WO2012145568A1 - Antibodies to human b7x for treatment of metastatic cancer - Google Patents

Antibodies to human b7x for treatment of metastatic cancer Download PDF

Info

Publication number
WO2012145568A1
WO2012145568A1 PCT/US2012/034348 US2012034348W WO2012145568A1 WO 2012145568 A1 WO2012145568 A1 WO 2012145568A1 US 2012034348 W US2012034348 W US 2012034348W WO 2012145568 A1 WO2012145568 A1 WO 2012145568A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
cancer
patient
metastasis
tumor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/034348
Other languages
French (fr)
Inventor
Xingxing Zang
James P. Allison
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Albert Einstein College of Medicine
Memorial Sloan Kettering Cancer Center
Original Assignee
Albert Einstein College of Medicine
Memorial Sloan Kettering Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Albert Einstein College of Medicine, Memorial Sloan Kettering Cancer Center filed Critical Albert Einstein College of Medicine
Publication of WO2012145568A1 publication Critical patent/WO2012145568A1/en
Priority to US14/050,512 priority Critical patent/US9447186B2/en
Anticipated expiration legal-status Critical
Priority to US15/252,267 priority patent/US20170029525A1/en
Priority to US17/004,331 priority patent/US12221489B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/0004Screening or testing of compounds for diagnosis of disorders, assessment of conditions, e.g. renal clearance, gastric emptying, testing for diabetes, allergy, rheuma, pancreas functions
    • A61K49/0008Screening agents using (non-human) animal models or transgenic animal models or chimeric hosts, e.g. Alzheimer disease animal model, transgenic model for heart failure
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3015Breast
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3023Lung
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3038Kidney, bladder
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3046Stomach, Intestines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3053Skin, nerves, brain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5011Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Cancer is a serious public health problem in the U.S. and other countries. More than 90% of cancer patient deaths result from cancer metastasis rather than from a primary cancer. There are about 924,310 new cancer cases and 339, 150 cancer deaths in the U.S. alone. According to Cancer Statistics 2010, in the U.S. in 2010 alone, there are an estimated 222,520 new cases and 157,300 deaths for lung cancer, 217,730 new cases and 32,050 deaths for prostate cancer, 207,090 new cases and 39,840 deaths for breast cancer, 145,500 new cases and 51,370 deaths for gut cancer, 58,240 new cases and 8,210 deaths for kidney cancer, and 51,350 new cases and 36,800 deaths for pancreas cancer. While traditional therapies such as surgery, chemotherapy, and radiation can often control primary cancer growth, successful control of disseminated metastases of cancer remains rare.
  • T cells of the immune system are the major combatants against cancers. T cell activation, proliferation, differentiation to effector function and memory generation are determined by both positive costimulation and negative coinhibition, generated mainly by the interaction between the B7 family and their receptor CD28 family (Fig 1). In 2003, B7x was discovered as a new member of the B7/CD28 family 1 . B7x inhibits T cell function in vitro 1 . B7x is extremely conservative with 87% amino acid identity between human and mice.
  • B7x is over-expressed in human cancers of the lung 4 , ovary 5 , breast 6 ' 7 , kidney 8 , brain 9 , pancreas 10 , esophagus 17 , skin 18 and gut 19 .
  • renal cell carcinoma patients with tumors expressing B7x were three times more likely to die from renal cancer compared to patients lacking B7x 8 .
  • human breast cancer there was a significant association between a high proportion of B7x positive cells in invasive ductal carcinomas and decreased number of tumor infiltrating lymphocytes.
  • the present invention addresses the serious and long-felt need for treatments for metastatic cancer.
  • Methods are provided for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.
  • Methods are also provided for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising determining the level of B7x expression in a tumor sample from the patient, and if B7x is over-expressed in the tumor sample compared to healthy tissue, administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.
  • Figure 1 The B7 family/CD28 family.
  • the members of the B7 and CD28 families have been divided into three groups by phylogenetic analysis: group I includes the pathway of B7-1/B7-2/CD28/CTLA-4, and the pathway of B7h/ICOS ; group II consists of the pathway of PD-L1/PD-L2/PD-1 ; and group III contains B7-H3 and B7x, whose receptors are currently unknown. Modified from Zang et al. 1
  • FIG. 2A-2B Expression of B7x on tumor CT26 (A) or MC38 (B) accelerates disease progression in vivo.
  • FACS analysis with PE-anti-B7x (line) or control PE-Ab (solid) showed that tumor cell lines CT26 and MC38 did not express B7x and that transfectants B7x/CT26 and B7x/MC38 expressed abundant cell surface B7x.
  • Survival curves showed that syngeneic mice iv injected with B7x/CT26 or B7x/MC38 died much faster than mice injected with CT26 or MC38.
  • the log-rank test was used for statistical analyses. P-values ⁇ 0.05 were considered statistically significant.
  • FIG. 4A-4C B7x deficiency protects mice from lung metastasis of cancer.
  • B7x knock-out mice B7x knock-out mice had fewer tumor nodules than Balb/c wildtype (B7x+/+) mice at day 18 (A); all wildtype mice were dead within 36 days whereas 33% of B7x-/- mice were still alive at day 72 (B).
  • B7x-/- mice were still alive at day 140 after rechallenge with 4T1(B), and no tumor was found in lungs from surviving B7x-/- mice with 4T1 double-challenge.
  • Wildtype mice had more regulatory T cells and myeloid-derived suppressor cells in lungs than B7x-/- mice during lung metastasis of cancer (C).
  • FIG. 8 Antibody-dependent cell-mediated cytotoxicity (ADCC) assay showed that three mAbs (1H3, 12D 11, 15D2), but not 37G9, were able to kill tumor cells by ADCC mechanism.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • the present invention provides a method for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.
  • tumor means, in regard to a cancer or tumor, to spread from one organ or tissue of a patient to another non-adjacent organ or tissue of the patient.
  • To "treat" a metastatic cancer means to reduce the number of metastases in an organ or tissue, and/or to kill metastatic tumor cells or tumor cells that are likely to metastasize, and/or to prevent or reduce the spread of cancerous cells from an original site in the body to another site in the body, and/or to inhibit the progression of metastatic cancer, and/or to prevent the reoccurrence of metastasis.
  • administration of the antibody or antibody fragment decreases the number of tumor nodules in the patient.
  • administration of the antibody or antibody fragment increases the patient's survival time.
  • the cancer can be, for example, a cancer of the skin, breast, pancreas, prostate, ovary, kidney, espophagus, gastrointestional tract, colon, brain, liver, lung, head and/or neck.
  • the cancer is lung cancer.
  • the tumor in the patient expresses B7x or overexpresses B7x compared to healthy tissue, for example, in comparison to healthy tissue of the breast, pancreas, prostate, ovary, kidney, gastrointestional tract, colon, brain, liver, lung, head and/or neck.
  • the level of B7x expression in the tumor can be determined, for example, using immunohistocytochemistry on a tissue sample obtained from the tumor (e.g., Zang et a/. 2 ' 3 ).
  • B7x expression can also be determined by measuring expression of B7x mRNA in the tumor sample, for example by Northern blot hybridization (e.g., Allison et al. 16 ).
  • the invention also provides a method for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising determining the level of B7x expression in a tumor sample from the patient, and if B7x is over-expressed in the tumor sample compared to the level of B7x expression in healthy tissue, administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.
  • the method can further comprise obtaining a tumor sample from the patient.
  • antibody refers to complete, intact antibodies.
  • a "fragment” of an antibody refers to a fragment that bind the antigen of interest, B7x.
  • Antibody fragments include, but are not limited to, F(ab')2 and Fab' fragments and single chain antibodies.
  • F(ab')2 is an antigen binding fragment of an antibody molecule with deleted crystallizable fragment (Fc) region and preserved binding region.
  • Fab' is 1/2 of the F(ab')2 molecule possessing only 1/2 of the binding region.
  • Complete, intact antibodies include, but are not limited to, polyclonal antibodies, monoclonal antibodies such as murine monoclonal antibodies, chimeric antibodies, human antibodies, and humanized antibodies.
  • ⁇ antibodies may be produced using standard recombinant DNA techniques.
  • "chimeric" antibodies may be constructed, in which the antigen binding domain from an animal antibody is linked to a human constant domain (an antibody derived initially from a nonhuman mammal in which recombinant DNA technology has been used to replace all or part of the hinge and constant regions of the heavy chain and/or the constant region of the light chain, with corresponding regions from a human immunoglobulin light chain or heavy chain).
  • Chimeric antibodies reduce the immunogenic responses elicited by animal antibodies when used in human clinical treatments.
  • recombinant "humanized" antibodies may be synthesized.
  • Humanized antibodies are antibodies initially derived from a nonhuman mammal in which recombinant DNA technology has been used to substitute some or all of the amino acids not required for antigen binding with amino acids from corresponding regions of a human immunoglobulin light or heavy chain. That is, they are chimeras comprising mostly human immunoglobulin sequences into which the regions responsible for specific antigen-binding have been inserted.
  • human IgG Fc can be used to replace the mouse Fc part of a monoclonal antibody.
  • the antibody can be, e.g., any of an IgA, IgD, IgE, IgG, or IgM antibody.
  • the IgA antibody can be, e.g., an IgAl or an IgA2 antibody.
  • the IgG antibody can be, e.g., an IgGl, IgG2, IgG2a, IgG2b, IgG3 or IgG4 antibody.
  • a combination of any of these antibodies subtypes can also be used.
  • One consideration in selecting the type of antibody to be used is the desired serum half-life of the antibody. IgG has a serum half-life of 23 days, IgA 6 days, IgM 5 days, IgD 3 days, and IgE 2 days 15 .
  • Another consideration is the size of the antibody. For example, the size of IgG is smaller than that of IgM allowing for greater penetration of IgG into tumors.
  • Preferred antibodies include IgGl monclonal antibodies.
  • the antibodies and antibody fragments of the present invention are designed by humans and made outside of the human body.
  • the antibodies and antibody fragments are specific for B7x, but not for other B7 family members (i.e., B7-1, B7-2, B7h, PD-L1, PD- L2, and B7-H3).
  • Preferred antibodies include monoclonal antibodies 1H3 and 12D1 1.
  • Preferred antibodies include monoclonal antibodies having a light and/or heavy chain the same as the light and/or heavy chain of 1H3 or 12D1 1.
  • the heavy and/or light chains can contain conservative amino acid sequence modifications that do not significantly affect the binding characteristics of the antibody.
  • Preferred antibodies include monoclonal antibodies that bind to the same epitope on B7x as 1H3 or 12D11.
  • Prefered antibodies include monoclonal antibodies that block the interaction between B7x and its receptor.
