WO2012135110A1 - Pentose fermentation by a recombinant microorganism - Google Patents
Pentose fermentation by a recombinant microorganism Download PDFInfo
- Publication number
- WO2012135110A1 WO2012135110A1 PCT/US2012/030549 US2012030549W WO2012135110A1 WO 2012135110 A1 WO2012135110 A1 WO 2012135110A1 US 2012030549 W US2012030549 W US 2012030549W WO 2012135110 A1 WO2012135110 A1 WO 2012135110A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- nucleic acid
- polynucleotide
- set forth
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0006—Oxidoreductases (1.) acting on CH-OH groups as donors (1.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y101/00—Oxidoreductases acting on the CH-OH group of donors (1.1)
- C12Y101/01—Oxidoreductases acting on the CH-OH group of donors (1.1) with NAD+ or NADP+ as acceptor (1.1.1)
- C12Y101/01307—D-Xylose reductase (1.1.1.307)
Definitions
- the present invention provides methods and compositions suitable for use in the conversion of xylose to xylitol and xylulose, including nucleic acid constructs, recombinant fungal host cells, and related materials.
- Ethanol and ethanol fuel blends are widely used in Brazil and in the United States as a transportation fuel. Combustion of these fuels is believed to produce fewer of the harmful exhaust emissions ⁇ e.g., hydrocarbons, nitrogen oxide, and volatile organic compounds [VOCs]) that are generated by the combustion of petroleum.
- Bioethanol is a particularly favored form of ethanol because the plant biomass from which it is produced utilizes sunlight, an energy source that is renewable.
- ethanol is used in gasoline blends that are from 5% to 85% ethanol.
- Blends of up to 10% ethanol (E10) are approved for use in all gasoline vehicles in the U.S. and blends of up to 85% ethanol (E85) can be utilized in specially engineered flexible-fuel vehicles (FFV).
- FFV specially engineered flexible-fuel vehicles
- the Brazilian government has mandated the use of ethanol-gasoline blends as a vehicle fuel, and the mandatory blend has been 25% ethanol (E25) since 2007.
- Bioethanol is currently produced by the fermentation of hexose sugars that are obtained from carbon feedstocks.
- sugar from sugar cane and starch from feedstock such as corn can be economically converted.
- feedstock such as corn
- Lignocellulosic biomass is made up of cellulose, hemicelluloses, and lignin.
- Cellulose and hemicellulose can be hydrolyzed in a saccharification process to sugars that can be subsequently converted to ethanol via fermentation.
- the major fermentable sugars from lignocelluloses are glucose and xylose.
- a strain that can effectively convert all the major sugars present in cellulosic feedstock would be highly desirable.
- the present invention provides methods and compositions suitable for use in the conversion of xylose to xylitol and xylulose, including nucleic acid constructs, recombinant fungal host cells, and related materials.
- the present invention provides recombinant nucleic acid constructs comprising at least one polynucleotide sequence that encodes at least one xylose reductase, wherein the polynucleotide is selected from: (a) a polynucleotide that encodes a polypeptide comprising an amino acid sequence having at least about 70% identity to SEQ ID NO:2, wherein the amino acid sequence comprises at least one substitution set forth herein; and (b) a polynucleotide that hybridizes under stringent hybridization conditions to the complement of a polynucleotide that encodes a polypeptide having the amino acid sequence of SEQ ID NO:2, and wherein the amino acid sequence comprises at least one substitution set forth herein.
- the polynucleotide sequence encodes a polypeptide comprising an amino acid sequence at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to SEQ ID NO:2, wherein the amino acid sequence comprises at least one substitution set forth herein.
- the polynucleotide sequence encodes a polypeptide comprising a portion of the amino acid sequence set forth in SEQ ID NO:2, wherein the amino acid sequence comprises at least one substitution set forth herein.
- the polynucleotide sequence encodes a polypeptide having an amino acid sequence that comprises at least one substitution at position 2, 3, 7, 11, 14, 17, 23, 24, 33, 36, 46, 47, 49, 56, 62, 68, 89, 97, 102, 108, 114, 116, 123, 132, 134, 143, 152, 155, 157, 162, 168, 184, 206, 219, 224, 225, 226, 228, 246, 231, 232, 233, 236, 240, 242, 245, 246, 249, 252, 255, 261, 266, 267, 275, 276, 279, 281, 282, 283, 285, 297, 301, 302, 303, and/or 318, wherein the positions are numbered by correspondence with the amino acid sequence of P.
- the polynucleotide sequence encodes a polypeptide having an amino acid sequence that comprises at least one substitution selected from P2, S3, N7, Dl 1, A14, F17, D23, V24, R33, K36, E46, D47, A49, A56, 162, K68, E89, S97, D102, L108, T114, K116, K123, K132, D134, 1143, K152, K155, G157, 1162, P168, S184, R206, Q219, L224, N225, Q226, R228, A246, N231, T232, S233, F236, T240, K242, A245, A246, G249, P252, V255, S261, A266, 1267, P275, R276, E279, K281, D282, V283, S285, A297, 1301, N302, L303, and/or V318,
- the polynucleotide sequence encodes a polypeptide having an amino acid sequence that comprises at least one substitution selected from P2T, S3H, S3R, S3W, N7L, D11K, A14V, F17W, D23E, V24G, R33L, R22V, K36Q, E46K, D47G, D47N, A49G, A56E, A56Y, I62V, K68G, K68M, K68R, E89N, E89V, S97R, S97T, D102T, L108Y, T114S, K116Q, K123C, K132A, K132N, D134E, D134H, D134V, I143L, K152A, K152E, K152H, K152Q, K155A, K155D, K155I, K155R, K155Y, G157R, I162L,
- the polynucleotide sequence is at least about 80%, about 85%, about 90%, or at least 95% identical to SEQ ID NO: l, and wherein the polynucleotide sequence comprises at least one mutation set forth herein.
- the polynucleotide sequence comprises at least one mutation selected from t82a, t99a, gl56a, c201t, a280c, c306t, t354g, t358c, a378t, c408t, a426t, c438t, a478c, t511c, a585g, t670c, t688c, t703c, t747c, t751a, t766c, t81 la, c816t, a826c, c849g, c855t, and/or c906t, wherein the nucleotide position is determined by alignment with SEQ ID NO: l.
- the present invention provides nucleic acid constructs comprising SEQ ID NO:3 and/or SEQ ID NO:4.
- the present invention also provides isolated xylose reductase variants, wherein the variants have xylose reductase activity and comprise a substitution at one or more positions selected from 2, 3, 7, 11, 14, 17, 23, 24, 33, 36, 46, 47, 49, 56, 62, 68, 89, 97, 102, 108, 114, 116, 123, 132, 134, 143, 152, 155, 157, 162, 168, 184, 206, 219, 224, 225, 226, 228, 246, 231, 232, 233, 236, 240, 242, 245, 246, 249, 252, 255, 261, 266, 267, 275, 276, 279, 281, 282, 283, 285, 297, 301, 302, 303, and/or 318, wherein the positions are numbered by correspondence with the amino acid sequence of P.
- the variant has xylose reductase activity and comprises a substitution at one or more positions selected from P2, S3, N7, Dl 1, A14, F17, D23, V24, R33, K36, E46, D47, A49, A56, 162, K68, E89, S97, D102, L108, T114, K116, K123, K132, D134, 1143, K152, K155, G157, 1162, P168, S184, R206, Q219, L224, N225, Q226, R228, A246, N231, T232, S233, F236, T240, K242, A245, A246, G249, P252, V255, S261, A266, 1267, P275, R276, E279, K281, D282, V283, S285, A297, 1301 , N302, L303 , and/or V318, wherein
- the variant has xylose reductase activity and comprises a substitution at one or more positions selected from P2T, S3H, S3R, S3W, N7L, D11K, A14V, F17W, D23E, V24G, R33L, R22V, K36Q, E46K, D47G, D47N, A49G, A56E, A56Y, I62V, K68G, K68M, K68R, E89N, E89V, S97R, S97T, D102T, L108Y, Tl 14S, Kl 16Q, K123C, K132A, K132N, D134E, D134H, D134V, I143L, K152A, K152E, K152H, K152Q, K155A, K155D, K155I, K155R, K155Y, G157R, I162L, P168S
- the isolated xylose reductase variants comprise the sequence set forth in SEQ ID NO:41, 43, 45, and/or 47.
- the present invention also provides isolated nucleic acid sequences comprising SEQ ID NO:3, 4, 40, 42, 44, and/or 46.
- the present invention also provides recombinant nucleic acid constructs comprising at least one polynucleotide sequence that encodes a xylitol dehydrogenase, wherein the polynucleotide is selected from: (a) a polynucleotide that encodes a polypeptide comprising an amino acid sequence having at least 70% identity to SEQ ID NO:6, wherein the amino acid sequence comprises at least one substitution set forth herein; and (b) a polynucleotide that hybridizes under stringent hybridization conditions to the complement of a polynucleotide that encodes a polypeptide having the amino acid sequence of SEQ ID NO: 6, wherein the amino acid sequence comprises at least one substitution set forth herein.
- the present invention further provides nucleic acid constructs, wherein the polynucleotide sequence encodes a polypeptide comprising an amino acid sequence at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to SEQ ID NO:6, wherein the amino acid sequence comprises at least one substitution set forth herein.
- the polynucleotide sequence encodes a polypeptide comprising at least a portion of the amino acid sequence set forth in SEQ ID NO:6, wherein the amino acid sequence comprises at least one substitution set forth herein.
- the polynucleotide sequence encodes a polypeptide having an amino acid sequence that comprises at least one substitution at position 5, 13, 19, 49, 81, 149, 187, 189, 202, 205, 206, 210, 215, 218, 226, 227, 228, 229, 230, 231, 235, 239, 241, 251, 252, 256, 260, 286, 287, 296, 307, 327, 350, and/or 352, wherein the positions are numbered by correspondence with the amino acid sequence of P.
- the polynucleotide sequence encodes a polypeptide having an amino acid sequence that comprises at least one substitution selected from P5, D13, T19, A49, S81, H149, V187, L189, G202, V205, V206, 1208, F209, D210, N211, M215, D218, F226, N227, S228, K229, T230, G231, E235, A239, G241, C251, T252, P256, L260, T286, V287, F296, K307, D327, A350, and/or K352, wherein the positions are numbered by correspondence with the amino acid sequence of P.
- the polynucleotide sequence encodes a polypeptide having an amino acid sequence that comprises at least one substitution selected from P5E, P5R, DOG, T19L, T19Q, A49Q, S81G, H149R, V187M, L189C, G202D, V205C, V205H, V206A, I208R, F209S, D210W, N211K, N211R, N211S, M215A, M215C, D218R, F226V, N227T, S228P, K229R, T230V, G231A, G231H, E235K, E235Q, A239C, G241W, C251G, C251T, T252S, P256A, P256Q, L260Q, T286V, V287L, F296R, K307R, D
- the polynucleotide sequence is at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to SEQ ID NO:5, and wherein the polynucleotide sequence comprises at least one mutation set forth herein.
- the polynucleotide sequence comprises mutations at at least one position selected from t24g, c630t, a732g, a768t, a780g, wherein nucleotide position is determined by alignment with SEQ ID NO:5.
