WO2012145595A1 - Filamentous fungi having an altered viscosity phenotype - Google Patents

Filamentous fungi having an altered viscosity phenotype Download PDF

Info

Publication number
WO2012145595A1
WO2012145595A1 PCT/US2012/034403 US2012034403W WO2012145595A1 WO 2012145595 A1 WO2012145595 A1 WO 2012145595A1 US 2012034403 W US2012034403 W US 2012034403W WO 2012145595 A1 WO2012145595 A1 WO 2012145595A1
Authority
WO
WIPO (PCT)
Prior art keywords
gene
strain
sebl
protein
variant
Prior art date
Application number
PCT/US2012/034403
Other languages
French (fr)
Inventor
Elizabeth A. Bodie
Robert James II PRATT
Original Assignee
Danisco Us Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Danisco Us Inc. filed Critical Danisco Us Inc.
Priority to KR1020137030769A priority Critical patent/KR101952470B1/en
Priority to EP12717559.4A priority patent/EP2663633B1/en
Priority to BR112013025203A priority patent/BR112013025203A2/en
Priority to CN201280019678.3A priority patent/CN103502431B/en
Priority to DK12717559.4T priority patent/DK2663633T3/en
Priority to CA2833541A priority patent/CA2833541C/en
Priority to US14/112,879 priority patent/US9725727B2/en
Priority to AU2012245322A priority patent/AU2012245322A1/en
Priority to JP2014506565A priority patent/JP6042868B2/en
Publication of WO2012145595A1 publication Critical patent/WO2012145595A1/en
Priority to AU2017202753A priority patent/AU2017202753A1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N1/00—Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
    • C12N1/14—Fungi; Culture media therefor
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N1/00—Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
    • C12N1/36—Adaptation or attenuation of cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/37—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10—Transferases (2.)
    • C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241—Nucleotidyltransferases (2.7.7)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/07—Nucleotidyltransferases (2.7.7)
    • C12Y207/07013—Mannose-1-phosphate guanylyltransferase (2.7.7.13)

Definitions

  • a variant strain of filamentous fungus derived from a parental strain comprising a genetic alteration that causes cells of the variant strain to produce an altered amount of functional Sebl protein compared to cells of the parental strain, wherein the cells of the variant strain are produced during aerobic fermentation in submerged culture cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content compared to the cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
  • the variant strain does not produce functional Sebl protein. In some embodiments, the variant strain does not produce Sebl protein.
  • the variant strain further comprises a gene encoding a protein of interest. In some embodiments, the variant strain further comprises a disruption of the sft>3 gene. In some embodiments, the variant strain further comprises a disruption of the mpgl gene. In some embodiments, the variant strain further comprises a disruption of the sft>3 and mpgl genes. In some embodiments, the variant strain further comprises a disruption of at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene. In some embodiments, the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
  • the filamentous fungus is a Pezizomycotina species.
  • the filamentous fungus is a Trichoderma spp., Aspergillus spp., Fusarium spp., Scedosporium spp., Penicillium spp., Chrysosporium spp., Cephalosporium spp., Talaromyces spp., Geosmithia spp., and Neurospora spp.
  • the genetic alteration reduces or prevents the production of
  • Sebl protein thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, o compared to the cells of the parental strain.
  • the genetic alteration comprises disrupting the sebl gene in a parental filamentous fungal cell using genetic manipulation. In some embodiments, the genetic alteration comprises deleting the sebl gene in a parental filamentous fungal cell using genetic manipulation. In some embodiments, the genetic alteration is performed using site-specific 5 genetic recombination.
  • disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
  • the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
  • disruption of the sebl gene is performed0 in combination with disrupting the sft>3 gene.
  • disruption of the sebl gene is performed in combination with disrupting the mpgl gene.
  • disruption of the sebl gene is performed in combination with disrupting at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
  • the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
  • the filamentous fungus can include, but is not limited to, Trichoderma reesei (previously classified as Trichoderma longibrachiatum and Hypocrea jecorina), Aspergillus niger, Aspergillus fumigatus, Aspergillus itaconicus, Aspergillus oryzae, Aspergillus nidulans, Aspergillus terreus, Aspergillus sojae, Aspergillus japonicus, Scedosporium prolificans, Neurospora crassa, Penicillium funiculosum, Penicillium chrysogenum, Talaromyces (Geosmithia) emersonii, Fusarium venenatum, and Chrysosporium lucknowense.
  • the filamentous fungus is Trichoderma reesei.
  • the parental strain further comprises a gene encoding a protein of interest.
  • the gene encoding the protein of interest is present in the parental strain prior to introducing the genetic alteration that reduces or prevents the production of functional Sebl protein.
  • the protein of interest within the parental strain is encoded by an endogenous gene or a heterologous gene.
  • a variant strain of filamentous fungus derived from a parental strain comprising: (a) a genetic alteration that results in (i) a requirement for reduced agitation in submerged culture to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintenance of an increased dissolved oxygen content in submerged culture at a preselected amount of agitation, compared to the cells of the parental strain, and (b) a gene encoding a protein of interest, wherein the gene encoding the protein of interest is present in the variant strain prior to the genetic alteration in (a).
  • the genetic alteration of the resulting variant strain comprises a disruption of the sebl gene present in the parental strain.
  • disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
  • disruption of the sebl gene is performed in combination with disrupting the sft>3 gene.
  • disruption of the sebl gene is performed in combination with disrupting the mpgl gene.
  • disruption of the sebl gene is performed in combination with disrupting at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
  • Figure 1A shows a schematic representing the T-DNA containing the pyr4 gene.
  • Figure IB is a map of the Agrobacterium tumefaciens PZP 100 vector.
  • Figure 2 is graph comparing the dissolved oxygen levels during growth of T4 T-DNA mutant F16 and the T4 parent in a 14 L fermentor.
  • Figure 7 is a map of the mpgl disruption vector. 0 DETAILED DESCRIPTION
  • Trichoderma reesei refers to a filamentous fungus of the phylum Ascomycota, subphylum Pezizomycotina. This organism was previously classified as
  • protein of interest refers to a polypeptide that is desired to be expressed in a filamentous fungus.
  • a protein can be an enzyme, a substrate -binding protein, a surface-active protein, a structural protein, or the like, and can be expressed at high levels, and can be for the purpose of commercialization.
  • the protein of interest can be encoded by an endogenous gene or a heterologous gene relative to the variant strain and/or the parental strain.
  • the protein of interest can be expressed intracellularly or as a secreted protein.
  • the phrase "substantially free of an activity," or similar phrases, means that a specified activity is either undetectable in an admixture or present in an amount that would not interfere with the intended purpose of the admixture.
  • the term "derivative polypeptide/protein” refers to a protein which is derived or derivable from a protein by addition of one or more amino acids to either or both the N- and C-terminal end(s), substitution of one or more amino acids at one or a number of different sites in the amino acid sequence, deletion of one or more amino acids at either or both 5 ends of the protein or at one or more sites in the amino acid sequence, and/or insertion of one or more amino acids at one or more sites in the amino acid sequence.
  • the preparation of a protein derivative can be achieved by modifying a DNA sequence which encodes for the native protein, transformation of that DNA sequence into a suitable host, and expression of the modified DNA sequence to form the derivative protein.
  • variant proteins include "variant proteins.” Variant proteins differ from a reference/parental protein (e.g. , a wild-type protein) by substitutions, deletions, and/or insertions at a small number of amino acid residues.
  • the number of differing amino acid residues between the variant and parental protein can be one or more, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, or more amino acid residues.
  • Variant proteins can share at least5 about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99%, or more, amino acid sequence identity with a reference protein.
  • a variant protein can also differ from a reference protein in selected motifs, domains, epitopes, conserved regions, and the like.
  • analogous sequence refers to a sequence within a protein that provides similar function, tertiary structure, and/or conserved residues as the protein of interest (i.e. , typically the original protein of interest). For example, in epitope regions that contain an a- helix or a ⁇ -sheet structure, the replacement amino acids in the analogous sequence preferably maintain the same specific structure.
  • the term also refers to nucleotide sequences, as well as5 amino acid sequences. In some embodiments, analogous sequences are developed such that the replacement amino acids result in a variant enzyme showing a similar or improved function.
  • the degree of homology between sequences can be determined using any suitable method known in the art (see, e.g. , Smith and Waterman (1981) Adv. Appl. Math. 2:482;
  • the phrases “substantially similar” and “substantially identical,” in the context of at least two nucleic acids or polypeptides, typically means that a polynucleotide or polypeptide comprises a sequence that has at least about 70% identity, at least about 75% identity, at least about 80% identity, at least about 85% identity, at least about 90% identity, at least about 91% identity, at least about 92% identity, at least about 93% identity, at least about 94% identity, at least about 95% identity, at least about 96% identity, at least about 97% identity, at least about 98% identity, or even at least about 99% identity, or more, compared to the reference ⁇ i.e. , wild-type) sequence.
  • Sequence identity can be determined using known programs such as BLAST, ALIGN, and CLUSTAL using standard parameters.
  • BLAST Altschul, et al. (1990) /. Mol. Biol. 215:403-410; Henikoff et al. (1989) Proc. Natl. Acad. Sci. USA 89: 10915; Karin et al. (1993) Proc. Natl. Acad. Sci USA 90:5873; and Higgins et al. (1988) Gene 73:237-244
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. Also, databases can be searched using FASTA (Pearson et al. (1988) Proc. Natl.
  • wild-type and “native” are used interchangeably and refer to genes proteins or strains found in nature.
  • deletion of a gene refers to its removal from the genome of a host cell.
  • a gene includes control elements ⁇ e.g. , enhancer elements) that are not located immediately adjacent to the coding sequence of a gene
  • deletion of a gene refers to the deletion of the coding sequence, and optionally adjacent enhancer elements, including but not limited to, for example, promoter and/or terminator sequences.
  • viscosity of a cell broth can be difficult to measure directly, indirect measurements of viscosity can be used, such as the dissolved oxygen content of the culture broth at a preselected amount of agitation, the amount of agitation required to maintain a preselected dissolved oxygen content, the amount of power required to agitate a o cell broth to maintain a preselected dissolved oxygen content, or even colony morphology on solid medium.
  • the reduction in the amount of functional Sebl protein can result from disruption of the sebl gene present in the parental strain. Because disruption of the sebl gene is a primary genetic determinant for conferring a reduced viscosity phenotype to the variant strain, such variant strains0 need only comprise a disrupted sebl gene, while all other genes can remain intact. In some cases, the variant strains can optionally include additional genetic alterations compared to the parental stain from which they are derived. Such additional genetic alterations are not necessary to confer a reduction in viscosity but can further reduce viscosity or confer other advantages for the variant strain.
  • Exemplary methods of disruption include but are not limited to: Complete or partial deletion of the sebl gene, including complete or partial deletion of, e.g., the Sebl -coding sequence, the promoter, the terminator, an enhancer, or another o regulatory element; and complete or partial deletion of a portion of the chromosome that
  • Mutations in the sebl gene can reduce the efficiency of the sebl promoter, reduce the 5 efficiency of a sebl enhancer, interfere with the splicing or editing of the sebl mRNA, interfere with the translation of the sebl mRNA, introduce a stop codon into the Sebl -coding sequence to prevent the translation of full-length Sebl protein, change the coding sequence of the Sebl protein to produce a less active or inactive protein or reduce Sebl interaction with other nuclear protein components, change the coding sequence of the Sebl protein to produce a less stable0 protein or target the protein for destruction, cause the Sebl protein to misfold or be incorrectly modified ⁇ e.g., by glycosylation), or interfere with cellular trafficking of the Sebl protein.
  • the genetic alteration increases or restores the expression of a functional Sebl protein, or increases the normal biological activity of the Sebl protein, thereby producing a morphology change in the cell that results in an increased or restored viscosity phenotype.
  • the amino acid sequence of the Sebl protein that is altered in production levels has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NOs: 1, 2, 3, 4, or 5, e.g., at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 1, 2, 3, 4, or 5.
  • the nucleotide sequences encoding each amino acid sequence can be identified from a BLAST search for each corresponding protein as is know to one skilled in the art.
  • the variant filamentous fungus cells exhibit altered growth morphology on solid
  • the parental strain into which the reduced viscosity phenotype is introduced creating a reduced viscosity strain already comprises a gene of interest intended to be o expressed at high levels.
  • the present methods obviate the need to introduce a gene of interest into a pre-existing reduced viscosity strain for production.
  • the present methods can be used to produce a reduced viscosity variant strain of filamentous fungus cells from a parental strain already comprising a gene of interest. 5 IV. Additive effect produced by altering Sfb3 production
  • Sec24 is an essential gene in yeast
  • SfbS and Sft>2 are not, although the deletion of Sft>3 in yeast is known to affect the transport of a plasma membrane transport protein (Pmalp) and a glucanosyltransferase (Gaslp) that is involved in cell wall synthesis.
  • Pmalp plasma membrane transport protein
  • Gaslp glucanosyltransferase
  • T. reesei has a single gene that is most closely homologous to yeast Sec24 and a single gene that is most closely homologous to yeast Sfb3. No other homolog was identified suggesting that T. reesei does not have a gene equivalent to Sfb2.
  • homologs of the Sfb3 proteins were found in e.g. , T. reesei (SEQ ID NO: 6), A. oryzae (SEQ ID NO: 7), A.
  • the amino acid sequence of the Sfb3 protein that is altered in production levels has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NOs: 6, 7, 8, 9, 10, 11, or 12, e.g. , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 6, 7, 8, 9, 10, 11, or 12.
  • the nucleotide sequences encoding each amino acid sequence can be identified from a BLAST search for each corresponding protein as is know to one skilled in the art.
  • a sfl>3 gene is disrupted, wherein the sft>3 gene encodes a Sfb3 protein that has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NOs: 6, 7, 8, 9, 10, 11, or 12, e.g. , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 6, 7, 8, 9, 10, 11, or 12.
  • IQLARQGXDGXEXXXARXLXEDRNXEAXSXVDWL SEQ ID NO: 13, where X is any amino acid residue
  • This consensus sequence can be used to identify Sfb3 proteins and variants thereof in other members of the Pezizomycotina.
  • guanyltransferase Over-expression of the mpgl gene increases GDP-mannose levels, which can play a major regulatory role in early stages of protein glycosylation.
  • Mpgl has l o heretofore not been associated with altered morphology, particularly not an altered morphology that gives rise to a low viscosity phenotype.
  • guanyltransferase protein is shown, below, as SEQ ID NO: 38:
  • the amino acid sequence of the Mpgl protein that is altered in production levels has a specified degree of overall amino acid sequence identity to the amino acid sequence of at least one of SEQ ID NOs: 36, 37, or 38, e.g. , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 36, 37, or 38.
  • the nucleotide sequences encoding each amino acid sequence can be identified from a BLAST search for each corresponding protein as is know to one skilled in the art.
  • the mpgl gene that is disrupted encodes a Mpgl protein that has a specified degree of overall amino acid sequence identity to the amino acid sequence of at least one of SEQ ID NOs: 36, 37, or 38, e.g. , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to at least one of SEQ ID NOs: 36, 37, or 38.
  • amino acid sequence information readily allows the skilled person to identify an Mpgl protein, and the nucleic acid sequence encoding an Mpgl protein, in any filamentous fungi, and to make appropriate disruptions in the mpgl gene to affect the production of the Mpgl protein.
  • the polynucleotide sequences encoding SEQ ID NOs: 36, 37, or 38 can be found in the GenBank or JGI databases, as are known to one of skill in the art.
  • the present variant strains can have a fully defined genome, making them well-suited for subsequent genetic manipulation, complementation, mating, and the like.
  • the present o strains are not adversely affected in protein production, for example, by the manipulation(s) that resulted in the attendant viscosity alteration.
  • reduced viscosity strains can be produced from essentially any parental strain, including parental strains that already produce a protein intended for high level expression (i.e., a protein of interest), already encode a selectable marker, or already include other features that are desirable in a production host.
  • the present strain and methods 5 eliminate the need to transfer a gene encoding a protein of interest into a preexisting reduced
  • the present strains and methods find use in the production of commercially important protein in submerged cultures of filamentous fungi.
  • Commercially important proteins include, for example, cellulases, xylanases, pectinases, lyases, proteases, kinases, amylases, pullulanases,0 lipases, esterases, perhydrolases, transferases, laccases, catalases, oxidases, reductases,
  • chlorophy liases hydrophobin, chymosin, carbonic anhydrase, hymidylate synthase,
  • dihydrofolate reductase dihydrofolate reductase, tyrosine kinases, multi-drug resistance proteins (e.g., ABC P-gp proteins), CAD (carbamyl-P synthase, aspartate transcarbamylase, dihydroorotase),
  • topoisomerases ribonucleotide reductase
  • antibodies and other enzymes and non-enzyme 5 proteins capable of being expressed in filamentous fungi Such proteins can be suitable for
  • a variant strain of filamentous fungus derived from a parental strain comprising a genetic alteration that causes cells of the variant strain to produce an altered amount of functional Sebl protein compared to cells of the parental strain, wherein the cells of the variant strain produce during aerobic fermentation in submerged culture a cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content compared to the cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
  • the altered amount of functional Sebl protein is a reduced amount
  • the variant strain produces during aerobic fermentation in submerged culture a cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental l o strain.
  • the genetic alteration comprises a disruption of the sebl gene present in the parental strain.
  • disruption of the sebl gene is the result of deletion of all or part of the sebl gene.
  • disruption of the sebl gene is the result of deletion of a portion of genomic DNA comprising the sebl gene.
  • disruption of the sebl gene is the result of mutagenesis of the sebl gene.
  • disruption of the sebl gene 20 is performed using site-specific recombination.
  • disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
  • the variant strain does not 25 produce functional Sebl protein.
  • the variant strain does not produce Sebl protein.
  • the variant strain further comprises a gene encoding a protein of interest.
  • the variant strain further comprises a disruption of at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene. 14. In some embodiments of the variant strain of any of paragraphs 1-13, the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
  • the filamentous fungus is a Pezizomycotina species.
  • the filamentous fungus is a Trichoderma spp.
  • the filamentous fungus is Trichoderma reesei.
  • a method for producing a variant strain of filamentous fungus cells comprising: introducing a genetic alteration into a parental strain of filamentous fungal cell, which genetic alteration alters the production of functional Sebl protein compared to the cells of the parental strain, thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
  • the genetic alteration reduces or prevents the production of functional Sebl protein, thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
  • the genetic alteration comprises disrupting the sebl gene in a parental filamentous fungal cell using genetic manipulation.
  • the genetic alteration comprises deleting the sebl gene in a parental filamentous fungal cell using genetic manipulation.
  • the genetic alteration is performed using site- specific genetic recombination.
  • disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
  • disruption of the sebl gene is performed in combination with disrupting the sft>3 gene.
  • disruption of the sebl gene is performed in combination with disruption of at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
  • the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
  • the filamentous fungus is a Pezizomycotina species.
  • the filamentous fungus is a Trichoderma spp.
  • the filamentous fungus is Trichoderma reesei.
  • the parental strain further comprises a gene encoding a protein of interest.
  • the gene encoding the protein of interest is present in the parental strain prior to introducing the genetic alteration that reduces or prevents the production of functional Sebl protein.
  • a variant strain of filamentous fungus derived from a parental strain comprising:
  • the genetic alteration comprises a disruption of the sebl gene present in the parental strain.
  • disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
  • disruption of the sebl gene is performed in combination with disrupting at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
  • disruption of the sebl gene is performed in combination with disrupting the mpgl gene.
  • Example 1 Identification of the sebl gene as responsible for morphological changes in filamentous fungus
  • Filamentous fungi disruption libraries were prepared by transforming an exemplary filamentous fungus, i.e., Trichoderma reesei, with a nucleic acid containing the pyr4 gene, using Agrobacterium tumefaciens- ediated transformation. In this manner, the pyr4 gene served as both a selectable marker and a gene tag.
  • the particular A. tumefaciens strain used was EHA 105, which is considered to be a hypervirulent (Hood et ah, 1993). However, other A.
  • tumefaciens strains e.g., A136 and EHA 101
  • A. rhizogenes strains e.g., ATCC 43057
  • the particular disruption library contained about 50,000 transformants.
  • the vector used for disruption was based on the PZP 100 vector, which includes the left and right T-DNA border regions, a pBR322 bom site for mobilization from E. coli to
  • Agrobacterium, ColEl and pVSl plasmid origins for replication in E. coli and Agrobacterium, respectively, and a bacterial marker for conferring chloramphenicol resistance (Hajdukiewiez, O. et ah, 1994).
  • a representation of the vector is shown in Figure IB, with a schematic of the T- DNA disruption cassette being shown in Figure 1A.
  • An expression cassette containing the pyr4 gene was prepared by standard molecular biology techniques and ligated into the PZP vector at the ZtamHI site.
  • the resulting vector was propagated in E. coli XL gold cells (Invitrogen, Carlsbad, CA, USA).
  • LA agar plates (10 g/L tryptone, 5 g/L yeast extract, 10 g/L NaCl, 10 g/L agar) with 25 ppm chloramphenicol were used to select for E. coli transformants. About 1-10% of the E. coli transformants had the desired vector.
  • E. coli containing the vector were grown in LB medium (10 g/L tryptone, 5 g/L yeast extract, 10 g/L NaCl) plus 25 ppm chloramphenicol.
  • Vector DNA was isolated using standard methods.
  • Competent Agrobacterium cells were made as follows. Briefly, Agrobacterium cells were revived from cryopreservation by growing on LA medium at 28 °C for about three days. Colonies were then selected and grown in LB medium containing 0.1 % glucose in 50 ml volumes in 250 ml dented bottom flasks at 28 °C until growth was apparent. Alternatively, colonies were started in a 5 ml culture tube and transferred to a 250 ml flask when growth was apparent. About 10% of the volume of the 250 ml flask was then transferred into a fresh flask with the same medium, which was grown to an OD (600 nm; ⁇ 6 ⁇ ) of about 0.4-0.8 (about 5-6 hours of growth).
  • the cells were recovered by centrifugation in a cold centrifuge at 10,000 rpm for 10 minutes, and then washed three times in cold 1 M HEPES, pH 7.0. Next, the cells were washed once in cold 1 mM HEPES with 10 % glycerol, and aliquots were frozen at -70 °C. Cell viability was determined (typically about lxlO 9 CFU/ml after freezing).
  • the vector DNA was used to transform Agrobacterium cells by electroporation.
  • Competent Agrobacterium cells were thawed on ice and about 40 ⁇ of the cells were mixed with about 1 ⁇ g of DNA in a 0.2 cm electroporation cell (on ice). The cells were electroporated at 2.5 volts (200 Ohms, at 25 ⁇ ) with a Buchler 3-150 electroporator. SOC medium
  • the Agrobacterium cells can be transformed by electroporation using the ligation mixture, thereby eliminating the need to propagate the vector DNA in E. coli.
  • about 1 ⁇ of the ligation mixture is used for transformation.
  • SOC sulfur-oxide-semiconductor
  • dilutions of the mixture were plated onto LA medium plus 250 ppm chloramphenicol culture plates and incubated at 28 °C for four days.
  • 1 x 10 7 CFU/ml of Agrobacterium transformants were obtained and about 90-100 % contained the vector DNA, as determined by PCR analysis.
  • As little at 25 ppm chloramphenicol can be used to obtain colonies in a shorter time frame but a larger number of colonies must to be screened to identify bonafide transformants.
  • the minimal medium culture was then incubated at 28 °C with shaking until cloudy (overnight to several days). 10 ml of the culture was transferred to 50 ml of induction medium (2.05 g/L K 2 HP0 4 , 1.45 g/L KH 2 P0 4 , 0.15 g/L NaCl, 0.5 g/L MgS0 4 -7 H 2 0, 0.1 g/L
  • CaCl 2 -6 H 2 0, 0.0025 g/L, FeS0 4 -7 H 2 0, 0.5 g/L (NH 4 ) 2 S0 4 , 1.8 g/L glucose, 5 g/L glycerol, prepared in 40 mM MES, pH 5.3, with 200 ⁇ ⁇ of 1 M acetosyringone added after sterilization) in 250 ml flasks.
  • the staring ⁇ 6 ⁇ was about 0.1, and the vector-transformed Agrobacterium cells were grown to an ⁇ 6 ⁇ of about 0.4-0.8.
  • T. reesei T4 Apyr4 cells a whole-cellulase mutant strain derived from QM6A NRRL 3652, Agricultural Research Service, Beltsville, MD, USA
  • Transformants in the disruption library were screened for alterations in morphology in solid and liquid culture using light microscopy. Following transformation, individual transformants were picked from the nitrocellulose filters using a colony picker and transferred to 96-well microtiter plates containing potato dextrose agar (CP-700, Norgren Systems LLC, Fairlea, WV, USA). Alternatively, spores from transformants were combined, germinated, and single spores were added to microtiter plate wells using a cell sorter. Spores were collected by suspending spores from a Vogel's transformation plate in 20 ml sterile distilled water using a cell spreader.
  • Mutant F16 obtained from the above procedure was observed to have altered morphology on plates, and subsequently in liquid culture. On PDA plates Mutant F16, had restricted growth compared to the T4 parent. In liquid medium, F16 appeared to have shorter filaments than the T4 parent.
  • Strains T4 and F16 were grown under identical conditions in submerged (liquid) culture, and their growth phenotypes were compared. Briefly, spores of each strain were added separately to 500-mL of medium in a 3-L flask with both side and bottom baffles. The cultures were grown in a minimal medium for 48 hrs at 34 °C in a shaking incubator.
  • flanking sequence identified the flanking sequence as region 1203727 to 1204065 on Scaffold 5, with the site of insertion site of the T-DNA being at position 1203727.
  • a dissolved oxygen (DO) probe was calibrated to 100% when there was no added pressure in the headspace (i.e. , 0 bar gauge, 1 bar absolute). The pressure in the headspace was then set to 0.7 bar (gauge), after which the oxygen probe read 170% before the seed culture was added.
  • the fermentor contained two, four-blade turbines that provided mixing via a variable speed motor that was initially set at 500 rpm.
  • Strain Morph TrGA 77B7 was transformed with the mpgl disruption cassette using PEG-mediated transformation, and plated on Vogel's minimal medium containing sorbitol to select for candidates based on uridine prototrophy acquired by the pyr2 marker. Individual transformants were isolated and propagated by transfer to Vogel's minimal medium. PCR analysis was used to identify transformants in which the mpgl disruption cassette integrated at the mpgl locus by homologous recombination. Homologous integration of the Ampgl disruption cassette at the mpgl locus was verified by amplifying DNA fragments of the expected sizes using two primer pairs.
  • Example 5 Additive viscosity reduction in mutants having disrupted at least one of gasl, crzl and tps2 genes in conjunction with disrupted mpgl, sebl, and/or sbfl
  • a Trichoderma reesei Morph strain was deleted for four major cellulase genes, including cbhl, cbhll, egll, and eglV, which makes it particular suitable for expressing other proteins in the absence of or in reduced cellulase background. See, WO 05/001036.
  • the Morph strain had been previously transformed with a native Trichoderma glucoamylase gene (TrGA) under control of the CBH1 promoter, using amdS as a marker.
  • a transformant containing two tandom copies of glucoamylase (TrGA 29-9) was subsequently isolated, and random chemical mutagenesis was used to produce a mutant (77B7).
  • a spontaneous pyr2 mutant derivative was subsequently isolated by 5-fluoro-orotic acid (FOA) selection.
  • the Trichoderma reesei gasl (PID 22914) was deleted from mutant Morph 77B7.
  • calcineurin mediated Ca 2+ signaling has been shown to be required for growth, development, and virulence in many organisms. It is necessary for adaption to diverse environmental conditions including high cation levels and alkaline pH.
  • the gene crzl encodes a calcineurin-regulated transcription factor.
  • the Crzlp transcription factor is dephosphorylated when the phosphatase calcineurin is activated by Ca 2+ /calmodulin.

