruits such as oranges, lemons, grapefruit and tangerines, artichoke, cherries; nuts such as the walnut and peanut; endive; leek; roots such as arrowroot, beet, cassava, turnip, radish, yam, sweet potato, wheat, corn or sweet corn (maize), rice, wild rice, sugarcane, bamboo, oats, turfgrass, brome-grass, Miscanthus, pampas grass, or switchgrass (Panicum). In addition, homologous sequences may be derived from plants that are evolutionarily-related to crop plants, but which may not have yet been used as crop plants. Examples include deadly nightshade (Atropa belladond), related to tomato; jimson weed {Datura strommium), related to peyote; and teosinte (Zea species), related to corn (maize).
Transgenic plants (or plant cells, or plant explants, or plant tissues) incorporating the disclosed polynucleotides and expressing the disclosed polypeptides or orthologs of the disclosed polypeptides can be produced by a variety of well-established techniques as described in the Examples. After construction of a nucleic acid vector, including an expression vector or cassette, including one or more
polynucleotides encoding one or more B-box transcriptional regulators or B-box transcriptional regulator orthologs, standard techniques can be used to introduce the vector into a plant, a plant cell, a plant explant or a plant tissue of interest. Optionally, the plant cell, explant or tissue can be regenerated to produce a transgenic plant.
The plant can be any higher plant, including gymnosperms, monocotyledonous and
dicotyledonous plants. Suitable protocols are available for Leguminosae (alfalfa, soybean, clover, etc.), Umbelliferae (carrot, celery, parsnip), Cruciferae (cabbage, radish, rapeseed, broccoli, etc.),
Curcurbitaceae (melons and cucumber), Poaceae (formerly Gramineae, including wheat, corn, rice, barley, millet, etc.), Solanaceae (potato, tomato, tobacco, peppers, etc.), and various other crops. See protocols described in Ammirato et al., 1984; Shimamoto et al. 1989; Fromm et al., 1990; and Vasil et al., 1990).
Identification of interacting partners with AiBBX32
Genetic and biochemical approaches were employed to identify proteins that may interact with
AiBBX32 in transgenic soybean plants. Engineering of crop plants with polynucleotides that encode or suppress such proteins may improve yield and other agronomic traits.
Yeast 2-hybrid screen
In order to identify BBX32 binding partners that may be involved in the regulation of AiBBX32 in overexpressing transgenic soybean, a yeast 2-hybrid (Y2H) screen was carried out using full length and truncatecL iBBX32 and the soy orthologGmBBX52 as baits in a total of 6 screens against a soybean cDNA library (Table 7). The six BBX32 baits from Table 7 were subcloned into pUC vectors and then recloned as LexA fusion constructs for use in Y2H screens. Most bait constructs were prepared in the pB27 background, which placed the LexA gene at the N terminus of the bait sequence. Other vector backbones include pB29 for C terminal LexA fusions and pB6 for N terminal Gal4 fusions. Two control screens were also performed using GmCOPl-like protein and GmPABP-like (Poly A binding protein) protein as baits (data not shown).
A random primed library was made from total RNA isolated from wild-type non-transgenic V5 soy leaves harvested at 4 hr intervals during a 14 hr diurnal cycle as well as from dark germinated soy seedlings. The two uppermost leaf tri-foliates, shoot, and meristem tissues were harvested from V5 stage soy plants at 3 am, 7 am, 11 am, 3 pm, 7 pm, and 11 pm. Whole seedlings were collected at a single time point. All tissues were harvested from plants grown in the growth chamber where lights were turned on at 5 am and off at 7 pm. RNA was isolated from all tissues for preparation of a cDNA library in the appropriate prey vector. The two-hybrid screens were performed by Hybrigenics Services.
Interacting clones were isolated and sequenced. Combining all six screens, approximately 471 interacting contigs were identified. Contigs are defined as an interacting fragment of a particular sequence. Separate contigs may represent overlapping portions of the same mRNA. Furthermore, some contigs identified in separate screens may be identical, thus reducing the total number of contigs identified. Translated BLAST searches against the public database revealed approximately 45 groups of contigs and 57 single contigs (including 333 different contigs) with similarity to Arabidopsis genes. An additional three contig groups did not show significant homology to publicly available gene sequences. Six contig groups did not show significant homology to genes within the Arabidopsis genome nor to the map to known soy genes. Of the remaining single contigs that map to soy gene sequences, approximately 107 showed no matches to known plant genes. Table 7. Bait insert sequences tested against the soy DNA library described above. Italicized sequence
Bait Sequence Nucleotides
N-terminal MVSFCELCGAEADLHCAADSAFLCRSCDAKFHASNFLFARHFRRVICPNC 1-222 At.BBX32 KSLTQNFVSGPLLPWPPRTTCCSE C-terminal TQNFVSGPLLPWPPRTTCCSESSSSSCCSSLOCVSSSELSSTTKDVNRARGR 160-678 At.BBX32 ENRVNAKAVAVTVADGIFVNWCGKLGLNRDLTNAVVSYASLALAVETR
PRATKRVFLAAAFWFGVKNTTTWQNLKKVEDVTGVSAGMIRAVESKLA RAMTQQLRRWRVDSEEGWAENDNV
Full length MVSFCELCGAEADLHCAADSAFLCRSCDAKFHASNFLFARHFRRVICPNC 1-678 At.BBX32 KSLTQNFVSGPLLPWPPRTTCCSESSSSSCCSSLDCVSSSELSSTTRDVNRA
RGRENRVNAKAVAVTVADGIFVNWCGKLGLNRDLTNAVVSYASLALAV
ETRPRATKRVFLAAAFWFGVKNTTTWQNLKKVEDVTGVSAGMIRAVES