- the nucleic acid construct comprises SEQ ID NO:7 and/or SEQ ID NO: 8.
- the present invention provides an isolated nucleic acid sequence comprising SEQ ID NO:7, 8, and/or 48.
- the present invention also provides isolated xylitol dehydrogenase variants comprising the sequence set forth in SEQ ID NO:49.
- the present invention provides isolated xylitol dehydrogenase variants, wherein the variants have xylitol dehydrogenase activity and comprise a substitution at one or more positions selected from 5, 13, 19, 49, 81, 149, 187, 189, 202, 205, 206, 210, 215, 218, 226, 227, 228, 229, 230, 231, 235, 239, 241, 251, 252, 256, 260, 286, 287, 296, 307, 327, 350, and/or 352, wherein the positions are numbered by correspondence with the amino acid sequence of P.
- the xylitol dehydrogenase variant have xylitol dehydrogenase activity and comprise a substitution at one or more positions selected from P5, D13, T19, A49, S81, H149, V187, L189, G202, V205, V206, 1208, F209, D210, N211, M215, D218, F226, N227, S228, K229, T230, G231, E235, A239, G241, C251, T252, P256, L260, T286, V287, F296, K307, D327, A350, and/or K352, wherein the positions are numbered by correspondence with the amino acid sequence of P.
- the isolated xylitol dehydrogenase variant has xylitol dehydrogenase activity and comprises a substitution at one or more positions selected from P5E, P5R, DBG, T19L, T19Q, A49Q, S81G, H149R, V187M, L189C, G202D, V205C, V205H, V206A, I208R, F209S, D210W, N21 IK, N211R, N21 IS, M215A, M215C, D218R, F226V, N227T, S228P, K229R, T230V, G231A, G231H, E235K, E235Q, A239C, G241W, C251G, C251T, T252S, P256A, P256Q, L260Q, T286V, V2
- the present invention also provides recombinant nucleic acid constructs comprising polynucleotide sequences encoding at least one xylose reductase and at least one xylitol dehydrogenase, wherein the polynucleotide sequences are selected from SEQ ID NOS: l, 3, 4, 40, 42, 44, and 46; and SEQ ID NOS:5, 7, 8, 48.
- the present invention further provides recombinant nucleic acid constructs further comprising at least one polynucleotide sequence encoding at least one xylulokinase, wherein the polynucleotide sequence comprises SEQ ID NO: 11 and/or SEQ ID NO: 12.
- the recombinant nucleic acid constructs comprise at least one sequence selected from SEQ ID NOS: l, 3, 4, 5, 7, 8, 11, 12, 40, 42, 44, 46, and 48.
- the constructs comprise SEQ ID NO:46 and/or 48.
- the nucleic acid constructs further comprise at least one genetic element that facilitates stable integration into a fungal host genome.
- the nucleic acid constructs further comprise a genetic element that facilitates stable integration into a fungal host genome. In some embodiments, the genetic element facilitates integration into a fungal host genome by homologous recombination. In yet some additional embodiments, the nucleic acid constructs comprise a fungal origin of replication. In some embodiments, the fungal origin of replication is a yeast origin of replication. In some further embodiments, the polynucleotide sequence is operatively linked to a promoter sequence that is functional in a fungal cell. In some embodiments, the promoter sequence is a fungal promoter sequence. In some additional embodiments, the fungal promoter sequence is a yeast promoter sequence.
- the polynucleotide sequence is operatively linked to a transcription termination sequence that is functional in a fungal cell.
- the polynucleotide sequence contains codons optimized for expression in a yeast cell.
- the polynucleotide sequence comprises SEQ ID NO:3, 4, 7, 8, 11, and/or 12.
- the present invention also provides recombinant fungal host cells comprising at least one polynucleotide sequence encoding at least one xylose reductase, wherein the polynucleotide sequences comprise at least one mutation relative to SEQ ID NO: 1, as set foith herein.
- the recombinant fungal host cell comprises at least one polynucleotide sequence selected from SEQ ID NOS:3, 4, 40, 42, 44, and 46.
- the recombinant fungal host cells comprise at least one polynucleotide sequence encoding at least one xylitol dehydrogenase, wherein the polynucleotide sequence comprises at least one mutation relative to SEQ ID NO:5, as set forth herein.
- at least one polynucleotide sequence is selected from SEQ ID NOS:7, 8, and 48.
- the present invention also provides recombinant fungal host cells comprising at least one polynucleotide sequence encoding at least one xylulokinase, wherein the polynucleotide sequences comprise at least one mutation relative to SEQ ID NO:9. In some embodiments, at least one
- polynucleotide sequence is selected from SEQ ID NOS: 11 and 12.
- the present invention also provides recombinant fungal host cells comprising at least one polynucleotide sequence encoding at least one xylose reductase, wherein the polynucleotide sequence comprises SEQ ID NO: l, 3, 4, 40, 42, 44, and/or 46; and at least one polynucleotide encoding at least one xylitol dehydrogenase, wherein the polynucleotide sequence comprises SEQ ID NO:5, 7, 8, and/or 48.
- the recombinant fungal host cells further comprise at least one polynucleotide encoding at least one xylulokinase, wherein the polynucleotide comprises SEQ ID NO: l 1 and/or 12.
- at least one polynucleotide is integrated into the host cell genome.
- the host cell is a yeast cell.
- the host cell has had one or more native genes deleted from its genome.
- the deletion results in one or more phenotypes selected from increased transport of xylose into the host cell, increased xylulose kinase activity, increased flux through the pentose phosphate pathway, decreased sensitivity to catabolite repression, increased tolerance to ethanol, increased tolerance to acetate, increased tolerance to increased osmolarity, increased tolerance to low pH, and reduced production of by products, wherein comparison is made with respect to the corresponding host cell without the deletion(s).
- phenotypes selected from increased transport of xylose into the host cell, increased xylulose kinase activity, increased flux through the pentose phosphate pathway, decreased sensitivity to catabolite repression, increased tolerance to ethanol, increased tolerance to acetate, increased tolerance to increased osmolarity, increased tolerance to low pH, and reduced production of by products, wherein comparison is made with respect to the corresponding host cell without the deletion(s).
- the host cell is altered to overexpress one or more polynucleotides.
- overexpression results in one or more phenotypes selected from increased transport of xylose into the host cell, increased xylulose kinase activity, increased flux through the pentose phosphate pathway, decreased sensitivity to catabolite repression, increased tolerance to ethanol, increased tolerance to acetate, increased tolerance to increased osmolarity, increased tolerance to low pH, and reduced product of by products, wherein comparison is made to the corresponding unaltered host cell.
- the host cell comprises at least one xylose reductase variant and at least one xylitol dehydrogenase variant.
- the recombinant fungal host cells further comprise at least one xylulokinase.
- the xylulokinase is encoded by SEQ ID NO: l 1 and/or 12.
- the recombinant fungal host cell is transformed using nucleic acid constructs comprising from about two to about fifty copies of at least one xylose reductase and/or xylitol dehydrogenase and/or xylulokinase.
- the present invention be limited to any particular copy number of xylose reductase and/or xylitol dehydrogenase genes and/or xylulokinase, as any suitable number finds use in the present invention.
- the nucleic acid constructs comprise any combination of wild-type and/or variant xylose reductase and/or xylitol dehydrogenase and/or xylulokinase.
- any suitable method for introducing multiple copies of either xylose reductase and/or xylitol dehydrogenase and/or xylulokinase find use in the present invention.
- the present invention also provides processes for producing a fermentation product, comprising: (a) providing at least one recombinant fungal host cell provided herein; (b) providing a fermentation medium comprising; and (c) contacting the fermentation medium with the recombinant fungal host cell under conditions suitable for generating the fermentation product.
- the process further comprises (d) recovering the fermentation product.
- the fermenting step is carried out under conditions selected from microaerobic or aerobic conditions. In some embodiments, the fermenting step is carried out under anaerobic conditions.
- the fermentation product is selected from an alcohol, a fatty acid, lactic acid, acetic acid, 3-hydroxypropionic acid, aciylic acid, succinic acid, citric acid, malic acid, fumaric acid, succinic acid, an amino acid, 1,3 -propanediol, ethylene, glycerol, and a ⁇ -lactam.
- the fermentation product is an alcohol selected from ethanol and butanol. In some embodiments, the fermentation product is ethanol. In some embodiments, the fermentation medium comprises product from a saccharification process. In some further embodiments, the fermentation medium comprises hemicellulosic feedstock.
- Figure 1 depicts xylose conversion pathways.
- D-xylose is initially reduced to xylitol by NAD(P)H-dependent xylose reductase ("XR").
- Xylitol is subsequently oxidized to D-xylulose by NAD+-dependent xylitol dehydrogenase ("XDH” or "XD”).
- XDH NAD+-dependent xylitol dehydrogenase
- XK Xylulokinase
- PPP pentose phosphate pathway
- D-xylose is directly converted to D-xylulose by a xylose isomerase (“XI”).
- Figures 2A-C depict the metabolic pathways for converting D-xylulose-5-P to ethanol.
- FIG. 2A depicts the pentose phosphate pathway (PPP). The substrates and products are shown. The enzymes are represented by numbers as follows: 6. Ribulose-5-phosphate 3-epimerase; 7. Transketolase (TKL1); 8. Transaldolase (TALI); 9. Ribose-5-phosphate ketoisomerase (RKI1); 10. 6- phosphogluconate dehydrogenase (GND1); 11. 6-phosphogluconalactonase (SOL3); and 12. Glucoses- phosphate- 1 -dehydrogenase (ZWF).
- Figure 2B depicts the pathway of glycolysis. The substrates and products are shown. The enzymes are represented by numbers as follows: 13.
- Figure 2C depicts the metabolic pathway for conveiting pyruvate to ethanol.
- the substrates and products are shown.
- the enzymes are represented by numbers as follows: 23. Pyruvate decarboxylase; 24. Aldehyde dehydrogenase; and 25. Alcohol dehydrogenase.
- Figure 3 provides a map of plasmid PLS2802, comprising XR.2, XD.2, and XK.2 genes.
- the present invention provides methods and compositions suitable for use in the conversion of xylose to xylitol and xylulose, including nucleic acid constructs, recombinant fungal host cells, and related materials.
- nucleic acids are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
- the headings provided herein are not limitations of the various aspects or embodiments of the invention that can be had by reference to the specification as a whole. Accordingly, the terms defined below are more fully defined by reference to the specification as a whole.
- isolated and purified are used to refer to a molecule (e.g., an isolated nucleic acid, polypeptide, etc.) or other component that is removed from at least one other component with which it is naturally associated.
- a reference enzyme refers to an enzyme to which a variant enzyme of the present invention is compared in order to determine the presence of an improved property in the variant enzyme being evaluated, including but not limited to improved thermoactivity, improved thermostability, or improved stability.
- a reference enzyme is a wild-type enzyme (e.g., wild-type xylose reductase or xylitol dehydrogenase).
- a reference enzyme is another variant enzyme (e.g., another variant xylose reductase or xylitol dehydrogenase enzyme of the present invention).
- recombinant refers to a polynucleotide or polypeptide that does not naturally occur in a host cell.