  • Prefered antibodies include antibodies that kill tumor cells through antibody-dependent cell-mediated cytotoxicity.
  • the antibody or antibody fragment blocks inhibition of T cell function by B7x.
  • the antibody or antibody fragment blocks interaction between cancer-expressed B7x and activiated T cells.
  • the antibody or antibody fragment binds cancer-expressed B7x and kill cancer cells.
  • the antibodies and antibody fragments used for therapy in the present invention do not include antibody -partner molecule conjugates, where the partner can be, for example, one or more of a drug, toxin, radioisotope, therapeutic agent, or marker agent.
  • the antibodies and antibody fragments of the present inventon are therapeutically effective without the need for another therapeutic agent conjugated to the antibody or fragment.
  • Antibodies and antibody fragments that are used for determining the expression of B7x expression in a tumor sample from a patient can be conjugated to a marker, such as, for example, a fluorescent marker or a radioisotope marker.
  • the antibody or antibody fragment is the sole therapeutic anti-cancer agent administered to the patient.
  • the antibody or antibody fragment can be administered in combination with another anti-cancer agent that is not bound to the antibody or antibody fragment.
  • Anti-cancer agents include, but are not limited to, an antibody against CTLA-4 (YERVOY®); an antibody against PD-1 (MDX- 1 106); an anti-epidermal growth factor receptor (EGFR) agent such as, e.g., panitumumab, the anti-EGFR antibody cetuximab (Erbitux®), and the EGFR tyrosine kinase (TK) inhibitors gefitinib (Iressa®) and erlotinib (Tarceva®); an alkylating agent such as, e.g., cisplatin, carboplatin, oxaliplatin, nedaplatin, satraplatin, triplatin tetranitrate, mechlorethamine,
  • the antibody or antibody fragment can be screened for efficacy using, e.g., procedures set forth herein in Experimental Details.
  • the antibody or antibody fragment can be administered to the subject in a pharmaceutical composition comprising a pharmaceutically acceptable carrier.
  • acceptable pharmaceutical carriers include, but are not limited to, additive solution-3 (AS- 3), saline, phosphate buffered saline, Ringer's solution, lactated Ringer's solution, Locke- Ringer's solution, Krebs Ringer's solution, Hartmann's balanced saline solution, and heparinized sodium citrate acid dextrose solution.
  • the pharmaceutical composition can be formulated for administration by any method known in the art, including but not limited to, direct administration to a tumor, parenteral administration, intravenous administration, and intramuscular administration.
  • the patient can be a human or another animal.
  • Human and mouse B7x have the amino acid and nucleic sequences indicated below.
  • the invention further provides an antibody to B7x, or an active antibody fragment that binds B7x, for use in a method of treatment of metastatic cancer in a patient having metastatic cancer or for use in a method of prevention of metastasis in a cancer patient at risk for metastasis.
  • the invention still further provides an antibody to B7x, or an active antibody fragment that binds B7x, for use in a method of determining if B7x is over- expressed in a tumor sample from a patient compared to healthy tissue, and for use in a method of treatment of metastatic cancer in a patient having metastatic cancer or for use in a method of prevention of metastasis in a cancer patient at risk for metastasis, where B7x is over-expressed in a tumor sample from the patient.
  • B7x The over-expression of B7x by tumor cells raises the possibility that it might provide a mechanism by which tumor cells avoid destruction mediated by tumor-reactive T cells and other immune cells. This is an interesting possibility for two reasons. The first is that high levels of B7x expression might facilitate tumor progression, and it may therefore provide a useful prognostic marker to predict outcome. The second is that B7x may be useful therapeutic target for checkpoint blockade with immunotherapy.
  • CT26 and MC38 are B7x negative and are able to induce lung metastasis when direct injected intravenously (iv) through the tail vein.
  • a retroviral expression vector B7x/MSCV was generated to make CT26 and MC38 stably expressing B7x.
  • Syngeneic Balb/c mice were then iv injected with 1 x 10 5 /per-mouse of CT26 or B7x/CT26, and survival kinetics were monitored.
  • mice injected with CT26 started to die at day 26 and half were still alive at day 50, whereas mice injected with B7x/CT26 started to die at day 21 and were all dead at day 33 (Fig. 2A).
  • syngeneic C57BL/6 started to die at day 44 after iv injection with 1 x 10 5 /per-mouse of MC38 and 37% were still alive at day 100, whereas mice iv injected with 1 x 10 5 /per-mouse of B7x/MC38 started to die at day 33 and were all dead at day 80 (Fig. 2B).
  • B7x gene knock-out mice were used to dissect the role of host B7x in cancer immune responses.
  • Naive B7x-/- mice were normal and healthy.
  • B7x-negative 4T1 cells (1 x 10 5 /per mouse) were injected iv into both B7x-/- (on pure BALB/c background) and wildtype BALB/c mice, and tumor progression and tumor nodules in lungs were monitored.
  • 4T1 was B7x negative in vitro and in vivo by RT-PCR (data not shown).
  • B7x-/- mice had many fewer tumor nodules in lungs than wildtype control (Fig. 4A).
  • Flow cytometric analysis was used to identify host cells of tumor infiltrates that are involved in anti-tumor responses. Wildtype mice had significantly more Foxp3+CD4+ regulatory T cells (Treg) and CDl lb+Ly6G+ myeloid-derived suppressor cells (MDSC) in the lung than B7x-/- mice on day 18 after iv injection of 4T1 tumor cells (Fig. 4C). Recent work has revealed that Treg 11 ' 12 and MDSC 13 ' 14 are two major cell populations capable of suppressing immune responses. The present results suggest that host cell-expressed B7x promotes expansion of immune suppressor cells within the tumor microenvironment.
  • Monoclonal antibodies were generated against both human and mice B7x from B7x gene knock-out mice. Briefly, B7x knock-out mice were immunized with B7x-Ig fusion protein and their spleen cells were used for generation of hybridomas. Thirty-two independent clones were obtained whose supernatant reacted with immobilized B7x-Ig, but not control Ig, in a standard ELISA. Eight of these were selected for further study.
  • hybridomas for B7x was confirmed by flow cytometry staining cell lines overexpressing B7x, but not cells expressing other B7 family members (B7-1, B7-2, B7h, PD-L1, PD-L2, and B7-H3).
  • Monoclonal antibodies inhibit metastatic cancer progression in vivo
  • mAbs [clones: 37G9 (IgG2b), 1H3 (IgGl), 12Dl l(IgGl), 19D6 (IgGl)] were purified and their therapeutic effects examined with B7x/CT26 lung metastatic cancer model. Syngeneic BLAB/c mice iv injected with 1 x 10 5 /per-mouse of B7x/CT26 on day 0 and then i.p injected with 20C ⁇ g/per-mouse of each mAb on day 1,3,7, 11, 14, or PBS as the control. All mice were killed on day 17 and tumor nodules in each lung were examined. Two clones, 12D11 and 1H3, had very good therapeutic effects.
  • FIG. 6 shows that hB7x/CT26 resulted in much more tumor nodules in the lung than CT26, 1 12.8 vs 23.8, demonstrating human B7x expressed on cancer cells can promote metastatic cancer progression in vivo.
  • This system can be used to identify monoclonal antibodies that are suitable for human clinical trials.
  • Monoclonal antibody inhibits human B7x-expressed metastatic cancer progression in vivo
  • a lung metastatic cancer model was developed in which the expression of human B7x on CT26 cancer cells (hB7x/CT26) significantly increased metastatic cancer progression in mice in vivo (Fig 6). To further facilitate the translation of this research into clinical trials, it was determined whether mAbs were able to inhibit human B7x-expressed metastatic cancer progression in vivo. Syngeneic BLAB/c mice were iv injected with 1 x 10 5 /per -mouse of hB7x/CT26 on day 0 and then i.p injected with 200 ⁇ g/per-mouse of mAb 1H3 on day 1,2,3,5,7,9, 11, 13,15, or PBS as the control. All mice were killed on day 17 and tumor nodules in each lung were examined. Monoclonal antibody 1H3 had very good therapeutic effects, and reduced more than 60% of tumor nodules in the lung in such a robust humanized metastatic cancer model (Fig. 7).
  • mAbs were tested to determine whether they were able to act through antibody- dependent cell-mediated cytotoxicity (ADCC).
  • ADCC antibody- dependent cell-mediated cytotoxicity
  • B7x/CT26 tumor cell as target cells, antibodies (0.2 ⁇ g/ml), and spleen cells from syngeneic BLAB/c mice as effector cells were incubated together at 37°C for 4 hours, and then tumor cells were analyzed by flow cytometry.
  • three (1H3, 15D2, 12D1 1) out of four mAbs significantly killed B7x-expressed CT26 tumor cells (Fig. 8). These results indicate that mAbs can kill B7x-positive tumor cells through ADCC.
  • B7x protein is not detected in antigen-presenting cells and T cells
  • B7x protein is not detected in antigen-presenting cells (APC) and T cells in both human and mice, as presented in Table 1.
  • Dendritic cells LPS, IL-4, IFN- ⁇ , IL-10, TNF-a, 4T1 cancer,
  • Macrophages Thioglycolate, IL-4, LPS+IFN- ⁇ , IL-6+IL-10, TGF- ⁇ ,
  • T cells ConA, anti-CD3, PMA+ ionomycin, 4T1 cancer T cells ConA, anti-CD3, PMA+ ionomycin, 4T1 cancer,
  • B7x protein was examined by flow cytometry with specific monoclonal or polyclonal Abs.
  • mice B7x promotes metastatic cancer progression in two mice models and that monoclonal antibodies can inhibit metastatic cancer progression in vivo, demonstrating that blockage of cancer-associated B7x can be used as a novel treatment for metastatic cancers; and 2) human B7x expressed on cancer cells can also promote metastatic cancer progression in vivo and that a monoclonal antibody can inhibit human B7x-expressing metastatic cancer progression in vivo, demonstrating that blockage of cancer-associated human B7x can be used as a novel treatment for metastatic cancers.
  • the present technology has enormous market and clinical potential for at least three reasons.
  • B7x is expressed in many human cancers, so it is an excellent therapeutic target for human cancers such as, for example, cancers of the lung, pancreas, kidney, brain, gut, prostate, and ovary.
  • the antibodies describe herein recognize both human and mice B7x, so these antibodies can be used in clinical trials.
  • CTLA-4 and PD-1 are two members of the B7/CD28 family.
  • An antibody against CTLA-4 (YERVOY® from Bristol-Myers Squibb Company) was approved by the FDA in March 201 1 as a new drug for metastatic melanoma.
  • Antibodies against PD-1 (MDX-1106) are in phase I clinical trials.
  • These existing technologies work by blockade of the B7/CD28 family members CTLA-4 and PD-1 on activated T cells, so they increase immunity against cancer but also induce autoimmune diseases.
  • the present technology works by blockade of B7x on cancer cells, so as to increase specific immunity against cancer without inducing autoimmune diseases.
  • Tringler, B., et al. B7-h4 is highly expressed in ductal and lobular breast cancer. Clin Cancer Res 11, 1842-1848 (2005).
  • B7-H4 is preferentially expressed in non-dividing brain tumor cells and in a subset of brain tumor stem-like cells. J Neurooncol 89, 121-129 (2008). Awadallah, N.S., et al. Detection of B7-H4 and p53 in pancreatic cancer: potential role as a cytological diagnostic adjunct. Pancreas 36, 200-206 (2008).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Epidemiology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Urology & Nephrology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Pathology (AREA)
  • Endocrinology (AREA)
  • Toxicology (AREA)
  • Mycology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Food Science & Technology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Diabetes (AREA)
  • Dermatology (AREA)
  • Zoology (AREA)
  • Oncology (AREA)
  • Rheumatology (AREA)