Abstract

Described are compositions and methods relating to variant filamentous fungi having altered growth characteristics. Such variants are well-suited for growth in submerged cultures, e.g., for the large-scale production of enzymes and other proteins for commercial applications.

Description

FILAMENTOUS FUNGI HAVING AN ALTERED VISCOSITY PHENOTYPE PRIORITY
[01] The present application claims priority to U.S. Provisional Application Serial Nos.
61/478,160, 61/478,162, both filed on April 22, 2011, which are hereby incorporated by reference in their entirety. TECHNICAL FIELD
[02] The present strains and methods relate to genetic mutations in filamentous fungi that give rise to strain variants having altered growth characteristics. Such variants are well-suited for growth in submerged cultures, e.g., for the large-scale production of enzymes and other proteins or metabolites for commercial applications.
BACKGROUND
[03] Filamentous fungi are capable of expressing native and heterologous proteins to high levels, making them well-suited for the large-scale production of enzymes and other proteins for industrial, pharmaceutical, animal health and food and beverage applications. Filamentous fungi are typically grown in mycelial submerged cultures in bioreactors, which are adapted to introduce and distribute oxygen and nutrients into the culture medium (i.e., broth). The morphological characteristics of the mycelium affect the rheological properties of the broth, thereby affecting bioreactor performance.
[04] Generally, the higher the viscosity of the broth, the less uniform the distribution of oxygen and nutrients and the more energy required to agitate the culture. In some cases, the viscosity of the broth becomes sufficiently high to significantly interfere with the dissolution of oxygen and nutrients, thereby adversely affecting the growth of the fungi. Additionally, the power required to mix and aerate viscous broth can significantly increase the cost of production, and incur higher capital expenditures in terms of motors and power supplies.
SUMMARY
[05] Described are strains and methods relating to filamentous fungi having genetic alterations that give rise to altered viscosity phenotypes.
[06] In one aspect, a variant strain of filamentous fungus derived from a parental strain is provided, the variant strain comprising a genetic alteration that causes cells of the variant strain to produce an altered amount of functional Sebl protein compared to cells of the parental strain, wherein the cells of the variant strain are produced during aerobic fermentation in submerged culture cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content compared to the cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
[07] In some embodiments, the altered amount of functional Sebl protein is a reduced amount, and the variant strain produces during aerobic fermentation in submerged culture a cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
[08] In some embodiments, the genetic alteration comprises a disruption of the sebl gene present in the parental strain. In some embodiments, disruption of the sebl gene is the result of deletion of all or part of the sebl gene. In some embodiments, disruption of the sebl gene is the result of deletion of a portion of genomic DNA comprising the sebl gene. In some
embodiments, disruption of the sebl gene is the result of mutagenesis of the sebl gene.
[09] In some embodiments, disruption of the sebl gene is performed using site-specific recombination. In some embodiments, disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
[010] In some embodiments, the variant strain does not produce functional Sebl protein. In some embodiments, the variant strain does not produce Sebl protein.
[011] In some embodiments, the variant strain further comprises a gene encoding a protein of interest. In some embodiments, the variant strain further comprises a disruption of the sft>3 gene. In some embodiments, the variant strain further comprises a disruption of the mpgl gene. In some embodiments, the variant strain further comprises a disruption of the sft>3 and mpgl genes. In some embodiments, the variant strain further comprises a disruption of at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene. In some embodiments, the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
[012] In some embodiments, the filamentous fungus is a Pezizomycotina species. In some embodiments, the filamentous fungus is a Trichoderma spp., Aspergillus spp., Fusarium spp., Scedosporium spp., Penicillium spp., Chrysosporium spp., Cephalosporium spp., Talaromyces spp., Geosmithia spp., and Neurospora spp. In some embodiments, the filamentous fungus can include, but is not limited to, Trichoderma reesei (previously classified as Trichoderma longibrachiatum and Hypocrea jecorina), Aspergillus niger, Aspergillus fumigatus, Aspergillus itaconicus, Aspergillus oryzae, Aspergillus nidulans, Aspergillus terreus, Aspergillus sojae, Aspergillus japonicus, Scedosporium prolificans, Neurospora crassa, Penicillium funiculosum, Penicillium chrysogenum, Talaromyces ( Geosmithia ) emersonii, Fusarium venenatum, and 5 Chrysosporium lucknowense. In some embodiments, the filamentous fungus is Trichoderma reesei.
[013] In another aspect, a method for producing a variant strain of filamentous fungus cells is provided, comprising: introducing a genetic alteration into a parental strain of filamentous fungal cell, which genetic alteration alters the production of functional Sebl protein compared to o the cells of the parental strain, thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
5 [014] In some embodiments, the genetic alteration reduces or prevents the production of
functional Sebl protein, thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, o compared to the cells of the parental strain.
[015] In some embodiments, the genetic alteration comprises disrupting the sebl gene in a parental filamentous fungal cell using genetic manipulation. In some embodiments, the genetic alteration comprises deleting the sebl gene in a parental filamentous fungal cell using genetic manipulation. In some embodiments, the genetic alteration is performed using site-specific 5 genetic recombination.
[016] In some embodiments, disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene. In some embodiments, the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain. In some embodiments, disruption of the sebl gene is performed0 in combination with disrupting the sft>3 gene. In some embodiments, disruption of the sebl gene is performed in combination with disrupting the mpgl gene. In some embodiments, disruption of the sebl gene is performed in combination with disrupting at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene. [017] In some embodiments, the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
[018] In some embodiments, the filamentous fungus is a Pezizomycotina species. In some embodiments, the filamentous fungus is a Trichoderma spp., Aspergillus spp., Fusarium spp., Scedosporium spp., Penicillium spp., Chrysosporium spp., Cephalosporium spp., Talaromyces spp., Geosmithia spp., and Neurospora spp. In some embodiments, the filamentous fungus can include, but is not limited to, Trichoderma reesei (previously classified as Trichoderma longibrachiatum and Hypocrea jecorina), Aspergillus niger, Aspergillus fumigatus, Aspergillus itaconicus, Aspergillus oryzae, Aspergillus nidulans, Aspergillus terreus, Aspergillus sojae, Aspergillus japonicus, Scedosporium prolificans, Neurospora crassa, Penicillium funiculosum, Penicillium chrysogenum, Talaromyces (Geosmithia) emersonii, Fusarium venenatum, and Chrysosporium lucknowense. In some embodiments, the filamentous fungus is Trichoderma reesei.
[019] In some embodiments, the parental strain further comprises a gene encoding a protein of interest. In some embodiments, the gene encoding the protein of interest is present in the parental strain prior to introducing the genetic alteration that reduces or prevents the production of functional Sebl protein. In some embodiments the protein of interest within the parental strain is encoded by an endogenous gene or a heterologous gene.
[020] In another aspect, a protein of interest produced by any of the aforementioned variant strains is provided.
[021] In yet another aspect, a filamentous fungus produced by any of the aforementioned methods and having any of the aforementioned properties is provided.
[022] In another aspect, a variant strain of filamentous fungus derived from a parental strain is provided, the variant strain comprising: (a) a genetic alteration that results in (i) a requirement for reduced agitation in submerged culture to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintenance of an increased dissolved oxygen content in submerged culture at a preselected amount of agitation, compared to the cells of the parental strain, and (b) a gene encoding a protein of interest, wherein the gene encoding the protein of interest is present in the variant strain prior to the genetic alteration in (a).
[023] In some embodiments, the genetic alteration of the resulting variant strain comprises a disruption of the sebl gene present in the parental strain. In some embodiments, disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene. In some embodiments, disruption of the sebl gene is performed in combination with disrupting the sft>3 gene. In some embodiments, disruption of the sebl gene is performed in combination with disrupting the mpgl gene. In some embodiments, disruption of the sebl gene is performed in combination with disrupting at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
[024] These and other aspects and embodiments of present variant strains and methods will be 5 apparent from the description, including the accompanying Figures.
BRIEF DESCRIPTION OF THE DRAWINGS
[025] Figure 1A shows a schematic representing the T-DNA containing the pyr4 gene.
[026] Figure IB is a map of the Agrobacterium tumefaciens PZP 100 vector.
o [027] Figure 2 is graph comparing the dissolved oxygen levels during growth of T4 T-DNA mutant F16 and the T4 parent in a 14 L fermentor.
[028] Figure 3 is graph comparing the growth rate of T4 T-DNA mutant F16 and the T4 parent in a 14 L fermentor.
[029] Figures 4 and 5 are images of the T4 Asebl F16 strain (Figure 4) and the Morph strain5 (Figure 5) after growth on PDA, sorbitol, and NaCl plates. The T4 sebl F16 mutant shows restricted growth and osmosensitivity compared to the Morph control.
[030] Figure 6 is a map of the sebl disruption vector.
[031] Figure 7 is a map of the mpgl disruption vector. 0 DETAILED DESCRIPTION
I. Overview
[032] The present strains and methods relate to variant strains of filamentous fungus cells having genetic modifications that affect their morphology and growth characteristics. When the variant cells are grown in submerged culture, they produce a cell broth that has different rheological 5 properties compared to a cell broth comprising cells of the parental strain. Some of these variant strains are well-suited for the large-scale production of enzymes and other commercially important proteins.
II. Definitions
o [033] Prior to describing the present strains and methods in detail, the following terms are defined for clarity. Terms not defined should be accorded their ordinary meanings as used in the relevant art.
[034] As used herein, "Trichoderma reesei" refers to a filamentous fungus of the phylum Ascomycota, subphylum Pezizomycotina. This organism was previously classified as
5 Trichoderma longibrachiatum, and also as Hypocrea jecorina. [035] As used herein, the phrase "variant strain of filamentous fungus cells," or similar phrases, refer to strains of filamentous fungus cells that are derived (i.e. , obtained from or obtainable from) from a parental (or reference) strain belonging to the Pezizomycotina, e.g. , by genetic manipulation. In the present description, parental and variant strains can be described as having certain characteristics, such as genetic modifications, expression phenotypes, morphology, and the like; however, the skilled person will appreciate that it is technically the cells of the parental or variant strain that have such characteristics, and "the strains" are referred to for convenience.
[036] As used herein, the term "protein of interest" refers to a polypeptide that is desired to be expressed in a filamentous fungus. Such a protein can be an enzyme, a substrate -binding protein, a surface-active protein, a structural protein, or the like, and can be expressed at high levels, and can be for the purpose of commercialization. The protein of interest can be encoded by an endogenous gene or a heterologous gene relative to the variant strain and/or the parental strain. The protein of interest can be expressed intracellularly or as a secreted protein.
[037] As used herein, the phrase "substantially free of an activity," or similar phrases, means that a specified activity is either undetectable in an admixture or present in an amount that would not interfere with the intended purpose of the admixture.
[038] As used herein, the terms "polypeptide" and "protein" (and/or their respective plural forms) are used interchangeably to refer to polymers of any length comprising amino acid residues linked by peptide bonds. The conventional one-letter or three-letter codes for amino acid residues are used herein. The polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.
[039] As used herein, functionally and/or structurally similar proteins are considered to be "related proteins." Such proteins can be derived from organisms of different genera and/or species, or even different classes of organisms (e.g. , bacteria and fungi). Related proteins also encompass homologs determined by primary sequence analysis, determined by secondary or tertiary structure analysis, or determined by immunological cross-reactivity. [040] As used herein, the term "derivative polypeptide/protein" refers to a protein which is derived or derivable from a protein by addition of one or more amino acids to either or both the N- and C-terminal end(s), substitution of one or more amino acids at one or a number of different sites in the amino acid sequence, deletion of one or more amino acids at either or both 5 ends of the protein or at one or more sites in the amino acid sequence, and/or insertion of one or more amino acids at one or more sites in the amino acid sequence. The preparation of a protein derivative can be achieved by modifying a DNA sequence which encodes for the native protein, transformation of that DNA sequence into a suitable host, and expression of the modified DNA sequence to form the derivative protein.
0 [041] Related (and derivative) proteins include "variant proteins." Variant proteins differ from a reference/parental protein (e.g. , a wild-type protein) by substitutions, deletions, and/or insertions at a small number of amino acid residues. The number of differing amino acid residues between the variant and parental protein can be one or more, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, or more amino acid residues. Variant proteins can share at least5 about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99%, or more, amino acid sequence identity with a reference protein. A variant protein can also differ from a reference protein in selected motifs, domains, epitopes, conserved regions, and the like.
o [042] As used herein, the term "analogous sequence" refers to a sequence within a protein that provides similar function, tertiary structure, and/or conserved residues as the protein of interest (i.e. , typically the original protein of interest). For example, in epitope regions that contain an a- helix or a β-sheet structure, the replacement amino acids in the analogous sequence preferably maintain the same specific structure. The term also refers to nucleotide sequences, as well as5 amino acid sequences. In some embodiments, analogous sequences are developed such that the replacement amino acids result in a variant enzyme showing a similar or improved function. In some embodiments, the tertiary structure and/or conserved residues of the amino acids in the protein of interest are located at or near the segment or fragment of interest. Thus, where the segment or fragment of interest contains, for example, an a-helix or a β-sheet structure, the o replacement amino acids preferably maintain that specific structure.
[043] As used herein, the term "homologous protein" refers to a protein that has similar activity and/or structure to a reference protein. It is not intended that homologs necessarily be evolutionarily related. Thus, it is intended that the term encompass the same, similar, or corresponding enzyme(s) (i.e., in terms of structure and function) obtained from different organisms. In some embodiments, it is desirable to identify a homolog that has a quaternary, tertiary and/or primary structure similar to the reference protein. In some embodiments, homologous proteins induce similar immunological response(s) as a reference protein. In some embodiments, homologous proteins are engineered to produce enzymes with desired activity(ies).
[044] The degree of homology between sequences can be determined using any suitable method known in the art (see, e.g. , Smith and Waterman (1981) Adv. Appl. Math. 2:482;
Needleman and Wunsch (1970) /. Mol. Biol, 48:443; Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85:2444; programs such as GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, WI); and Devereux et al. (1984) Nucleic Acids Res. 12:387-95).
[045] For example, PILEUP is a useful program to determine sequence homology levels. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle, (Feng and Doolittle (1987) /. Mol. Evol. 35:351-60). The method is similar to that described by Higgins and Sharp ((1989) CABIOS 5: 151-53). Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps. Another example of a useful algorithm is the BLAST algorithm, described by Altschul et al. ((1990) /. Mol. Biol. 215:403-10) and Karlin et al. ((1993) Proc. Natl. Acad. Sci. USA 90:5873-87). One particularly useful BLAST program is the WU-BLAST-2 program (see, e.g. , Altschul et al. (1996) Meth. Enzymol. 266:460-80). Parameters "W," "T," and "X" determine the sensitivity and speed of the alignment. The BLAST program uses as defaults a word-length (W) of 11, the BLOSUM62 scoring matrix (see, e.g. , Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915) alignments (B) of 50, expectation (E) of 10, M'5, N'-4, and a comparison of both strands.