- recombinant molecules contain two or more naturally-occurring sequences that are linked together in a way that does not occur naturally.
- a recombinant cell contains a recombinant polynucleotide or polypeptide.
- enzyme variant and “variant enzyme” are used in reference to enzymes that are similar to a reference enzyme, particularly in their function, but have mutations in their amino acid sequence that make them different in sequence from the wild-type or another reference enzyme.
- Enzyme variants e.g., "xylose reductase variants” and/or “xylitol dehydrogenase variants"
- mutagenesis kits are also available from many commercial molecular biology suppliers.
- Methods are available to make specific substitutions at defined amino acids (site-directed), specific or random mutations in a localized region of the gene (regio-specific) or random mutagenesis over the entire gene (e.g., saturation mutagensis).
- site-directed site-directed mutagenesis of single-stranded DNA or double-stranded DNA using PCR, cassette mutagenesis, gene synthesis, error-prone PCR, shuffling, and chemical saturation mutagenesis, or any other suitable method known in the art.
- the variants can be screened for the desired property (e.g., high or increased; or low or reduced activity, increased thermal and/or alkaline stability, etc.).
- combinatorial variant refers to any variant that has a combination of two or more mutations (e.g., substitutions). In some embodiments, the combination of mutations results in changes in enzyme activity (e.g., improved thermostability, improved thermoactivity, improved specific activity, etc.).
- overexpress is intended to encompass increasing the expression of a protein to a level greater than the cell normally produces. It is intended that the term encompass overexpression of endogenous, as well as heterologous proteins.
- a cell of a particular strain refers to a parental cell of the strain as well as progeny and genetically modified derivatives.
- Genetically modified derivatives of a parental cell include progeny cells that contain a modified genome or episomal plasmids that confer for example, antibiotic resistance, improved fermentation, the ability to utilize xylose as a carbon source, etc.
- nucleic acid construct e.g., a polynucleotide
- polypeptide e.g., a polypeptide
- host cell e.g., a cell
- recombinant when it is non-naturally occurring, artificial or engineered.
- xylose reductase and “xylose reductase polypeptide” are used interchangeably herein to refer to an enzyme that is capable of catalyzing xylose to xylitol.
- the ability to catalyze xylose to xylitol is referred to herein as "xylose reductase activity”.
- protein and “polypeptide” are used interchangeably herein to refer to a polymer of amino acid residues.
- xylose reductase polynucleotide refers to a polynucleotide that encodes a xylose reductase polypeptide.
- xylose reductase polynucleotides employed in the practice of the present invention encode a polypeptide comprising an amino acid sequence that is at least about 71% identical, at least about 72% identical, at least about 73% identical, at least about 74% identical, at least about 75% identical, at least about 76% identical, at least about 77% identical, at least about 78% identical, at least about 79% identical, at least about 80% identical, at least about 81% identical, at least about 82% identical, at least about 83% identical, at least about 84% identical, at least about 85% identical, at least about 86% identical, at least about 87% identical, at least about 88% identical, at least about 89% identical, at least about 90% identical, at least about 91% identical, at least about 92% identical, at least about 93% identical, at least about 94% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, or at least about 99% identical to SEQ ID NO:
- the xylose reductase polynucleotide encodes a polypeptide having an amino acid sequence comprising SEQ ID NO:41,43, 45, and/or 47.
- xylose reductase polynucleotides employed in the practice of the present invention comprise polynucleotide sequences that are at least about 70% identical, at least about 71% identical, at least about 12% identical, at least about 73%) identical, at least about 74% identical, at least about 75%> identical, at least about 76% identical, at least about 77% identical, at least about 78% identical, at least about 19% identical, at least about 80% identical, at least about 81 ) identical, at least about 82% identical, at least about 83% identical, at least about 84%) identical, at least about 85% identical, at least about 86%) identical, at last about 87% identical, at least about 88% identical, at least about 89%o identical, at least about 90% identical, at least about 91% identical
- xylitol dehydrogenase and “xylitol dehydrogenase polypeptide” are used interchangeably herein to refer to an enzyme that is capable of catalyzing xylitol to xylulose.
- the ability to catalyze xylitol to xylulose is referred to herein as "xylitol dehydrogenase activity”.
- xylitol dehydrogenase polynucleotide refers to a polynucleotide that encodes a xylitol dehydrogenase polypeptide.
- xylitol dehydrogenase polynucleotides employed in the practice of the present invention encode polypeptides comprising amino acid sequences that are at least about 71% identical, at least about 12% identical, at least about 13% identical, at least about 74%> identical, at least about 75% identical, at least about 76% identical, at least about 77% identical, at least about 78% identical, at least about 19% identical, at least about 80% identical, at least about 81%> identical, at least about 82% identical, at least about 83%> identical, at least about 84% identical, at least about 85% identical, at least about 86% identical, at least about 87% identical, at least about 88% identical, at least about 89%) identical, at least about 90% identical, at least about 91% identical, at least about 92% identical, at least about 93%> identical, at least about 94% identical, at least about 95% identical, at least about 96% identical, at least about 91% identical, at least about 98%> identical, or at least about
- the xylitol dehydrogenase polynucleotide encodes a polypeptide having an amino acid sequence comprising SEQ ID NO:6 and/or 49, wherein SEQ ID NO:6 further comprises at least one substitution as set forth herein
- xylulokinase polynucleotides employed in the practice of the present invention comprise polynucleotides sequence that are at least about 70% identical, at least about 71%> identical, at least about 72% identical, at least about 73% identical, at least about 74% identical, at least about 15% identical, at least about 76% identical, at least about 77% identical, at least about 78% identical, at least about 79% identical, at least about 80% identical, at least about 81% identical, at least about 82% identical, at least about 83% identical, at least about 84% identical, at least about 85% identical, at least about 86% identical, at last about 87% identical, at least about 88%) identical, at least about 89%o identical, at least about 90% identical, at least about 91% identical, at least about 92% identical, at least about 93% identical, at least about 94% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, or at least about 99% identical
- percent identity refers to the percent amino acid or polynucleotide sequence identity that is obtained by ClustalW analysis (version W 1.8 available from European Bioinformatics Institute, Cambridge, UK), counting the number of identical matches in the alignment and dividing such number of identical matches by the length of the reference sequence, and using the following ClustalW parameters to achieve slow/accurate pairwise optimal alignments - DNA/Protein Gap Open Penalty: 15/10;
- DNA/Protein Gap Extension Penalty:6.66/0.1; Protein weight matrix: Gonnet series; DNA weight matrix: Identity; Toggle Slow/Fast pairwise alignments SLOW or FULL Alignment; DNA/Protein Number of K-tuple matches:2/l; DNA/Protein number of best diagonals: 4/5; DNA/Protein Window size: 4/5.
- Two sequences are "aligned” when they are aligned for similarity scoring using a defined amino acid substitution matrix (e.g., BLOSUM62), gap existence penalty and gap extension penalty so as to arrive at the highest score possible for that pair of sequences.
- Amino acid substitution matrices and their use in quantifying the similarity between two sequences are well known in the art (See, e.g., Dayhoff et ah, in Dayhoff [ed.], Atlas of Protein Sequence and Structure," Vol. 5, Suppl. 3, Natl. Biomed. Res. Round., Washington D.C. [1978]; pp. 345-352; and Henikoff et ah, Proc. Natl. Acad. Sci.
- the BLOSUM62 matrix is often used as a default scoring substitution matrix in sequence alignment protocols such as Gapped BLAST 2.0.
- the gap existence penalty is imposed for the introduction of a single amino acid gap in one of the aligned sequences, and the gap extension penalty is imposed for each additional empty amino acid position inserted into an already opened gap.
- the alignment is defined by the amino acid position of each sequence at which the alignment begins and ends, and optionally by the insertion of a gap or multiple gaps in one or both sequences so as to arrive at the highest possible score.
- the present invention also provides a recombinant nucleic acid construct comprising a xylose reductase polynucleotide sequence that hybridizes under stringent hybridization conditions to the complement of a polynucleotide which encodes a polypeptide having the amino acid sequence of SEQ ID NO:2, wherein the polypeptide is capable of catalyzing the xylose to xylitol, and the polypeptide comprises at least one substitution set forth herein.
- the polynucleotide that hybridizes to the complement of a polynucleotide which encodes a polypeptide having the amino acid sequence of SEQ ID NO:2, wherein the polypeptide comprises at least one substitution as set forth herein does so under high or very high stringency conditions to the complement of a reference sequence having the sequence of SEQ ID NO: l (e.g., over substantially the entire length of the reference sequence).
- the polynucleotide that hybridizes to the complement of a polynucleotide which encodes a polypeptide having the amino acid sequence of SEQ ID NO:2, wherein the polypeptide comprises at least one substitution as set forth herein does so under high or very high stringency conditions to the complement of a reference sequence having the sequence of SEQ ID NO: 3 (e.g., over substantially the entire length of the reference sequence).
- the polynucleotide that hybridizes to the complement of a polynucleotide which encodes a polypeptide having the amino acid sequence of SEQ ID NO:2, wherein the amino acid sequence comprises at least one substitution as set forth herein does so under high or very high stringency conditions to the complement of a reference sequence having the sequence of SEQ ID NO:4 (e.g., over substantially the entire length of the reference sequence).
- the present invention also provides a recombinant nucleic acid construct comprising a xylitol dehydrogenase polynucleotide sequence that hybridizes under stringent hybridization conditions to the complement of a polynucleotide which encodes a polypeptide having the amino acid sequence of SEQ ID NO: 6, wherein the polypeptide comprises at least one substitution set forth herein, and wherein the polypeptide is capable of catalyzing xylitol to xylulose.
- nucleic acids "hybridize” when they associate, typically in solution. There are numerous texts and other reference materials that provide details regarding hybridization methods for nucleic acids (See e.g., Tijssen, Laboratory Techniques in Biochemistry and Molecular Biology-Hybridization with Nucleic Acid Probes," Parti, Chapter 2, Elsevier, New York, [1993], which is incorporated herein by reference).
- low to very high stringency conditions are defined as follows: prehybridization and hybridization at 42°C in 5xSSPE, 0.3% SDS, 200 ⁇ g/ml sheared and denatured salmon sperm DNA, and either 25% formamide for low stringencies, 35% formamide for medium and medium-high stringencies, or 50% formamide for high and very high stringencies, following standard Southern blotting procedures.
- the carrier material is finally washed three times each for 15 minutes using 2xSSC, 0.2% SDS at least at 50°C (low stringency), at least at 55°C (medium stringency), at least at 60°C (medium-high stringency), at least at 65°C (high stringency), and at least at 70°C (very high stringency).
- the "position" is denoted by a number that sequentially identifies each amino acid in the reference sequence based on its position relative to the N-terminus. Owing to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, in general the amino acid residue number in a test sequence determined by simply counting from the N- terminal will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where there is a deletion in an aligned test sequence, there will be no amino acid that corresponds to a position in the reference sequence at the site of deletion. Where there is an insertion in an aligned reference sequence, that insertion will not correspond to any amino acid position the reference sequence. In the case of truncations or fusions there can be stretches of amino acids in either the reference or aligned sequence that do not correspond to any amino acid in the corresponding sequence.