Abstract

Methods are provided for treating metastatic cancer in patients having metastatic cancer or for preventing metastasis in cancer patients at risk for metastasis comprising administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.

Description

ANTIBODIES TO HUMAN B7X FOR TREATMENT OF METASTATIC CANCER
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims the benefit of U.S. Provisional Patent Application No. 61/477,729, filed April 21, 201 1, the content of which is herein incorporated by reference in its entirety.
BACKGROUND OF THE INVENTION
[0002] Throughout this application various publications are referred to in superscripts. Full citations for these references may be found at the end of the specification. The disclosures of these publications are hereby incorporated by reference in their entirety into the subject application to more fully describe the art to which the subject invention pertains.
[0003] Cancer is a serious public health problem in the U.S. and other countries. More than 90% of cancer patient deaths result from cancer metastasis rather than from a primary cancer. There are about 924,310 new cancer cases and 339, 150 cancer deaths in the U.S. alone. According to Cancer Statistics 2010, in the U.S. in 2010 alone, there are an estimated 222,520 new cases and 157,300 deaths for lung cancer, 217,730 new cases and 32,050 deaths for prostate cancer, 207,090 new cases and 39,840 deaths for breast cancer, 145,500 new cases and 51,370 deaths for gut cancer, 58,240 new cases and 8,210 deaths for kidney cancer, and 51,350 new cases and 36,800 deaths for pancreas cancer. While traditional therapies such as surgery, chemotherapy, and radiation can often control primary cancer growth, successful control of disseminated metastases of cancer remains rare.
[0004] Cancer and the immune system have dynamic interactions, which play crucial roles in determining tumor development and thus clinical outcome. T cells of the immune system are the major combatants against cancers. T cell activation, proliferation, differentiation to effector function and memory generation are determined by both positive costimulation and negative coinhibition, generated mainly by the interaction between the B7 family and their receptor CD28 family (Fig 1). In 2003, B7x was discovered as a new member of the B7/CD28 family1. B7x inhibits T cell function in vitro1. B7x is extremely conservative with 87% amino acid identity between human and mice.
[0005] A study of 823 prostatectomy patients for whom a minimum of 7 year follow-up data were available revealed that prostate cancer patients with strong expression of B7x or its closest homologue, B7-H3, by tumor cells were significantly more likely to have disease spread at time of surgery, and were at significantly increased risk of clinical cancer recurrence and cancer-specific death2. In addition, all of 103 ovarian borderline tumors tested expressed B7x3. In contrast, only scattered B7x-positive cells were detected in nonneoplastic ovarian tissues. Other investigators have reported that B7x is over-expressed in human cancers of the lung4, ovary5, breast6'7, kidney8, brain9, pancreas10, esophagus17, skin18 and gut19. In renal cell carcinoma, patients with tumors expressing B7x were three times more likely to die from renal cancer compared to patients lacking B7x8. In human breast cancer, there was a significant association between a high proportion of B7x positive cells in invasive ductal carcinomas and decreased number of tumor infiltrating lymphocytes. In esophageal squamous cell carcinoma, expression levels of B7x on tumor cells were significantly correlated with distant metastasis, tumor stage and poor survival, and were inversely correlated with densities of CD3+ T cells in tumor nest and CD8+ T cells in tumor stroma.
[0006] The present invention addresses the serious and long-felt need for treatments for metastatic cancer.
SUMMARY OF THE INVENTION
[0007] Methods are provided for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.
[0008] Methods are also provided for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising determining the level of B7x expression in a tumor sample from the patient, and if B7x is over-expressed in the tumor sample compared to healthy tissue, administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.
BRIEF DESCRIPTION OF THE DRAWINGS
[0009] Figure 1. The B7 family/CD28 family. The members of the B7 and CD28 families have been divided into three groups by phylogenetic analysis: group I includes the pathway of B7-1/B7-2/CD28/CTLA-4, and the pathway of B7h/ICOS ; group II consists of the pathway of PD-L1/PD-L2/PD-1 ; and group III contains B7-H3 and B7x, whose receptors are currently unknown. Modified from Zang et al.1
[0010] Figure 2A-2B. Expression of B7x on tumor CT26 (A) or MC38 (B) accelerates disease progression in vivo. FACS analysis with PE-anti-B7x (line) or control PE-Ab (solid) showed that tumor cell lines CT26 and MC38 did not express B7x and that transfectants B7x/CT26 and B7x/MC38 expressed abundant cell surface B7x. Survival curves showed that syngeneic mice iv injected with B7x/CT26 or B7x/MC38 died much faster than mice injected with CT26 or MC38. The log-rank test was used for statistical analyses. P-values <0.05 were considered statistically significant.
[0011] Figure 3. Syngeneic BLAB/c mice iv injected with CT26 or B7x/CT26 and killed on day 20 for determining tumor nodules in lungs. Mice receiving B7x/CT26 had more tumor nodules than mice receiving CT26, P=0.0002.
[0012] Figure 4A-4C. B7x deficiency protects mice from lung metastasis of cancer. After intravenous injection with breast cancer cell line 4T1, B7x knock-out (B7x-/-) mice had fewer tumor nodules than Balb/c wildtype (B7x+/+) mice at day 18 (A); all wildtype mice were dead within 36 days whereas 33% of B7x-/- mice were still alive at day 72 (B). Surviving B7x-/- mice were still alive at day 140 after rechallenge with 4T1(B), and no tumor was found in lungs from surviving B7x-/- mice with 4T1 double-challenge. Wildtype mice had more regulatory T cells and myeloid-derived suppressor cells in lungs than B7x-/- mice during lung metastasis of cancer (C).
[0013] Figure 5. Monoclonal antibody clones 12D11 and 1H3 reduced more than 50% tumor nodules in a lung metastasis of cancer model.
[0014] Figure 6. BLAB/c mice iv injected with CT26 or hB7x/CT26 and killed on day 17 for determining tumor nodules in lungs. Mice receiving hB7x/CT26 had more tumor nodules than mice receiving CT26, P=0.02.
[0015] Figure 7. Anti-B7x monoclonal antibody 1H3 reduced more than 60% of tumor nodules in a human B7x-expressed lung metastasis of cancer model.
[0016] Figure 8. Antibody-dependent cell-mediated cytotoxicity (ADCC) assay showed that three mAbs (1H3, 12D 11, 15D2), but not 37G9, were able to kill tumor cells by ADCC mechanism.
[0017] Figure 9. Possible mechanisms by which treatment with anti-B7x antibodies inhibit metastatic cancer progression in vivo (see Experimental Details for discussion). DETAILED DESCRIPTION OF THE INVENTION
[0018] The present invention provides a method for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.
[0019] As used herein "metastasize" means, in regard to a cancer or tumor, to spread from one organ or tissue of a patient to another non-adjacent organ or tissue of the patient.
[0020] To "treat" a metastatic cancer means to reduce the number of metastases in an organ or tissue, and/or to kill metastatic tumor cells or tumor cells that are likely to metastasize, and/or to prevent or reduce the spread of cancerous cells from an original site in the body to another site in the body, and/or to inhibit the progression of metastatic cancer, and/or to prevent the reoccurrence of metastasis. Preferably, administration of the antibody or antibody fragment decreases the number of tumor nodules in the patient. Preferably, administration of the antibody or antibody fragment increases the patient's survival time.
[0021] Various diagnostic procedures have been developed to identify cancer patients at risk for metastasis. See, for example, U.S. Patent Application Publication Nos. 2008/0138805, 201 1/0059470 and 2011/0059470, the contents of which are herein incorporated by reference.
[0022] The cancer can be, for example, a cancer of the skin, breast, pancreas, prostate, ovary, kidney, espophagus, gastrointestional tract, colon, brain, liver, lung, head and/or neck. In a preferred embodiment, the cancer is lung cancer.