[046] As used herein, the phrases "substantially similar" and "substantially identical," in the context of at least two nucleic acids or polypeptides, typically means that a polynucleotide or polypeptide comprises a sequence that has at least about 70% identity, at least about 75% identity, at least about 80% identity, at least about 85% identity, at least about 90% identity, at least about 91% identity, at least about 92% identity, at least about 93% identity, at least about 94% identity, at least about 95% identity, at least about 96% identity, at least about 97% identity, at least about 98% identity, or even at least about 99% identity, or more, compared to the reference {i.e. , wild-type) sequence. Sequence identity can be determined using known programs such as BLAST, ALIGN, and CLUSTAL using standard parameters. (See, e.g. , Altschul, et al. (1990) /. Mol. Biol. 215:403-410; Henikoff et al. (1989) Proc. Natl. Acad. Sci. USA 89: 10915; Karin et al. (1993) Proc. Natl. Acad. Sci USA 90:5873; and Higgins et al. (1988) Gene 73:237-244). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. Also, databases can be searched using FASTA (Pearson et al. (1988) Proc. Natl. Acad. Sci. USA 85:2444-48). One indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross- reactive with the second polypeptide. Typically, polypeptides that differ by conservative amino acid substitutions are immunologically cross-reactive. Thus, a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions {e.g., within a range of medium to high stringency).
[047] As used herein, the term "gene" is synonymous with the term "allele" in referring to a nucleic acid that encodes and directs the expression of a protein or RNA. Vegetative forms of filamentous fungi are generally haploid, therefore a single copy of a specified gene {i.e. , a single allele) is sufficient to confer a specified phenotype.
[048] As used herein, the terms "wild-type" and "native" are used interchangeably and refer to genes proteins or strains found in nature.
[049] As used herein, "deletion of a gene," refers to its removal from the genome of a host cell. Where a gene includes control elements {e.g. , enhancer elements) that are not located immediately adjacent to the coding sequence of a gene, deletion of a gene refers to the deletion of the coding sequence, and optionally adjacent enhancer elements, including but not limited to, for example, promoter and/or terminator sequences.
[050] As used herein, "disruption of a gene" refers broadly to any genetic or chemical manipulation, i.e., mutation, that substantially prevents a cell from producing a function gene product, e.g. , a. protein, in a host cell. Exemplary methods of disruption include complete or partial deletion of any portion of a gene, including a polypeptide-coding sequence, a promoter, an enhancer, or another regulatory element, or mutagenesis of the same, where mutagenesis encompasses substitutions, insertions, deletions, inversions, and combinations and variations, thereof, any of which mutations substantially prevent the production of a function gene product. A gene can also be disrupted using RNAi, antisense, or any other method that abolishes gene expression. [051] As used herein, the terms "genetic manipulation" and "genetic alteration" are used interchangeably and refer to the alteration/change of a nucleic acid sequence. The alteration can included but is not limited to a substitution, deletion, insertion or chemical modification of at least one nucleic acid in the nucleic acid sequence.
5 [052] As used herein, "aerobic fermentation" refers to growth in the presence of oxygen.
[053] As used herein, the term "cell broth" refers collectively to medium and cells in a liquid/submerged culture.
[054] As used herein, the term "cell mass" refers to the cell component (including intact and lysed cells) present in a liquid/submerged culture. Cell mass can be expressed in dry or wet o weight.
[055] As used herein, the term "rheology" refers to a branch of physics dealing with the deformation and flow of matter.
[056] As used herein, "viscosity" is a measure of the resistance of a fluid to deformation by mechanical stress, such as shear stress or tensile stress. In the present context, viscosity can also5 refer to the resistance of a cell broth comprising filamentous fungus cells to mechanical stress, e.g. , as provided by a rotor/impeller. Because the viscosity of a cell broth can be difficult to measure directly, indirect measurements of viscosity can be used, such as the dissolved oxygen content of the culture broth at a preselected amount of agitation, the amount of agitation required to maintain a preselected dissolved oxygen content, the amount of power required to agitate a o cell broth to maintain a preselected dissolved oxygen content, or even colony morphology on solid medium.
[057] As used herein, an "altered- viscosity" variant strain of filamentous fungus cells refers to a variant strain that produces a cell broth that has either a reduced or increased viscosity (i.e. , reduced or increased resistance to shear or tensile stress) compared to an equivalent cell broth5 produced by a parental strain. Generally, equivalent cell broths have comparable cell masses.
Preferably, the difference between a variant, altered viscosity strain and a parental strain, with respect to any direct or indirect measure of viscosity, is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, or even at least 50%, or more. Methods for comparing the viscosity of filamentous fungus cell broths are described,0 herein. Generally, comparable (or equivalent) cell broths have comparable cell masses.
[058] As used herein, a "reduced-viscosity" variant strain of filamentous fungus cells refers to a variant strain that produces a cell broth that has reduced viscosity (i.e. , reduced resistance to shear or tensile stress) compared to an equivalent cell broth produced by a parental strain.
Preferably, the difference between a variant, altered viscosity strain and a parental strain, with respect to any direct or indirect measure of viscosity, is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, or even at least 50%, or more.
[059] As used herein, "dissolved oxygen" (DO) refers to the amount of oxygen ((¾) present in a liquid medium as measured in vol/vol units. The dissolved oxygen level can be maintained at a high level, e.g., between 170-100% and 20%, between 100-80% and 20%, between 70% and 20%, between 65% and 20%, between 60% and 20%, between 55% and 20%, between 50% and 20%, between 45% and 20%, between 44% and 20%, between 43% and 20%, between 42% and 20%, between 41% and 20%, between 40% and 20%, between 35% and 20%, between 30% and 20%, and between 25% and 20% throughout the fermentation. In particular, the dissolved oxygen can be high at the beginning of the fermentation and to be permitted to fall as the fermentation progresses. The dissolved oxygen level can be controlled by the rate at which the fermentation is agitated, e.g. stirred, and/or by the rate of addition of air or oxygen. The culture can be agitated, e.g., stirred at between 400-700 rpm and the dissolved oxygen level is maintained above 20%, above 25%, above 30%, above 35%, above 40%, above 45%, above 50% and above 55% or more by altering the air or oxygen flow rate and impeller speed.
[060] As used herein, a "primarily genetic determinant" refers to a gene, or genetic manipulation thereof, that is necessary and sufficient to confer a specified phenotype in the absence of other genes, or genetic manipulations, thereof. However, that a particular gene is necessary and sufficient to confer a specified phenotype does not exclude the possibility that additional effects to the phenotype can be achieved by further genetic manipulations.
[061] As used herein, a "functional polypeptide/protein" is a protein that possesses an activity, such as an enzymatic activity, a binding activity, a surface-active property, or the like, and which has not been mutagenized, truncated, or otherwise modified to abolish or reduce that activity. Functional polypeptides can be thermostable or thermolabile, as specified.
[062] As used herein, "a functional gene" is a gene capable of being used by cellular components to produce an active gene product, typically a protein. Functional genes are the antithesis of disrupted genes, which are modified such that they cannot be used by cellular components to produce an active gene product, or have a reduced ability to be used by cellular components to produce an active gene product.
[063] As used herein, variant cells "maintain or retain a high level of protein expression and/or secretion" compared to a parental strain if the difference in protein expression between the variant strain and a parental strain is less than about 20%, less than about 15%, less than about 10%, less than about 7%, less than about 5%, or even less than about 3%. [064] As used herein, host cells have been "modified to prevent the production of a specified protein" if they have been genetically or chemically altered to prevent the production of a functional protein/polypeptide that exhibits an activity characteristic of the wild-type protein, particularly an activity that promotes elongation of hyphae or otherwise increases the viscosity 5 of a filamentous fungus in liquid culture. Such modifications include, but are not limited to, deletion or disruption of the gene encoding the protein (as described, herein), modification of the gene such that the encoded polypeptide lacks the aforementioned activity, modification of the gene to affect post-translational processing or stability, and combinations, thereof.
[065] As used herein, a "protein of interest" is a protein that is desired to be produced in a
0 submerged culture of filamentous fungus cells. Generally, proteins of interest are commercially important for industrial, pharmaceutical, animal health, and food and beverage use, making them desirable to produce in large quantities. Proteins of interest are to be distinguished from the myriad other proteins expressed by the filamentous fungus cells, which are generally not of interest as products and are mainly considered background protein contaminants.
5 [066] As used herein, a variant strain produces "substantially the same amount" of protein per unit amount of biomass as a parental strain if the amount of protein produced by the variant strain is no more than 20% reduced, no more than 15% reduced, no more than 10% reduced, an even no more than 5% reduced compared to the amount of protein produced by the parental strain, wherein the amount of protein is normalized to the total amount of biomass of cells from which protein o production is measured, wherein biomass can be expressed in terms of either wet (e.g. , of cell pellet) or dry weight.
[067] As used herein, a variant strain produces "substantially more protein per unit amount of biomass" than a parental strain if the amount of protein produced by the variant strain is at least 5% increased, at least 10% increased, at least 15% increased, or more, compared to the parental strain, 5 wherein the amount of protein is normalized to the total amount of biomass of cells from which protein production is measured, wherein biomass can be expressed in terms of either wet (e.g. , of cell pellet) or dry weight.
[068] As used herein, "fluorochromes" are fluorescent dyes. Preferred fluorochromes bind to cellulose and/or chitin in the cell walls of fungi.
o [069] As used herein, the singular articles "a," "an," and "the" encompass the plural referents unless the context clearly dictates otherwise. All references cited herein are hereby incorporated by reference in their entirety. The following abbreviations/acronyms have the following meanings unless otherwise specified: CFU colony forming units
EC enzyme commission
kl)a kiloDalton
kb kilobase
MW molecular weight
w/v weight/ volume
w/w weight/weight
v/v volume/volume
wt weight percent
°C degrees Centigrade
H20 water
H202 hydrogen peroxide
dH20 or DI deionized water
dIH20 deionized water, Milli-Q filtration
DO dissolved oxygen
g or gm gram
μ microgram
mg milligram
kg kilogram
lb pound
μΐ^ and μΐ microliter
mL and ml milliliter
mm millimeter
μιη micrometer
mol mole
mmol millimole
M molar
mM millimolar
μΜ micromolar
nm nanometer
U unit
ppm parts per million
sec and " second
min and ' minute
hr and h hour
EtOH ethanol
eq. equivalent
N normal
PCR polymerase chain reaction
DNA deoxyribonucleic acid
FOA fluoroorotic acid
UV ultraviolet
A540 absorbance measured at a wavelength of 540 nm
CMC carboxymethyl cellulose
rpm revolutions per minute
Δ relating to a deletion
CER C02 evolution rate
bp base pairs III. Filamentous fungal strain with altered Sebl protein production
[070] In one aspect, a variant strain of filamentous fungus derived from a parental strain is provided, the variant strain comprising a genetic alteration that causes cells of the variant strain to 5 produce an altered amount of functional Sebl protein compared to cells of the parental strain. The cells of the variant strain subsequently produce, during aerobic fermentation in submerged culture, a cell broth that requires an altered amount of agitation to maintain a preselected dissolved oxygen content, or a cell mass that maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
o [071] In some cases, the genetic alteration causes cells of the variant strain to produce a reduced amount of functional Sebl protein compared to cells of the parental strain, and the resulting cell broth requires reduced agitation to maintain a preselected dissolved oxygen content or maintains a higher dissolved oxygen content at a preselected amount of agitation compared to the cells of the parental strain. In such cases, it is believed that the cell mass of the variant strain exhibits reduced 5 viscosity compared to a cell mass of the parental strain, which accounts for the observations
relating to dissolved oxygen content and agitation, as described in the Examples.
[072] The reduction in the amount of functional Sebl protein can result from disruption of the sebl gene present in the parental strain. Because disruption of the sebl gene is a primary genetic determinant for conferring a reduced viscosity phenotype to the variant strain, such variant strains0 need only comprise a disrupted sebl gene, while all other genes can remain intact. In some cases, the variant strains can optionally include additional genetic alterations compared to the parental stain from which they are derived. Such additional genetic alterations are not necessary to confer a reduction in viscosity but can further reduce viscosity or confer other advantages for the variant strain.
5 [073] Disruption of the sebl gene can be performed using any suitable methods that
substantially prevent expression of a function sebl gene product, i.e., the Sebl protein.
Exemplary methods of disruption as are known to one of skill in the art include but are not limited to: Complete or partial deletion of the sebl gene, including complete or partial deletion of, e.g., the Sebl -coding sequence, the promoter, the terminator, an enhancer, or another o regulatory element; and complete or partial deletion of a portion of the chromosome that
includes any portion of the sebl gene. Particular methods of disrupting the sebl gene include making nucleotide substitutions or insertions in any portion of the sebl gene, e.g., the Sebl- coding sequence, the promoter, the terminator, an enhancer, or another regulatory element. Preferably, deletions, insertions, and/or substitutions (collectively referred to as mutations) are made by genetic manipulation using sequence-specific molecular biology techniques, as opposed to by chemical mutagenesis, which is generally not targeted to specific nucleic acid sequences. Nonetheless, chemical mutagenesis can be used to disrupt the sebl gene.
[074] Mutations in the sebl gene can reduce the efficiency of the sebl promoter, reduce the 5 efficiency of a sebl enhancer, interfere with the splicing or editing of the sebl mRNA, interfere with the translation of the sebl mRNA, introduce a stop codon into the Sebl -coding sequence to prevent the translation of full-length Sebl protein, change the coding sequence of the Sebl protein to produce a less active or inactive protein or reduce Sebl interaction with other nuclear protein components, change the coding sequence of the Sebl protein to produce a less stable0 protein or target the protein for destruction, cause the Sebl protein to misfold or be incorrectly modified {e.g., by glycosylation), or interfere with cellular trafficking of the Sebl protein.
[075] In one embodiment, these and other genetic manipulations act to reduce or prevent the expression of a functional Sebl protein, or reduce or prevent the normal biological activity of the Sebl protein, thereby producing a morphology change in the cell that results in a reduced 5 viscosity phenotype.
[076] In other cases, the genetic alteration increases or restores the expression of a functional Sebl protein, or increases the normal biological activity of the Sebl protein, thereby producing a morphology change in the cell that results in an increased or restored viscosity phenotype.
Exemplary genetic alterations that increase or restore Sebl function are those that introduce o addition copies of the sebl gene into a cell, increase the efficiency of the sebl promoter,
enhancer, or other control element, increase the translation of the mRNA encoding the Sebl protein, increase the stability of mRNA encoding the Sebl protein, introduce changes in the sebl gene that increase the activity or stability of the Sebl protein, introduce changes in the sebl gene that modulate the interaction with other proteins or cell wall components, and the like.5 Other genetic alterations that increase or restore Sebl function are those that reverse the effect of genetic alterations that reduce or prevent the expression of a functional Sebl protein.