KLARAMTQQLRRWRVDSEEGWAENDNV
N-terminal MKPKTCELCHQLASLYCPSDSAFLCFHCDAAVHAANFLVARHLRRLLCS 1-228 Gm.BBX5 K NRFAAIHISGAISRHLSSTCTSCSL
2
C-terminal AA/ff/5GA/SRffL55rcr5C5LEIPSADSDSLPSSSTCVSSSESCST QIKAEKKR 163-732 Gm.BBX5 RRRRRSFSSSSVTDDASPAAKKRRRNGGSVAEVFEKWSREIGLGLGVNGN
2 RVASNALSVCLGKWRSLPFRVAAATSFWLGLRFCGDRGLATCQNLARLE
AISGVPAKLILGAHANLARVFTHRRELQEGWGES
Full length MKPKTCELCHQLASLYCPSDSAFLCFHCDAAVHAANFLVARHLRRLLCS 1-732 Gm.BBX5 KCNRFAAIHISGAISRHLSSTCTSCSLEIPSADSDSLPSSSTCVSSSESCSTNQ
2 IKAEKKRRRRRRSFS S S S VTDD ASP AAKKRRRNGGS V AE VFEKWSREIGL
GLGVNGNRVASNALSVCLGKWRSLPFRVAAATSFWLGLRFCGDRGLAT CQNLARLEAISGVPAKLILGAHANLARVFTHRRELQEGWGES
Analysis of the Y2H prey identified in each screen revealed several consistent patterns of potential interaction. In general, the N-terminal, B-Box containing region of both the AiBBX32and Gm BBX32 proteins showed potential interaction with other B-Box proteins. Many of the potentially interacting proteins are expressed during a timeframe in which AiBBX32 overexpression has been shown to influence expression of the most mRNAs in growth chamber experiments (2 hr predawn and dawn). At a molecular level, AiBBX32 overexpression resulted in marked changes in mRNA expression for a number of nuclear genes, suggesting that AiBBX32 plays a role in transcriptional regulation (Figure 11). As a putative component of the transcriptional network, it is likely that BBX32 functions through interactions with other proteins. Taken together, these data indicate that, like BBX32, these genes may modulate a variety of traits, including yield, when overexpressed or suppressed in plants.
AiBBX32 putative interacting proteins from the yeast 2 hybrid screens were identified and are further described in the phylo genetic tree in Figures 12 and 13. Several possible interacting proteins of GmBBX52 were also identified from yeast 2 hybrid screens. For example, GmG1481(GmBBX62) was identified and is proposed to function in protein-protein stabilization and could facilitate light signaling in leaves, roots and nodules. The interaction of BBX32 with B-box proteins may also help in stabilizing the nuclear complex. Together such a complex could lead to altered gene expression of key regulatory and metabolic genes resulting in enhanced vigor, growth and yield.
AtBBX32 and GmBBX62 are physically associated in vivo
To confirm the interaction between AtBBX32 and GmBBX62 identified through Y2H screening, the ability of AtBBX32 to associate with GmBBX62 in vivo was tested. AtBBX32::GFP and Flag::GmBBX62 fusion proteins were transiently co-expressed in soybean protoplasts. Soybean protoplasts were isolated from 4-6 mm cotyledons and transformed as described by Abel and Theologis, 1994. Approximately lxlO6 protoplasts were transformed in 15 mL Falcon conical tubes with 90 μg of Qiagen prepped plasmid DNA. Protoplasts were then incubated at 22 °C for 18 to 24 hours, and harvested at 150 x g for 3 minutes and lysed with lysis buffer (50 mM Tris pH 7.8, 150 mM NaCl, 1 % Triton-X 100 and Complete Protease Inhibitor (Roche) for 1 hr on ice with vortex mixing every 15 min. The lysate was centrifuged for 5 min at 3000 x g and soluble fractions were retained for use in Luminex-based co- immunoprecipitation assays.
Luminex co-immunoprecipitation (co-IP) assay was carried out using the miniaturized sandwich immunoassay and co-IP method with modifications, Poetz et al., 2009. This combination of co-IP and sandwich immunoassay allows the relative quantification of components of the complex. Briefly, antibodies for GFP (MBL International, D153-3) and FLAG (Bethyl Laboratories, A190-101A) were covalently coupled to carboxylated fluorescent microspheres (Luminex) according to the manufacturer' s protocol. Fifty μΐ of protoplast cell lysate (above) was aliquoted to three different wells in a 96 well clear flat-bottom plate (Bio-Rad) for Luminex assays. To each sample, 50 μΐ of conjugated beads was added to each appropriate well and incubated for 30 minutes with shaking. Forward and reverse co-IPs were performed with anti-GFP conjugated beads and anti-FLAG conjugated beads. Beads were captured for 2 minutes and washed three times with PBST (137 mM NaCl, 8.1 mM Na2HP04, 2.68 mM KC1, 1.47 mM KH2P04, and 0.05% Tween-20). Biotinylated GFP (ab6658, 1 : 1000; Abeam) and FLAG (A190-101B, 1 : 1000; Bethyl) antibodies were added to appropriate wells. The plate was incubated on a shaker for 30 minutes. After washing, 100 μΐ of reporter NeutrAvidin R-phycoerythrin at a 1 : 1000 dilution was added to each well and incubated for 30 minutes with subsequent washing. Each well was resuspended in 100 μΐ of PBST buffer before plates were analyzed using FLEX MAP 3D system (Luminex Corp, Austin, TX). Approximately 100 beads were measured per sample to determine the median fluorescence intensity (MFI).