- transformed and “transformation” used in reference to a cell refer to a cell that has a non-native nucleic acid sequence integrated into its genome or has an episomal plasmid that is maintained through multiple generations.
- by-product refers to an organic molecule that is an undesired product of a particular fermentation process.
- xylose pathway refers to the steps of conversion of xylose to xylulose phosphate which is then metabolized through the pentose phosphate pathway. In some embodiments, this involves the reduction of xylose to xylitol, oxidation of xylitol to xylulose and subsequent conversion of xylulose to xylulose phosphate. In some other embodiments the xylose is directly converted to xylulose which is then phosphoiylated to xylulose phosphate.
- xylose pathway enzymes refers to the enzymes that catalyze the conversion of xylose to xylulose-phosphate.
- these enzymes comprise xylose reductase, xylitol dehydrogenase and/or xylulose kinase.
- the enzymes comprise xylose isomerase and xylulose kinase.
- the present invention provides methods and compositions suitable for use in the conversion of xylose to xylitol and xylulose, including nucleic acid constructs, recombinant fungal host cells, and related materials.
- D-xylose is initially reduced to xylitol by NAD(P)H-dependent xylose reductase (“XR”) (EC 1.1.1.21).
- Xylitol is subsequently oxidized to D-xylulose by NAD+-dependent xylitol dehydrogenase ("XDH” or "XD”) (EC 1.1.1.9).
- Xylulokinase EC 2.7.1.17) subsequently phosphorylates D- xylulose to produce D-xylulose 5-phosphate (“X5P”), which is then further metabolized through the pentose phosphate pathway (“PPP").
- Figure 1 provides a schematic of the pathway.
- D-xylulose may be phosphorylated by a native or recombinant xylulokinase to xylulose-5-P, as depicted in Figure 1.
- the xylulose-5-P may be further metabolized by enzymes in the pentose phosphate pathway to products such as glucose-6-P, fructose-6-P, glyceraldehydes-3-P, and the like.
- the pentose phosphate pathway and relevant enzymes and products are depicted in Figure 2A.
- enzyme from the pentose phosphate pathway and "pentose phosphate pathway enzyme” are used interchangeably to refer to an enzyme from the group of enzymes involved in the pentose phosphate pathway, (i.e., 6. ribulose-5-phosphate ketoisomerase (RKl 1); 7. transketolase (TKLl); 8. transaldolase (TALI); 9. ribose-5 -phosphate ketolisomerase (RKl 1); 10. 6-phosphogluconate dehydrogenase (GND1); 11. 6-phosphogluconalactonase (SOL3); and/or 12. glucose-6-phosphate-l -dehydrogenase (ZWF); the reference numbers correspond to those in Figure 2A).
- glycolytic enzyme refers to an enzyme from the group of enzymes involved in glycolysis (i.e.: 13. hexokinase; 14. phosphoglucose isomerase; 15. phosphofructokinase; 16. aldolase; 17. triose phosphate isomerase; 18. glyceraldehyde phosphate dehydrogenase; 19. phosphoglycerate kinase; 20.
- Pyruvate from the glycolytic pathway may be further metabolized to ethanol as shown in Figure 2C by ethanologenic enzymes.
- ethanologe ic enzyme refers to an enzyme involved in the conversion of pyruvate to ethanol, (e.g., a pyruvate decarboxylase, an aldehyde dehydrogenase, and/or an alcohol dehydrogenase).
- ethanologenic pathway refers to the pathway depicted in Figure 2C.
- Recombinant host cells transformed with xylose reductase and xylitol dehydrogenase genes are hence capable of converting xylose to xylitol and then converting xylitol to xylulose, which can lead to the production of desirable fermentation products (e.g., an alcohol, such as ethanol, butanol, and the like, including, but not limited to a fatty alcohol [e.g., a C8-C20 fatty alcohol], a fatty acid [e.g., a C8-C20 fatty acid], lactic acid, 3-hydroxpropionic acid, acrylic acid, acetic acid, succinic acid, citric acid, malic acid, fumaric acid, an amino acid, 1,3 -propanediol, ethylene, glycerol, a ⁇ -lactam, and the like).
- an alcohol such as ethanol, butanol, and the like, including, but not limited to a fatty
- the present application provides improved xylose reductase and xylitol dehydrogenase variants that significantly increase the efficiency of xylose conversion.
- the present invention provides recombinant nucleic acid constructs comprising
- polypeptide sequences that encode at least one polypeptide comprising an amino acid sequence having at least 70% identity to SEQ ID NO:2, wherein the polypeptide is capable of catalyzing xylose to xylitol, and wherein the polypeptide comprises at least one substitution set forth herein.
- SEQ ID NO:2 corresponds to the amino acid sequence encoding xylose reductase from the yeast, Pichia stipitis.
- SEQ ID NO: 1 corresponds to the native P. stipitis polynucleotide sequence that encodes a P.
- nucleic acid construct comprises SEQ ID NO:40, while in other embodiments, the nucleic acid construct comprises SEQ ID NO:42, in still other embodiments, the nucleic acid construct comprises SEQ ID NO:44, and in additional embodiments, the nucleic acid construct comprises SEQ ID NO:46.
- the polypeptide comprises SEQ ID NO:41, while in other embodiments, the polypeptide comprises SEQ ID NO:43, in still other embodiments, the polypeptide comprises SEQ ID NO:45, and in further embodiments, the polypeptide comprises SEQ ID NO:47.
- the present invention also provides a recombinant nucleic acid constructs comprising polynucleotide sequences that encode at least one polypeptide comprising an amino acid sequence having at least 70% identity to SEQ ID NO:6, wherein the polypeptide is capable of catalyzing xylitol to xylulose, and wherein the polypeptide comprises at least one substitution set forth herein.
- SEQ ID NO: 6 corresponds to the amino acid sequence encoding xylitol dehydrogenase from the yeast, Pichia stipitis.
- SEQ ID NO: 5 corresponds to the native P. stipitis polynucleotide sequence that encodes a P.
- nucleic acid construct comprises SEQ ID NO:48, while in other embodiments, the nucleic acid construct encodes a polypeptide comprising SEQ ID NO:49.
- the present invention also provides recombinant nucleic acid constructs comprising polynucleotide sequences that encode polypeptide sequences having xylose reductase and xylitol dehydrogenase activity.
- the nucleic acid constructs comprise at least one of SEQ ID NO:40, 42, 44, and/or 46, and SEQ ID NO:48.
- the present invention also provides nucleic acid constructs comprising codon-optimized polynucleotides encoding xylulokinase.
- the present invention provides SEQ ID NO: l 1, while in other embodiments, the present invention provides SEQ ID NO: 12.
- the present invention also provides nucleic acid constructs comprising polynucleotides encoding xylose reductase, xylitol dehydrogenase and xylulokinase.
- the nucleic acid constructs comprise SEQ ID NO: l, 3, 4, 40, 42, 44, and/or 46, as well as SEQ ID NO: 5, 7, 8, and/or 48, and SEQ ID NO:9, 11, and/or 12.
- nucleic acid constructs of the present invention further comprise a polynucleotide sequence (genetic) element that facilitates integration into a fungal host cell genome, by homologous or non-homologous recombination.
- the nucleic acid construct of the present invention further comprises an origin of replication that is functional in a fungal cell (e.g., a yeast origin of replication).
- the fungal host cell is a yeast or filamentous fungal cell, more typically, a yeast cell.
- nucleic acid constructs of the present invention comprise a transcriptional regulatory element that is functional in a fungal cell.
- the recombinant nucleic acid construct comprises a promoter sequence and/or transcription terminator sequence that is functional in a fungal cell such that the xylose reductase and/or xylitol dehydrogenase polynucleotide is operatively linked to the promoter sequence and/or transcription terminator sequences.
- Xylose reductase and xylitol dehydrogenase polynucleotides that are suitable for use in the practice of the present invention include those encoding variants of SEQ ID NO:2 and/or 6, respectively. These variants include those having amino acid sequences with one or more conservative or non- conservative substitutions relative to the amino acid sequence of SEQ ID NO: 2 and/or SEQ ID NO:6. As used herein, the term "conservative substitution" refers to the substitution of a residue for another residue that does not generally alter the specific activity of the encoded polypeptide.
- An exemplary conservative substitution is a substitution that is within the same group of basic amino acids (arginine, lysine and histidine), acidic amino acids (glutamic acid and aspartic acid), polar amino acids (glutamine and asparagine), hydrophobic amino acids (leucine, isoleucine and valine), aromatic amino acids
- polynucleotides encoding conservatively substituted variations of the P. stipitis xylose reductase and/or xylitol dehydrogenase employed in the practice of the present invention include substitutions of a small percentage, typically less than about 5%, more typically less than 2%, and often less than about 1% of the amino acids of the polypeptide sequence, with a conservatively selected amino acid of the same conservative substitution group.
- xylose reductase and/or xylitol dehydrogenase polynucleotides suitable for use in the practice of the present invention include those encoding variants of P. stipitis xylose reductase and/or xylitol dehydrogenase generated by mutagenesis, recombination, or other protein engineering method followed by screening of the variants for xylose utilization using a method, such as that described in the Examples.
- the resulting variants comprise one or more substitutions (conservative or non-conservative), deletions, and/or insertions.
- the present invention thus provides methods for making improved P.
- stipitis xylose reductase and xylitol dehydrogenase polynucleotide variants wherein the method comprises introducing one or more modifications into a polynucleotide encoding SEQ ID NO: 1, 3 and/or 4; and/or 5, 7 and/or 8, respectively, to produce a modified polynucleotide, wherein the modification is selected from at least one substitution, at least one deletion, and/or at least one insertion; transforming a host cell with the modified polynucleotide; and screening the transformed host cell for an improvement in a desired phenotype relative to the corresponding untransformed host cell.
- the improved variants are screened to assess improvements in a desired phenotype relative to a transformed host cell that has been transformed with wild-type sequences, while in other embodiments, transformed host cells are compared with other transformed host cells.
- exemplary phenotypes include improved utilization of a pentose sugar (e.g., xylose, arabinose, etc.), stability, specific activity, lower Ki for xylitol, ethanol/acetate tolerance and/or tolerance to low pH, decreased byproduct formation, and/or increased ethanol yield.
- Exemplary desirable xylose utilization phenotypes include the ability to ferment xylose to ethanol, the ability to ferment xylose to other metabolic intermediates/products, the ability to undergo aerobic or anaerobic growth on xylose, and the like.
- mutagenesis and directed evolution methods can be readily applied to polynucleotides encoding the xylose reductase polypeptide of SEQ ID NO:2 and/or xylitol dehydrogenase of SEQ ID NO:6, to generate variant libraries that can be expressed, screened, and assayed using the methods described herein.
- Mutagenesis and directed evolution methods are well known in the art ⁇ See e.g., Ling et al, Anal. Biochem, 254(2): 157-78 [1997]; Dale et al, Meth. Mol.
- the present invention provides P. stipitis polypeptide variants that comprise at least one modification that is a substitution, insertion, and/or deletion relative to SEQ ID NO:2.
- the polypeptide variant has from 1 to 2, 1 to 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, up to about 50, 75, 100, or 130 modifications.