[077] Filamentous fungus cells for manipulation and use as described are generally from the phylum Ascomycota, subphylum Pezizomycotina, particularly fungi that have a vegetative hyphae state and include a homolog of the sebl gene. Such organisms include filamentous o fungus cells used for the production of commercially important industrial and pharmaceutical proteins, including, but are not limited to Trichoderma spp., Aspergillus spp., Fusarium spp., Scedosporium spp., Penicillium spp., Chrysosporium spp., Cephalosporium spp., Talaromyces spp., Geosmithia spp., and Neurospora spp. Particular organisms include, but are not limited to, Trichoderma reesei (previously classified as Trichoderma longibrachiatum and Hypocrea jecorina), Aspergillus niger, Aspergillus fumigatus, Aspergillus itaconicus, Aspergillus oryzae, Aspergillus nidulans, Aspergillus terreus, Aspergillus sojae, Aspergillus japonicus,
Scedosporium prolificans, Neurospora crassa, Penicillium funiculosum, Penicillium
chrysogenum, Talaromyces (Geosmithia) emersonii, Fusarium venenatum, and Chrysosporium lucknowense.
[078] As described by Peterbauer, C. et al. ((2002) Molecular Genetics and Genomics 268:223-31) Sebl from Trichoderma atroviride is a STRE-element-binding protein, and the sebl gene is believed to be an orthologue of the yeast msn2/4 gene and the Aspergillus nidulans msnA gene. Notably, the sebl gene cannot complement the msn2/4 gene in yeast, so is probably not a functional homologue. Sebl is involved with but not essential in the osmotic stress response but has not been described previously as being associated with altered morphology, particularly those giving rise to a low viscosity phenotype. The present disclosure provides experimental evidence of the association of Sebl with altered morphology.
[079] A BLAST search of the publicly available genomic DNA sequence of Trichoderma reesei performed using the T. atroviride Sebl amino acid sequence (SEQID NO: 1) as a query revealed that the T. reesei genome includes a single gene that is closely homologous to sebl . No further homologs or similar sequences were identified, suggesting that sebl is a unique single copy gene. Homologs of the Sebl proteins were found in e.g., Aspergillus clavatus (SEQ ID NO: 2), Aspergillus fumigatus Af93 (SEQ ID NO: 3), and Neosartorya fischeri NRRL 181 (SEQ ID NO: 4). The predicted Sebl amino acid sequence of T. reesei is shown in SEQ ID NO: 5.
[080] The amino acid sequence of the Trichoderma atroviride Sebl protein is shown, below, as SEQID NO: 1:
MDGMMSQAMGQQAFYFYNHNHDHKMARQAIFAQQMAAYQMVPTLPPTPMYSRPNSSCSQPPTLY SNGPSVMTPTSTPPLSRKHMMLDAEFGDNPYFPSTPPLSTSGSTVGSPKACDMLQTPMNPMFSG LEGIAMKEAVDTTESLVVDWASIVSPPLSPVYFQSQVSRVPSPTSSPSDILSTASCPSLSPSPT PYARSVTSEHDVDFCDPRNLTVSVGSNPTLAPEFTLTGLAEDLKGEQLSTAQHTFDFNPALPSG LPTFEDFSDLESEADFSNLVNLGEVNP IDISRPRACTGSSWSLGHGSFIGDEELSFEDNDAFG FNSLPSPTSSIDFSDVHQDKRRKKEKKDIKP IMNTAASGSPSGNEQIGATPAASAASDSNASSA SEDPSSMPAPTNRRGRKQSLTEDPSKTFVCDLCNRRFRRQEHLKRHYRSLHTQEKPFECNECGK KFSRSDNLAQHARTHAGGAIVMNLIEDGSEVPAFDGSMMTGPVGDDYNTYGKVLFQIASEIPGS ASELSSEEGDQSKKKRKRSD [081] The amino acid sequence of the Aspergillus clavatus Sebl protein is shown, below, as SEQ ID NO: 2:
MDTTYTMVGTPVQGQPSFAYYTTNDSQSRQQHFTSHPSEMQAFYGQMQPYPQQQQQTCMPDQQS IYAAQPMLNMHQMATA AFRGALSMTPI SPQPTHLKPTII QQDSPMLMPLDTRFVSSDYYAF PSTPPLSTSGSTISSPPSSGRSLHTPINDCFFSFEKVEGVKEGCESDVHSELLANADWSRSDSP PLTPVFIHPPSLTASQSSDLLSAHSSCPSLSPSPSPVSSTFIAPPHSGLSVEPSGTDFCDPRQL TVESSVDSSTELPPLPTLSCNEEEPKVVLGSATVTLPVHESLSPAYTSSTEDPLGSLPTFDSFT DLDSEDEFVNNLVDFHPGGNPYFLGDKRQRLGSYLLEEDEFLSDRSFDDLDDHEAFAHSGLPSL EPSELISVQGDVAEVSEEMRSKKRTTSRRTLKRTNSSDSSSESLATSGKRTQASANGRSGHSEA TSSSAQQSTTPSRQNSTANASSSSEAPSAPVSVNRRGRKQSLTDDPSKTFVCTLCSRRFRRQEH LKRHYRSLHTQDKPFECHECGKKFSRSDNLAQHARTHGGGSIVMGVIDTNASLQASYEEREPRL LGAALYEAANAAANKSTTSDSSDGTISDTSSVEGRPIKKRRREDHA
[082] The amino acid sequence of the Aspergillus fumigatus Af93 Sebl protein is shown, below, as SEQ ID NO: 3:
MDATYTMAQTPVQGQPSFAYYPTESQSRQQHFTSHPFEMQYYGQVSSYPQQQAQQQHSMPEQQP VYAAQPMLNMHQMATTNAFRGALSMTPIASPQPTHLKPTII QQDSPALMPLDTRFVSNDFYGF PSTPPLSTSGSTISSPPSSNGSLHTPINDCFFSFEKVEGVKEGCESDVHCELLANTDWSRSDSP PLTPVFIQPQSLTASQSSDLLSAQIPCPSLSPSPSPDSATFISHPQSILSAEPSGSDFCDPRQL TVESSVGAPAELPPLPTLSCNEEEPKVVLGSATVTLPVHEGLSPSFSSSSEDPLGSLPTFDSFS DLDSEDEFANKLVDFHP IGNTYFQGDKRQRLGTYLLDEDEFLSERSLEDLDDQEAFAQSGLPSV ESTDFLAVEGDATQSTEEMSSKKRVTSRRSLKKASTSESSSDSLAKKTQASATSRSGHSDTTST VQQSTASSRQNSTANTSNSESPAAPVSVNRRGRKQSLTDDPSKTFVCSLCSRRFRRQEHLKRHY RSLHTQDKPFECHECGKKFSRSDNLAQHARTHGGGSIVMGVIDTNSSNTQPAFDEPEPRALGLA LYEAANAATSKSTTSESSDGTISDTSSVGGRPAKKRRRDDHV
[083] The amino acid sequence of the Neosartoryafischeri NRRL 181 Sebl protein is shown, below, as SEQ ID NO: 4:
MDATYTMAQTPVQGQPSFAYYPTESQSRQQHFTSHPSEMQYYGQVPPYPQQQHSMPEQQPVYAA QPMLNMHQMATTNAFRGALSMTPIASPQPTHLKPTII QQQDSPVLMPLDTRFVSNDFYGFPST PPLSTSGSTISSPPSSNGSLHTPINDCFFSFEKVEGVKEGCESDVHCELLANTGWSRSDSPPLT PVFIQPPSLTASQSSDLLSAHMSCPSLSPSPSPDSTTFISHPQSVLSAEPSGSDFCDPRQLTVE SSVGAPAELPPLPTLSCNEEEPKVVLGSATVTLPVHEGLSPSFSSSSEDPLGSLPTFDSFSDLD SEDEFANKLVDFHPIGNTYFLGDKRQRLGTYLLDEDEFLSERSLEDLDDQEAFAQSGLPSVESS DFLAAEGDATQNTEEMSSKKRVTSRRSLKRASTSESSSDSLAKKTQASATSRSGHSETTSTVQQ STASSRQNSTANTSSSGSPAAPVSVNRRGRKQSLTDDPSKTFVCSLCSRRFRRQEHLKRHYRSL HTQDKPFECHECGKKFSRSDNLAQHARTHGGGSIVMGVIDTNGSNTQPAFDEPEPRALGLALYE AANAATSKSTTSESSDGTISDTSSVGGRP AKKRRRDDHV [084] The predicted amino acid sequence of the Trichoderma reesei Sebl protein is shown, below, as SEQ ID NO: 5:
MDGMMSQPMGQQAFYFYNHEHKMSPRQVIFAQQMAAYQMMPSLPPTPMYSRPNSSCSQPPTLYS NGPSVMTPTSTPPLSSRKPMLVDTEFGDNPYFPSTPPLSASGSTVGSPKACDMLQTPMNPMFSG LEGIAIKDSIDATESLVLDWASIASPPLSPVYLQSQTSSGKVPSLTSSPSDMLSTTASCPSLSP SPTPYARSVTSEHDVDFCDPRNLTVSVGSNPTLAPEFTLLADDIKGEPLPTAAQPSFDFNPALP SGLPTFEDFSDLESEADFSSLVNLGEINPVDISRPRACTGSSWSLGHGSFIGDEDLSFDDEAF HFPSLPSPTSSVDFCDVHQDKRQKKDRKEAKPVMNSAAGGSQSGNEQAGATEAASAASDSNASS ASDEPSSSMPAPTNRRGRKQSLTEDPSKTF CDLCNRRF RRQEHLKRHYRSLHTQEKPFECNEC GKKFSRSDNLAQHARTHSGGAIVMNLIEESSEVPAYDGSMMAGPVGDDYSTYGKVLFQIASEIP GSASELSSEEGEQGKKKRKRSD
[085] In some embodiments of the present compositions and methods, the amino acid sequence of the Sebl protein that is altered in production levels has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NOs: 1, 2, 3, 4, or 5, e.g., at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 1, 2, 3, 4, or 5. The nucleotide sequences encoding each amino acid sequence can be identified from a BLAST search for each corresponding protein as is know to one skilled in the art.
[086] In some embodiments of the present compositions and methods, the sebl gene that is disrupted encodes a Sebl protein that has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NOs: 1, 2, 3, 4, or 5, e.g., at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 1,2,3,4, or 5.
[087] The amino acid sequence information provided, herein, readily allows the skilled person to identify a Sebl protein, and the nucleic acid sequence encoding a Sebl protein, in any filamentous fungi, and to make appropriate disruptions in the sebl gene to affect the production of the Sebl protein. The polynucleotide sequences encoding SEQ ID NOs: 1, 2, 3, 4, can be found in the GenBank or JGI databases, as are known to one of skill in the art.
[088] In another aspect, a method for altering the morphology of filamentous fungus cells is
5 provided. The variant filamentous fungus cells exhibit altered growth morphology on solid
medium and produce cell broth having different viscosities when grown in submerged culture compared to parental cell growth and cell broth viscosities.
[089] In some cases, the method comprises disrupting the seblgene in a parental strain using suitable genetic methods, wherein during aerobic fermentation the disrupted sebl variant strain o produces during aerobic fermentation in submerged culture a cell broth that requires reduced
agitation to maintain a preselected dissolved oxygen content or maintains an increased dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain. Such methods can be used to disrupt the sebl gene in any manner described above and elsewhere as are known to one of skill in the art. Preferably, disruption of the seblgene is performed by genetic5 manipulation using sequence-specific molecular biology techniques, as opposed to chemical mutagenesis, which is generally not targeted to specific nucleic acid sequences. However, chemical mutagenesis can be used with satisfactory results.
[090] In some embodiments, the parental strain into which the reduced viscosity phenotype is introduced creating a reduced viscosity strain already comprises a gene of interest intended to be o expressed at high levels. In this manner, the present methods obviate the need to introduce a gene of interest into a pre-existing reduced viscosity strain for production. Thus, the present methods can be used to produce a reduced viscosity variant strain of filamentous fungus cells from a parental strain already comprising a gene of interest. 5 IV. Additive effect produced by altering Sfb3 production
[091] In some embodiments of the present compositions and methods, genetic alterations that affect Sebl production or Mpgl and Sebl production, are combined with genetic alterations that affect Sfb3 production. The Sft>3 gene (also known as Lstl) has previously been characterized in budding yeast {i.e., Saccharomyces cerevisiae), where it encodes a protein associated with the o COPII protein coat surrounding transport vesicles that carry proteins from the endoplasmic reticulum to the Golgi apparatus. Sft>3, as well as Sfl>2, are homologs of Sec24, all of which genes are involved with packaging specific cargo proteins into the vesicles. [092] While Sec24 is an essential gene in yeast, SfbS and Sft>2 are not, although the deletion of Sft>3 in yeast is known to affect the transport of a plasma membrane transport protein (Pmalp) and a glucanosyltransferase (Gaslp) that is involved in cell wall synthesis.
[093] Using BLAST to search the publicly available genome sequence of Trichoderma reesei using S. cerevisiae Sec24p, Sfb3p or Sfb2p amino acid sequences as query sequences reveals that T. reesei has a single gene that is most closely homologous to yeast Sec24 and a single gene that is most closely homologous to yeast Sfb3. No other homolog was identified suggesting that T. reesei does not have a gene equivalent to Sfb2. Moreover, homologs of the Sfb3 proteins were found in e.g. , T. reesei (SEQ ID NO: 6), A. oryzae (SEQ ID NO: 7), A. niger (SEQ ID NO: 8), P. funiculosum (SEQ ID NO: 9), P. chrysogenum (SEQ ID NO: 10), N. Crassa (SEQ ID NO: 11), and F. oxysporum (SEQ ID NO: 12):
[094] Trichoderma reesei Sfb3 amino acid sequence (SEQ ID NO: 6):
MDYTQYHALGHGEVLDPNDPNKTSAPAAPQFQPPSSPYVPPGSPYGAPPYHGGHQAPPMAMPPP STPGYGPPQGQSFPGSPMPSQDAGLAAQFGGMSLGADAGGAAARKKKKDRHAYHSVEPTGSSQA FNGLPPGTPAEQFLNVNNPQGIPALGGQFGSPLASPMGTPHMANPGQFPAPTSPFTPSAPVSPA EFASRFGSPDAATSIGSAGPSQVSPDDMPSIPASRDAIQEHFFKNVYPTFERHVPPPATVSFVA FDQGNASPKFTRLTLNNIPTTAEGLHATGLPLGMLIQPLAPLQAGEAEIPVLDFGDAGPPRCRR CRAYINPFMMFRSGGNKFVCNLCSYPNETPPEYFCAVSPQGVRLDRDQRPELHRGTVEFVVPKE YWTREPVGLRWLFVIDVTQESYNKGFMETFCEGILAALYGGNDEENDEDGEPKRRIPKGAKVGF ITYDKDIHFYNINPHLDQAHMMIMPDLEDPFLPLGEGLFVDPYESKAIITSLLTRLPEMFSTIK NPEPALLATLNAAVAALEATGGKVVCSCSTLPTWGPGRLFMRDDGNHPGGELDKKLYTTEHPAW KKVSEKMASSGIGVDFFLAAPSGGYLDIATIGHVAATTGGETFYYPNFIAPRDGARLSMEITHA ITRETGFQALMKVRCSTGLQVAAYHGNFVQHTFGADLEIGVIDADKALGVSFSHDGKLDPKLDA HFQTALLYTTASGQRRVRCSNVIASVSDTSKESNTKELAIRQCLKFVDQDAVVGIFAKEASTKL ATTSANLQDVRNWLTERTIDIMAYYKKHSANQFPPSQLVMPERLKEFCMYMLGMLKCRAFKGGI ENSDRRVHELRMVRSMGPLELSLYLYPRMIALHNLQPEEGFADPETGHLKMPPSVRTSFSRVEP GGVYLVDNGQQCLLWFHAQTSPNLITDLFGEGHDSLKGLDPYTSTLPVLETHLSAQVRNIIEFL KSMRGSKGMTIQLARQGIDGAEYEFARMLVEDRNNEAKSYVDWLVHIHRGVQLELSGQRKKEGD GEATAVMANFAGLRPAYW
[095] Aspergillus oryzae RIB40 Sfb3 amino acid sequence (GI: 83766074; SEQ ID NO: 7):
MADQSMYNTLGQGTSPAEDPSNPNRMAHQVPPQSQPAAGFPPGPYPPQPGAYYGNPPPNQYDAPAA APPTQQLQSPPPRGLAPSPQLAYGTETQTHMGAPADPMAGLASQMSGLGIMGDSGARPGKKKHRHA HHEIGGATASAPQQFAGMPQAGMQPSSQFLNTGLNQAPRPISPAAGVPPAGIVPQPGVPAPGSGSV PTQGKIDPEQIPSIPQSRDIPTMYYFDHIYPTMERHLPPPAAVPFVAHDQGNSSPKHARLTLNNIP TTSDFLSSTALPLGMVLQPLARLDPGEPEVPVLDFGEMGPPRCRRCRAYINPFMTFRSGGNKFVCN MCTFPNDVAPEYFAPLDMSGARVDRLQRPELMIGTVEFMVPKEYWNKEPVGLQRLFLIDVSQESV RGFLKGVCKGITEALYGAPDASEEDAAARRVPEGSKIGIVTYDREVHFYNLSAQLDQAQMMVMTDL EEPFVPLSEGLFVDPYESKDIITSLLHRIPKIFSHIKKPEPALLPALNAAMSALQATGGKIFASIC SLPTWGPGALHMRDDPKVHGTDAERKLFTTDNQAWRTTAGKMAEHGIGVDMFVAAPGGTYVDVATI GHVAEVSGGETFFYPNFHAPRDILKLSQEFAHAVTRETGYQAMMKVRCSNGLQVSAYHGNFIQHAL GADLEIGSIDADKAIGVMFSYDGKLDPKLDAHFQAALLYTTAEGQRRVRCINVVAAVNEGGLETMK FIDQDCVVSIMAKEAAAKTVDKSLKDIRASITEKTVDIFSGYRKVFSGSHPPGQLVLPENLKEFSM YMLALIKSRAFKGGQEASDRRIHDMRMLRSIGATELALYLYPRVIPIHNMQPEDGFPNEQGQLQVP PSLRASFSKIEEGGAYLVDNGQICLLWLHSRVSPNLLEDLLGPGQSSLQGLNPQTSSLPVLETHLN AQVRNLLQYFSTMRGSKSVAIQLARQGLDGAEYEFARLLVEDRNNEAQSYVDWLVHIHRQINLELA GHRKREDTSAEGSLTSLAGLRAPYW [096] Aspergillus niger Sfb3 amino acid sequence (SEQ ID NO: 8)
MADPNMYHTYGQAPVPGENPSDPNQMAYQVPPQGYPAAGIPPGPSPPQPGAAYGVPAPNQQWPA YGSPPPAQQPLQQPPSQFAHQADPQAAMGAPVDPGMAGLASQMSGLGIMGGEGGAARSSKKKHR HAHHEIAGASASVAQPFAAAPQDPMQPTSQFLNTGLNQAPRPISPAASIPAPVNPAFGGGAGAV PTQGKVDPEQIPSIPRSRDLPAQYYFNHVYPTMERHLPPPAAVPFVAHDQGNSSPKYARLTLNN IPSTSDFLSSTGLPLGMVLQPLARLDGEQPIPVLDFGDAGPPRCRRCRAYINPFMSFRSGGNKF VCNMCTFPNDVPPEYFAPLDPSGSRIDRMQRPELMMGTVEFLVPKDYWNKEPVGLQWLLLIDVS QESVNKGFLKGVCKGIMEALYSEETENPEDEAPARRIPEGAKIGI TYDKEVHFYNLSAQLDQA QMMVMTDLEEPF PLSEGLFVDPYESKD ITSLLQRIPSIFSHVKNPQPALLPALNAALSALRP TGGKIVGTIASLPTWGPGALSLRDDPKVHGTDAERKLFTTEHAGWRETAGHLAEAGIGLDMFIA APSGTYMDVATIGHIPEVTGGETFFYPNFHAPRDIRKLSKELAHAITRETGYQALMKVRCSNGL QVSGYHGNFVQHTFGADLEIGAIDADKAIGVVFSYDGKLDPKLDAHFQAALLYTSANGQRRVRC INTVAAVNEGGMETMKFVDQDAVVAMVAKDAASKTLDKSLKDIRAGVSEKTVDIFSGYRKIFSG SHPPGQLVLPENLKEFSMYMLSLIKSRAIKGGQEASDRRIHDMRMLRSIGCTELSLYLYPRIIP IHNMQPTDGFPNEQGQLQVPPSLRASFSKIEEGGAYLVDNGQQCLLWLHSHVSPNLLEDLFGEG QTSLQGLSPQISTIPVLETHLNAQVRNLLQYFSTIRGSKAVTIQLARQGLDGAEYEFARMLVED RNNEAQSSVDWLVHIHRQINLELAGHRKREDTAGEGGLTSLAGLRAPYW
[097] Penicillium funiculosum Sfb3 amino acid sequence (SEQ ID NO: 9)
MADYSTYHSSGYAGAPGEDPNRQQPAVPAPYHSPNAPPGQAIQQPGITPYGAAQPPQFPGQPGV GYGVAPVPSPPQALGGPDVGDLATRIGGLGIISDAGTRSHKKKHRHAYHDIGGPNAQGLNTFPS QTNLQSQFLNTGLNQPEQQPAAPAAFPGAPVGQVPANVAPGAAPEVGGVGSVPTQGKIDPEQIP SVPRSRDLPAQYYFNNVYPTMERHVPPPASIPFIAHDQGNSSPKVARLTLNNIPSSSDFLQSTG LPLGMILQPLAKLDAGEQPVPVIDFGDIGPPRCRRCRTYINPFMTFRSGGNKFVCNMCTFPNDV PPEYFAPVDPSGVRVDRLQRPELMLGTVEFTVPKEYWVKEPAGLHQLFLIDVSQESVNRGFLKG VCDGIINALYGEEEPVEGAEPETRKVPEGSKIGIVTFDREIHFYNLLPRLDKAQMMVMTDLEEP FVPLSEGLFVDPYESKDVITSLLEQLPSLFARVKSPESTLLPTIKAAISALQATGGKIICCLTS LPTYGPGKLVMKDKSQAPDGENKLFAIDNPDYKAAATKLTEAGVGIDFFVAAPGGSFMDLTTIG YTAAISGGECFFYPNFHSPRDSLKLAQEISHTVTRETGYQALMKVRCSNGLQVSAYYGNFLQHT FGADLEIGTIDADKALGVLFSYDGKLDPKLDAHFQAALLYTAANGQRRVRCINIVAGVNEGGIE TMKCIDQDAVVAIIAKEAASKAGDKTLKDIRASITEKTVDIFSGYRKNFSGSHPPGQLVLPENL KEFSMYMLGLLKSRAFKGGSETADRRVHDLRMLRSIGCLELSLYLYPRI IPIHNMSAEDGFANE QGQLQVPPALRASFSRVEEGGAYLIDNGQGILLWIHSFVSPNLLEDLFGPGITSLQALDPNTSS LPVLETHLNAQVRNLLQYLSTVRGSKAVTIQLARQGIDGAEYEFARSLVEDRNNEAQSYVDWLV HIHRQINLELAGHRKKEDSATSSGEGALSSLAGIRAPYW
[098] Penicillium chrysogenum Sfb3 amino acid sequence (SEQ ID NO: 10)
MADSSMYNTMGQGSSEDPSNPQYMAQVPPQQYPAGYPPTAAPLQPGAPYANPAPNQWPAYGSPQ QPGMASPGIAYNAPQQPMGAAVDPGMAGLASQMGGLDIAADAGARTHRKKHRHAHHDIGGGAAP PAQGFNTGMDQGGLQQPQPQQQSQFLNTGLNQHADRPVSPAVGLVSGQSVAAIPGIQSGAGSVP TSGRIDPEHIPSIPRSRDLPAQYYFNHVYPTMDQHLPPPAAIPFVAQDQGNSSPKYARLTLNNI PSASDFLTSTGLPLGMILQPLAPLDPGEQPIPVLDFGDVGPPRCRRCRTYINPFMSFRSGGSKF VCNMCTFPNDTPPEYFAPLDPSGARVDRMQRPELLMGTVEFTVPKEYWNKEPVGLQTLFLIDVS RESVHRGFLKGVCAGIKDALYGDDDKASEGTEGDGSSRKLPVGAKVGIVTYDKEVHFYNLAAAL DQAQMMVMTDLDEPFVPLSEGLFVDPYESKSVITSLLSRIPKIFSSIKNPESALLPTLNSALSA LQATGGKIVCAVASLPTCGPGHLAIREDPKVHGTDAERKLFTTENPAWKKTASKLAEAGVGLDL FMAAPGGTYLD ATIGHVSSLTGGETFFYPNFHAPRDLLKLRKEIAHAVTRETGYQTLMKVRCS NGLQVSAYHGNFVQHTLGADLEIAG DADKAVGVLFSYDGKLDPKLDAHFQAALLYTSADGQRR VRCINVVAAVNEGGLETMKFVDQDAVVSVIAKEAASKTLDKNLKDIRASISEKTVDIFSGYRKI FSGSHPPGQLVLPENLKEFSMYMLSLVKSRAFKAGPESSDRRIHDMRLIRSMGCTEMALYLYPR IIP HNMQPEDGFANEHGQLQIPPTMRASYSRIEDGGVYIVDNGQAILLWIHAQVSPNLLEDLF GPGHNSLQGLNPNTSSLPVLETHLNAQVRNLLQYLSTVRGSKSVTIQLARQGLDGAEYEFARLL LEDRNNEAQSYVDWLVHIHRQINLELAGHRKKEEGGEGALASLSAMRTPYW [099] Neurospora crassa Sfb3 amino acid sequence (SEQ ID NO: 11)
MADYTMYHALGQGETLDPNDPNRTTQPAPPQFQPPVAPNPYHPGAEYNAPGQQQQQQQQYGQQY GQQYGQQYGQQQYGQEYGHQQQQQQQQQYGAPSPYGAPPAHSPVSPMDDVGLAAQMGGMSLGAG AGAADHHGRKKKKDRHAFHTVEAPAGSSQPFNGMPPAGIPATQFLNADPSLAGRIPGPGHGQFP MPASPAFGPVPTSAADFAARDATQGVGSGVFAAGGPQGGKPSPDDTPSVPLSRDAVQPYFHTNV YPTFERLVPPPAVTSFVALDQGNSSPKFARLTMTNLPASAEGLKSTGLPLGLLLQPLAETQPGE LPIPVLDFGEQGPPRCHRCRAYMNPFMMFKAGGNKFVCNLCTYANDTPPEYFCALSPQGVRVDR DQRPELTRGTVEFWPKEYWTKEPVGMRYLFVIDVTQESYNKGFLESFCEGILSALYGGSEEGE DQDETGEPKRKIPAGAKVGFVTFDQEIHFYNVSPALEQAQMIVMPDIEDPFLPLSDGLFVDPYE SKAVISSLLTRLPQMFSNIKNPEPALLSALNSAVAALEKTGGKVFCSLAALPTWGPGRLFMRDD GKHPGGEPDKKLFTTEHPGWRKLAEKMVSLGVGADFFMASPSGGYLDIATIGHVSSTTGGETFF YPNFVVQRDSTKLSLEIHHAVRRETGYAALMKVRCSNGLQVNAYHGNFIQHTFGADLEIGVIDA DKALAVTFGYDGKLDSKLDAHFQAALLYTTASGQRRVRCINVIAGVSDLARDCMKYIDQDAIVS ILAKEASTKLSTTSANLKEVRSSLTEKTIDILALYRKNHLAVPHPPQQLVMPERLKEFTMYVLG MLKCRAFKGGNETTDRRVHDMRLIRSMGARELSLYLYPRIIPLHSLQPEDGYPDATTGHLRMPS TMRASFARVEPGGVYLVDNGQVCLLWMHAQTAPALIQDLFGEDKTTLQSLDPYTSTIPVLETHL NAQTRNIIEYMRTVRGSKGLTIQLARQGIDGAEFEFARMLVEDRNNEAQSYVDWLVHVHKGVQL ELAGQRKREDGESHSALGSFTGLRPAYW
[0100] Fusarium oxysporum Sfb3 amino acid sequence (SEQ ID NO: 12)
MADYAQYHALGQGEVIDPNDPNRTSQPSAQQFQPPIAPSPYQQQASPYGAPQYLGGQQAPPPMT GSPAPAPGYGYAPPQAQAPPGQAPPSQDATLAAQLGGMNLGDGHGTARRKKKDRHAYHTVEPTG SSQAFNGMPPQGTSATQFLDSVPGGPGFGGQFGSPQGTPQMQSQSQFSAPVNPAFGPGPVAGTP GVGEGLGTASVSTSGPKGVSPDDMPSVPASRDAIQQYYLKNVYPTFERHVPPPSTVSFVAYDQG NSSPKYTRLTLNNIPTTQDALQATGLSLGLLLQPLAPLQAGEAEIPVLDFGEAGPPRCRRCRAY MNPFMMFRSGGNKFVCNLCAYPNDTPPEYFSATNPQGVRVDRDTRPELHRGTVEFWPKEYWTR EPVGLRWLFLIDVTQESYNKGYVEAFCEGIRVALYGGEDQELDENGEPKRRIPEGAKVGFVTYD KDIHFYNVNPALDQAQMMIMPDLEDPFVPLSEGLFVDPYESKDVITSLLTRLPDMFSTIKNPEP ALLAALNSALAALEATGGKVVASCSALPTWGPGRLFMRDNGNHPGGEIDKKLYTTEHPAWKKVA EKMAASGVGADFFLAAPSGGYLDIATIGHVSSTTGGETFYYPNFIAARDSRKLSLEISHAVTRE TGFQALMKVRCSNGLQVSGYHGNFIQHTFGADLEIGVIDADKAMGVSFSYDGKLDPKLDAHFQS ALLYTTASGERRVRCSNVIASVTETSKESGAREQGIRECLKFVDQDAVIGMLAKEASTKLATTS SNLKDIRHWLSEKAIDVLACYRKHAAQQHPPGQLVMPERLKEYCMYLLGLLKCRALKGGVENSD RRVHEMRMLRSMGALELSLYLYPRMIP IHNLAPEEGFADPETGHLKMPPAIRTSFSRVEPGGVY LVDNGQQCLLWFHSQTSPNLISDLFGEDKDSLKSLDPYTSALPLLETHLNAQVR IIEFLRTMR GSKGLTIQLARQGIDGAEFDFARMLVEDRNNEAQSYVDWLVHIHKGVQLELSGQRKKEGEEHTA ASLSNFAGLRPAYW