A co-immunoprecipitation (co-IP) experiment was performed with the co-expressed soybean protoplast extracts using an antibody against GFP. The protein complex was captured via the immobilized GFP antibody and the associated components within the complex were detected via anti- FLAG antibody and visualized using phycoerythrin-conjugated reporter molecules. As shown in Figure 15A, the median fluorescence intensity (MFI) from cell extracts co-expressing AtBBX32::GFP and Flag: :GmBBX62 is significantly higher (6-fold) than the control samples, including non-transfected cells and cell extracts lacking either AtBBX32: :GFP or FLAG::GmBBX62. As expected, low fluorescence signals for the single gene construct samples did not show a significant difference from non-transfected cell extract, suggesting that these signals represent non-specific binding. A reciprocal co-IP experiment with anti-FLAG antibody-immobilized beads was also performed. The presence of AtBBX32: :GFP within the complex was detected by anti-GFP antibody. Similarly, the fluorescence intensity for the co- expressed cell extract exhibited a 5 -fold increase compared to the controls (Figure 15B). The results indicate that AtBBX32 and GmBBX62 physically interact in soybean cells, further demonstrating the biological relevance of GmBBX62 as a partner of AtBBX32.
AtBBX32 binds GmBBX62 in vitro
In vitro pull-down and ELISA-based protein-protein interaction assays were also conducted to confirm the binding of AtBBX32 with GmBBX62. Purified FLAG: :GmBBX62 was bound to anti-FLAG M2 agarose resin and incubated with soluble protein extracts from wheat germ lysate expressing AtBBX32. The beads were pelleted and washed, and the bound protein complexes were eluted using SDS-PAGE loading buffer. The eluted protein complexes were identified by western blotting analysis. As expected, FLAG: :GmBBX62 was detected with anti-Flag antibody from FLAG-GmBBX62-bound beads (Figure 16A), confirming the presence of the GmBBX62 protein in reactions. AtBBX32 within the protein complex was detected with anti-AiBBX32 antibody from FLAG: :GmBBX62 beads but not from the negative controls (Figure 16B), demonstrating that FLAG: :GmBBX62 can bind to AtBBX32 in vitro. Co-immunoprecipitation of AtBBX32 with GmBBX39 and bead-based fluorescence detection
Bead-based co-IP assays with Luminex on-bead detection method was used to confirm the interaction between the AtBBX32 and GmBBX39 proteins. Pairs of potential interacting proteins were co-expressed in soybean cotyledon protoplasts as described above.
Capture antibodies for GFP (MBL International, D153-3),Myc (Bethyl Laboratories cat # A190- 104A)and FLAG (Bethyl Laboratories, A190-101A) were covalently coupled to carboxylated fluorescent microspheres (Luminex) according to the manufacturer' s protocol. Luminex two-step Carbodimide coupling protocol was modified as follows: 3.5 x 106 beads were conjugated to 15 μg of antibody and resuspended in coupling buffer containing 100 rriM MES pH 6. Biotinylated antibodies for GFP (Abeam, ab6658), Myc (Bethyl Laboratories cat # A190-104B)and FLAG (Bethyl laboratories, A190- 101B) were used for detection of interacting proteins in the miniaturized sandwich immunoassay.
NeutrAvidin R-phycoerythrin was used as the reporter assay reagent (Invitrogen, A2660).
Protein input for BBX32: :GFP and interactions were detected using the miniaturized sandwich immunoassay and co-IP method (Poetz, et ah, 2009).Protein complexes were captured from extracts on antibody-conjugated beads, and the bound partner proteins were detected with biotinylated antibodies. NeutrAvidin R-phycoerythrin provided a fluorescence read-out for the quantity of bound detection antibody. Interacting proteins were defined as pairs of potential interacting proteins that yielded a greater median fluorescence intensity (MFI) than any of the controls (single protein expressed or untransformed cells) with a p-value <0.001 and a change in MFI that was 4-fold or greater when compared to each of the controls.
To assess the potential interaction between AtBBX32 and GmBBX39, two experiments were conducted consisting of a total of three repetitions (exp. 1, n=l ; exp. 2, n=2). BBX32::GFP was co- expressed with FLAG: :GmBBX39 in soybean cotyledon protoplasts. Expression analyses on one replicate of each treatment using either Luminex (BBX32::GFP) or Western blot (FLAG: :BBX39) detection confirmed that each protein was expressed at detectable levels (data not shown). When co- expressed in protoplasts, BBX32::GFP and FLAG: :BBX39 co-precipitated with either anti-GFP or anti- FLAG beads (Figure 17). BBX32::GFP did not co-IP with anti-FLAG beads in the absence of
FLAG: :BBX39 and FLAG: :BBX39 did not co-IP with anti-GFP beads in the absence of BBX32: :GFP. These results demonstrate that AtBBX32 and GmBBX39 physically interact in soybean protoplasts. Similar experiments also demonstrated physical interactions between GmBBX39 and GmBBX62, between GmBBX52 and GmBBX39, and between GmBBX52 and GmBBX62 (data not shown). References cited:
Abel and Theologis (1994) Plant J. 5: 421-427
Aldemita and Hodges (1996) Planta 199: 612-617
Altschul (1990) J. Mol. Biol. 215: 403-410
Altschul (1993) J. Mol. Evol. 36: 290-300
Ammirato et al., eds. (1984), Handbook of Plant Cell Culture -Crop Species, Macmillan Publ. Co., New York, NY
Anderson and Young (1985) "Quantitative Filter Hybridisation", In: Hames and Higgins, ed., Nucleic Acid Hybridisation, A Practical Approach. Oxford, IRL Press, 73-111
Ausubel et al. (1997) Short Protocols in Molecular Biology, John Wiley & Sons, New York, NY, unit 7.7 Babic et al. (1998) Plant Cell Reports 17: 183-188
Bairoch et al. (1997) Nucleic Acids Res. 25 : 217-221
Bechtold and Pelletier (1998) Methods Mol. Biol. 82: 259-266
Berger and Kimmel (1987), "Guide to Molecular Cloning Techniques", in Methods in Enzymology, vol.
152, Academic Press, Inc., San Diego, CA
Bevmi (1984) Nucleic Acids Res. 12: 8711-8721
Borevitz et al. (2000) Plant Cell 12: 2383-2393
Boss and Thomas (2002) Nature, 416: 847-850