- the xylose reductase variants of the present invention comprise a substitution at position 276 of wild-type P. stipitis xylose reductase.
- the xylose reductase variants comprise at least one substitution at positions 2, 49, 132, 233, 267, and/or 276, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylose reductase set forth in SEQ ID NO:2.
- the substitutions comprise substitutions at R276, P2, A49, K132, S233, 1267, and/or R276.
- the substitutions comprise R276W, P2T, A49G, K132N, S233K, I267V, and/or R276W, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylose reductase set forth in SEQ ID NO:2.
- the variants comprise substitutions P2T, A49G, and R276W, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylose reductase set forth in SEQ ID NO:2.
- the variants comprise substitutions P2T, A49G, K132N, S233K, I267V, and R276W, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylose reductase set forth in SEQ ID NO:2.
- the variants comprise at least one substitution selected from position 2, 3, 7, 11, 14, 17, 23, 24, 33, 36, 46, 47, 49, 56, 62, 68, 89, 97, 102, 108, 114, 116, 123, 132, 134, 143, 152, 155, 157, 162, 168, 184, 206, 219, 224, 225, 226, 228, 246, 231, 232, 233, 236, 240, 242, 245, 246, 249, 252, 255, 261, 266, 267, 275, 276, 279, 281, 282, 283, 285, 297, 301, 302, 303, and 318, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylose reductase set forth in SEQ ID NO:2.
- the variants comprise at least one substitution selected from P2, S3, N7, Dl 1, A14, F17, D23, V24, R33, K36, E46, D47, A49, A56, 162, K68, E89, S97, D102, L108, Tl 14, Kl 16, K123, K132, D134, 1143, K152, K155, G157, 1162, P168, S184, R206, Q219, L224, N225, Q226, R228, A246, N231, T232, S233, F236, T240, K242, A245, A246, G249, P252, V255, S261, A266, 1267, P275, R276, E279, K281, D282, V283, S285, A297, 1301, N302, L303, and V318, , wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylose reductase set forth in SEQ ID
- the substitutions comprise at least one substitution selected from P2T, S3H, S3R, S3W, N7L, Dl lK, A14V, F17W, D23E, V24G, R33L, R22V, K36Q, E46K, D47G, D47N, A49G, A56E, A56Y, I62V, K68G, K68M, K68R, E89N, E89V, S97R, S97T, D102T, L108Y, T114S, K116Q, K123C, K132A, K132N, D134E, D134H, D134V, I143L, K152A, K152E, K152H, K152Q, K155A, K155D, K155I, K155R, K155Y, G157R, I162L, P168S, S184A, R206S, R206V, Q219H, Q219L, Q219T, L224A, L
- the present invention provides polynucleotide sequences encoding xylose reductase variants comprising SEQ ID NO:40, as provided below. In some additional embodiments, the present invention provides polypeptide sequences comprising SEQ ID NO:41, as provided below.
- the present invention provides polynucleotide sequences encoding xylose reductase variants comprising SEQ ID NO:42, as provided below. In some additional embodiments, the present invention provides polypeptide sequences comprising SEQ ID NO:43, as provided below.
- the present invention provides polynucleotide sequences encoding xylose reductase variants comprising SEQ ID NO:44, as provided below. In some additional embodiments, the present invention provides polypeptide sequences comprising SEQ ID NO: 45, as provided below.
- the present invention provides polynucleotide sequences encoding xylose reductase variants comprising SEQ ID NO:46, as provided below. Ln some additional embodiments, the present invention provides polypeptide sequences comprising SEQ ID NO:47, as provided below. ATGCCTTCTATTAAGTTGAACTCTGGTTACGACATGCCAGCCGTCGGTTTCGGCTGTTGGAAA
- the present invention also provides nucleic acid substitutions in sequences encoding xylose reductase variants (e.g., SEQ ID NOS: l, 3 and/or 4).
- the nucleic acids comprise substitutions at positions 42, 82, 99, 156, 201, 280, 306, 354, 358, 378, 408, 438, 478, 511, 585, 670, 688, 703, 747, 751, 766, 855, 849, and/or 906, wherein the positions are numbered by correspondence with the nucleic acid sequence of P. stipitis xylose reductase set forth in SEQ ID NO: l, 3 and/or 4.
- the substitutions comprise t82a, t99a, gl56a, c201t, a280c, c306t, t354g, t358c, a378t, c408t, a426t, c438t, a478c, t511c, a585g, t670c, t688c, t703c, t747c, t751a, t766c, c849g, c855t, and/or c906t, wherein the positions are numbered by correspondence with the nucleic acid sequence of P. stipitis xylose reductase set forth in SEQ ID NO: l, 3 and/or 4.
- the present invention further provides xylitol dehydrogenase variants comprising at least one substitution at positions 5, 13, 19, 49, 81, 149, 187, 189, 202, 205, 206, 208, 209, 211, 215, 218, 226, 227, 228, 229, 231, 235, 239, 241, 251, 252, 256, 260, 287, 296, 307, 327, 350, and/or 352, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylose reductase set forth in SEQ ID NO:6.
- the xylitol dehydrogenase variants comprise substitution at position 208, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylitol dehydrogenase set forth in SEQ ID NO:6.
- the substitution at position 208 is I208X.
- the substitution at position 208 is I208R.
- the xylitol dehydrogenase variants comprise substitutions at position 211, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylitol dehydrogenase set forth in SEQ ID NO:6.
- the substitution at position 21 1 is N21 IX.
- the substitution is N21 IK, while in other embodiments, the substitution is N21 IS, and in still other embodiments, the substitution is N21 IK.
- the xylitol dehydrogenase variants comprise substitutions at positions
- the substitution at position 208 is I208X and the substitution at position 211 is N21 IX.
- the substitutions comprise I208R and N21 IK, while in some other embodiments, the substitutions comprise I208R and N211S.
- the xylitol dehydrogenase variants comprise substitutions at positions
- substitutions are F209X and N211X.
- the xylitol dehydrogenase variants comprise substitutions at positions 208, 209 and 211, wherein the positions are numbered by correspondence with the amino acid sequence of P. stipitis xylitol dehydrogenase set forth in SEQ ID NO:6.
- the substitutions are I208X, F209X, and N21 IX.
- the substitutions are I208R, F209S, and N21 1S.
- the present invention also provides nucleic acid substitutions in sequences encoding xylitol dehydrogenase variants ⁇ e.g., SEQ ID NOS:5, 7, and/or 8).
- the nucleic acids comprise substitutions at positions t24g, c630t, a732g, a768t, and/or a780g, wherein the positions are numbered by correspondence with the nucleic acid sequence of P.
- the present invention provides polypeptides that comprise XR and XD substitutions, including, but not limited to combinations of substitutions at positions 271, 270, 272, and/or 276 in XR (wherein the positions are numbered by correspondence with SEQ ID NO:2) and substitutions at positions 208, 209, and/or 211 in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6).
- substitutions comprise substitutions S271X, K270, N272, and/or R276 in XR (wherein the positions are numbered by correspondence with SEQ ID NO:2) and substitutions I208X, F209X, and/or N21 IX in XD (wherein the positions are numbered by
- substitutions comprise substitutions S271G, K270R, N272P, and/or R276F in XR (wherein the positions are numbered by correspondence with SEQ ID NO:2) and substitutions I208R, F209S, and/or N21 IK in XD (wherein the positions are numbered by correspondence with SEQ ID NO: 6).
- the substitutions comprise R276F in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and I208R in XD (wherein the position is numbered by correspondence with SEQ ID NO:6).
- the substitutions comprises R276F in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and F209S and N21 IK in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6).
- the substitutions comprise S271G in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and I208R and N21 IK in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6). In some embodiments, the substitutions comprise S271G in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and I208R and N21 IS in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6).
- the substitutions comprise R276F in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and I208R, F209S and N21 IK in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6).
- the substitutions comprise S271G in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and I208R in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6).
- the substitutions comprise K270R in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and I208R and N211R in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6). In some embodiments, the substitutions comprise K270R in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and F209S and N21 IK in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6).
- the substitutions comprise N272P and R276F in XR (wherein the position is numbered by correspondence with SEQ ID NO:2), and F209S and N21 IK in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6).
- the substitutions comprise K270R, N272P and R276F in XR (wherein the position is numbered by correspondence with SEQ ID NO: 2), and N21 IK in XD (wherein the positions are numbered by correspondence with SEQ ID NO:6).
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprises R276F, amino acid substitutions in SEQ ID NO:6 comprise I208R, and the nucleic acid substitutions comprise t811a and c816t in SEQ ID NO: l, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise R276F, amino acid substitutions in SEQ ID NO:6 comprise F209S and N21 IK, and the nucleic acid substitutions comprise t81 la and c816t in SEQ ID NO: l, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise S271G, amino acid substitutions in SEQ ID NO:6 comprise I208R and N21 IK, and the nucleic acid substitutions comprise c816t and a826c in SEQ ID NO: 1, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise S271G, amino acid substitutions in SEQ ID NO:6 comprise I208R and N211 S, and the nucleic acid substitutions comprise c816t and a826c in SEQ ID NO: l, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise R276F, amino acid substitutions in SEQ ID NO:6 comprise I208R, F209S and N211K, and the nucleic acid substitutions comprise t81 la and c816t in SEQ ID NO: 1, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise S271G, amino acid substitutions in SEQ ID NO:6 comprise I208R, and the nucleic acid substitutions comprise c816t and a826c in SEQ ID NO: 1, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise K270R, amino acid substitutions in SEQ ID NO:6 comprise I208R and N211R, and the nucleic acid substitutions comprise t81 la, c816t, and a826c, in SEQ ID NO: l, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise K270R, amino acid substitutions in SEQ ID NO:6 comprise F209S and N21 IK, and the nucleic acid substitutions comprise t811a, c816t, and a826c, in SEQ ID NO: l, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise K272P and R276F, amino acid substitutions in SEQ ID NO:6 comprise F209S and N21 IK, and the nucleic acid substitutions comprise t81 la in SEQ ID NO: l, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:2 comprise K270R, N272P, and R276F, amino acid substitutions in SEQ ID NO:6 comprise N21 IK, and the nucleic acid substitutions comprise t81 la in SEQ ID NO: l, 3 and/or 4.
- the present invention provides XR and XD variants having amino acid and nucleic acid substitutions, wherein amino acid substitutions in SEQ ID NO:6 comprise I208R, and the nucleic acid substitutions comprise t811a, c816t, and a826c, in SEQ ID NO: l, 3 and/or 4.
- the present invention provides polynucleotide sequences encoding xylitol dehydrogenase variants comprising SEQ ID NO:48, as provided below.
- the present invention provides polypeptide sequences comprising SEQ ID NO:49, as provided below.
- the present invention provides polynucleotide sequences encoding xylose reductase variants comprising SEQ ID NO:46 and xylitol dehydrogenase variants comprising SEQ ID NO:48. In some additional embodiments, the present invention provides polypeptide sequences comprising SEQ ID NO:47 and SEQ ID NO:49.
- polynucleotides encoding a truncated variant of P. stipitis xylose reductase and/or a truncated variant xylitol dehydrogenase capable of catalyzing xylose to xylitol and/or xylitol to xylulose.