[0023] Preferably, the tumor in the patient expresses B7x or overexpresses B7x compared to healthy tissue, for example, in comparison to healthy tissue of the breast, pancreas, prostate, ovary, kidney, gastrointestional tract, colon, brain, liver, lung, head and/or neck. The level of B7x expression in the tumor can be determined, for example, using immunohistocytochemistry on a tissue sample obtained from the tumor (e.g., Zang et a/.2'3). B7x expression can also be determined by measuring expression of B7x mRNA in the tumor sample, for example by Northern blot hybridization (e.g., Allison et al.16).
[0024] Accordingly, the invention also provides a method for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising determining the level of B7x expression in a tumor sample from the patient, and if B7x is over-expressed in the tumor sample compared to the level of B7x expression in healthy tissue, administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis. The method can further comprise obtaining a tumor sample from the patient.
[0025] As used herein, the term "antibody" refers to complete, intact antibodies. A "fragment" of an antibody refers to a fragment that bind the antigen of interest, B7x. Antibody fragments include, but are not limited to, F(ab')2 and Fab' fragments and single chain antibodies. F(ab')2 is an antigen binding fragment of an antibody molecule with deleted crystallizable fragment (Fc) region and preserved binding region. Fab' is 1/2 of the F(ab')2 molecule possessing only 1/2 of the binding region. Complete, intact antibodies include, but are not limited to, polyclonal antibodies, monoclonal antibodies such as murine monoclonal antibodies, chimeric antibodies, human antibodies, and humanized antibodies.
[0026] Various forms of antibodies may be produced using standard recombinant DNA techniques. For example, "chimeric" antibodies may be constructed, in which the antigen binding domain from an animal antibody is linked to a human constant domain (an antibody derived initially from a nonhuman mammal in which recombinant DNA technology has been used to replace all or part of the hinge and constant regions of the heavy chain and/or the constant region of the light chain, with corresponding regions from a human immunoglobulin light chain or heavy chain). Chimeric antibodies reduce the immunogenic responses elicited by animal antibodies when used in human clinical treatments. In addition, recombinant "humanized" antibodies may be synthesized. Humanized antibodies are antibodies initially derived from a nonhuman mammal in which recombinant DNA technology has been used to substitute some or all of the amino acids not required for antigen binding with amino acids from corresponding regions of a human immunoglobulin light or heavy chain. That is, they are chimeras comprising mostly human immunoglobulin sequences into which the regions responsible for specific antigen-binding have been inserted. For example, human IgG Fc can be used to replace the mouse Fc part of a monoclonal antibody.
[0027] The antibody can be, e.g., any of an IgA, IgD, IgE, IgG, or IgM antibody. The IgA antibody can be, e.g., an IgAl or an IgA2 antibody. The IgG antibody can be, e.g., an IgGl, IgG2, IgG2a, IgG2b, IgG3 or IgG4 antibody. A combination of any of these antibodies subtypes can also be used. One consideration in selecting the type of antibody to be used is the desired serum half-life of the antibody. IgG has a serum half-life of 23 days, IgA 6 days, IgM 5 days, IgD 3 days, and IgE 2 days15. Another consideration is the size of the antibody. For example, the size of IgG is smaller than that of IgM allowing for greater penetration of IgG into tumors. Preferred antibodies include IgGl monclonal antibodies.
[0028] The antibodies and antibody fragments of the present invention are designed by humans and made outside of the human body. The antibodies and antibody fragments are specific for B7x, but not for other B7 family members (i.e., B7-1, B7-2, B7h, PD-L1, PD- L2, and B7-H3).
[0029] Preferred antibodies include monoclonal antibodies 1H3 and 12D1 1. Preferred antibodies include monoclonal antibodies having a light and/or heavy chain the same as the light and/or heavy chain of 1H3 or 12D1 1. The heavy and/or light chains can contain conservative amino acid sequence modifications that do not significantly affect the binding characteristics of the antibody. Preferred antibodies include monoclonal antibodies that bind to the same epitope on B7x as 1H3 or 12D11. Prefered antibodies include monoclonal antibodies that block the interaction between B7x and its receptor. Prefered antibodies include antibodies that kill tumor cells through antibody-dependent cell-mediated cytotoxicity. Preferably, the antibody or antibody fragment blocks inhibition of T cell function by B7x. Preferably, the antibody or antibody fragment blocks interaction between cancer-expressed B7x and activiated T cells. Preferably, the antibody or antibody fragment binds cancer-expressed B7x and kill cancer cells.
[0030] The antibodies and antibody fragments used for therapy in the present invention do not include antibody -partner molecule conjugates, where the partner can be, for example, one or more of a drug, toxin, radioisotope, therapeutic agent, or marker agent. The antibodies and antibody fragments of the present inventon are therapeutically effective without the need for another therapeutic agent conjugated to the antibody or fragment. Antibodies and antibody fragments that are used for determining the expression of B7x expression in a tumor sample from a patient can be conjugated to a marker, such as, for example, a fluorescent marker or a radioisotope marker.
[0031] In one embodiment, the antibody or antibody fragment is the sole therapeutic anti-cancer agent administered to the patient. In another embodiment, the antibody or antibody fragment can be administered in combination with another anti-cancer agent that is not bound to the antibody or antibody fragment. Anti-cancer agents include, but are not limited to, an antibody against CTLA-4 (YERVOY®); an antibody against PD-1 (MDX- 1 106); an anti-epidermal growth factor receptor (EGFR) agent such as, e.g., panitumumab, the anti-EGFR antibody cetuximab (Erbitux®), and the EGFR tyrosine kinase (TK) inhibitors gefitinib (Iressa®) and erlotinib (Tarceva®); an alkylating agent such as, e.g., cisplatin, carboplatin, oxaliplatin, nedaplatin, satraplatin, triplatin tetranitrate, mechlorethamine, cyclophosphamide, chlorambucil and ifosfamide; paclitaxel and docetaxel; and topoisomerase inhibitors such as, e.g., irinotecan, topotecan, amsacrine, etoposide, etoposide phosphate and teniposide.
[0032] The antibody or antibody fragment can be screened for efficacy using, e.g., procedures set forth herein in Experimental Details.
[0033] The antibody or antibody fragment can be administered to the subject in a pharmaceutical composition comprising a pharmaceutically acceptable carrier. Examples of acceptable pharmaceutical carriers include, but are not limited to, additive solution-3 (AS- 3), saline, phosphate buffered saline, Ringer's solution, lactated Ringer's solution, Locke- Ringer's solution, Krebs Ringer's solution, Hartmann's balanced saline solution, and heparinized sodium citrate acid dextrose solution. The pharmaceutical composition can be formulated for administration by any method known in the art, including but not limited to, direct administration to a tumor, parenteral administration, intravenous administration, and intramuscular administration.
[0034] The patient can be a human or another animal.
[0035] Human and mouse B7x have the amino acid and nucleic sequences indicated below.
Human B7x amino acid sequence (SEQ ID NO: l):
MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIK LSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKN VQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEV VDY ASSETLRCEAPRWFP QPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLY VTTN TYSCMIENDI AKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Mouse B7x amino acid sequence (SEQ ID NO:2):
MASLGQIIFWSirNIIIILAGAIALIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIK
LNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLK
NVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPETNVDY ASSESLRCEAPRWF
PQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLY VTTN TYSCMIEN
DIAKATGDIKVTDSEVKRRSQLQLLNSGPSPCVFSSAFVAGWALLSLSCCLMLR. Nucleic acid encoding Human B7x (SEQ ID NO:3):
atggcttccc tggggcagat cctcttctgg agcataatta gcatcatcat tattctggct 60
ggagcaattg cactcatcat tggctttggt atttcaggga gacactccat cacagtcact 120
actgtcgcct cagctgggaa cattggggag gatggaatcc tgagctgcac ttttgaacct 180