Bruce et al. (2000) Plant Cell 12: 65-79
Cassas et al. (1993) Proc. Natl. Acad. Sci. USA 90: 11212-11216
Cheikh et al. (2003) U.S. Patent Application No. US20030101479
Christou et al. (1987) Proc. Natl. Acad. Sci. USA 84: 3962-3966
Christou (1991) Bio/Technol. 9:957-962
Christou et al. (1992) Plant. J. 2: 275-281
D'Halluin et al. (1992) Plant Cell 4: 1495-1505
Daly et al. (2001) Plant Physiol. 127: 1328-1333
Deshayes et al. (1985) EMBO J., 4: 2731-2737
Donn et al.(1990) in Abstracts of Vllth International Congress on Plant Cell and Tissue Culture IAPTC, A2-38: 53
Doolittle, ed. (1996) Methods in Enzymology, vol. 266: "Computer Methods for Macromolecular
Sequence Analysis" Academic Press, Inc., San Diego, Calif., USA
Draper et al. (1982) Plant Cell Physiol. 23: 451-458
Eddy (1996) Curr. Opin. Str. Biol. 6: 361-365
Eisen (1998) Genome Res. 8: 163-167
Feng and Doolittle (1987) J. Mol. Evol. 25 : 351 -360
Fowler and Thomashow (2002) Plant Cell 14: 1675-1690
Fromm et al. (1990) Bio Technol. 8: 833-839
Fu et al. (2001) Plant Cell 13: 1791 -1802 Gelvin et al. (1990) Plant Molecular Biology Manual. Kluwer Academic Publishers Gilmour et al. (1998) Plant J. 16: 433-442
Goodrich et al. (1993) Cell 75: 519-530
Gordon-Kamm et al. (1990) Plant Cell 2: 603-618
Gruber et al., in Glick and Thompson (1993) Methods in Plant Molecular Biology and Biotechnology, eds., CRC Press, Inc., Boca Raton
Haake et al. (2002) Plant Physiol. 130: 639-648
Hain et al. (1985) Mol. Gen. Genet. 199: 161-168
Haymes et al. (1985) Nucleic Acid Hybridization: A Practical Approach, IRL Press, Washington, D.C. He et al. (2000) Transgenic Res. 9: 223-227
Hein (1990) Methods Enzymol. 183: 626-645
Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915
Henikoff and Henikoff (1991) Nucleic Acids Res. 19: 6565-6572
Herrera-Estrella et al. (1983) Nature 303 : 209
Hiei et al. (1994) Plant J. 6:271-282
Hiei et al. (1997) Plant Mol. Biol. 35:205-218
Higgins and Sharp (1988) Gene 73: 237-244
Higgins et al. (1996) Methods Enzymol. 266: 383-402
Ishida (1990) Nature Biotechnol. 14:745-750
Jaglo et al. (2001) Plant Physiol. 127: 910-917
Kashima et al. (1985) Nature 313: 402-404
Khanna et al. (2006) Plant Cell 18, 2157-2171
Kim et al. (2001) Plant J. 25: 247-259
Kimmel (1987) Methods Enzymol. 152: 507-511
Klee (1985) Bio/Technology 3: 637-642
Klein et al. (1987) Nature 327: 70-73
Koornneef et al (1986) In Tomato Biotechnology: Alan R. Liss, Inc., 169-178
Ku et al. (2000) Proc. Natl. Acad. Sci. USA 97: 9121-9126
Kyozuka and Shimamoto (2002) Plant Cell Physiol. 43: 130-135
Lin et al. (1991) Nature 353: 569-571
Mandel (1992a) Nature 360: 273-277
Mandel et al. (1992b) Cell 71-133-143
Meyers (1995) Molecular Biology and Biotechnology, Wiley VCH, New York, NY, p 856-853
Miki et al. (1993) in Methods in Plant Molecular Biology and Biotechnology, p. 67-88, Glick and
Thompson, eds., CRC Press, Inc., Boca Raton
Mount (2001), in Bioinformatics: Sequence and Genome Analysis, Cold Spring Harbor Laboratory Press,
Cold Spring Harbor, New York, p. 543
Miiller et al. (2001) Plant J. 28: 169-179 Nandi et al. (2000) Curr. Biol. 10: 215-218
Niman et al. (1983). Proc. Natl. Acad. Sci. U.S.A. 80: 4949-4953
Peng et al. ( 1997) Genes Development 11 : 3194-3205
Peng et al. (1999) Nature 400: 256-261
Poetz, O., K. Luckert, et al. (2009) Anal. Biochem. 395:244-248
Putterill et al. (1995) Cell 80: 847-857
Ratcliffe et al. (2001) Plant Physiol. 126: 122-132
Reeves and Nissen (1990) J. Biol. Chem. 265, 8573-8582
Reeves and Nissen (1995). Prog. Cell Cycle Res. 1 : 339-349
Riechmann et al. (2000a) Science 290, 2105-2110
Riechmann and Ratcliffe (2000b) Curr. Opin. Plant Biol. 3, 423-434
Rieger et al. (1976) Glossary of Genetics and Cytogenetics: Classical and Molecular, 4th ed., Springer Verlag, Berlin
Robson et al. (2001) Plant J. 28: 619-631
Sadowski et al. (1988) Nature 335: 563-564
Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.
Sanford et al. (1987) Part. Sci. Technol. 5:27-37
Sanford (1993) Methods Enzymol. 217: 483-509
Shimamoto et al. 1989; Nature 338: 274-276
Shpaer(1997) Methods Mol. Biol. 70: 173-187
Smith et al. (1992) Protein Engineering 5: 35-51
Sonnhammer et al. (1997) Proteins 28: 405-420
Spencer et al. (1994) Plant Mol. Biol. 24: 51 -61
Suzuki et al. (2001) Plant J. 28: 409-418
Thompson et al. (1994) Nucleic Acids Res. 22: 4673-4680
Tudge (2000) in The Variety of Life, Oxford University Press, New York, NY pp. 547-606
Vasil et al. (1990) Bio/Technol. 8: 429-434
Vasil et al. (1992) Bio/Technol. 10:667-674
Vasil et al. (1993) fi;o/Tec/iwo/. l l : 1553-1558
Vasil (1994) Plant Mol. Biol. 25: 925-937
Wahl and Berger (1987) Methods Enzymol. 152: 399-407
Wan and Lemeaux (1994) Plant Physiol. 104: 37-48
Weeks et al. (1993) Plant Physiol. 102: 1077-1084
Weigel and Nilsson (1995) Nature 377 : 482-500
Weissbach and Weissbach (1989) Methods for Plant Molecular Biology, Academic Press
Wu (ed.) Meth. Enzymol. (1993) vol. 217, Academic Press
Zhang et al. (1991) Bio/Technology 9: 996-997 All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
The present disclosure is not limited by the specific embodiments described herein. The disclosure now being fully described, it will be apparent to one of ordinary skill in the art that many changes and modifications can be made thereto without departing from the spirit or scope of the appended claims. Modifications that become apparent from the foregoing description and accompanying figures fall within the scope of the claims.