- these truncation variants are truncated at the carboxy (C)-terminus and/or the amino (N)-terminus.
- the truncation is from about 1 to about 50 amino acid residues in length.
- nucleotide sequences that encode the xylose isomerase polypeptides described herein exist.
- Table 1 provides the standard triplet genetic code for each amino acid.
- the codons AGA, AGG, CGA, CGC, CGG, and CGU all encode the amino acid arginine.
- the codon can be altered to any of the corresponding codons described above without altering the encoded polypeptide.
- U in an R A sequence corresponds to T in a DNA sequence.
- the invention contemplates and provides each and every possible variation of nucleic acid sequence encoding a polypeptide of the invention that could be made by selecting combinations based on possible codon choices.
- DNA sequences are designed for high codon usage bias (i.e., codons that are used at higher frequency in the protein coding regions than other codons that code for the same amino acid).
- the preferred codons are determined in relation to codon usage in a single gene, a set of genes of common function or origin, highly expressed genes, the codon frequency in the aggregate protein coding regions of the whole organism, codon frequency in the aggregate protein coding regions of related organisms, or combinations thereof. Codons whose frequency increases with the level of gene expression are typically optimal codons for expression.
- a DNA sequence can be optimized for expression in a particular host organism.
- codon frequency e.g., codon usage, relative synonymous codon usage
- codon preference in specific organisms, including multivariate analysis, for example, using cluster analysis or correspondence analysis, and the effective number of codons used in a gene
- the data source for obtaining codon usage may rely on any available nucleotide sequence capable of coding for a protein.
- These data sets include nucleic acid sequences actually known to express proteins (e.g., complete protein coding sequences-CDS), expressed sequence tags (ESTs), or predicted coding regions of genomic sequences (See e.g., Mount,
- the xylose reductase and xylitol dehydrogenase polynucleotides contain codons optimized for expression in a fungal cell, particularly a yeast cell.
- codon-optimized xylose reductase polynucleotide sequence is provided as SEQ ID NOS:3 and 4.
- codon-optimized xylitol dehydrogenase polynucleotides are provided herein (SEQ ID NOS:7 and 8), as well as codon-optimized xylulokinase polynucleotides (SEQ ID NOS: 11 and 12).
- the codon-optimized sequences provide various advantages, as compared to the corresponding wild-type S. cerevisiae sequence(s).
- Certain silent mutations have been identified in P. stipitis xylose reductase and xylitol dehydrogenase polynucleotide variants that appear to confer the property of greater xylose utilization in transformed Saccharomyces cerevisiae. These variants are described in the Examples.
- the silent mutations include t24g, t82a, t99a, gl56a, c201t, a280c, c306t, t354g, t358c, a378t, c408t, a426t, c438t, a478c, t51 lc, a585g, c630t, t670c, t688c, t703c, a732g, t747c, t751a, t766c, a768t, a780g, t81 la, c816t, a826c, c849g, c855t, and c906t(where the nucleotide position is determined by alignment with SEQ ID NO: 1).
- the xylose reductase and/or xylitol dehydrogenase polynucleotides are employed in recombinant nucleic acid constructs that comprise a vector (e.g., a plasmid, a cosmid, a phage, a virus, a yeast artificial chromosome (YAC), and the like), into which a xylose reductase and/or xylitol dehydrogenase polynucleotide sequence has been inserted.
- a vector e.g., a plasmid, a cosmid, a phage, a virus, a yeast artificial chromosome (YAC), and the like
- xylose reductase and xylitol dehydrogenase polynucleotides find use when incorporated into any one of a variety of vectors.
- Suitable vectors include, but are not limited to chromosomal, nonchromosomal and synthetic DNA sequences, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and many others. Any suitable vector that transduces genetic material into a cell, and, if replication is desired, which is replicable and viable in the relevant host find use in the present invention.
- Nucleic acid constructs of the present invention find use in transforming a host cell to permit the host to express the xylose reductase and/or xylitol dehydrogenase polypeptide.
- Methods for recombinant expression of proteins in fungi are well known in the art, and a number of vectors are available or can be constructed using routine methods (See e.g., Zhu et ah, Plasmid 6: 128-33 [2009], incorporated herein by reference; and the many standard reference works in this field).
- recombinant nucleic acid constructs of the present invention further comprise a transcriptional regulatory element that is functional in a fungal cell.
- the nucleic acid construct comprises the xylose reductase and/or xylitol dehydrogenase polynucleotide operatively linked to a transcriptional regulatory sequence (e.g., a promoter, transcription termination sequence, and the like), that is functional in a fungal cell.
- a transcriptional regulatory sequence e.g., a promoter, transcription termination sequence, and the like
- promoters that are functional in a fungal host cell include, but are not limited to promoters from yeast and filamentous fungi.
- Promoters that are suitable for use in the practice of the present invention include endogenous or heterologous promoters and include both constitutive and inducible promoters that are natural or modified. Particularly useful promoters are those that are insensitive to catabolite (glucose) repression and/or do not require xylose for induction. Such promoters are well known in the art.
- a promoter sequence is operably linked to the 5' region of the xylose isomerase or xylitol dehydrogenase coding sequence using routine methods that are well known in the art.
- Promoters that are suitable for use in the practice of the present invention include, but are not limited to yeast promoters from glycolytic genes (e.g., yeast phosphofructokinase (PFK), triose phosphate isomerase (TPI), glyceraldehyde-3 -phosphate dehydrogenase (GPD, TDH3 or GAPDH), pyruvate kinase (PYK), phosphoglycerate kinase (PGK) promoters, and the like; See e.g., WO 93/03159, which is incorporated herein by reference); promoters of glucose transporters; ribosomal protein encoding gene promoters; alcohol dehydrogenase promoters (e.g., ADH1, ADH4, and the like), and the enolase promoter (ENO).
- yeast promoters from glycolytic genes e.g., yeast phosphofructokinase (PFK), triose phosphate isome
- Exemplary promoters that are useful for directing the transcription of the nucleic acid constructs of the present invention in yeast host cells include, but are not limited to those from the genes for Saccharomyces cerevisiae enolase (eno-1), Saccharomyces cerevisiae galactokinase (g /1),
- yeast host cells ADH1/ADH2/GAP
- Saccharomyces cerevisiae 3 -phosphoglycerate kinase Saccharomyces cerevisiae transcription elongation factor (TEF)
- Saccharomyces cerevisiae fructose 1,6-bisphosphate aldolase FBA1
- Saccharomyces cerevisiae 3-phosphate glycerate kinase PGK1
- Other useful promoters for yeast host cells are well known in the art (See e.g., Romanos et ah, Yeast 8:423-488 [1992], which is incorporated herein by reference).
- Suitable filamentous fungal promoters that are useful in the practice of the present invention include, but are not limited to promoters obtained from the genes for Aspergillus oryzeae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral alpha-amylase, Aspergillus niger acid stable alpha-amylase, Aspergillus niger ox Aspergillus awamori glucoamylase (glaA), Rhizomucor miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus oryzae triose phosphate isomerase, Aspergillus nidulans acetamidase, and Fusarium oxysporum trypsin-like protease (See e.g., WO 96/00787, which is incorporated herein by reference), as well as the NA2-t
- Promoters associated with chitinase production in fungi also find use in sme embodiments (See e.g., Blaiseau and Lafay, Gene 120:243-248 [1992] [filamentous fungus Aphanocladium album]; and Limon et ah, Curr. Genet, 28:478-83 [1995] [Trichoderma harzianum]; both of which are incorporated herein by reference).
- Any other suitable promoter sequence that drives expression in a fungal host cell finds use in the present invention.
- Suitable promoter sequences can be identified using well loiown methods.
- a putative promoter sequence is linked 5' to a sequence encoding a reporter protein, the construct is transfected into the host cell and the level of expression of the reporter is measured.
- Expression of the reporter can be determined by measuring, for example, mRNA levels of the reporter sequence, an enzymatic activity of the reporter protein, or the amount of reporter protein produced.
- promoter activity may be determined by using the green fluorescent protein as coding sequence (See, Henriksen et ah, Microbiol., 145:729-34 [1999], which is incorporated herein by reference) or a lacZ reporter gene (See, Punt et ah, Gene, 197: 189-93 [1997], which is incorporated herein by reference).
- functional promoters are derived from naturally occurring promoter sequences by directed evolution methods (See e.g., Wright et a , Hum. Gene Ther., 16:881-892 [2005], which is incorporated herein by reference).
- Exemplary transcription termination sequences that are functional in a fungal host cell, include transcription termination sequences from yeast and filamentous fungi, that are well known in the art. In some embodiments, the transcription termination sequence is from a yeast.
- Exemplary yeast transcription termination sequences include, but are not limited to CYC1, ADHlt, ADH2t, etc.
- the nucleic acid constructs of the present invention contain a ribosome binding site for translation initiation.
- the construct includes appropriate sequences for amplifying expression (e.g., an enhancer). Such elements are well known in the art and any suitable enhancers and/or transcription termination sequences, and/or ribosome binding sites find use in the present invention.
- nucleic acid constructs of the present invention contain one or more selectable marker genes to provide a phenotypic trait for selection of transformed host cells.
- Suitable marker genes include, but are not limited to those coding for antimicrobial resistance such as, ampicillin (ampR), kanamycin, chloramphenicol, tetracycline, streptomycin or spectinomycin (e.g., the aada gene); including but not limited to the streptomycin phosphotransferase (spt) gene coding for streptomycin resistance, the neomycin phosphotransferase ⁇ nptll) gene encoding kanamycin or geneticin resistance, the nourseothricin actetyltransferase (natl) gene coding for nourseothricin resistance, the hygromycin phosphotransferase (hpt) gene coding for hygromycin resistance, genes encoding dihydrofolate reduc
- ampR ampicillin
- Nucleic acid constructs of the present invention typically comprise a fungal origin of replication, such as, for example, a filamentous fungal or yeast origin of replication.
- a fungal origin of replication such as, for example, a filamentous fungal or yeast origin of replication.
- the recombinant nucleic acid constructs of the present invention comprise a yeast origin of replication.
- nucleic acid constructs include constructs suitable for transforming yeast.
- yeast 2 ⁇ or CEN origin based plasmids like pYES2/CT, pYES3/CT, pESC His, pESC Ura, pESC/Trp, pES Leu, p427TEF, pRS405, pRS406, pRS413, and other yeast-based constructs that are known in the art.
- the nucleic acid constructs of the present invention comprise elements to facilitate integration of the xylose reductase and/or xylitol dehydrogenase polynucleotide into a fungal host chromosome (i.e., the genome), by either homologous or non-homologous recombination and either site-directed or random mutagenesis.
- the nucleic acid constructs comprise elements that facilitate homologous integration.
- the xylose reductase and/or xylitol dehydrogenase polynucleotide is integrated at one or more site and is present in one or more copies.
- the nucleic acid construct comprises the xylose reductase and/or xylitol
- This type of construct typically comprises genetic elements to facilitate integration into the fungal host chromosome at a location that is downstream of a native promoter (i.e., in the host chromosome).