gacatcaaac tttctgatat cgtgatacaa tggctgaagg aaggtgtttt aggcttggtc 240
catgagttca aagaaggcaa agatgagctg tcggagcagg atgaaatgtt cagaggccgg 300
acagcagtgt ttgctgatca agtgatagtt ggcaatgcct ctttgcggct gaaaaacgtg 360
caactcacag atgctggcac ctacaaatgt tatatcatca cttctaaagg caaggggaat 420
gctaaccttg agtataaaac tggagccttc agcatgccgg aagtgaatgt ggactataat 480
gccagctcag agaccttgcg gtgtgaggct ccccgatggt tcccccagcc cacagtggtc 540
tgggcatccc aagttgacca gggagccaac ttctcggaag tctccaatac cagctttgag 600
ctgaactctg agaatgtgac catgaaggtt gtgtctgtgc tctacaatgt tacgatcaac 660
aacacatact cctgtatgat tgaaaatgac attgccaaag caacagggga tatcaaagtg 720
acagaatcgg agatcaaaag gcggagtcac ctacagctgc taaactcaaa ggcttctctg 780
tgtgtctctt ctttctttgc catcagctgg gcacttctgc ctctcagccc ttacctgatg 840
ctaaaataa 849
Nucleic acid encoding mouse B7x (SEQ ID N0:4):
atggcttcct tggggcagat catcttttgg agtattatta acatcatcat catcctggct 60
ggggccatcg cactcatcat tggctttggc atttcaggca agcacttcat cacggtcacg 120
accttcacct cagctggaaa cattggagag gacgggaccc tgagctgcac ttttgaacct 180
gacatcaaac tcaacggcat cgtcatccag tggctgaaag aaggcatcaa aggtttggtc 240
cacgagttca aagaaggcaa agacgacctc tcacagcagc atgagatgtt cagaggccgc 300
acagcagtgt ttgctgatca ggtggtagtt ggcaatgctt ccctgagact gaaaaacgtg 360
cagctcacgg atgctggcac ctacacatgt tacatccgca cctcaaaagg caaagggaat 420
gcaaacctag agtataagac cggagccttc agtatgccag agataaatgt ggactataat 480
gccagttcag agagtttacg ctgcgaggct cctcggtggt tcccccagcc cacagtggcc 540
tgggcatctc aagtcgacca aggagccaac ttctcagaag tctcgaacac cagctttgag 600
ttgaactctg agaatgtgac catgaaggtc gtatctgtgc tctacaatgt cacaatcaac 660
aacacatact cctgtatgat tgaaaatgac attgccaaag ccactgggga catcaaagtg 720
acagattcag aggtcaaaag gcggagtcag ctgcagctgc tcaactccgg gccttccccg 780
tgtgtttttt cttctgcctt tgcggctggc tgggcgctcc tatctctctc ctgttgcctg 840
atgctaagat ga 852
[0036] The invention further provides an antibody to B7x, or an active antibody fragment that binds B7x, for use in a method of treatment of metastatic cancer in a patient having metastatic cancer or for use in a method of prevention of metastasis in a cancer patient at risk for metastasis. The invention still further provides an antibody to B7x, or an active antibody fragment that binds B7x, for use in a method of determining if B7x is over- expressed in a tumor sample from a patient compared to healthy tissue, and for use in a method of treatment of metastatic cancer in a patient having metastatic cancer or for use in a method of prevention of metastasis in a cancer patient at risk for metastasis, where B7x is over-expressed in a tumor sample from the patient. [0037] This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
Cancer-expressed B7x promotes metastatic cancer progression
[0038] The over-expression of B7x by tumor cells raises the possibility that it might provide a mechanism by which tumor cells avoid destruction mediated by tumor-reactive T cells and other immune cells. This is an interesting possibility for two reasons. The first is that high levels of B7x expression might facilitate tumor progression, and it may therefore provide a useful prognostic marker to predict outcome. The second is that B7x may be useful therapeutic target for checkpoint blockade with immunotherapy.
[0039] In order to develop new drugs with B7x as a target, a mouse system was first developed in which cancer-expressed B7x can promote cancer progression and drugs can be screened. Two lung metastatic cancer models were developed in which the expression of B7x on CT26 and MC38 cancer cells significantly increased mortality in mice (Fig. 2).
[0040] Like most tumor cell lines which permanently lose endogenous B7x protein expression after in vitro culture, two tumor lines CT26 and MC38 are B7x negative and are able to induce lung metastasis when direct injected intravenously (iv) through the tail vein. A retroviral expression vector B7x/MSCV was generated to make CT26 and MC38 stably expressing B7x. Syngeneic Balb/c mice were then iv injected with 1 x 105/per-mouse of CT26 or B7x/CT26, and survival kinetics were monitored. Mice injected with CT26 started to die at day 26 and half were still alive at day 50, whereas mice injected with B7x/CT26 started to die at day 21 and were all dead at day 33 (Fig. 2A). In a parallel study, syngeneic C57BL/6 started to die at day 44 after iv injection with 1 x 105/per-mouse of MC38 and 37% were still alive at day 100, whereas mice iv injected with 1 x 105/per-mouse of B7x/MC38 started to die at day 33 and were all dead at day 80 (Fig. 2B).
[0041] In a subsequent experiment, Balb/c mice were iv injected with 1 x 105/per-mouse of CT26 or B7x/CT26 and killed on day 20 to determine tumor nodules in the lung. Fig. 3 showed that B7x/CT26 resulted in much more tumor nodules in the lung than CT26. Collectively, these results demonstrate that expression of B7x on tumor cells accelerates disease progression in vivo. Host cell-expressed B7x promotes expansion of immune suppressor cells within the tumor microenvironment
[0042] Some tissue cells express very low level of B7x, so B7x gene knock-out mice were used to dissect the role of host B7x in cancer immune responses. Naive B7x-/- mice were normal and healthy. B7x-negative 4T1 cells (1 x 105/per mouse) were injected iv into both B7x-/- (on pure BALB/c background) and wildtype BALB/c mice, and tumor progression and tumor nodules in lungs were monitored. 4T1 was B7x negative in vitro and in vivo by RT-PCR (data not shown). At day 18, B7x-/- mice had many fewer tumor nodules in lungs than wildtype control (Fig. 4A). All wildtype mice were dead at day 36, whereas 33% of B7x-/- mice were still alive at day 72 (Fig. 4B). These results reveal that host B7x promotes lung metastasis of cancer and that removal of host B7x protects mice from this disease. As more than 30% of B7-/- mice survived lung metastasis, these surviving B7x-/- mice were re-challenged with a higher dose (2 x 105/per mouse) of 4T1, and their survival was monitored. Remarkably, none of these mice died (Fig. 4B). At day 140 after primary injection, these mice were sacrificed and histological examination demonstrated that lungs of these mice did not have tumor. These results suggest that B7x deficiency not only protects mice from lung metastasis but also helps to develop strong immune memory of sufficient magnitude to completely eliminate the tumor.
[0043] Flow cytometric analysis was used to identify host cells of tumor infiltrates that are involved in anti-tumor responses. Wildtype mice had significantly more Foxp3+CD4+ regulatory T cells (Treg) and CDl lb+Ly6G+ myeloid-derived suppressor cells (MDSC) in the lung than B7x-/- mice on day 18 after iv injection of 4T1 tumor cells (Fig. 4C). Recent work has revealed that Treg11'12 and MDSC13'14 are two major cell populations capable of suppressing immune responses. The present results suggest that host cell-expressed B7x promotes expansion of immune suppressor cells within the tumor microenvironment.
Generation of monoclonal antibodies recognizing both human and mice B7x
[0044] Monoclonal antibodies (mAbs) were generated against both human and mice B7x from B7x gene knock-out mice. Briefly, B7x knock-out mice were immunized with B7x-Ig fusion protein and their spleen cells were used for generation of hybridomas. Thirty-two independent clones were obtained whose supernatant reacted with immobilized B7x-Ig, but not control Ig, in a standard ELISA. Eight of these were selected for further study. The specificity of these hybridomas for B7x was confirmed by flow cytometry staining cell lines overexpressing B7x, but not cells expressing other B7 family members (B7-1, B7-2, B7h, PD-L1, PD-L2, and B7-H3).
Monoclonal antibodies inhibit metastatic cancer progression in vivo
[0045] Four mAbs [clones: 37G9 (IgG2b), 1H3 (IgGl), 12Dl l(IgGl), 19D6 (IgGl)] were purified and their therapeutic effects examined with B7x/CT26 lung metastatic cancer model. Syngeneic BLAB/c mice iv injected with 1 x 105/per-mouse of B7x/CT26 on day 0 and then i.p injected with 20C^g/per-mouse of each mAb on day 1,3,7, 11, 14, or PBS as the control. All mice were killed on day 17 and tumor nodules in each lung were examined. Two clones, 12D11 and 1H3, had very good therapeutic effects. Both mAbs were able to reduce more than 50% tumor nodules in the lung in such a robust metastatic cancer model (Fig. 5). The other two mAb clones (37G9 and 19D6) did not have significant therapeutic effects in vivo (data not shown), which is most likely due to the possibility that 37G9 and 19D6 are unable to block the interaction between B7x and its receptor(s).
Cancer-expressed human B7x promotes metastatic cancer progression in vivo