Claims

What is claimed is:
1. A method for modifying a trait in a plant, the method comprising the steps of:
introducing into a target plant at least one recombinant polynucleotide comprising at least one nucleotide sequence that encodes a polypeptide, wherein the nucleotide sequence is selected from the group consisting of:
(a) a nucleotide sequence set forth as SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27,
29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83,
85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129,
131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213,
215, 217, 219, 221, 223, 225, 227, 229, 231, 233; 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455,
457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497,
499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 545, 547, or 549;
(b) a nucleotide sequence encoding SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28,
30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84,
86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130,
132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456,
458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498,
500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550, or any of SEQ ID NO: 235 to 427; and
(c) a nucleotide sequence encoding a polypeptide wherein the polypeptide has a percentage identity to at least one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548,550, or any of SEQ ID NO: 235 to 427;
wherein the nucleotide sequence is operably linked to a promoter that is expressed in a plant cell; wherein the target plant overexpresses the polypeptide and said overexpression results in the target plant expressing the modified trait; wherein the percentage identity is selected from the group consisting of at least 50%, at least 51 %, at least 52%, at least 53%, at least 54%, at least 55%, at least 56%, at least 57%, at least 58%, at least 59%, at least 60%, at least 61%, at least 62%, at least 63%, at least 64%, at least 65%, at least 66%, at least 67%, at least 68%, at least 69%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% and 100%;
wherein the modified trait is selected from the group consisting of decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased branching, increased secondary rooting, greater cold tolerance, greater tolerance to water deprivation, reduced stomatal conductance, altered C/N sensing, increased tolerance to nitrogen limiting conditions, improved late season growth and vigor, greater number of primary nodes, greater late season canopy coverage, increased tolerance to abiotic stress, increased tolerance to hyperosmotic stress, altered levels of ureides, altered levels of hexose sugars, altered sucrose phosphate synthase (SPS) activity, altered levels of starch, and delayed senescence, as compared to a control plant that does not comprise the recombinant polynucleotide; and,
optionally, selecting a transgenic plant having at least one of the modified traits as compared to the control plant.
2. The method of claim 1, wherein the target plant comprises a second recombinant polynucleotide comprising a trans-acting element that controls expression of the polypeptide.
3. The method of claim 2, wherein the target plant expresses a protein encoded by a nucleic acid selected from the group consisting of: SEQ ID NO: 429, SEQ ID NO: 431, SEQ ID NO: 433, and SEQ ID NO: 529.
4. The method of claim 1, wherein the target plant is stably transformed with the at least one recombinant polynucleotide.
5. A method for modifying a trait in a plant, the method comprising the steps of:
introducing into a target plant at least one recombinant polynucleotide that suppresses the expression of at least a polypeptide, wherein the polypeptide is encoded by a polynucleotide comprising a nucleotide sequence selected from the group consisting of:
(a) a nucleotide sequence set forth as SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233; 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455, 457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497,
499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 545, 547, or 549;
(b) a nucleotide sequence encoding SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84,
86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498,
500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548,550, or any of SEQ ID NO: 235 to 427;
(c) a nucleotide sequence encoding a polypeptide wherein the polypeptide has a percentage identity to at least one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548,550, or any of SEQ ID NO: 235 to 427; and
wherein the percentage identity is selected from the group consisting of at least 50%, at least 51%, at least 52%, at least 53%, at least 54%, at least 55%, at least 56%, at least 57%, at least 58%, at least 59%, at least 60%, at least 61%, at least 62%, at least 63%, at least 64%, at least 65%, at least 66%, at least 67%, at least 68%, at least 69%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% and 100%;