- a second nucleic acid construct is employed which comprises a promoter and genetic elements to facilitate integration into the fungal host chromosome in a location upstream of the targeted integration site of the xylose reductase and/or xylitol dehydrogenase polynucleotide.
- the nucleic acid construct comprises the xylose reductase and/or xylitol dehydrogenase polynucleotide operatively linked to a promoter or promoter and terminator sequences such that all are integrated into the host chromosome (genome).
- Genetic elements that facilitate integration by homologous recombination are those having sequence homology to targeted integration sites in the fungal host chromosome (genome). Suitable sites that find use as targets for integration include, but are not limited to the TY1 loci, the RDN loci, the ura3 locus, the GPD locus, aldose reductase (GRE3) locus, etc. Those having ordinary skill in the art appreciate that additional sites for integration can be readily identified using methods known in the art, including but not limited to microarray analysis, metabolic flux analysis, comparative genome hybridization analysis, etc.
- recombination include, but are not limited to restriction enzyme-mediated integration (REMI) (See e.g., Manivasakam et ah, Mol. Cell Biol., 18(3): 1736-1745 [1998], which is incorporated herein by reference), transposon-mediated integration, and other elements and methods that are well known in the art.
- REMI restriction enzyme-mediated integration
- the nucleic acid constructs of the present invention comprise at least one further recombinant polynucleotide that is capable of conferring a desired phenotype to a fungal host cell, particularly in the context of xylose fermentation.
- the recombinant polynucleotide that is capable of conferring an improved phenotype to the fungal host cell is a non-coding polynucleotide such as a regulatory polynucleotide, a coding polynucleotide, or combination thereof.
- Exemplary further desired phenotypes include, but are not limited to increased transport of xylose into the host cell, increased xylulose kinase activity, increased flux through the pentose phosphate pathway, decreased sensitivity to catabolite repression, increased tolerance to ethanol, increased tolerance to increased osmolarity, increased tolerance to organic acids, reduced production of by-products, and other similar properties related to increasing flux through the pentose phosphate and glycolysis pathways to produce a desired metabolic product/intermediate at higher levels as compared to the corresponding wild-type host cell.
- the desired metabolic product is an alcohol (e.g., ethanol).
- this polynucleotide is operatively linked to its native promoter, or to a heterologous promoter (i.e., a promoter that is not associated with the polynucleotide in the corresponding native gene).
- the at least one further polynucleotide is overexpressed.
- the nucleic acid constructs comprise multiple copies of a least one polynucleotide.
- Suitable polynucleotides include, but are not limited to those that facilitate overexpression of proteins known to have an impact on the desired phenotype.
- Exemplary recombinant polynucleotides that are capable of conferring a desired phenotype to a fungal host cell include recombinant polynucleotides (either wild-type or mutated forms) which encode a xylose or hexose transporter, a xylulose kinase (XKS), an enzyme from the pentose phosphate pathway (See e.g., Figure 2A), a glycolytic enzyme (i.e., from the glycolytic metabolic pathway; See e.g., Figure 2B), and an ethanologenic enzyme (See e.g., Figure 2C), regulatory sequences that enhance expression of these sequences, and combinations thereof.
- XKS xylulose kinase
- Additional recombinant polynucleotides that find use in the present invention include those that encode additional proteins involved in the pentose phosphate, glycolysis, and ethanologenic pathways (See e.g., Figures 2A- C).
- Exemplary transporters include, but are not limited to GXF1, SUT1 and At6g59250 from Candida intermedia, Pichia stipitis and Arabidopsis thaliana, respectively (See e.g., Runquist et ah, Biotechnol. Biofuels., 3:5 [2010], which is incorporated herein by reference), as well as HXT4, HXT5, HXT7, GAL2, AGT1, GXF2 (See e.g., Matsushika et al, Appl. Microbiol. Biotechnol., 84:37-53 [2009], which is incorporated herein by reference).
- overexpression of native S In some embodiments, overexpression of native S.
- Particularly suitable recombinant polynucleotides include those which encode: a xylulose kinase (XK); an enzyme from the pentose phosphate pathway (e.g., a ribulose-5-phosphate 3-epimerase (RPE1), a ribose-5-phosphate ketol-isomerase (RKI1), a transketolase (TKL1), a transaldolase (TALI), etc.); a glycolytic enzyme (e.g., a hexokinase (HXK1 HXK2), a glyceraldehyde-3 -phosphate dehydrogenase (GAPDH), a pyruvate kinase (PVK2), etc.); and an ethanologenic enzyme (e.g., a pyruvate decarboxylase, an alcohol dehydr
- XK xylulose kinase
- RPE1 ribu
- Exemplary regulatory polynucleotides include promoters, enhancer, terminator, and other regulatory elements that function to improve the expression of polynucleotides in a fungal host cell, particularly, a yeast host cell. These include, but are not limited to the regulatory elements described hereinabove.
- nucleic acid constructs described herein are useful for transforming fungal host cells to confer to these cells the property of xylose utilization.
- the present invention provides recombinant fungal host cells comprising at least one xylose reductase and/or xylitol dehydrogenase polynucleotide provided herein. More specifically, the recombinant fungal host cell comprises a polynucleotide sequence that encodes a polypeptide which is capable of catalyzing xylose to xylitol, wherein the polynucleotide is selected from: (a) a polynucleotide that encodes a polypeptide comprising an amino acid sequence that is at least about 70% identical to SEQ ID NO:2, wherein the polypeptide comprises at least one substitution set forth herein; and (b) a polynucleotide that hybridizes under stringent hybridization conditions to the complement of a polynucleotide encoding a polypeptide having the amino acid sequence of SEQ ID NO:2, wherein the polypeptide comprises at least one substitution set forth herein.
- the recombinant fungal host cell comprises a polynucleotide sequence that encodes a polypeptide which is capable of catalyzing xylitol to xylulose, wherein the polynucleotide is selected from: (a) a
- polynucleotide that encodes a polypeptide comprising an amino acid sequence that is at least about 70% identical to SEQ ID NO: 6, wherein the polypeptide comprises at least one substitution as set forth herein; and (b) a polynucleotide that hybridizes under stringent hybridization conditions to the complement of a polynucleotide encoding a polypeptide having the amino acid sequence of SEQ ID NO:6, wherein the polypeptide comprises at least one substitution set forth herein.
- the recombinant fungal host cell comprises polynucleotide sequences that encode a polypeptide which is capable of catalyzing xylose to xylitol and a polypeptide capable of catalyzing xylitol to xylulose-5-P, wherein the polynucleotides are selected from: (a) polynucleotides that encode polypeptides comprising amino acid sequences that are at least about 70% identical to SEQ ID NO:2 and/or 6, wherein each of the polypeptides comprise at least one substitution set forth herein; and (b) polynucleotides that hybridize under stringent hybridization conditions to the complement of polynucleotides encoding polypeptides having the amino acid sequences of SEQ ID NO: 2 and/or 6, wherein each of the polypeptides comprise at least one substitution set forth herein.
- the recombinant fungal host cell further comprises at least one xylulokinase, including but not limited to the xylulokinase provided herein (SEQ ID NO: 10), encoded by SEQ ID NO:9, and by codon-optimized sequences SEQ ID NOS: 11 and 12.
- the recombinant fungal host cell comprises at least one xylose reductase, at least one xylitol dehydrogenase, and at least one xylulokinase.
- the xylose reductase comprises SEQ ID NO:2, 41, 43, 45, and/or 47
- the xylitol dehydrogenase comprises SEQ ID NO:6 and/or 42.
- the xylulokinase comprises SEQ ID NO: 10.
- the present invention provides a recombinant fungal host cell comprising or transformed with a nucleic acid construct of the present invention.
- the xylose reductase and/or xylitol dehydrogenase and/or xylulokinase polynucleotide is integrated into the host cell genome.
- the recombinant fungal host cell is a filamentous fungal or yeast host cell. More typically, the recombinant fungal host cell is a yeast host cell.
- the present invention also provides methods for producing a recombinant fungal host cell, wherein the method comprises: (a) providing at least one nucleic acid construct of the present invention, wherein the nucleic acid construct comprises at least one xylose reductase and/or xylitol dehydrogenase and/or at least one xylulokinase polynucleotide provided herein; and (b) transforming a fungal host cell with the nucleic acid construct to produce a recombinant fungal host cell.
- the recombinant fungal host cell is transformed using nucleic acid constructs comprising from about two to about fifty copies of at least one xylose reductase and/or xylitol dehydrogenase and/or xylulokinase. It is not intended that the present invention be limited to any particular copy number of xylose reductase and/or xylitol dehydrogenase genes and/or xylulokinase, as any suitable number of copies finds use in the present invention.
- the nucleic acid constructs comprise any combination of wild-type and/or variant xylose reductase and/or xylitol dehydrogenase and/or xylulokinase.
- any suitable method for introducing multiple copies of either xylose reductase and/or xylitol dehydrogenase and/or xylulokinase find use in the present invention.
- Introduction of the expression construct of the present invention into the host cell can be accomplished using any suitable method, including but not limited to calcium phosphate transfection, DEAE-dextran mediated transfection, electroporation, or any other suitable technique. Indeed, there are numerous methods known in the art and described in various standard reference texts.
- the xylose reductase and/or xylitol dehydrogenase and/or xylulokinase polynucletide sequence is integrated into the host cell genome.
- Suitable fungal host cells include yeast and filamentous fungal host cells.
- the fungal host cell is a yeast cell.
- Exemplary yeast host cells that are useful in the practice of the present invention include, but are not limited to Candida, Hansenula, Saccharomyces,
- the yeast cell is Hansenula polymorpha, Saccharomyces cerevisiae, Saccharomyces carlsbergensis, Saccharomyces diastaticas, Saccharomyces norbensis, Saccharomyces vicyveri, Schizosaccharomyces pombe, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia kodamae, Pichia
- the yeast host cell is Saccharomyces species. In some additional embodiments, the yeast host cell is Saccharomyces cerevisiae.
- Any suitable yeast strain finds use in the present invention, including but not limited to strains such as those commercially available from companies such as Lallemand (e.g., SuperstartTM, THERMO S ACC® , etc.); RED STAR and ETHANOL RED® (Fermentis/Lesaffre); FALI (AB Maui); (Baker's Best Yeast, Baker's Compressed Yeast, etc.
- Lallemand e.g., SuperstartTM, THERMO S ACC® , etc.
- RED STAR and ETHANOL RED® Fermentis/Lesaffre
- FALI AB Maui
- Baker's Best Yeast Baker's Compressed Yeast, etc.
- the filamentous fungal host cell is a species of Achlya, Acremonium, Aspergillus, Aureobasidium, Bjerkandera, Ceriporiopsis, Cephalosporium, Chrysosporium, Cochliobolus, Corynascus, Cryphonectria, Cryptococcus, Coprinus, Coriolus, Diplodia, Endothia, Fusarium, Gibberella, Gliocladium, Humicola, Hypocrea, Myceliophthora, Mucor, Neurospora, Penicillium, Podospora, Phlebia, Piromyces, Pyricularia, Rhizomucor, Rhizopus, Schizophyllum, Scytalidium, Sporotrichum, Talaromyces, Thermoascus, Thielavia, Trametes, Tolypocladium, Trichoderma, Verticillium, Volvariella, or teleomorphs, or an
- filamentous fungal host cells that find use in the present invention include, but are not limited to a filamentous fungal host cell of the Trichoderma species (e.g., T. longibrachiatum, T. viride [e.g., ATCC 32098 and 32086], T. reesei [NRRL 15709, ATTC 13631, 56764, 56765, 56466, 56767, and RL- P37 and derivatives thereof; See e.g., Sheir-Neiss et al., Appl. Microbiol.