[0046] To facilitate the translation of this research into clinical trials, another lung metastatic cancer model was developed in which the expression of human B7x on CT26 cancer cells significantly increased metastatic cancer progression in mice in vivo. A CT26 cell line, hB7x/CT26, was made that stably express human B7x on cell surface. Balb/c mice were iv injected with 1 x 105/per-mouse of CT26 or hB7x/CT26 and killed on day 17 to determine tumor nodules in the lung. Fig. 6 shows that hB7x/CT26 resulted in much more tumor nodules in the lung than CT26, 1 12.8 vs 23.8, demonstrating human B7x expressed on cancer cells can promote metastatic cancer progression in vivo. This system can be used to identify monoclonal antibodies that are suitable for human clinical trials.
Monoclonal antibody inhibits human B7x-expressed metastatic cancer progression in vivo
[0047] A lung metastatic cancer model was developed in which the expression of human B7x on CT26 cancer cells (hB7x/CT26) significantly increased metastatic cancer progression in mice in vivo (Fig 6). To further facilitate the translation of this research into clinical trials, it was determined whether mAbs were able to inhibit human B7x-expressed metastatic cancer progression in vivo. Syngeneic BLAB/c mice were iv injected with 1 x 105/per -mouse of hB7x/CT26 on day 0 and then i.p injected with 200 μg/per-mouse of mAb 1H3 on day 1,2,3,5,7,9, 11, 13,15, or PBS as the control. All mice were killed on day 17 and tumor nodules in each lung were examined. Monoclonal antibody 1H3 had very good therapeutic effects, and reduced more than 60% of tumor nodules in the lung in such a robust humanized metastatic cancer model (Fig. 7).
Monoclonal antibody-dependent cell-mediated cytotoxicity
[0048] mAbs were tested to determine whether they were able to act through antibody- dependent cell-mediated cytotoxicity (ADCC). B7x/CT26 tumor cell as target cells, antibodies (0.2 μg/ml), and spleen cells from syngeneic BLAB/c mice as effector cells were incubated together at 37°C for 4 hours, and then tumor cells were analyzed by flow cytometry. Compared to the control normal IgG, three (1H3, 15D2, 12D1 1) out of four mAbs significantly killed B7x-expressed CT26 tumor cells (Fig. 8). These results indicate that mAbs can kill B7x-positive tumor cells through ADCC.
B7x protein is not detected in antigen-presenting cells and T cells
[0049] B7x protein is not detected in antigen-presenting cells (APC) and T cells in both human and mice, as presented in Table 1.
Table 1. B7x protein is not detected in APCs and T cells before and after stimuli
Immune cells Stimulation and disease models
Human
Dendritic cells CD40L, LPS, PMA+ ionomycin, cytokine cocktail
Langerhans cells CD40L, cytokine cocktail
Monocytes LPS+IFN-γ
B cells LPS, PMA+ ionomycin
T cells PHA, PMA+ ionomycin
Mouse
Dendritic cells LPS, IL-4, IFN-γ, IL-10, TNF-a, 4T1 cancer,
S. pneumoniae infection, B. malayi infection,
Macrophages Thioglycolate, IL-4, LPS+IFN-γ, IL-6+IL-10, TGF-β,
Treg, 4T1 cancer, S. pneumoniae infection,
B. malayi infection,
B cells LPS, anti-IgM F(ab')2, PMA+ ionomycin, 4T1 cancer,
S. pneumoniae infection
T cells ConA, anti-CD3, PMA+ ionomycin, 4T1 cancer,
S. pneumoniae infection Thl, Th2, Treg
B7x protein was examined by flow cytometry with specific monoclonal or polyclonal Abs. Mechanisms of treatment for cancers
[0050] The present results show that 1) cancer-expressed mice B7x promotes metastatic cancer progression in two mice models and that monoclonal antibodies can inhibit metastatic cancer progression in vivo, demonstrating that blockage of cancer-associated B7x can be used as a novel treatment for metastatic cancers; and 2) human B7x expressed on cancer cells can also promote metastatic cancer progression in vivo and that a monoclonal antibody can inhibit human B7x-expressing metastatic cancer progression in vivo, demonstrating that blockage of cancer-associated human B7x can be used as a novel treatment for metastatic cancers. There are three possible mechanisms by which this treatment can inhibit metastatic cancer progression in vivo (see Figure 9): (A) antibodies block the interaction between cancer-expressed B7x and activated T cells, therefore increasing T cell-mediated immunity against cancer; (B) antibodies bind cancer-expressed B7x and kill cancer cells; and (C) antibodies block very low level of B7x expressed by some tissue cells, therefore inhibiting the expansion of regulatory T cells (Treg) and myeloid-derived suppressor cells (MDSC) within the tumor microenvironment.
Discussion
[0051] The present technology has enormous market and clinical potential for at least three reasons. 1) B7x is expressed in many human cancers, so it is an excellent therapeutic target for human cancers such as, for example, cancers of the lung, pancreas, kidney, brain, gut, prostate, and ovary. 2) More than 90% of cancer patients die from metastasis; therefore, therapies for metastasis are desperately needed. 3) The antibodies describe herein recognize both human and mice B7x, so these antibodies can be used in clinical trials.
[0052] Like B7x, CTLA-4 and PD-1 are two members of the B7/CD28 family. An antibody against CTLA-4 (YERVOY® from Bristol-Myers Squibb Company) was approved by the FDA in March 201 1 as a new drug for metastatic melanoma. Antibodies against PD-1 (MDX-1106) are in phase I clinical trials. These existing technologies work by blockade of the B7/CD28 family members CTLA-4 and PD-1 on activated T cells, so they increase immunity against cancer but also induce autoimmune diseases. In contrast, the present technology works by blockade of B7x on cancer cells, so as to increase specific immunity against cancer without inducing autoimmune diseases. REFERENCES
Zang, X., et al. B7x: a widely expressed B7 family member that inhibits T cell activation. Proc. Natl. Acad. Sci. U. S. A. 100, 10388-10392 (2003).
Zang, X., et al. B7-H3 and B7x are highly expressed in human prostate cancer and associated with disease spread and poor outcome. Proc Natl Acad Sci U S A 104, 19458-19463 (2007).
Zang, X., et al. Tumor associated endothelial expression of B7-H3 predicts survival in ovarian carcinomas. Mod Pathol, May 21. [Epub ahead of print] (2010).
Sun, Y., et al. B7-H3 and B7-H4 expression in non-small-cell lung cancer. Lung Cancer 53, 143-151 (2006).
Tringler, B., et al. B7-H4 overexpression in ovarian tumors. Gynecol Oncol 100, 44- 52 (2006).
Tringler, B., et al. B7-h4 is highly expressed in ductal and lobular breast cancer. Clin Cancer Res 11, 1842-1848 (2005).
Salceda, S., et al. The immunomodulatory protein B7-H4 is overexpressed in breast and ovarian cancers and promotes epithelial cell transformation. Exp Cell Res 306, 128-141 (2005).
Krambeck, A.E., et al. B7-H4 expression in renal cell carcinoma and tumor vasculature: associations with cancer progression and survival. Proc Natl Acad Sci USA 103, 10391-10396 (2006).
Yao, Y., et al. B7-H4 is preferentially expressed in non-dividing brain tumor cells and in a subset of brain tumor stem-like cells. J Neurooncol 89, 121-129 (2008). Awadallah, N.S., et al. Detection of B7-H4 and p53 in pancreatic cancer: potential role as a cytological diagnostic adjunct. Pancreas 36, 200-206 (2008).
Tang, Q. & Bluestone, J.A. The Foxp3+ regulatory T cell: a jack of all trades, master of regulation. Nat Immunol 9, 239-244 (2008).
Littman, D.R. & Rudensky, A.Y. Thl7 and regulatory T cells in mediating and restraining inflammation. Cell 140, 845-858 (2010).
Gabrilovich, D.I. & Nagaraj, S. Myeloid-derived suppressor cells as regulators of the immune system. Nat Rev Immunol 9, 162-174 (2009).
Marigo, I., Dolcetti, L., Serafini, P., Zanovello, P. & Bronte, V. Tumor-induced tolerance and immune suppression by myeloid derived suppressor cells. Immunol Rev 222, 162-179 (2008). Abbas AK, Lichtman AH, Pober JS. Cellular and Molecular Immunology, 4 edition, W.B. Saunders Co., Philadelphia, 2000.
Allison et al. U.S. Patent Application Publication No. 2004/0157380, published Sep. 9, 2004, Compositions and methods for modulating lymphocyte activity.
Chen LJ et al. B7-H4 expression associates with cancer progression and predicts patient's survival in human esophageal squamous cell carcinoma. Cancer Immunol Immunother 60(7): 1047-55, 201 1.
Quandt D et al. B7-h4 expression in human melanoma: its association with patients' survival and antitumor immune response. Clin Cancer Res. 17:3100-11, 201 1.
Jiang J et al. Tumor expression of B7-H4 predicts poor survival of patients suffering from gastric cancer. Cancer Immunol Immunother. 59: 1707-14, 2010.