wherein the nucleotide sequence is operably linked to a promoter that is expressed in a plant cell; wherein the target plant overexpresses the polypeptide and said overexpression results in the target plant expressing the modified trait wherein the modified trait is selected from the group consisting of decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased branching, increased secondary rooting, greater cold tolerance, greater tolerance to water deprivation, reduced stomatal conductance, altered C/N sensing, increased tolerance to nitrogen limiting conditions, improved late season growth and vigor, greater number of primary nodes, greater late season canopy coverage, increased tolerance to abiotic stress, increased tolerance to hyperosmotic stress, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence, as compared to a control plant that does not comprise the recombinant
polynucleotide; and optionally, selecting a transgenic plant having at least one of the modified traits as compared to the control plant.
6. The method of claim 5, wherein the target plant comprises a second recombinant polynucleotide comprising a trans-acting element that controls expression of the polypeptide.
7. The method of claim 5, wherein the target plant expresses a protein encoded by a nucleic acid selected from the group consisting of: SEQ ID NO: 429, SEQ ID NO: 431, SEQ ID NO: 433, and SEQ ID NO: 529.
8. The method of claim 5, wherein the target plant is stably transformed with the at least one recombinant polynucleotide.
9. The method of claim 1 or 5, wherein the promoter is a constitutive, inducible, tissue-specific, tissue- enhanced or cell-specific promoter.
10. The method of claim 1 or 5, wherein the promoter:
regulates expression of the polypeptide in vascular, shoot apical meristem, hypocotyl or leaf primordia tissue;
or the promoter is a light-regulated promoter;
or the promoter is a stress-inducible promoter.
or the promoter is a diurnally-regulated promoter.
or the promoter is a chemically-inducible promoter.
11. The method of claim 1 or 5, the method steps further comprising:
crossing the target plant with itself, a second plant from the same line as the target plant, a non- transgenic plant, a wild-type plant, or a transgenic plant from a different line of plants, to produce a transgenic seed.
12. The method of claim 1 or 5, wherein the at least one nucleotide sequence is derived from:
the family Pinaceae, cedar, fir, hemlock, larch, pine, spruce, the family Alliaceae, onion, leek, garlic, the family Amaranthaceae, spinach, the family Anacardiaceae, mango, the family Asteraceae, sunflower, endive, lettuce, artichoke, the family Brassicaceae, Arabidopsis thaliana, rape, oilseed rape, canola, cauliflower, turnip, radish, broccoli, cabbage, cauliflower, Brussels sprouts, kohlrabi, the family Bromeliaceae, pineapple, the family Caricaceae, papaya, the family Chenopodiaceae, beet, the family Curcurbitaceae, melon, cantaloupe, squash, watermelon, honeydew, cucumber, pumpkin, the family Dioscoreaceae, yam, the family Ericaceae, blueberry, the family Euphorbiaceae, cassava, the family Fabaceae, alfalfa, clover, peanut, the family Grossulariaceae, currant; the family Juglandaceae, walnut, the family Lamiaceae, mint, the family Lauraceae, avocado, the family Leguminosae, soybean, bean, pea, the family Malvaceae, cotton, the family Marantaceae, arrowroot, the family Myrtaceae, guava, eucalyptus, the family Rosaceae, peach, apple, cherry, plum, pear, prune, blackberry, raspberry, strawberry, the family Rubiaceae, coffee, the family Rutaceae, citrus, orange, lemon, grapefruit, tangerine, the family Salicaceae, poplar, willow, the family Solanaceae, potato, sweet potato, tomato, Capsicum, tobacco, tomatillo, eggplant, Atropa belladona, Datura stramonium, the family Vitaceae, grape, the family Umbelliferae, carrot, the family Musaceae, banana, the family Poaceae, wheat, maize, sweet corn, rice, wild rice, barley, rye; millet, sorghum, sugar cane, turfgrass, bamboo, oats, brome-grass, Miscanthus, pampas grass, switchgrass (Panicum), and/or teosinte.
13. A transgenic plant produced by the method of claim 1 or 5, wherein the transgenic plant comprises the at least one recombinant polynucleotide of claim 1 or 5.
14. The transgenic plant of claim 13, wherein the transgenic plant is a dicot or a conifer.
15. The transgenic plant of claim 14, wherein the dicot or conifer is a: member of the family Pinaceae, cedar plant, fir plant, hemlock plant, larch plant, pine plant, spruce plant, member of the family
Amaranthaceae, spinach plant, member of the family Anacardiaceae, mango plant, member of the family Asteraceae, sunflower plant, endive plant, lettuce plant, artichoke plant, member of the family