[0101] In some embodiments of the present compositions and methods, the amino acid sequence of the Sfb3 protein that is altered in production levels has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NOs: 6, 7, 8, 9, 10, 11, or 12, e.g. , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 6, 7, 8, 9, 10, 11, or 12. The nucleotide sequences encoding each amino acid sequence can be identified from a BLAST search for each corresponding protein as is know to one skilled in the art.
[0102] In some embodiments of the present compositions and methods, a sfl>3 gene is disrupted, wherein the sft>3 gene encodes a Sfb3 protein that has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NOs: 6, 7, 8, 9, 10, 11, or 12, e.g. , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 6, 7, 8, 9, 10, 11, or 12.
[0103] An alignment of the amino acid sequences of the Sfb3 proteins from approximately 40 Pezizomycotina species revealed a specific amino acid sequence, i.e.,
IQLARQGXDGXEXXXARXLXEDRNXEAXSXVDWL (SEQ ID NO: 13, where X is any amino acid residue), which is close to the C-terminus of the Sfb3 proteins, and not found in Sec24 proteins. This consensus sequence can be used to identify Sfb3 proteins and variants thereof in other members of the Pezizomycotina.
[0104] The skilled person will appreciate that genetic alterations that affect Sfb3 production can be made in the same manner as genetic alterations that affect Mpgl and/or Sebl production, which are detailed, herein. Alterations in the Sfb3 protein resulting in alterations in viscosity are further described in PCT Publication No. WO 2012/027580 Al, published 1, March 2012, filed as International Application No. PCT/US2011/049164, filed 25, August 2011, incorporated herein by reference. V. Additive effect produced by altering Mpgl production
[0105] In some embodiments of the present compositions and methods, genetic alterations that affect Sebl production, or Sebl and Sfb3 production, are combined with genetic alterations that 5 affect Mpgl production. As described by Kruszewska et al. (1998) Cur. Genet. 33:445-50 and Zakrzewska et al. (2003) Applied and Enviromnetal Microbiology 69:4383-89), Mpg 1(PID 122551) from Trichoderma reesei encodes a GTP:alpha-D-mannose-l-phoshate
guanyltransferase. Over-expression of the mpgl gene increases GDP-mannose levels, which can play a major regulatory role in early stages of protein glycosylation. However, Mpgl has l o heretofore not been associated with altered morphology, particularly not an altered morphology that gives rise to a low viscosity phenotype.
[0106] The amino acid sequence of the Trichoderma reesei Mpg 1 protein (PID 122551) is shown, below, as SEQ ID NO: 36:
MKGLILVGGFGTRLRPLTLTLPKPLVEFCNKPMIVHQIEALVAAGVTDIVLAVNYRPEIMEKFL
15 AEYEEKYNINIEFSVESEPLDTAGPLKLAERILGKDDSPFFVLNSDVICDYPFKELLEFHKAHG DEGTI VTKVEEPSKYGVVVHKPNHPSRIDRFVEKPVEFVGNRINAGMYIFNPSVLKRIELRPT SIEKETFPAMVADNQLHSFDLEGFWMDVGQPKDFLSGTCLYLSSLTKKGSKELTPPTEPYVHGG NVMIHPSAKIGKNCRIGPNVTIGPDVVVGDGVRLQRCVLLKGSKVKDHAWVKSTIVGWNSTVGR WARLENVTVLGDDVTIGDEIYVNGGSVLPHKSIKANVDVPAIIM
20
[0107] The amino acid sequence of the Neurospora crassa Mpgl protein is shown, below, as SEQ ID NO: 37:
MKALILVGGFGTRLRPLTLTMPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEIMEKYL AEYEKQFGINITISIESEPLGTAGPLKLAEDVLRKDDTPFFVLNSDVTCEYPFKELAAFHKAHG
25 DEGTI VTKVEEPSKYGVVVHKPNHPSRIDRFVEKPVQFVGNRINAGLYIFNPSVIDRVELRPT SIEQETFPAMVRDGQLHSFDLEGFWMDIGQPKDFLTGTCLYLSSLTKKGSKELAPTTLPYIHGG NVLIDPSAKIGKNCRIGPNVTIGPNVVVGDGVRLQRCVLLEGSKVKDHAWVKSTIVGWNSTVGK WARLENVTVLGDDVTIGDEIYV GGSILPHKTIKANVDVPAIIM
30 [0108] The amino acid sequence of the Aspergillus oryzae Mannose-1 -phosphate
guanyltransferase protein is shown, below, as SEQ ID NO: 38:
MKGVGGGTRRTTKVCNKMVHAVAAGVTDVAVNYRMKAYKMKAVGGGTRRTTKVGNRMHVSAAAG VTDVAVNYRDVMVSAKKYYNNSVSDTAGKARGKDDSVNSDVCDYKHKAHGDGTVVTKVYNVKSV SGTAGKAKGKDDSVNSDVCDYKAHKKHGDGTVVTKVDSKYGVVVHKNHSRDRVKVVGNRNAGMY NSVKRRTSKTAMVADNHSSKYGVVVHKNHSRDRVKVVGNRNAGYMNSVNRRTSTACKDGHSDGW MDVGKDSGTCYSSTKKGSKTTYVHGGNVMHSAKGKNCRGNVTGDGWMDVGKDSGTCYTSAKRNS KANSYVYGGNVMVDSAKGKNCRGNVVGDVVVGDGVRRCVKGSKVKDHAWVKSTVGWNSTVGRWA RNVTVGDDVTGDYVNGGSVHNVVVGDGVRRCVNSKVKDHAWVKSTVGWNSSVGRWARNVTVGDD VTAD Y NGGSHKSKA DVAMKSK DVAM
[0109] In some embodiments of the present compositions and methods, the amino acid sequence of the Mpgl protein that is altered in production levels has a specified degree of overall amino acid sequence identity to the amino acid sequence of at least one of SEQ ID NOs: 36, 37, or 38, e.g. , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NOs: 36, 37, or 38. The nucleotide sequences encoding each amino acid sequence can be identified from a BLAST search for each corresponding protein as is know to one skilled in the art.
[0110] In some embodiments of the present compositions and methods, the mpgl gene that is disrupted encodes a Mpgl protein that has a specified degree of overall amino acid sequence identity to the amino acid sequence of at least one of SEQ ID NOs: 36, 37, or 38, e.g. , at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to at least one of SEQ ID NOs: 36, 37, or 38.
[0111] The amino acid sequence information provided, herein, readily allows the skilled person to identify an Mpgl protein, and the nucleic acid sequence encoding an Mpgl protein, in any filamentous fungi, and to make appropriate disruptions in the mpgl gene to affect the production of the Mpgl protein. The polynucleotide sequences encoding SEQ ID NOs: 36, 37, or 38can be found in the GenBank or JGI databases, as are known to one of skill in the art.
[0112] The skilled person will appreciate that genetic alterations that affect Mpgl production can be made in the same manner as genetic alterations that affect Sebl and/or Sfb3 production, which are detailed, herein. Alterations in the Mpgl protein resulting in alterations in viscosity are further described in Provisional Patent Application No. 61,478,162, filed 22, April 2011, incorporated herein by reference. VI. Utility
[0113] The use of reduced viscosity strains of filamentous fungi is known to improve the distribution of oxygen and nutrients in a submerged culture, reduce the amount of energy required 5 to agitate a submerged culture, and increase the cell mass present in the culture, leading to increased protein production. Moreover, the present variant strains of filamentous fungus offer significant advantages over previously-described reduced viscosity strains.
[0114] First, the present variant strains can have a fully defined genome, making them well-suited for subsequent genetic manipulation, complementation, mating, and the like. Second, the present o strains are not adversely affected in protein production, for example, by the manipulation(s) that resulted in the attendant viscosity alteration. Third, reduced viscosity strains can be produced from essentially any parental strain, including parental strains that already produce a protein intended for high level expression (i.e., a protein of interest), already encode a selectable marker, or already include other features that are desirable in a production host. Thus, the present strain and methods 5 eliminate the need to transfer a gene encoding a protein of interest into a preexisting reduced
viscosity production strain.
[0115] The present strains and methods find use in the production of commercially important protein in submerged cultures of filamentous fungi. Commercially important proteins include, for example, cellulases, xylanases, pectinases, lyases, proteases, kinases, amylases, pullulanases,0 lipases, esterases, perhydrolases, transferases, laccases, catalases, oxidases, reductases,
chlorophy liases, hydrophobin, chymosin, carbonic anhydrase, hymidylate synthase,
dihydrofolate reductase, tyrosine kinases, multi-drug resistance proteins (e.g., ABC P-gp proteins), CAD (carbamyl-P synthase, aspartate transcarbamylase, dihydroorotase),
topoisomerases, ribonucleotide reductase, and antibodies and other enzymes and non-enzyme 5 proteins capable of being expressed in filamentous fungi. Such proteins can be suitable for
industrial, pharmaceutical, animal health and food and beverage use.
[0116] The following numbered paragraphs further describe various aspects and embodiments of the present compositions and methods. The subject matter of each of the numbered paragraphs can be used alone or in combination with the subject matter of any other numbered paragraph, as o indicated.
1. In one aspect, a variant strain of filamentous fungus derived from a parental strain is provided, the variant strain comprising a genetic alteration that causes cells of the variant strain to produce an altered amount of functional Sebl protein compared to cells of the parental strain, wherein the cells of the variant strain produce during aerobic fermentation in submerged culture a cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content compared to the cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
5 2. In some embodiments of the variant strain of paragraph 1, the altered amount of functional Sebl protein is a reduced amount, and the variant strain produces during aerobic fermentation in submerged culture a cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental l o strain.
3. In some embodiments of the variant strain of paragraphs 1 or 2, the genetic alteration comprises a disruption of the sebl gene present in the parental strain.
4. In some embodiments of the variant strain of paragraph 3, disruption of the sebl gene is the result of deletion of all or part of the sebl gene.
15 5. In some embodiments of the variant strain of paragraph 3, disruption of the sebl gene is the result of deletion of a portion of genomic DNA comprising the sebl gene.
6. In some embodiments of the variant strain of paragraph 3, disruption of the sebl gene is the result of mutagenesis of the sebl gene.
7. In some embodiments of the variant strain of any of paragraphs 3-6, disruption of the sebl gene 20 is performed using site-specific recombination.
8. In some embodiments of the variant strain of any of paragraphs 3-7, disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
9. In some embodiments of the variant strain of any of paragraphs 1-8, the variant strain does not 25 produce functional Sebl protein.
10. In some embodiments of the variant strain of any of paragraphs 1-8, the variant strain does not produce Sebl protein.
11. In some embodiments of the variant strain of any of paragraphs 1-10, the variant strain further comprises a gene encoding a protein of interest.
30 12. In some embodiments of the variant strain of any of paragraphs 1-11, further comprises a disruption of the sft>3 gene.
13. In some embodiments of the variant strain of any of paragraphs 1-12, the variant strain further comprises a disruption of at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene. 14. In some embodiments of the variant strain of any of paragraphs 1-13, the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
15. In some embodiments of the variant strain of any of paragraphs 1-14, the filamentous fungus is a Pezizomycotina species.
16. In some embodiments of the variant strain of any of paragraphs 1-15, the filamentous fungus is a Trichoderma spp.
17. In some embodiments of the variant strain of any of paragraphs 1-16, the filamentous fungus is Trichoderma reesei.
18. In another aspect, a method for producing a variant strain of filamentous fungus cells is provided, comprising: introducing a genetic alteration into a parental strain of filamentous fungal cell, which genetic alteration alters the production of functional Sebl protein compared to the cells of the parental strain, thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
19. In some embodiments of the method of paragraph 18, the genetic alteration reduces or prevents the production of functional Sebl protein, thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
20. In some embodiments of the method of paragraph 18 or 19, the genetic alteration comprises disrupting the sebl gene in a parental filamentous fungal cell using genetic manipulation.
21. In some embodiments of the method of any of paragraphs 18-20, the genetic alteration comprises deleting the sebl gene in a parental filamentous fungal cell using genetic manipulation.
22. In some embodiments of the method of any of paragraphs 18-21, the genetic alteration is performed using site- specific genetic recombination.
23. In some embodiments of the method of any of paragraphs 18-22, disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
24. In some embodiments of the method of any of paragraphs 18-23, disruption of the sebl gene is performed in combination with disrupting the sft>3 gene. 25. In some embodiments of the method of any of paragraphs 18-24, disruption of the sebl gene is performed in combination with disruption of at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
26. In some embodiments of the method of any of paragraphs 18-25, the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
27. In some embodiments of the method of any of paragraphs 18-26, the filamentous fungus is a Pezizomycotina species.
28. In some embodiments of the method of any of paragraphs 18-27, the filamentous fungus is a Trichoderma spp.
29. In some embodiments of the method of any of paragraphs 18-28, the filamentous fungus is Trichoderma reesei.
30. In some embodiments of the method of any of paragraphs 18-29, the parental strain further comprises a gene encoding a protein of interest.
31. In some embodiments of the method of paragraph 30, the gene encoding the protein of interest is present in the parental strain prior to introducing the genetic alteration that reduces or prevents the production of functional Sebl protein.
32. In another aspect, a protein of interest produced by the variant strain of paragraph 11 is provided.
33. In another aspect, a variant strain of filamentous fungus produced by the method of any of paragraphs 18-31 is provided.
34. In another aspect, a variant strain of filamentous fungus derived from a parental strain is provided, the variant strain comprising:
(a) a genetic alteration that results in (i) a requirement for reduced agitation in submerged culture to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintenance of an increased dissolved oxygen content in submerged culture at a preselected amount of agitation, compared to the cells of the parental strain, and
(b) a gene encoding a protein of interest,
wherein the gene encoding the protein of interest is present in the variant strain prior to the genetic alteration in (a).
35. In some embodiments of the variant strain of paragraph 34, the genetic alteration comprises a disruption of the sebl gene present in the parental strain.
36. In some embodiments of the variant strain of paragraph 35, disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene. 37. In some embodiments of the variant strain of paragraph 35 or 36, disruption of the sebl gene is performed in combination with disrupting at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
38. In some embodiments of the variant strain of any of paragraphs 35-37, disruption of the sebl gene is performed in combination with disrupting the mpgl gene.
[0117] These and other aspects and embodiments of the present strains and methods will be apparent to the skilled person in view of the present description. The following examples are intended to further illustrate, but not limit, the strains and methods.
EXAMPLES
Example 1. Identification of the sebl gene as responsible for morphological changes in filamentous fungus
A. Overview
[0118] Filamentous fungi disruption libraries were prepared by transforming an exemplary filamentous fungus, i.e., Trichoderma reesei, with a nucleic acid containing the pyr4 gene, using Agrobacterium tumefaciens- ediated transformation. In this manner, the pyr4 gene served as both a selectable marker and a gene tag. The particular A. tumefaciens strain used was EHA 105, which is considered to be a hypervirulent (Hood et ah, 1993). However, other A.
tumefaciens strains, e.g., A136 and EHA 101, produce similar transformation frequencies in T. reesei. A. rhizogenes strains, e.g., ATCC 43057, can also be used. The particular disruption library contained about 50,000 transformants.
B. Preparation of DNA
[0119] The vector used for disruption was based on the PZP 100 vector, which includes the left and right T-DNA border regions, a pBR322 bom site for mobilization from E. coli to
Agrobacterium, ColEl and pVSl plasmid origins for replication in E. coli and Agrobacterium, respectively, and a bacterial marker for conferring chloramphenicol resistance (Hajdukiewiez, O. et ah, 1994). A representation of the vector is shown in Figure IB, with a schematic of the T- DNA disruption cassette being shown in Figure 1A.
[0120] An expression cassette containing the pyr4 gene was prepared by standard molecular biology techniques and ligated into the PZP vector at the ZtamHI site. The resulting vector was propagated in E. coli XL gold cells (Invitrogen, Carlsbad, CA, USA). LA agar plates (10 g/L tryptone, 5 g/L yeast extract, 10 g/L NaCl, 10 g/L agar) with 25 ppm chloramphenicol were used to select for E. coli transformants. About 1-10% of the E. coli transformants had the desired vector. E. coli containing the vector were grown in LB medium (10 g/L tryptone, 5 g/L yeast extract, 10 g/L NaCl) plus 25 ppm chloramphenicol. Vector DNA was isolated using standard methods.
C. Transformation of Agrobacterium cells
[0121] Competent Agrobacterium cells were made as follows. Briefly, Agrobacterium cells were revived from cryopreservation by growing on LA medium at 28 °C for about three days. Colonies were then selected and grown in LB medium containing 0.1 % glucose in 50 ml volumes in 250 ml dented bottom flasks at 28 °C until growth was apparent. Alternatively, colonies were started in a 5 ml culture tube and transferred to a 250 ml flask when growth was apparent. About 10% of the volume of the 250 ml flask was then transferred into a fresh flask with the same medium, which was grown to an OD (600 nm; Οϋ6οο) of about 0.4-0.8 (about 5-6 hours of growth). The cells were recovered by centrifugation in a cold centrifuge at 10,000 rpm for 10 minutes, and then washed three times in cold 1 M HEPES, pH 7.0. Next, the cells were washed once in cold 1 mM HEPES with 10 % glycerol, and aliquots were frozen at -70 °C. Cell viability was determined (typically about lxlO9 CFU/ml after freezing).