Claims

What is claimed is:
1. A method for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising administering to the patient an antibody to B7x, or an active antibody fragment that binds B7x, in an amount effective to treat or prevent metastasis.
2. A method for treating metastatic cancer in a patient having metastatic cancer or for preventing metastasis in a cancer patient at risk for metastasis comprising
determining the level of B7x expression in a tumor sample from the patient, and if B7x is over-expressed in the tumor sample compared to healthy tissue, administering to the patient an antibody to B7x, or an active antibody fragment that binds
B7x, in an amount effective to treat or prevent metastasis.
3. The method of claim 1 or 2, wherein the patient has metastatic cancer.
4. The method of claim 1 or 2, wherein the patient is a cancer patient at risk for metastasis.
5. The method of any of claims 1-4, wherein the cancer is a cancer of the skin, breast, pancreas, prostate, ovary, kidney, esophagus, gastrointestional tract, colon, brain, liver, lung, head and/or neck.
6. The method of any of claims 1-4, wherein the cancer is lung cancer.
7. The method of any of claims 1-6, wherein the antibody is a monoclonal antibody.
8. The method of any of claims 1-7, wherein the antibody is an IgG monoclonal antibody.
9. The method of any of claims 1-8, wherein the antibody is an IgGl monoclonal antibody.
10. The method of any of claims 1-9, wherein administration of the antibody or antibody fragment decreases the number of tumor nodules in the patient.
1 1. The method of any of claims 1-10, wherein administration of the antibody or antibody fragment reduces the number of metastases.
12. The method of any of claims 1-11, wherein administration of the antibody or antibody fragment prevents the occurrence or reoccurrence of metastasis.
13. The method of any of claims 1-12, wherein administration of the antibody or antibody fragment increases the patient's survival time.
14. The method of any of claims 1-13, wherein the antibody or antibody fragment does not include an antibody-partner molecule conjugate.
15. The method of any of claims 1-14, wherein the antibody or antibody fragment is the sole therapeutic anti-cancer agent administered to the patient.
16. The method of any of claims 1-14, wherein the antibody or antibody fragment is administered in combination with another anti-cancer agent.
PCT/US2012/034348 2011-04-21 2012-04-20 Antibodies to human b7x for treatment of metastatic cancer Ceased WO2012145568A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US14/050,512 US9447186B2 (en) 2011-04-21 2013-10-10 Antibodies to human B7x for treatment of metastatic cancer
US15/252,267 US20170029525A1 (en) 2011-04-21 2016-08-31 Antibodies to human b7x for treatment of metastatic cancer
US17/004,331 US12221489B2 (en) 2011-04-21 2020-08-27 Antibodies to human B7x for treatment of metastatic cancer

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161477729P 2011-04-21 2011-04-21
US61/477,729 2011-04-21

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US14/050,512 Continuation-In-Part US9447186B2 (en) 2011-04-21 2013-10-10 Antibodies to human B7x for treatment of metastatic cancer

Publications (1)

Publication Number Publication Date
WO2012145568A1 true WO2012145568A1 (en) 2012-10-26

Family

ID=47041926

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/034348 Ceased WO2012145568A1 (en) 2011-04-21 2012-04-20 Antibodies to human b7x for treatment of metastatic cancer

Country Status (2)

Country Link
US (3) US9447186B2 (en)
WO (1) WO2012145568A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021155307A1 (en) * 2020-01-30 2021-08-05 Apeximmune Therapeutics Inc. Anti-b7-h4 constructs and uses thereof