Brassicaceae, Arabidopsis thaliana plant, rape plant, oilseed rape plant, broccoli plant, Brussels sprouts plant, cabbage plant, canola plant, cauliflower plant, kohlrabi plant, turnip plant, radish plant, member of the family Bromeliaceae, pineapple plant, member of the family Caricaceae, papaya plant, member of the family Chenopodiaceae, beet plant, member of the family Curcurbitaceae, melon plant, cantaloupe plant, squash plant, watermelon plant, honeydew plant, cucumber plant, pumpkin plant, member of the family Dioscoreaceae, yam plant, member of the family Ericaceae, blueberry plant, member of the family Euphorbiaceae, cassava plant, member of the family Fabaceae, alfalfa plant, clover plant, peanut plant, member of the family Grossulariaceae, currant plant, member of the family Juglandaceae, walnut plant, member of the family Lamiaceae, mint plant, member of the family Lauraceae, avocado plant, member of the family Leguminosae, soybean plant, bean plant, pea plant, member of the family Malvaceae, cotton plant, member of the family Marantaceae, arrowroot plant, member of the family Myrtaceae, guava plant, eucalyptus plant, member of the family Rosaceae, peach plant, apple plant, cherry plant, plum plant, pear plant, prune plant, blackberry plant, raspberry plant, strawberry plant, member of the family Rubiaceae, coffee plant, member of the family Rutaceae, citrus plant, orange plant, lemon plant, grapefruit plant, tangerine plant, member of the family Salicaceae, poplar plant, willow plant, member of the family Solanaceae, potato plant, sweet potato plant, tomato plant, Capsicum plant, tobacco plant, tomatillo plant, eggplant plant, Atropa belladona plant, Datura stramonium plant, member of the family Vitaceae, grape plant, member of the family Umbelliferae, carrot plant and/or member of the family Musaceae, banana plant.
16. The transgenic plant of claim 13, wherein the transgenic plant is a monocot.
17. The transgenic plant of claim 16, wherein the monocot is a: member of the family Poaceae; maize plant; rice plant; wild rice plant, wheat plant; barley plant; sorghum plant; rye plant; oat plant; millet plant; turfgrass plant; sugarcane plant, bamboo plant, brome-grass plant, pampas grass plant, Miscanthus plant; switchgrass plant, teosinte plant; and/or member of the family Alliaceae, onion, leak and garlic.
18. A tissue culture produced from protoplasts or cells from the transgenic plant of claim 13, wherein said cells or protoplasts are produced from a plant part selected from the group consisting of leaf, pollen, ovule, embryo, cotyledon, hypocotyl, meristematic cell, root, root tip, pistil, anther, flower, seed, shoot, stem, pod and petiole.
19. A regenerated plant regenerated from the tissue culture of claim 18.
20. A seed from the transgenic plant of claim 13.
21. A method for producing a transgenic seed, the method comprising crossing two plants and harvesting resultant seed, wherein at least one plant is the transgenic plant of claim 13.
22. A transgenic seed produced by the method of claim 1.
23. A transgenic progeny plant, or a part thereof, produced by growing the seed of claim 22.
24. The transgenic progeny plant of claim 23, wherein the transgenic progeny plant has a modified trait relative to a control plant,
wherein the modified trait is selected from the group consisting of decreased sensitivity to light, increased yield, greater height, greater stem diameter, greater resistance to lodging, increased branching, increased secondary rooting, greater cold tolerance, greater tolerance to water deprivation, reduced stomatal conductance, altered C/N sensing, increased tolerance to nitrogen limiting conditions, improved late season growth and vigor, greater number of primary nodes, greater late season canopy coverage, increased tolerance to abiotic stress, increased tolerance to hyperosmotic stress, altered levels of ureides, altered levels of hexose sugars, altered SPS activity, altered levels of starch, and delayed senescence, as compared to a control plant that does not comprise the recombinant polynucleotide.
25. A recombinant polynucleotide comprising a nucleotide sequence that encodes a polypeptide, wherein the nucleotide sequence is selected from the group consisting of:
(a) a nucleotide sequence set forth as SEQ ID NO: 447, 461, 473, 481, 483, 485, 509;
(b) a nucleotide sequence encoding SEQ ID NO: 448, 462, 474, 482, 484, 486, 510;
(c) a nucleotide sequence wherein the nucleotide sequence has a percentage identity to at least one of SEQ ID NO: 447, 461, 473, 481, 483, 485, 509; and
(d) a nucleotide sequence encoding a polypeptide wherein the polypeptide has a percentage identity to at least one of SEQ ID NO: 448, 462, 474, 482, 484, 486, 510;
wherein the percentage identity is selected from the group consisting of at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% and 100%.
26. A recombinant DNA construct comprising a promoter that is functional in a plant cell and that is operably linked to the recombinant polynucleotide of claim 25.
27. A plant cell comprising at least one recombinant polynucleotide of claim 25.
28. A plant cell comprising at least one recombinant polynucleotide that suppresses the expression of at least a polypeptide, wherein the polypeptide is encoded by a recombinant polynucleotide of claim 25.
29. A plant comprising the plant cell of claim 27 or 28.
30. A seed comprising the plant cell of claim 27 or 28.
31. A method for producing a plant comprising the recombinant polynucleotide of claim 25.
PCT/US2012/038719 2011-05-20 2012-05-18 Manipulating plant sensitivity to light Ceased WO2012162193A2 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US14/118,491 US20140380520A1 (en) 2011-05-20 2012-05-18 Manipulating plant sensitivity to light
US15/802,397 US20180155736A1 (en) 2011-05-20 2017-11-02 Manipulating plant sensitivity to light
US17/404,842 US20220042029A1 (en) 2011-05-20 2021-08-17 Manipulating plant sensitivity to light
US18/465,595 US20240124885A1 (en) 2011-05-20 2023-09-12 Manipulating plant sensitivity to light