[0122] The vector DNA was used to transform Agrobacterium cells by electroporation.
Competent Agrobacterium cells were thawed on ice and about 40 μΐ of the cells were mixed with about 1 μg of DNA in a 0.2 cm electroporation cell (on ice). The cells were electroporated at 2.5 volts (200 Ohms, at 25 μΕ) with a Buchler 3-150 electroporator. SOC medium
(Invitrogen) was added to the electroporation cell immediately after electroporation.
Alternatively, the Agrobacterium cells can be transformed by electroporation using the ligation mixture, thereby eliminating the need to propagate the vector DNA in E. coli. In the alternative method, about 1 μΐ of the ligation mixture is used for transformation. After the addition of SOC to the electroporation mixture, dilutions of the mixture were plated onto LA medium plus 250 ppm chloramphenicol culture plates and incubated at 28 °C for four days. 1 x 107 CFU/ml of Agrobacterium transformants were obtained and about 90-100 % contained the vector DNA, as determined by PCR analysis. As little at 25 ppm chloramphenicol can be used to obtain colonies in a shorter time frame but a larger number of colonies must to be screened to identify bonafide transformants.
D. Agrobacterium-mediated transformation of T. reesei
[0123] 25 ml of minimal medium (2.05 g/L K2HP04, 1.45 g/L KH2P04, 0.15 g/L NaCl, 0.5 g/L MgS04-7 H20, 0.1 g/L CaCl2-6 H20, 0.0025 g/L, FeS04-7 H20, 0.5 g/L (NH4)2S04, and 2 g/L glucose, with 25 ppm chloramphenicol added after sterilization) in a 250 ml flask was inoculated with either a frozen stock of vector-transformed Agrobacterium or directly from a fresh LA plate. The minimal medium culture was then incubated at 28 °C with shaking until cloudy (overnight to several days). 10 ml of the culture was transferred to 50 ml of induction medium (2.05 g/L K2HP04, 1.45 g/L KH2P04, 0.15 g/L NaCl, 0.5 g/L MgS04-7 H20, 0.1 g/L
CaCl2-6 H20, 0.0025 g/L, FeS04-7 H20, 0.5 g/L (NH4)2S04, 1.8 g/L glucose, 5 g/L glycerol, prepared in 40 mM MES, pH 5.3, with 200 μΐ^ of 1 M acetosyringone added after sterilization) in 250 ml flasks. The staring Οϋ6οο was about 0.1, and the vector-transformed Agrobacterium cells were grown to an Οϋ6οο of about 0.4-0.8.
[0124] A fresh culture of T. reesei T4 Apyr4 cells (a whole-cellulase mutant strain derived from QM6A NRRL 3652, Agricultural Research Service, Beltsville, MD, USA) was prepared by resuspending spores in 10 ml of sterile water. Transformation of the T. reesei T4 Apyr4 cells was performed as follows: About 100 μΐ of Agrobacterium whole broth (Οϋ6οο = 0.4-0.8) was mixed with 100 μΐ of fungal spores (107 sfu/ml) in a tube (other ratios of Agrobacterium cells to fungal spores will also produce satisfactory results). About 0.1-1.0 ml of this mix was plated onto induction agar plates (induction medium with 15 g/L agar and 0.25 mg/mL uridine) with embedded nitrocellulose filters. The plates were incubated at about 18-28 °C for about 24-48 hours to allow the growth of the T. reesei cells. Next, the nitrocellulose filters were transferred to Vogel's medium (Vogel, Microbiol. Genet. Bull. 13:42-43, 1956) supplemented with 250 ppm carbenicillin to kill/inhibit Agrobacterium growth. The cultures were then incubated at 28 °C until growth of filamentous fungi (representing transformants of the disruption library) on the filters was evident.
E. Screening for morphology mutants
[0125] Transformants in the disruption library were screened for alterations in morphology in solid and liquid culture using light microscopy. Following transformation, individual transformants were picked from the nitrocellulose filters using a colony picker and transferred to 96-well microtiter plates containing potato dextrose agar (CP-700, Norgren Systems LLC, Fairlea, WV, USA). Alternatively, spores from transformants were combined, germinated, and single spores were added to microtiter plate wells using a cell sorter. Spores were collected by suspending spores from a Vogel's transformation plate in 20 ml sterile distilled water using a cell spreader. Spores were inoculated into a 250 mL flask containing 50 ml of a minimal medium and incubated at 28 °C with agitation for 24 h until germlings were obtained. Using high speed sorting (MoFlo sorter, Cytomation, Fort Collins, CO, USA) at an event rate of
15,000 event per second, 60 psi with a 70 μιη nozzle), individual germlings were separated into microtiter plate wells containing potato dextrose agar (Difco, Detroit, MI, USA). The microtiter plates containing the transformants obtained by either method described above were incubated for 7 days at 28°C. The individual germinates spores were replicate plated into 384 well black sensoplates with glass bottoms (Greiner Bio-one, Germany) containing YEG (5 g yeast extract, 20 g glucose per 1 L water) and incubated at 20°C, for 24 h. The morphology of individual transformants was examined microscopically.
F. Isolation and characterization of T. reesei T4 mutant F16
[0126] Mutant F16 obtained from the above procedure was observed to have altered morphology on plates, and subsequently in liquid culture. On PDA plates Mutant F16, had restricted growth compared to the T4 parent. In liquid medium, F16 appeared to have shorter filaments than the T4 parent. Strains T4 and F16 were grown under identical conditions in submerged (liquid) culture, and their growth phenotypes were compared. Briefly, spores of each strain were added separately to 500-mL of medium in a 3-L flask with both side and bottom baffles. The cultures were grown in a minimal medium for 48 hrs at 34 °C in a shaking incubator.
[0127] After 48 hrs, the contents of each flask were added separately to 14-L fermentors containing 9.5 L of medium containing 4.7 g/L KH2P04, 1.0 g/L MgS04-7 H20, 4.3 g/L (NH4)2S04 and 2.5 mL/L of the same trace element solution. These components were heat sterilized together at 121°C for 30 minutes. A solution of 60% glucose and 0.48% CaCl2-2 H20 was separately autoclaved, cooled, and added to the fermentor to a final concentration of 75 g/L glucose and 0.6 g/L CaCl2-2 H20. The medium was adjusted to pH 3.5 with 28% N¾ and the temperature was maintained at 34°C during the growth period. Once glucose was exhausted, the temperature was dropped to 28°C and the cultures were fed glucose-sophorose.
[0128] A dissolved oxygen (DO) probe was calibrated to 100% when there was no added pressure in the headspace {i.e. , 0 bar gauge, 1 bar absolute). The pressure in the headspace was then set to 0.7 bar (gauge), after which the oxygen probe read 170% before the seed culture was added. The fermentor contained two, four-blade turbines that provided mixing via a variable speed motor that was initially set at 500 rpm.
[0129] As the cultures grew, DO content levels dropped, at least partly as a consequence of the increased viscosity of the broth due to the proliferation of filamentous fungus hyphae. When the glucose was completely consumed, the amount of biomass produced in each fermentor was measured, and found to be substantially the same for both strains. The DO content level in each fermentor at a given level of agitation is an indirect measure of the viscosity of the different cell broths, due to the different strain growth phenotypes.
[0130] The nucleic acid sequence of the sebl gene was obtained from the JGI data base. Protein ID: 76505, Name: estExt_GeneWisePlus.C_50617, available at; http://genome.jgi-psf.org/cgi- bin/dispGeneModel?db=Trire2&id=76505, (The Genome Portal of the Department of Energy Joint Genome Institute I. V. Grigoriev, H. Nordberg, I. Shabalov, A. Aerts, M. Cantor, D.
Goodstein, A. Kuo, S. Minovitsky, R. Nikitin, R. A. Ohm, R. Otillar, A. Poliakov, I. Ratnere, R. Riley, T. Smirnova, D. Rokhsar, and I. Dubchak. Nucleic Acids Res 2011 0: gkr947vl-gkr947) as disclosed below. The untranslated region is italicized, coding regions are in bold and introns are in lower case (SEQ ID NO: 39):
GTTCTGCGCAACAAACCACCCTTCGCAAACATCCCCTCCTCTTCCTCCTCCATCACCCTTACCA TTACCAAAGACCGCCATCCATTCTTTCACCCGGAGCCGAAGACGACCCTCACCACTCTTTACTC TCTGCCTCTTCTTACAACAACCTGATTGCCTGGGCAATTGTATAATACGGACTACTACTTCTAC Ί AT ACAACAAACCAA TAACGCTTAATA TCTAAATCTATACCCTTCGGGACTCGGAAGCCATCGC AAACACACAAAAGAGgt cagacaaagaaccatggcagacaaaacaaaaaggacttt cagagagc t gacttgtatacctttt ggct ggaacagACAAGCAATGGACGGCATGATGTCTCAACCCATGGG AC AGC AGGC GT T C T AC T T C T AC AAC C AC GAGC AC AAGAT GTCCCCTC GAC AAGT C AT C T T C GC A CAACAGATGGCCGCCTACCAGATGATGCCCTCGCTGCCGCCCACGCCCATGTACTCGCGACCAA ACTCGTCCTGCTCGCAGCCCCCGACTTTGTACAGCAACGGCCCTTCAGTCATGACTCCCACAAG CACACCCCCTCTGTCCTCGCGCAAGCCCATGCTGGTGGACACGGAGTTTGGCGACAACCCCTAC TTCCCCTCCACGCCGCCTCTGTCGGCCTCGGGCAGCACCGTCGGCAGCCCCAAGGCCTGCGACA T GC T GC AGAC GC C CAT GAAC C C CAT GTTCTCCGGCCTC GAGGGC AT T GC CAT C AAGGAC AGC AT CGACGCCACCGAGAGCCTCGTCCTGGACTGGGCCAGCATCGCCTCGCCCCCCCTGTCGCCTGgt aagt cgt cgccttgtttt ctttaattt ccgcagt cgaat gtt ccttggaccctt cct ct ccgt c aat gccagcctttgt cgcgatgaactggcgccatggtggacat gctgcttt agat gaat actgg ggcgggacagccggctaat ccgctt cgggcagTGTATCTCCAGTCCCAGACCAGCTCGGGCAAG GTGCCCTCGCTTACCTCGAGCCCGAGCGACATGCTCTCCACCACAGCTTCGTGCCCTTCGCTGT CTCCCTCGCCAACTCCCTACGCGCGCTCCGTCACGTCGGAGCACGATGTTGACTTCTGCGATCC CCGCAACCTGACCGTCTCTGTTGGCTCCAACCCCACCCTGGCCCCGGAGTTTACCCTGCTGGCC GACGACATCAAGGGCGAGCCGCTGCCCACCGCTGCCCAGCCGTCCTTTGACTTCAACCCTGCGC TGCCCAGCGGCCTGCCGACCTTTGAGGACTTCTCCGATCTCGAGTCGGAAGCCGACTTCAGCAG CCTCGTCAACCTCGGCGAGATCAACCCCGTCGACATCTCCCGCCCCCGCGCCTGCACCGGCTCC TCGGTCGTCTCCCTGGGCCACGGCAGCTTCATTGGCGACGAGGACCTGAGCTTCGACGACGAGG CCTTCCACTTCCCCTCCCTGCCCAGCCCGACCTCGTCCGTCGACTTCTGCGACGTCCACCAGGA C AAGAGAC AGAAGAAGGAC C GC AAGGAGGC C AAGC C C GT CAT GAAC TCTGCTGCCGGCGGCTCC CAGTCCGGCAACGAGCAGGCTGGCGCCACCGAGGCCGCCTCTGCCGCCTCCGACTCCAATGCCT CCTCTGCCTCTGACGAGCCCTCTTCCTCCATGCCCGCCCCTACCAACCGCCGCGGTCGCAAGCA GTCGCTGACCGAGGATCCCTCAAAGACCTTTGTCTGCGACCTCTGCAACCGCCGCTTCCGTCGC C AGGAGC AC C T C AAGC GT C AC T AC CGCTCCCT GC AC AC C C AGGAGAAGC C C T T T GAGT GC AAC G AGT GC GGC AAGAAGT T C T C T C GC AGC GAC AAC C T GGC T C AGC AC GC C C GC AC C C AC TCTGGTGG T GC CAT T GT CAT GAAC C T CAT C GAGGAGT C C T C C GAGGT GC C C GC C T AC GAT GGC AGC AT GAT G GCCGGGCCCGTGGGT GAC GAC T AC AGC AC C TAT GGC AAGGT C C T GT T C C AGAT C GC C T C AGAGA TCCCCGGAAGCGCCAGCGAGCTCTCCTCAGAAGAGGGCGAGCAGGGCAAGAAGAAGCGCAAGCG
CTCCGATTAAATGACTTCCCCCCATCTCTCTCTCTCATACGCCTGACACGATTTTACACTTTGA
5 CACTTCTCGCTTCGCTTCGGCGCAAGCCCTATTTCCACACATACACTTTTTTGCTAGAGGGGGA CCACCACCACACTATACAGGGAAAAAGCTCAAGCGGTTATGATTGCATTTCAAAACCTTTCAGT TCTTGTATCGACTTTGCA
[0131] As shown in Figure 2, disruption of the sebl gene in the F16 mutant resulted in a strain l o showing a higher level of dissolved oxygen during growth compared to cultures containing the T4 parent, while the levels of growth (Figure 3) and protein production (not shown) were unaffected. Southern analysis showed that the F16 strain contained only one copy of the pyr4 gene, indicating that the single expected disruption event had taken place (not shown).
[0132] Inverse PCR was used to identify the insertion site of the T-DNA pyr4 gene in the F16
15 mutant by determining the pyrA flanking regions. Briefly, high molecular- weight genomic DNA from strain F16 was digested to completion with the restriction enzymes Pstl and Nsil. After heat inactivation of the enzymes, the reaction was diluted five-fold in ligation buffer and T4 DNA ligase was added. Following an overnight ligation reaction, the ligase was heat inactivated and the reaction was precipitated with ammonium acetate and ethanol. The washed DNA pellet
20 was dissolved in TE and used as template for PCR with primers RPG097 and RPG098 (referring to Table 1). This PCR reaction was then diluted and used as template for PCR using nested primers RPG099 and RPG100. The resulting PCR product was cleaned then sequenced with primer RPG116 to determine the nucleotide sequence flanking the site of the T-DNA insertion. BLASTn analysis of this sequence against the JGI Trichoderma reesei database v 2.0 genome
25 sequence identified the flanking sequence as region 1203727 to 1204065 on Scaffold 5, with the site of insertion site of the T-DNA being at position 1203727.
[0133] The site of insertion was confirmed by PCR using primers homologous to the genomic DNA flanking the insertion site and primers homologous to the T-DNA. In particular, primers RPG099 and RPG133 were used to confirm the sequence at the 5 ' end of the T-DNA {i.e. , near 30 the pyr4 promoter), and primers RPG112 and RPG134 were used to confirm the sequence at the 3 ' end of the T-DNA {i.e. , near the pyr4 terminator). Primers RPG133 and RPG134 amplified the full T-DNA insertion at the identified site.
[0134] The site of the pyr4 insertion in mutant F16 was at Scaffold 5 at 1203727 in the T. reesei JGI genomic database v2. The gene found at this site has homology to the sebl gene found in several other fungi including Aspergillus fumigatus and Trichoderma atroviride. The sebl gene encodes an AGGGG-binding protein, which appears to be involved in osmotic stress response (Peterbauer, C. et al. (2002) Molecular Genetics and Genomics 268:223-31). Indeed, the F16 strain was found to have a stress response phenotype similar to that described in the literature. Since the insertion at this site was shown to be the only genetic change made in the F16 strain, it follows that disruption of the sebl gene was responsible for the observed morphological changes.
Table 1. Primers used in Example 1.
Figure imgf000039_0001
Example 2. Deletion of the sebl gene from the Morph 1.1 ku80 deleted strain of T. reesei
[0135] The T. reesei Morph 1.1 {i.e., "Morph") mutant is deleted for four major cellulases genes {i.e. , cbhl, cbhll, egll and eglll), which makes it useful for expressing other proteins in the absence of cellulase background activity. The ku80 gene was deleted from Morph to increase homologous recombination and aid in the sequence-specific disruption of sebl. The pyr4 gene was disrupted so that it could be used as a transformation marker. A sebl disruption cassette was prepared by PCR by amplifying the disrupted sebl gene from DNA obtained from the aforementioned F16 mutant, along with about 500 bp of 5' sebl flanking sequences and about 500 bp of 3' sebl flanking sequences. Morphl.l Aku80Apyr4 was transformed using PEG with this deletion cassette, to produce strain Morphl.l Aku80Apyr4Asebl . As above, this strain had an osmotic stress response similar to that of the T. atroviride sebl -deleted strain described in the literature (Peterbauer, C. et al., 2002).
[0136] Strains Morph 1.1 Aku80 and Morphl.l Aku80Apyr4Asebl were grown under identical conditions in submerged (liquid) culture, and their growth phenotypes were compared. Briefly, spores of each strain were added separately to 500-mL of medium in a 3-L flask with both side and bottom baffles. The culture was grown in a minimal glucose medium for 48 hrs at 34°C in a shaking incubator. [0137] After 48 hrs, the contents of each flask were added separately to 14-L fermentors containing 9.5 L of medium containing 4.7 g/L KH2P04, 1.0 g/L MgS04-7 H20, 4.3 g/L (NH4)2S04 and 2.5 mL/L of the same trace element solution. These components were heat sterilized together at 121°C for 30 minutes. A solution of 60% glucose and 0.48% CaCl2-2 H20 was separately autoclaved, cooled, and added to the fermentor to a final concentration of 75 g/L glucose and 0.6 g/L CaCl2-2 H20. The medium was adjusted to pH 3.5 with 28% N¾ and the temperature was maintained at 34°C for the entire growth period.
[0138] A dissolved oxygen (DO) probe was calibrated to 100% when there was no added pressure in the headspace (i.e. , 0 bar gauge, 1 bar absolute). The pressure in the headspace was then set to 0.7 bar (gauge), after which the oxygen probe read 170% before the seed culture was added. The fermentor contained two, four-blade turbines that provided mixing via a variable speed motor that was initially set at 500 rpm.
[0139] As the cultures grew, DO levels dropped, at least partly as a consequence of the increased viscosity of the broth due to the proliferation of filamentous fungus hyphae. When DO fell below 40%, the agitation rate was increased to maintain the dissolved oxygen at 40%. Upon reaching 750 rpm agitation, DO would be allowed to drop below 40%. If the DO did not fall below 40%, then it was unnecessary to increase the agitation rate during the fermentation run, and the initial agitation rate was higher than necessary. When the glucose was completely consumed, the amount of biomass produced in each fermentor was measured, and found to be substantially the same for both strains.
[0140] The DO level in each fermentor at a given level of agitation, and the amount of agitation required to maintain a given DO level are indirect measures of the viscosity of the different broths, due to the different strain growth phenotypes. Although it would be ideal to vary only one variable (i.e. , DO or agitation) and measure the other, it is desirable to prevent the DO from falling below 40% to ensure the production of sufficient biomass in each fermentor, thereby permitting a more meaningful comparison between the growth of the different strains.
[0141] Generally, where it is necessary to increase the agitation rate to maintain a target DO level, the amount of agitation can be estimated by the amount of power supplied to the motor driving the fermentor turbine, which provides a metric that correlates with the viscosity of the broth. In particular, the extra power required to agitate the suspended culture is proportional to the agitation rate raised to the 3rd power.
[0142] As shown in Table 2, deletion of the sebl gene from strain Morphl/1 Aku80 resulted in a strain having a reduction in broth viscosity. At the end of the batch growth phase, when all the glucose has been consumed, both strains had achieved a similar biomass concentration. To get there, the control strain saw agitation increased to the maximum of 750 rpm and then saw DO drop down to as low as 29%. The sebl deleted strain did not require as much energy to achieve the same biomass concentration. Agitation rate was never increased above 500 rpm and DO dropped only as low as 55%.