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012145568A1 (en) 2011-04-21 2012-10-26 Albert Einstein College Of Medicine Of Yeshiva University Antibodies to human b7x for treatment of metastatic cancer
US9422351B2 (en) * 2011-11-03 2016-08-23 The Trustees Of The University Of Pennsylvania Isolated B7-H4 specific compositions and methods of use thereof
WO2015167948A1 (en) 2014-04-30 2015-11-05 Albert Einstein College Of Medicine Of Yeshiva University Tmigd2 and its derivatives as blockers or binders of cancer-expressed hhla2 for immunotherapies
US10626176B2 (en) * 2014-10-31 2020-04-21 Jounce Therapeutics, Inc. Methods of treating conditions with antibodies that bind B7-H4
PE20181326A1 (en) 2015-11-03 2018-08-20 Janssen Biotech Inc ANTIBODIES THAT SPECIFICALLY BIND PD-1 AND ITS USES
US11306144B2 (en) 2017-08-25 2022-04-19 Five Prime Therapeutics, Inc. B7-H4 antibodies and methods of use thereof
CA3084512A1 (en) 2017-11-22 2019-05-31 Cornell University Co-therapies including a metastasis inhibitor
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies
BR112020016986A2 (en) 2018-02-21 2021-03-02 Five Prime Therapeutics, Inc. antibody formulations against b7-h4
KR20200144094A (en) 2018-03-02 2020-12-28 파이브 프라임 테라퓨틱스, 인크. B7-H4 antibody and methods of use thereof
US12452308B2 (en) 2023-04-27 2025-10-21 Bank Of America Corporation Systems, methods, and apparatuses for detecting and preventing misappropriation attempts based on initiator device data and dynamic rules in a distributed network

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090208489A1 (en) * 2005-03-24 2009-08-20 Millennium Pharmaceuticals, Inc. Intellectual Property Group Antibodies That Bind OV064 and Methods of Use Therefor

Family Cites Families (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6962980B2 (en) 1999-09-24 2005-11-08 Corixa Corporation Compositions and methods for the therapy and diagnosis of ovarian cancer
US7888477B2 (en) 1998-12-17 2011-02-15 Corixa Corporation Ovarian cancer-associated antibodies and kits
US6891030B2 (en) 2000-07-27 2005-05-10 Mayo Foundation For Medical Education And Research T-cell immunoregulatory molecule
EP1539218A4 (en) 2002-06-20 2007-08-22 Univ California COMPOSITIONS AND METHODS FOR MODULATING LYMPHOCYTE ACTIVITY
US8546541B2 (en) 2002-06-20 2013-10-01 Washington University Compositions and methods for modulating lymphocyte activity
US20050163772A1 (en) * 2003-06-16 2005-07-28 University Of Washington B7S1: an immune modulator
WO2006017635A2 (en) 2004-08-11 2006-02-16 Albert Einstein College Of Medicine Of Yeshiva University Isolation, gene expression, and chemotherapeutic resistance of motile cancer cells
JP5173428B2 (en) * 2004-11-10 2013-04-03 ディアデクサス インコーポレーテッド Ovr110 antibody compositions and methods of use
WO2007067991A2 (en) * 2005-12-08 2007-06-14 Medarex, Inc. Human monoclonal antibodies to o8e
DE102005061690A1 (en) 2005-12-21 2007-07-05 Solmic Gmbh Process for the preparation of solar grade silicon
WO2007082154A2 (en) * 2006-01-05 2007-07-19 Mayo Foundation For Medical Education And Research B7-h1 and b7-h4 in cancer
JP5391073B2 (en) * 2006-11-27 2014-01-15 ディアデクサス インコーポレーテッド Ovr110 antibody compositions and methods of use
EP2124998B8 (en) * 2006-12-27 2015-05-06 The Johns Hopkins University Methods for detecting inflammation and auto-immune diseases
CL2008003526A1 (en) * 2007-11-30 2010-01-11 Medarex Inc Antibody-associated molecule conjugate comprising a human monoclonal anti human b7-h4 / 08e / b7x / b7s1 / bl-cam / b3 / leu-14 / lyb-8 antibody; composition comprising it; in vitro method of inhibition of tumor cell expressing b7-h4 / 08e / b7x / b7s1 / bl-cam / b3 / leu-14 / lyb-8; and use to treat cancer.
CA2729351C (en) 2008-06-30 2017-01-24 University Of Pennsylvania Fn14/trail fusion proteins
EP3255060A1 (en) 2008-12-09 2017-12-13 F. Hoffmann-La Roche AG Anti-pd-l1 antibodies and their use to enhance t-cell function
CA2772204A1 (en) * 2009-08-31 2011-03-03 Amplimmune, Inc. Methods and compositions for the inhibition of transplant rejection
US8642277B2 (en) 2009-09-10 2014-02-04 Albert Einstein College Of Medicine Of Yeshiva University Tumor microenvironment of metastasis (TMEM) and uses thereof in diagnosis, prognosis and treatment of tumors
WO2012145568A1 (en) * 2011-04-21 2012-10-26 Albert Einstein College Of Medicine Of Yeshiva University Antibodies to human b7x for treatment of metastatic cancer
US9676854B2 (en) * 2011-08-15 2017-06-13 Medimmune, Llc Anti-B7-H4 antibodies and their uses
US9422351B2 (en) * 2011-11-03 2016-08-23 The Trustees Of The University Of Pennsylvania Isolated B7-H4 specific compositions and methods of use thereof
CA2894879A1 (en) * 2012-12-19 2014-06-26 Amplimmune, Inc. B7-h4 specific antibodies, and compositions and methods of use thereof
US9562099B2 (en) * 2013-03-14 2017-02-07 Genentech, Inc. Anti-B7-H4 antibodies and immunoconjugates
US10689432B2 (en) 2013-12-18 2020-06-23 Albert Einstein College Of Medicine B7X and its derivatives for treating and preventing cardiovascular disease

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090208489A1 (en) * 2005-03-24 2009-08-20 Millennium Pharmaceuticals, Inc. Intellectual Property Group Antibodies That Bind OV064 and Methods of Use Therefor

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
ZANG ET AL.: "B7-H3 and B7x are highly expressed in human prostate cancer and associated with disease spread and poor outcome.", PNAS, USA, vol. 104, no. 49, 4 December 2007 (2007-12-04), pages 19458 - 19463 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021155307A1 (en) * 2020-01-30 2021-08-05 Apeximmune Therapeutics Inc. Anti-b7-h4 constructs and uses thereof

Also Published As

Publication number Publication date
US20140037551A1 (en) 2014-02-06
US20200392246A1 (en) 2020-12-17
US20170029525A1 (en) 2017-02-02
US12221489B2 (en) 2025-02-11
US9447186B2 (en) 2016-09-20

Similar Documents

Publication Publication Date Title
US12221489B2 (en) Antibodies to human B7x for treatment of metastatic cancer
Podojil et al. Potential targeting of B7‐H4 for the treatment of cancer
EP3377534B1 (en) Treatment of lung cancer using a combination of an anti-pd-1 antibody and an anti-ctla-4 antibody
CA2894879A1 (en) B7-h4 specific antibodies, and compositions and methods of use thereof
CN112703012A (en) Methods of treating cancer
AU2018351007B2 (en) Treatment of ovarian cancer with anti-CD47 and anti-PD-L1
CN109310763A (en) Receptor-selective retinoid and rexinoid compounds and immunomodulators for cancer immunotherapy
Fabrizio et al. B7-H3/CD276 and small-cell lung cancer: What's new?
KR102554507B1 (en) Method for detecting tissue-infiltrating NK cells
JP2025020119A (en) PD-1 blockade with nivolumab in refractory Hodgkin lymphoma
JP2019517505A (en) Use of anti-PD-1 antibody in combination with anti-CD30 antibody in lymphoma treatment
CA3117016A1 (en) Combination therapy for melanoma
Goldman et al. Safety and tolerability of MEDI0562, an OX40 agonist mAb, in combination with durvalumab or tremelimumab in adult patients with advanced solid tumors
CN114174538A (en) Multiple tumor gene signatures suitable for immunooncology therapy
JP2024514590A (en) Bispecific antibodies targeting PD-1 and TIM-3
JP6274542B2 (en) Method for determining therapeutic effect of anticancer agent comprising anti-CD4 antibody as active ingredient
RU2816531C2 (en) Combinations of antibodies for treating cancer in specific patients
TW202528342A (en) Hla/tumor antigen pvt1 derived peptide complex specific antibody
HK40092424A (en) Treatment of ovarian cancer with anti-cd47 and anti-pd-l1
CN117177771A (en) A method of diagnosing and treating T-cell lymphoma
HK40099135A (en) A scoring method for an anti-b7h4 antibody-drug conjugate therapy
HK40036031B (en) Treatment of ovarian cancer with anti-cd47 and anti-pd-l1
HK40036031A (en) Treatment of ovarian cancer with anti-cd47 and anti-pd-l1
CN108103086A (en) DNA fragmentation, the recombinant vector containing the segment and its construction method and application
Ghosh et al. Immune Checkpoint Inhibitors in Non-Small Cell Lung Cancer

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12774321

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 12774321

Country of ref document: EP

Kind code of ref document: A1