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161488592P 2011-05-20 2011-05-20
US61/488,592 2011-05-20

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/118,491 A-371-Of-International US20140380520A1 (en) 2011-05-20 2012-05-18 Manipulating plant sensitivity to light
US15/802,397 Division US20180155736A1 (en) 2011-05-20 2017-11-02 Manipulating plant sensitivity to light

Publications (2)

Publication Number Publication Date
WO2012162193A2 true WO2012162193A2 (en) 2012-11-29
WO2012162193A3 WO2012162193A3 (en) 2014-05-08

Family

ID=47217996

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/038719 Ceased WO2012162193A2 (en) 2011-05-20 2012-05-18 Manipulating plant sensitivity to light

Country Status (2)

Country Link
US (4) US20140380520A1 (en)
WO (1) WO2012162193A2 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016007640A1 (en) * 2014-07-10 2016-01-14 Benson Hill Biosystems, Inc. Compositions and methods for increasing plant growth and yield
WO2024102277A3 (en) * 2022-11-07 2024-06-20 Syngenta Crop Protection Ag Genes altering soy plant flowering time and/or maturation and uses thereof
CN119752932A (en) * 2024-12-20 2025-04-04 南京农业大学 Application of soybean GmBBX13b gene in delaying leaf and plant senescence

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2814532C (en) 2010-10-12 2021-07-27 Monsanto Technology Llc Soybean plant and seed corresponding to transgenic event mon87712 and methods for detection thereof
CN112795691B (en) * 2021-03-24 2022-02-18 湖南农业大学 Molecular marker linked with corn stem thickness and application thereof
CN114644704B (en) * 2022-02-24 2023-05-12 东北农业大学 Protein with plant stress regulation function and cultivation method for improving plant stress
CN116555284B (en) * 2023-04-24 2023-12-29 南京农业大学 Application of GmBBX4 gene in regulating soybean isoflavone synthesis

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10597667B2 (en) * 1998-09-22 2020-03-24 Mendel Biotechnology, Inc. Stress tolerance in plants
US7692067B2 (en) * 2002-09-18 2010-04-06 Mendel Biotechnology, Inc. Yield and stress tolerance in transgenic plants
CA2420555C (en) * 2000-08-24 2012-10-23 The Scripps Research Institute Stress-regulated genes of plants, transgenic plants containing same, and methods of use
US20100275333A1 (en) * 2005-09-14 2010-10-28 Joel Kreps Abiotic stress responsive polynucleotides and polypeptides

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016007640A1 (en) * 2014-07-10 2016-01-14 Benson Hill Biosystems, Inc. Compositions and methods for increasing plant growth and yield
CN106661584A (en) * 2014-07-10 2017-05-10 本森希尔生物系统股份有限公司 Compositions and methods for increasing plant growth and yield
US11060101B2 (en) 2014-07-10 2021-07-13 Benson Hill, Inc. Compositions and methods for increasing plant growth and yield
WO2024102277A3 (en) * 2022-11-07 2024-06-20 Syngenta Crop Protection Ag Genes altering soy plant flowering time and/or maturation and uses thereof
CN119752932A (en) * 2024-12-20 2025-04-04 南京农业大学 Application of soybean GmBBX13b gene in delaying leaf and plant senescence

Also Published As

Publication number Publication date
US20220042029A1 (en) 2022-02-10
US20140380520A1 (en) 2014-12-25
WO2012162193A3 (en) 2014-05-08
US20240124885A1 (en) 2024-04-18
US20180155736A1 (en) 2018-06-07

Similar Documents

Publication Publication Date Title
US7868229B2 (en) Early flowering in genetically modified plants
US20240124885A1 (en) Manipulating plant sensitivity to light
US8633353B2 (en) Plants with improved water deficit and cold tolerance
US8927811B2 (en) Plants with enhanced size and growth rate
CA2957986C (en) Biotic and abiotic stress tolerance in plants
EP1682668B1 (en) Plant transcriptional regulators
US7888558B2 (en) Conferring biotic and abiotic stress tolerance in plants
US7939715B2 (en) Plants with improved yield and stress tolerance
US20050086718A1 (en) Plant transcriptional regulators of abiotic stress
US20090265813A1 (en) Stress tolerance in plants
US7960612B2 (en) Plant quality with various promoters
WO2004108900A2 (en) Plant transcriptional regulators of disease resistance
WO2012145269A1 (en) Yield and stress tolerance in transgenic plants
US20120210456A1 (en) Enhancement of plant yield, vigor and stress tolerance ii
US20110010796A1 (en) Water deficit-inducible promoters
WO2015024119A1 (en) Plants producing seeds which remove chlorophyl during maturation under stress conditions
WO2009117448A1 (en) Enhancement of plant yield, vigor and stress tolerance
US20130031669A1 (en) Plant transcriptional regulators of abiotic stress ii
WO2005038034A2 (en) Plant transcriptional regulators of abiotic stress

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12789602

Country of ref document: EP

Kind code of ref document: A2

122 Ep: pct application non-entry in european phase

Ref document number: 12789602

Country of ref document: EP

Kind code of ref document: A2