Table 2. Broth viscosity in Morphl/1 Aku80 with and without the sebl gene
Figure imgf000041_0001
Example 3. Additive viscosity reduction in mutants having disrupted sebl and sfl)3 genes
A. Morph strain TrGA #32
l o [0143] The Morph strain, described above, was previously transformed with a native
Trichoderma glucoamylase gene (TrGA) under control of the CBH1 promoter, using amds as a marker. A transformant containing two tandom copies of glucoamylase (TrGA 29-9) was subsequently isolated, and random chemical mutagenesis was used to produce a cell wall mutant (70H2) having altered morphology associated with a reduced viscosity phenotype. This reduced
15 viscosity phenotype was later determined to be the result of a truncated sfb 3 gene (data not shown). A 70H2 strain transformed with additional copies of TrGA (i.e., TrGA #32) has further been useful for overexpressing TrGA.
B. Generation of a sebl disruption cassette
[0144] The sebl disruption cassette plasmid pRATT240 (Figure 6) was prepared using standard 20 molecular biology procedures. This plasmid included a DNA sequence having a 3.3 Kb region homologous to the DNA sequence immediately 5 ' (relative to sebl transcription) to the T-DNA insertion site identified in strain T4 F16 and a 3.0 Kb region homologous to the DNA sequence immediately 3' to the T-DNA insertion site. These sequences were designed to target the insertion of the intervening cassette sequences to the insertion site identified in strain T4 F16. 25 These intervening sequences included a pyr2 selection marker from Trichoderma atroviride intended to minimize homology to the endogenous T. reesei pyr2 in the genome of the strain to be transformed. Immediately upstream of the pyr2 selection marker was a directly repeated duplication of the 3 'end of the marker, which facilitated the subsequent loss of the marker and isolation of useful pyr2 mutant derivatives of the transformants/disruptants. This full sebl 30 disruption cassette was amplified by PCR using primers RPG257 and RPG264 (referring to Table 2). Multiple PCR reactions were pooled and cleaned using standard molecular biology procedures for use in the subsequent steps.
C. Generation of strain TrGA#32AseW
[0145] Strain TrGA #32 was transformed with the sebl disruption cassette using PEG-mediated transformation, and plated on Vogel's minimal medium containing sorbitol to select for candidates based on uridine prototrophy acquired by the pyr2 marker. Individual transformants were isolated by transfer to Vogel's minimal medium. PCR analysis was used to identify transformants in which the sebl disruption cassette integrated at the sebl locus by homologous recombination. Homologous integration of the Asebl disruption cassette at the sebl locus was verified by amplifying DNA fragments of the expected sizes using two primer pairs. Primer pair RPG297 and RPG253 amplified a DNA fragment starting outside the 5 ' end of the disruption cassette region and ending within the 3 ' region. Primer pair RPG296 and RPG273 amplified a DNA fragment starting within the 5 ' region of the disruption cassette and ending outside the 3 ' end of the disruption cassette region. Consistent with disruption, a third primer pair, RPG133 and RPG220, amplified a 1.6 Kb DNA fragment spanning the insertion site using template DNA from the untransformed parental strain but failed to amplify this fragment using template DNA from the sebl disruption strain. The generated strain with confirmed homologous integration of the sebl disruption cassette was named TrGA#32 Asebl.
D. Growth of TrGA#32 Asebl in submerged culture
[0146] Strains TrGA#32 and TrGA#32 Asebl were grown under identical conditions in submerged (liquid) culture as described in Example 2, and their growth phenotypes were compared. As shown in Table 3, deletion of the sebl gene from the TrGA#32 strain resulted in a strain having a further reduction in viscosity (based on the rpm required to maintain a preselected level of dissolved oxygen), indicating that disruption of the sebl gene and disruption of the sft>3 gene have an additive effect with respect to morphology and viscosity reduction. Protein production was not affected by the sebl deletion (not shown).
Table 3. Growth characteristics of TrGA #32 and TrGA #32 Asebl in liquid medium.
Figure imgf000042_0001
Table 4. Primers used in Example 3.
Figure imgf000043_0001
Example 4. Viscosity reduction in mutants having disrupted sebl and mpgl genes A. Morph strain TrGA 77B7
[0147] The Morph strain, described above, was previously transformed with a native
Trichoderma glucoamylase gene (TrGA) under control of the CBH1 promoter, using amds as a marker. A transformant containing two tandom copies of glucoamylase (TrGA 29-9) was subsequently isolated, and random chemical mutagenesis was used to produce a mutant (77B7). A spontaneous pyr2 mutant derivative was subsequently isolated by 5-fluoro-orotic acid (FOA) selection.
B. Generation of an mpgl disruption cassette
[0148] The Trichoderma reesei mpgl (j gi ITrire21122551) protein sequence is shown below (SEQ ID NO: 29):
MKGLILVGGFGTRLRPLTLTLPKPLVEFCNKPMIVHQIEALVAAGVTDIVLAVNYRPEIMEKFL AEYEEKYNINIEFSVESEPLDTAGPLKLAERILGKDDSPFFVLNSDVICDYPFKELLEFHKAHG DEGTI VTKVEEPSKYGVVVHKPNHPSRIDRFVEKPVEFVGNRINAGMYIFNPSVLKRIELRPT SIEKETFPAMVADNQLHSFDLEGFWMDVGQPKDFLSGTCLYLSSLTKKGSKELTPPTEPYVHGG NVMIHPSAKIGKNCRIGPNVTIGPDVVVGDGVRLQRCVLLKGSKVKDHAWVKSTIVGWNSTVGR WARLENVTVLGDDVTIGDEIYVNGGSVLPHKSIKANVDVPAIIM*
[0149] The mpgl disruption cassette plasmid pRATT249 (Figure 7) was prepared using standard molecular biology procedures. This plasmid included a DNA sequence having a 2.5 Kb region homologous to the DNA sequence spanning part of the 5 ' untranslated region and contiguous upstream sequences (Left Flank). Also included within the plasmid was a DNA sequence having a 3.3 Kb region homologous to the DNA sequence spanning part of the fourth exon of the mpgl gene and contiguous downstream sequences (Right Flank). These sequences were designed to target the mpgl gene and replace the regions of the genome between the Left and Right Flanks with the intervening cassette sequences. These intervening sequences included a pyr2 selection marker from Trichoderma atroviride intended to minimize homology to the endogenous T. reesei pyr2 in the genome of the strain to be transformed. Immediately upstream of the pyr2 selection marker was a directly repeated duplication of the 3 'end of the marker, which facilitated the subsequent loss of the marker and isolation of useful pyr2 mutant derivatives of the transformants/disruptants. This full mpgl disruption cassette was amplified by PCR using primers RPG388 and RPG391. Multiple PCR reactions were pooled and cleaned using standard molecular biology procedures for use in the subsequent steps.
C. Generation of strain Morph 77B7 Ampgl
[0150] Strain Morph TrGA 77B7 was transformed with the mpgl disruption cassette using PEG-mediated transformation, and plated on Vogel's minimal medium containing sorbitol to select for candidates based on uridine prototrophy acquired by the pyr2 marker. Individual transformants were isolated and propagated by transfer to Vogel's minimal medium. PCR analysis was used to identify transformants in which the mpgl disruption cassette integrated at the mpgl locus by homologous recombination. Homologous integration of the Ampgl disruption cassette at the mpgl locus was verified by amplifying DNA fragments of the expected sizes using two primer pairs. Primer pair RPG394 and RPG253 amplified a DNA fragment starting outside the 5' end of the disruption cassette region and ending within the 3' region. Primer pair RPG395 and RPG273 amplified a DNA fragment starting within the 5 ' region of the disruption cassette and ending outside the 3 ' end of the disruption cassette region. The generated strain with confirmed homologous integration of the mpg 1 disruption cassette was named TrGA 77B7 Ampgl
D. Deletion of sebl from TrGA 77B7 and TrGA 77B7 Ampgl
[0151] Deletion of sebl from TrGA 77B7 Ampgl was performed as described in Example 3, thereby generating strain TrGA 77B7 Ampgl Asebl.
E. Growth of TrGA 77B7 Asebl and TrGA 77B7 Ampgl Asebl in submerged culture
[0152] Strains Morph TrGA 77B7 Ampgl, and TrGA 77B7 Ampgl Asebl were grown under identical conditions in submerged (liquid) culture as described in Example 2 and their growth phenotypes were compared. As shown in Table 5, deletion of the sebl gene from the Morph TrGA Ampgl strain resulted in a further reduction in viscosity, even though TrGA 77B7 Ampgl Asebl was at a higher cell mass, indicating that disruption of the mpgl and sebl genes have an additive effect with respect to morphology and viscosity reduction. Protein production of TrGA 77B7 Ampgl Asebl was at least 85% or higher of that of Morph TrGA 77B7 and Morph TrGA Ampgl. Table 5. Broth viscosity in TrGA 77B7 Δ mpgl, and TrGA 77B7 Ampgl Asebl
Figure imgf000045_0001
Table 6. Primers used in Example 4.
Figure imgf000045_0002
Example 5. Additive viscosity reduction in mutants having disrupted at least one of gasl, crzl and tps2 genes in conjunction with disrupted mpgl, sebl, and/or sbfl
A. Viscosity reduction in disrupted gasl
[0153] The Gel/Gas/Phr family of fungal P(l,3)-glucanosyltransferases plays an important role in cell wall biogenesis by processing the main component P(l,3)-glucan (Popolo et al., 2008). gasl (PID 22914) encodes a beta-l,3-glucanosyltransferase that is a GPI (and/or glucan)- anchored protein capable of breaking and joining beta-l,3-glucans. There are multiple paralogs in many fungal genomes including T. reesei, which has five. Separate studies have shown that mutation of the gasl gene (or the gell gene as it is known in Aspergillus fumigatus) affects fungal cell wall structure, and can lead to morphological changes as well as hypersensitivity to Calcofluor White, Congo Red and sodium dodecyl sulfate (Schirawski, J. et al. 2005, Mouyna, I. et al. 2005).
[0154] A Trichoderma reesei Morph strain was deleted for four major cellulase genes, including cbhl, cbhll, egll, and eglV, which makes it particular suitable for expressing other proteins in the absence of or in reduced cellulase background. See, WO 05/001036. The Morph strain had been previously transformed with a native Trichoderma glucoamylase gene (TrGA) under control of the CBH1 promoter, using amdS as a marker. A transformant containing two tandom copies of glucoamylase (TrGA 29-9) was subsequently isolated, and random chemical mutagenesis was used to produce a mutant (77B7). A spontaneous pyr2 mutant derivative was subsequently isolated by 5-fluoro-orotic acid (FOA) selection. The Trichoderma reesei gasl (PID 22914) was deleted from mutant Morph 77B7.
[0155] Strain Morph TrGA 77B7 Apyr2 was transformed with a gasl disruption cassette using PEG-mediated transformation, and plated on Vogel's minimal medium containing sorbitol to select for candidates based on uridine prototrophy acquired by the pyr2 marker. As shown in Table 8, Morph 77B7 Agasl has a reduction in broth viscosity compared to the parent Morph 77B7. At the end of the batch growth phase, when all the glucose has been consumed, both strains had achieved a similar biomass concentration. To arrive at the end of the batch growth phase, the Morph 77B7 control strain saw agitation increased to 616 rpm and then saw DO content level drop down to as low as 40%. The strain Morph 77B7 Agasl did not require as much energy (i.e., rpm increase in agitation) to achieve the same biomass concentration.
Agitation rate never increased above 500 rpm and the % DO never dropped below 115. Protein production was not adversely affected in Morph 77B7 Agasl compared to Morph 77B7 (data not shown). Details of the gasl disruption can be found in U.S. Provisional Application No.
61,480,602, filed April 29, 2011, incorporated by reference herein in its entirety.
Table 8. Broth viscosity of Morph 77B7 compared to Morph 77b7 Agasl
Figure imgf000046_0001
B. Viscosity reduction in disrupted crzl
[0156] In fungi, calcineurin mediated Ca2+ signaling has been shown to be required for growth, development, and virulence in many organisms. It is necessary for adaption to diverse environmental conditions including high cation levels and alkaline pH. The gene crzl encodes a calcineurin-regulated transcription factor. The Crzlp transcription factor is dephosphorylated when the phosphatase calcineurin is activated by Ca2+/calmodulin. It then enters the nucleus and induces expression of a number of genes, many of which encode proteins with cell wall- related functions (Yoshimoto et al., 2002; Lagorce et al., 2003; Garcia et al., 2004; Karababa et al., 2006; Pardini et al., 2006, Munro, C. et al. 2009). Deletion of crzl or a homolog can result in alterations in hyphal morphology (Kothe, G. and Free, S. 1998, Prokisch, H. et al. 1997).
[0157] A Trichoderma reesei Morph strain was prepared as described above. The Trichoderma reesei crzl (PID 36391) was deleted from mutant Morph 77B7. Strain Morph TrGA 77B7 Apyr2 was transformed with the crzl disruption cassette using PEG-mediated transformation, and plated on Vogel's minimal medium containing sorbitol to select for candidates based on uridine prototrophy acquired by the pyr2 marker. As shown in Table 9, Morph 77B7 Acrzl has a reduction in broth viscosity compared to the parent Morph 77B7. At the end of the batch growth phase, when all the glucose has been consumed, both strains had achieved a similar biomass concentration. To arrive at the end of the batch growth phase, the Morph 77B7 control strain saw agitation increased to 616 rpm and then saw DO content level drop down to as low as 40%. The strain Morph 77B7 Acrzl did not require as much energy to achieve the same biomass concentration. Agitation rate never increased above 500 rpm and the % DO never dropped below 100. Details of the crzl disruption can be found in U.S. Provisional Application No. 61,480,610, filed April 29, 2011, incorporated by reference herein in its entirety.
Table 9. Broth viscosity of Morph 77B7 compared to Morph 77b7 Acrzl
Figure imgf000047_0001
C. Viscosity reduction in disrupted tpsl
[0158] The gene tps2 encodes a trehalose-phosphate phosphatase involved in the synthesis of the disaccharide trehalose. Trehalose is a stress induced sugar that buffers the refolding of denatured proteins in the cytoplasm and ER (Singer, M et al. 1998, Simola, M et al. 2000). This disaccharide is produced in large quantities by diverse organisms in response to a variety of stresses. In yeast, trehalose stabilizes proteins at high temperatures and assists in refolding heat damaged proteins (Simola, M et al. 2000).
[0159] A Trichoderma reesei Morph strain was prepared as described above. The Trichoderma reesei tps2 (PID 48707) was deleted from mutant Morph 77B7. Strain Morph TrGA 77B7 Apyr2 was transformed with the tps2 disruption cassette using PEG-mediated transformation, and plated on Vogel's minimal medium containing sorbitol to select for candidates based on uridine prototrophy acquired by the pyr2 marker. As shown in Table 10, Morph 77B7 Atps2 has a reduction in broth viscosity compared to the parent Morph 77B7. At the end of the batch growth phase, when all the glucose had been consumed, both strains had achieved a similar biomass concentration. To arrive at the end of the batch growth phase, the Morph 77B7 control strain saw agitation increased to 616 rpm and then saw DO content level drop down to as low as 40%. The strain Morph 77B7 Atps2 did not require as much energy to achieve the same biomass concentration. Agitation rate never increased above 500 rpm and the % DO never dropped below 110. Details of the tpsl disruption can be found in U.S. Provisional Application No. 61,480,629, filed April 29, 2011, incorporated by reference herein in its entirety.
Table 10. Broth viscosity of Morph 77B7 compared to Morph 77b7 Atps2
Figure imgf000048_0001
[0160] Although the foregoing compositions and methods have been described in some detail by way of illustration and examples for purposes of clarity of understanding, it will be apparent to those skilled in the art that certain changes and modifications can be made. Therefore, the description should not be construed as limiting the scope of the invention, which is delineated by the appended claims.
[0161] All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entireties for all purposes and to the same extent as if each individual publication, patent, or patent application were specifically and individually indicated to be so incorporated by reference.
REFERENCES
[0162] The following references, and additional reference cited herein, are hereby incorporated by reference:
Caracuel, Z. et al. (2005) Molecular Plant-Microbe Interactions 18: 1140-47.
Hajdukiewiez, P. et al. (1994) Plant Molecular Biology 25:989-94.
Hood, E.E. et al. (1993) Trangenic Research 2:208-18.
Hughes, H. and Stephens, D.J. (2008) Cell Biol. 129: 129-51.
Karhinen, L. et al. (2005) Traffic 6:562-74.
Mouyna, I. et al. (2005) Molecular Microbiology 56: 1675-88.
Passolunghi, S. et al. (2010) Microbial Cell Factories 9:7-17.
Peng, R. et al. (2000) /. Biol. Chem. 275: 11521-28.
Peterbauer, C. et al. (2002) Molecular Genetics and Genomics 268:223-31.
Popolo,L et al. (2008) /. Biol. Chem. 283: 18553-18565
Roberg, KJ. et al. (1999) /. Cell. Biol. 145:659-72.
Schirawski, J. et al. (2005) Plant Cell 17: 3532-3543.
Shimoni, Y. et al. (2000) /. Cell. Biol. 151 :973-84. Turchini, A. et al. (2000) /. Bacteriol. 182: 1167-71.
Yoshimoto et al. (2002) /. Biol Chem. 227:31079-31088. Lagorce et al. (2003) /. Biol. Chem. 278:20345-20357.
Garcia et al. (2004) /. Bio. Chem. 279: 15183-15195.
Karababa et al. (2006) Mol. Microbiol. 59: 1429- 1451.
Pardini et al. (2006) /. Biol. Chem. 281 :40399-40411.
Munro, C. et al. (2009) Mol. Microbiol. 63: 1399-1413.
Kothe, G. and Free, S. (1998) Fungal Genet. Biol 23:248-258. Prokisch, H., et al. (1997) Gen. Genet. 256: 104-114.
Simola, M et al. (2000) Mol. Microbiol. 37:42-53.
Singer , M. and Lindquist S. (1998) Mol. Cell. 5:639-48.

Claims

What is claimed is:
5 1. A variant strain of filamentous fungus derived from a parental strain, the variant strain comprising a genetic alteration that causes cells of the variant strain to produce an altered amount of functional Sebl protein compared to cells of the parental strain, wherein the cells of the variant strain produce during aerobic fermentation in submerged culture a cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content compared to the l o cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
2. The variant strain of claim 1, wherein the altered amount of functional Sebl protein is a reduced amount, and the variant strain produces during aerobic fermentation in submerged culture a
15 cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
3. The variant strain of claims 1 or 2, wherein the genetic alteration comprises a disruption 20 of the sebl gene present in the parental strain.
4. The variant strain of claim 3, wherein disruption of the sebl gene is the result of deletion of all or part of the sebl gene.
25 5. The variant strain of claim 3, wherein disruption of the sebl gene is the result of deletion of a portion of genomic DNA comprising the sebl gene.
6. The variant strain of claim 3, wherein disruption of the sebl gene is the result of mutagenesis of the sebl gene.
30
7. The variant strain of any of claims 3-6, wherein disruption of the sebl gene is performed using site-specific recombination.
8. The variant strain of any of claims 3-7, wherein disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
9. The variant strain of any of claims 1-8, wherein the variant strain does not produce functional Sebl protein.
10. The variant strain of any of claims 1-8, wherein the variant strain does not produce Sebl protein.
11. The variant strain of any of claims 1-10, wherein the variant strain further comprises a gene encoding a protein of interest.
12. The variant strain of any of claims 1-11, further comprising a disruption of the sft>3 gene.
13. The variant strain of any of claims 1-12, further comprising a disruption of at least one gene selected from the group consisting of the sft>3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
14. The variant strain of any of claims 1-13, wherein the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
15. The variant strain of any of claims 1-14, wherein the filamentous fungus is a
Pezizomycotina species.
16. The variant strain of any of claims 1-15, wherein the filamentous fungus is a
Trichoderma spp.
17. The variant strain of any of claims 1-16, wherein the filamentous fungus is
Trichoderma reesei.
18. A method for producing a variant strain of filamentous fungus cells comprising:
introducing a genetic alteration into a parental strain of filamentous fungal cell, which genetic alteration alters the production of functional Sebl protein compared to the cells of the parental strain, thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires an altered amount of agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an altered dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
19. The method of claim 18, wherein the genetic alteration reduces or prevents the production of functional Sebl protein, thereby producing a variant filamentous fungal cell that produces during aerobic fermentation in submerged culture a cell broth that (i) requires reduced agitation to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintains an increased dissolved oxygen content at a preselected amount of agitation, compared to the cells of the parental strain.
20. The method of claim 18 or 19, wherein the genetic alteration comprises disrupting the sebl gene in a parental filamentous fungal cell using genetic manipulation.
21. The method of any of claims 18-20, wherein the genetic alteration comprises deleting the sebl gene in a parental filamentous fungal cell using genetic manipulation.
22. The method of any of claims 18-21, wherein the genetic alteration is performed using site-specific genetic recombination.
23. The method of any of claims 18-22, wherein disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
24. The method of any of claims 18-23, wherein disruption of the sebl gene is performed in combination with disrupting the sft>3 gene.
25. The method of any of claims 18-24, wherein disruption of the sebl gene is performed in combination with disruption of at least one gene selected from the group consisting of the sft> 3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
26. The method of any of claims 18-25, wherein the variant strain produces substantially the same amount of, or more, protein per unit amount of biomass as the parental strain.
27. The method of any of claims 18-26, wherein the filamentous fungus is a
Pezizomycotina species.
28. The method of any of claims 18-27, wherein the filamentous fungus is a Trichoderma spp.
29. The method of any of claims 18-28, wherein the filamentous fungus is Trichoderma reesei.
30. The method of any of claims 18-29, wherein the parental strain further comprises a gene encoding a protein of interest.
31. The method of claim 30, wherein the gene encoding the protein of interest is present in the parental strain prior to introducing the genetic alteration that reduces or prevents the production of functional Sebl protein.
32. A protein of interest produced by the variant strain of claim 11.
33. A variant strain of filamentous fungus produced by the method of any of claims 18-31.
34. A variant strain of filamentous fungus derived from a parental strain, the variant strain comprising:
(a) a genetic alteration that results in (i) a requirement for reduced agitation in submerged culture to maintain a preselected dissolved oxygen content, compared to the cells of the parental strain, and/or (ii) maintenance of an increased dissolved oxygen content in submerged culture at a preselected amount of agitation, compared to the cells of the parental strain, and
(b) a gene encoding a protein of interest,
wherein the gene encoding the protein of interest is present in the variant strain prior to the genetic alteration in (a).
35. The variant strain of claim 34, wherein the genetic alteration comprises a disruption of the sebl gene present in the parental strain.
36. The variant strain of claim 35, wherein disruption of the sebl gene is performed in combination with introducing a selectable marker at the genetic locus of the sebl gene.
37. The variant strain of claim 35 or 36, wherein disruption of the sebl gene is performed in combination with disrupting at least one gene selected from the group consisting of the sft> 3 gene, the mpgl gene, the gasl gene, the crzl gene, and the tps2 gene.
38. The variant strain of any of claims 35-37, wherein disruption of the sebl gene is performed in combination with disrupting the mpgl gene.
PCT/US2012/034403 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype WO2012145595A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
KR1020137030769A KR101952470B1 (en) 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype
EP12717559.4A EP2663633B1 (en) 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype
BR112013025203A BR112013025203A2 (en) 2011-04-22 2012-04-20 "Variant strains of filamentous bottoms having genetic modification for increased seb1 protein production and altered growth and their production method."
CN201280019678.3A CN103502431B (en) 2011-04-22 2012-04-20 There is the filamentous fungi of viscosity-modifying phenotype
DK12717559.4T DK2663633T3 (en) 2011-04-22 2012-04-20 FILAMENTOUS FUNGI WITH CHANGED VISCOSITY PHENOTYPE
CA2833541A CA2833541C (en) 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype
US14/112,879 US9725727B2 (en) 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype
AU2012245322A AU2012245322A1 (en) 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype
JP2014506565A JP6042868B2 (en) 2011-04-22 2012-04-20 Filamentous fungi with altered viscosity phenotype
AU2017202753A AU2017202753A1 (en) 2011-04-22 2017-04-26 Filamentous fungi having an altered viscosity phenotype

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201161478160P 2011-04-22 2011-04-22
US201161478162P 2011-04-22 2011-04-22
US61/478,162 2011-04-22
US61/478,160 2011-04-22

Publications (1)

Publication Number Publication Date
WO2012145595A1 true WO2012145595A1 (en) 2012-10-26

Family

ID=46018123

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2012/034403 WO2012145595A1 (en) 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype
PCT/US2012/034379 WO2012145584A1 (en) 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/US2012/034379 WO2012145584A1 (en) 2011-04-22 2012-04-20 Filamentous fungi having an altered viscosity phenotype

Country Status (11)

Country Link
US (2) US9725726B2 (en)
EP (3) EP2699588B1 (en)
JP (2) JP6042868B2 (en)
KR (2) KR101993939B1 (en)
CN (2) CN103502431B (en)
AR (2) AR086201A1 (en)
AU (3) AU2012245402B2 (en)
BR (2) BR112013025203A2 (en)
CA (2) CA2833541C (en)
DK (3) DK3000870T3 (en)
WO (2) WO2012145595A1 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017025586A1 (en) * 2015-08-13 2017-02-16 Glykos Finland Oy Regulatory protein deficient trichoderma cells and methods of use thereof
US9593341B2 (en) 2011-04-22 2017-03-14 Danisco Us Inc. Filamentous fungi having an altered viscosity phenotype
WO2019209576A1 (en) 2018-04-24 2019-10-31 Danisco Us Inc Filamentous fungal strains comprising reduced viscosity phenotypes
WO2020028126A1 (en) 2018-07-30 2020-02-06 Danisco Us Inc Mutant and genetically modified filamentous fungal strains comprising enhanced protein productivity phenotypes and methods thereof
WO2021092356A1 (en) 2019-11-08 2021-05-14 Danisco Us Inc Fungal strains comprising enhanced protein productivity phenotypes and methods thereof
US11976266B2 (en) 2019-04-16 2024-05-07 Danisco Us Inc. Filamentous fungal strains comprising reduced viscosity phenotypes

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AR086201A1 (en) * 2011-04-22 2013-11-27 Danisco Us Inc FILAMENTOUS FUNGES THAT HAVE AN ALTERED VISCOSITY PHENOTYPE
BR112021001743A2 (en) 2018-07-30 2021-04-27 Toray Industries, Inc. mutant strains of a filamentous fungus of the trichoderma genus and methods for the production of a protein and for the production of a cellulase
FR3104169B1 (en) * 2019-12-04 2022-10-21 Ifp Energies Now MUSHROOM STRAIN WITH A REDUCED VISCOSITY
CN113881586B (en) * 2021-09-27 2023-03-10 四川大学 High-temperature-resistant, high-sugar-resistant and high-salt-resistant saccharomyces cerevisiae strain as well as construction method and application thereof

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001009352A2 (en) * 1999-07-30 2001-02-08 Nederlandse Organisatie Voor Toegepast-Natuurwetenschappelijk Onderzoek (Tno) Use of aspergillus sojae as host for recombinant protein production
WO2002079399A2 (en) * 2001-03-14 2002-10-10 Genencor International, Inc. Regulatable growth of filamentous fungi
US20040224388A1 (en) * 1999-03-24 2004-11-11 Nigel Dunn-Coleman Hyphal growth in fungi
WO2005001036A2 (en) 2003-05-29 2005-01-06 Genencor International, Inc. Novel trichoderma genes
WO2012027580A1 (en) 2010-08-25 2012-03-01 Danisco Us Inc. Filamentous fungi having an altered viscosity phenotype

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FI972909A0 (en) * 1997-07-09 1997-07-09 Valtion Teknillinen Oekad Produktion av avsoendrade proteiner genom recombinatjaestceller
US7906309B2 (en) 1998-10-06 2011-03-15 Dyadic International (Usa), Inc. Expression-regulating sequences and expression products in the field of filamentous fungi
WO2002097060A2 (en) * 2001-05-25 2002-12-05 Incyte Genomics Inc. Carbohydrate-associated proteins
US6902921B2 (en) * 2001-10-30 2005-06-07 454 Corporation Sulfurylase-luciferase fusion proteins and thermostable sulfurylase
CA2699413C (en) 2007-09-11 2013-09-10 Mark Banks Insulated pallet shipper and methods of making and using the same
CN101960006B (en) * 2008-03-07 2015-03-11 丹尼斯科美国公司 Expression of catalase in trichoderma
BR112013026559A2 (en) * 2011-04-22 2016-11-29 Danisco Us Inc "Variant strains of filamentous bottoms having genetic modification for increased gas1 protein production and altered growth and their production method."
AR086201A1 (en) * 2011-04-22 2013-11-27 Danisco Us Inc FILAMENTOUS FUNGES THAT HAVE AN ALTERED VISCOSITY PHENOTYPE

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040224388A1 (en) * 1999-03-24 2004-11-11 Nigel Dunn-Coleman Hyphal growth in fungi
WO2001009352A2 (en) * 1999-07-30 2001-02-08 Nederlandse Organisatie Voor Toegepast-Natuurwetenschappelijk Onderzoek (Tno) Use of aspergillus sojae as host for recombinant protein production
WO2002079399A2 (en) * 2001-03-14 2002-10-10 Genencor International, Inc. Regulatable growth of filamentous fungi
WO2005001036A2 (en) 2003-05-29 2005-01-06 Genencor International, Inc. Novel trichoderma genes
WO2012027580A1 (en) 2010-08-25 2012-03-01 Danisco Us Inc. Filamentous fungi having an altered viscosity phenotype

Non-Patent Citations (52)

* Cited by examiner, † Cited by third party
Title
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., METH. ENZYMOL., vol. 266, 1996, pages 460 - 80
BORGIA P T ET AL: "THE ORLA GENE FROM ASPERGILLUS NIDULANS ENCODES A TREHALOSE-6- PHOSPHATE PHOSPHATASE NECESSARY FOR NORMAL GROWTH AND CHITIN SYNTHESIS AT ELEVATED TEMPERATURES", MOLECULAR MICROBIOLOGY, vol. 20, no. 6, 1 June 1996 (1996-06-01), WILEY-BLACKWELL PUBLISHING LTD, GB, pages 1287 - 1296, XP002060302, ISSN: 0950-382X, DOI: 10.1111/J.1365-2958.1996.TB02647.X *
BURLINGAME RP, VERDOES JC: "Maximizing Protein Expression in Filamentous Fungi", 1 May 2006 (2006-05-01), XP002680849, Retrieved from the Internet <URL:http://license.icopyright.net/user/viewFreeUse.act?fuid=MTY0ODk0ODU%3D> [retrieved on 20120730] *
CARACUEL, Z. ET AL., MOLECULAR PLANT-MICROBE INTERACTIONS, vol. 18, 2005, pages 1140 - 47
DAI ZIYU ET AL: "Identification of genes associated with morphology in Aspergillus niger by using suppression subtractive hybridization", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 70, no. 4, 1 April 2004 (2004-04-01), AMERICAN SOCIETY FOR MICROBIOLOGY, US, pages 2474 - 2485, XP002428202, ISSN: 0099-2240, DOI: 10.1128/AEM.70.4.2474-2485.2004 *
DEVEREUX ET AL., NUCLEIC ACIDS RES., vol. 12, 1984, pages 387 - 95
FENG; DOOLITTLE, J. MOL. EVOL., vol. 35, 1987, pages 351 - 60
GARCIA ET AL., J. BIO. CHEM., vol. 279, 2004, pages 15183 - 15195
HAJDUKIEWIEZ, P. ET AL., PLANT MOLECULAR BIOLOGY, vol. 25, 1994, pages 989 - 94
HENIKOFF ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915
HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915
HIGGINS ET AL., GENE, vol. 73, 1988, pages 237 - 244
HIGGINS; SHARP, CABIOS, vol. 5, 1989, pages 151 - 53
HOOD, E.E. ET AL., TRANGENIC RESEARCH, vol. 2, 1993, pages 208 - 18
HUGHES, H.; STEPHENS, D.J., CELL BIOL., vol. 129, 2008, pages 129 - 51
I. V. GRIGORIEV; H. NORDBERG; I. SHABALOV; A. AERTS; M. CANTOR; D. GOODSTEIN; A. KUO; S. MINOVITSKY; R. NIKITIN; R. A. OHM: "The Genome Portal of the Department of Energy Joint Genome Institute", NUCLEIC ACIDS RES, vol. 0, 2011, pages GKR947VL - GKR947
KARABABA ET AL., MOL. MICROBIOL., vol. 59, 2006, pages 1429 - 1451
KARHINEN, L. ET AL., TRAFFIC, vol. 6, 2005, pages 562 - 74
KARIN ET AL., PROC. NATL. ACAD. SCI USA, vol. 90, 1993, pages 5873
KARLIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 87
KOTHE, G.; FREE, S., FUNGAL GENET. BIOL, vol. 23, 1998, pages 248 - 258
KRUSZEWSKA ET AL., CUR. GENET., vol. 33, 1998, pages 445 - 50
LAGORCE ET AL., J. BIOL.CHEM., vol. 278, 2003, pages 20345 - 20357
MOUYNA, I. ET AL., MOLECULAR MICROBIOLOGY, vol. 56, 2005, pages 1675 - 88
MUNRO, C. ET AL., MOL. MICROBIOL., vol. 63, 2009, pages 1399 - 1413
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
PAPAGIANNI M: "Fungal morphology and metabolite production in submerged mycelial processes", BIOTECHNOLOGY ADVANCES, vol. 22, no. 3, 1 January 2004 (2004-01-01), ELSEVIER PUBLISHING, BARKING, GB, pages 189 - 259, XP004479966, ISSN: 0734-9750, DOI: 10.1016/J.BIOTECHADV.2003.09.005 *
PARDINI ET AL., J. BIOL. CHEM., vol. 281, 2006, pages 40399 - 40411
PASSOLUNGHI, S. ET AL., MICROBIAL CELL FACTORIES, vol. 9, 2010, pages 7 - 17
PEARSON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 2444 - 48
PEARSON; LIPMAN, PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 2444
PENG, R. ET AL., J. BIOL. CHEM., vol. 275, 2000, pages 11521 - 28
PETERBAUER C K ET AL: "The Trichoderma atroviride seb1 (stress response element binding) gene encodes an AGGGG-binding protein which is involved in the response to high osmolarity stress.", MGG MOLECULAR GENETICS AND GENOMICS, vol. 268, no. 2, October 2002 (2002-10-01), pages 223 - 231, XP002680848, ISSN: 1617-4615 *
PETERBAUER, C. ET AL., MOLECULAR GENETICS AND GENOMICS, vol. 268, 2002, pages 223 - 31
POPOLO,L ET AL., J. BIOL. CHEM., vol. 283, 2008, pages 18553 - 18565
PROKISCH, H. ET AL., GEN. GENET., vol. 256, 1997, pages 104 - 114
R. PENG: "Evidence for Overlapping and Distinct Functions in Protein Transport of Coat Protein Sec24p Family Members", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 275, no. 15, 6 April 2000 (2000-04-06), pages 11521 - 11528, XP055015580, ISSN: 0021-9258, DOI: 10.1074/jbc.275.15.11521 *
ROBERG, K.J. ET AL., J. CELL. BIOL., vol. 145, 1999, pages 659 - 72
SCHIRAWSKI JAN ET AL: "Endoplasmic reticulum glucosidase II is required for pathogenicity of Ustilago maydis.", THE PLANT CELL, vol. 17, no. 12, December 2005 (2005-12-01), pages 3532 - 3543, XP002680850, ISSN: 1040-4651 *
SCHIRAWSKI, J. ET AL., PLANT CELL, vol. 17, 2005, pages 3532 - 3543
SCHUMACHER JULIA ET AL: "Calcineurin-responsive zinc finger transcription factor CRZ1 of Botrytis cinerea is required for growth, development, and full virulence on bean plants", EUKARYOTIC CELL, vol. 7, no. 4, April 2008 (2008-04-01), pages 584 - 601, XP002680851, ISSN: 1535-9778 *
SHIMONI, Y. ET AL., J. CELL. BIOL., vol. 151, 2000, pages 973 - 84
SIMOLA, M ET AL., MOL. MICROBIOL., vol. 37, 2000, pages 42 - 53
SINGER, M.; LINDQUIST S., MOL. CELL, vol. 5, 1998, pages 639 - 48
SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482
TALBOT N ET AL: "Identification and characterization of MPG1, a gene", THE PLANT CELL, vol. 5, no. 11, 1 November 1993 (1993-11-01), AMERICAN SOCIETY OF PLANT BIOLOGISTS, US, pages 1575 - 1590, XP002103524, ISSN: 1040-4651, DOI: 10.1105/TPC.5.11.1575 *
TURCHINI, A. ET AL., J. BACTERIOL., vol. 182, 2000, pages 1167 - 71
VOGEL, MICROBIOL. GENET. BULL., vol. 13, 1956, pages 42 - 43
YOSHIMOTO ET AL., J. BIOL. CHEM., vol. 227, 2002, pages 31079 - 31088
ZAKRZEWSKA ET AL., APPLIED AND ENVIROMNETAL MICROBIOLOGY, vol. 69, 2003, pages 4383 - 89

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9593341B2 (en) 2011-04-22 2017-03-14 Danisco Us Inc. Filamentous fungi having an altered viscosity phenotype
WO2017025586A1 (en) * 2015-08-13 2017-02-16 Glykos Finland Oy Regulatory protein deficient trichoderma cells and methods of use thereof
WO2019209576A1 (en) 2018-04-24 2019-10-31 Danisco Us Inc Filamentous fungal strains comprising reduced viscosity phenotypes
WO2020028126A1 (en) 2018-07-30 2020-02-06 Danisco Us Inc Mutant and genetically modified filamentous fungal strains comprising enhanced protein productivity phenotypes and methods thereof
US11976266B2 (en) 2019-04-16 2024-05-07 Danisco Us Inc. Filamentous fungal strains comprising reduced viscosity phenotypes
WO2021092356A1 (en) 2019-11-08 2021-05-14 Danisco Us Inc Fungal strains comprising enhanced protein productivity phenotypes and methods thereof

Also Published As

Publication number Publication date
AU2012245402A1 (en) 2013-08-22
EP3000870B1 (en) 2018-01-24
US9725727B2 (en) 2017-08-08
CA2833660C (en) 2020-08-04
KR20140033048A (en) 2014-03-17
CA2833541A1 (en) 2012-10-26
JP2014513531A (en) 2014-06-05
US20140094587A1 (en) 2014-04-03
EP2663633B1 (en) 2016-02-24
KR101952470B1 (en) 2019-02-26
JP6042866B2 (en) 2016-12-14
CN103517916A (en) 2014-01-15
US9725726B2 (en) 2017-08-08
AR086200A1 (en) 2013-11-27
CN103502431A (en) 2014-01-08
CA2833541C (en) 2021-04-27
CN103502431B (en) 2016-07-06
AU2012245322A1 (en) 2013-08-22
AR086201A1 (en) 2013-11-27
DK2699588T3 (en) 2017-03-13
KR20140033053A (en) 2014-03-17
CN103517916B (en) 2017-05-10
DK3000870T3 (en) 2018-04-30
EP2663633A1 (en) 2013-11-20
US20140099721A1 (en) 2014-04-10
AU2017202753A1 (en) 2017-05-18
DK2663633T3 (en) 2016-05-23
BR112013025430A2 (en) 2016-11-29
EP2699588A1 (en) 2014-02-26
AU2012245402B2 (en) 2017-09-28
WO2012145584A1 (en) 2012-10-26
BR112013025203A2 (en) 2016-11-29
CA2833660A1 (en) 2012-10-26
JP6042868B2 (en) 2016-12-14
JP2014513529A (en) 2014-06-05
KR101993939B1 (en) 2019-06-27
EP2699588B1 (en) 2016-11-30
EP3000870A1 (en) 2016-03-30

Similar Documents

Publication Publication Date Title
AU2017235968B2 (en) Filamentous fungi having an altered viscosity phenotype
US9725727B2 (en) Filamentous fungi having an altered viscosity phenotype

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12717559

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2012717559

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2012245322

Country of ref document: AU

Date of ref document: 20120420

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014506565

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2833541

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20137030769

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14112879

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013025203

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013025203

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20130930