- Trichoderma species e.g., T. longibrachiatum, T. viride [e.g., ATCC 32098 and 32086], T. reesei [NRRL 15709, ATTC 13631, 56764, 56765, 56466, 56767, and RL- P37 and derivatives thereof; See e.g., Sheir-Neiss et al.
- Trichoderma refers to any fungal strain that was previously classified as Trichoderma or is currently classified as Trichoderma.
- the filamentous fungal host cell is an
- Aspergillus species e.g., A. awamori, A. funigatus, A. japonicas, A. nidulans, A. niger. A. aculeatus, A. foetidus, A. oiyzae, A. sojae, or A. kawachi (See e.g., Kelly and Hynes, EMBO J., 4:475479 [1985]; NRRL 3112, ATCC 11490, 22342, 44733, and 14331; Yelton et al, Proc. Natl. Acad. Sci.
- the filamentous fungal host cell is a Fusarium species (e.g., F. bactridioides, F. cerealis, F. crookwellense, F. culmorum, F. graminaearum, F. graminum, F. oxysporum, F. rosium, or F. venenatum).
- F. bactridioides e.g., F. bactridioides, F. cerealis, F. crookwellense, F. culmorum, F. graminaearum, F. graminum, F. oxysporum, F. rosium, or F. venenatum.
- the filamentous fungal host cell is of a Neurospora species (e.g., N. crassa; See e.g., Case, et al, Proc. Natl. Acad. Sci. USA, 76:5259-5263 [1979]; US Pat. No. 4,486,553; and Kinsey and Rambosek, Mol. Cell. Biol, 4:117-122 [1984], all of which are incorporated herein by reference).
- the filamentous fungal host cell is of a Humicola species (e.g., H. insolens. H. grisea, or H. lanuginose).
- the filamentous fungal host cell is a Mucor species (e.g., M. miehei or M. circinelloides). In some embodiments of the invention, the filamentous fungal host cell is a Rhizopus species (e.g., R. oryzae or R. niveus). In some embodiments of the invention, the filamentous fungal host cell is of a Penicillum species (e.g., P. purpurogenum, P. chrysogenum, or P. verruculosum). In some embodiments of the invention, the filamentous fungal host cell is a Thielavia species (e.g., T. terrestris). In some
- the filamentous fungal host cell is a Tolypocladium species (e.g., T.
- the filamentous fungal host cell is a Trametes species (e.g., T. villosa or T. versicolor). In some embodiments of the invention, the filamentous fungal host cell is a Chrysosporium species, (e.g., C. lucknowense, C. keratinophilum, C. tropicum, C. merdarium, C. inops, C. pannicola, or C. zonatum).
- C. lucknowense C. keratinophilum, C. tropicum, C. merdarium, C. inops, C. pannicola, or C. zonatum.
- Strains that find use in the present invention include those that are readily accessible to the public from a number of culture collection, including but not limited to the American Type Culture Collection (ATCC), Deutsche Sammlung von Mikroorganismen und Zellkutlturen GmbH (DSM), Centraalbureau Voor Schimmelcultures (CBS), and Agricultural Research Service Patent Culture Collection, Northern Regional Research Center (NRRL).
- ATCC American Type Culture Collection
- DSM Deutsche Sammlung von Mikroorganismen und Zellkutlturen GmbH
- CBS Centraalbureau Voor Schimmelcultures
- NRRL Northern Regional Research Center
- Recombinant fungal host cells of the present invention are capable of fermenting xylose when provided with a xylose based culture medium.
- the recombinant fungal host cells described herein are capable of fermenting xylose at a faster rate compared to the corresponding wild-type fungal host cell.
- the recombinant fungal host cells provided herein are capable of fermenting xylose at a faster rate compared to fungal host cells transformed with a nucleic acid construct comprising xylose reductase and/or xylitol dehydrogenase genes.
- the recombinant fungal host cells provided herein are capable of fermenting xylose at a faster rate compared to fungal host cells transformed with a nucleic acid construct comprising of xylose reductase, xylitol dehydrogenase and/or xylulose kinase genes.
- the recombinant fungal host cells are capable of fermenting xylose at a rate of at least about lg/L/h and sometimes at a rate of at least about 2g/L/h.
- Exemplary xylose-based culture media include culture media which have been formulated to contain xylose, as well as feedstock from cellulosic saccharification processes and/or feedstock from a hemicellulose pre-treatment process (i.e., a "hemicellulosic feedstock").
- the fungal host cell is a wild-type fungal cell, while in other embodiments, it is a mutated or otherwise altered or engineered form of a wild-type fungal cell.
- the fungal host cell (either wild-type or otherwise altered or engineered) comprises polynucleotides encoding a xylulokinase and one or more enzymes in the pentose phosphate, glycolytic, and/or ethanologenic pathways.
- the fungal host cell comprises polynucleotides encoding a xylulokinase and all of the enzymes in the pentose phosphate, glycolytic, and ethanologenic pathways.
- the fungal host cell comprises recombinant polynucleotides encoding enzymes that are heterologous to the fungal host cell (i.e., not native to the fungal host cell).
- the fungal host cell is engineered to comprise other metabolic pathways that utilize products/intermediates from the pentose phosphate, glycolytic, and/or enthanologenic pathways to produce other desirable products.
- the fungal host cell is engineered to comprise a metabolic pathway for the biosynthesis of a fatty alcohol or fatty acid (See e.g., WO 2007/136762, which is incorporated herein by reference).
- the fatty alcohol or fatty acid is a C8-C20 fatty acid or fatty alcohol.
- the fungal host cell is altered or engineered to overexpress any one or more of the polynucleotides encoding the enzymes in one or more of these metabolic pathways.
- the recombinant fungal host cell of the present invention further comprises genetic modifications in addition to the xylose reductase and/or xylitol dehydrogenase polynucleotide.
- the recombinant host cell in addition to having a xylose reductase and/or xylitol dehydrogenase polynucleotide described herein, comprises at least one different recombinant polynucleotide that is capable of conferring a further desired phenotype to the fungal host cell.
- the present invention provides a recombinant fungal host cell comprising at least one P.
- stipitis xylose reductase and/or xylitol dehydrogenase polynucleotide or variant thereof as described herein and at least one recombinant polynucleotide that encodes a polypeptide which differs from the P. stipitis xylose reductase and/or xylitol dehydrogenase and/or variant(s) thereof, wherein the recombinant polynucleotide imparts a desired phenotype to the fungal host cell.
- the recombinant polynucleotide that is capable of conferring a desired phenotype to the fungal host cell is introduced to the fungal host cell on the same nucleic construct as the xylose reductase and/or xylitol dehydrogenase polynucleotide, or on a separate nucleic acid construct.
- Nucleic acid constructs of the present invention comprising at least one xylose reductase and xylitol
- dehydrogenase polynucleotides and at least one further recombinant polynucleotide capable of conferring a desired phenotype to the fungal host cell are also provided by the present invention.
- the recombinant polynucleotide that is capable of conferring a desired phenotype to the fungal host cell is a non-coding polynucleotide (e.g., a regulatory polynucleotide, a coding polynucleotide, or a combination thereof).
- a non-coding polynucleotide e.g., a regulatory polynucleotide, a coding polynucleotide, or a combination thereof.
- exemplary further desired phenotypes include, but are not limited to increased transport of xylose into the host cell, increased xylulose kinase activity, increased flux through the pentose phosphate pathway, decreased sensitivity to catabolite repression, increased tolerance to ethanol, increased tolerance to increased osmolality, increased tolerance to organic acids, reduced production of by-products, and other like properties related to increasing flux through the pentose phosphate, glycolysis, and/or ethanologenic pathways to produce the desired metabolic product/intermediate at higher levels as compared to the corresponding wild-type host cell.
- the desired metabolic product is an alcohol (e.g., ethanol).
- recombinant fungal host cells comprising at least one further polynucleotide capable of conferring a desired phenotype to the fungal host cell comprise at least one polynucleotide encoding a protein known to impact the desired phenotype, wherein the polynucleotide is either native or heterologous to the fungal host cell.
- the polynucleotide(s) are operatively linked to its native promoter, while in other embodiments, the polynucleotide is operatively linked to a heterologous promoter (i.e., one not associated with the polynucleotide in the corresponding native gene).
- the polynucleotide is overexpressed.
- the recombinant fungal host cell comprises multiple copies of the polynucleotide.
- Suitable polynucleotides include, but are not limited to those that facilitate overexpression of proteins known to have an impact on the desired phenotype. Therefore, in some embodiments, the fungal host cell is altered or engineered to overexpress one or more polynucleotides.
- recombinant polynucleotides that are capable of imparting a desired phenotype to a fungal host cell include, but are not limited to recombinant polynucleotides which encode a xylose or hexose transporter, a xylulose kinase (XKS), an enzyme from the pentose phosphate pathway (See e.g., Figure 2A), a glycolytic enzyme (i.e., from the metabolic pathway of glycolysis; See e.g., Figure 2B), and an ethanologenic enzyme (See e.g., Figure 2C), the regulatory sequences associated with these sequences, and any combination thereof.
- XKS xylulose kinase
- Exemplary transporters that find use in the present invention include, but are not limited to GXF1, SUT1 and At6g59250 from Candida intermedia, Pichia stipitis, and Arabidopsis thaliana, respectively ⁇ See e.g., Runquist et al, 84:37-53 [2010], incorporated herein by reference), HXT4, HXT5, HXT7, GAL2, AGT1, and GXF2, ⁇ See e.g., Matsushika et al, Appl. Microbiol. BiotechnoL, 84:37-53 [2009]).
- overexpression of native S. cerevisiae transporters is desirable, particularly HXT5 and HXT7.
- Particularly suitable recombinant polynucleotides include, but are not limited to those that encode: a xylulose kinase (XK); an enzyme from the pentose phosphate pathway ⁇ e.g., a ribulose-5- phosphate 3-epimerase (RPE1), a ribose- 5 -phosphate ketol-isomerase (RKI1), a transketolase (TKL1), a transaldolase (TALI), etc.); a glycolytic enzyme (e.g., a hexokinase (HXK1/HXK2), a glyceraldehyde-3- phosphate dehydrogenase (GAPDH), a pyruvate kinase (PVK2), etc.; and an ethanologenic enzyme (e.g., a pyruvate decarboxylase, an alcohol dehydrogenase, etc.).
- XK
- Exemplary regulatory polynucleotides include promoters, enhancer, terminator, and other regulatory elements that function to improve the expression of polynucleotides in a fungal host cell, particularly, a yeast host cell, as described above.
- recombinant host cells of the present invention comprise one or more native genes deleted from its genome.
- the deletion(s) cause removal or diminishment of a biological activity that is otherwise exhibited by the fungal host cell.
- the cumulative effect of the deletion(s) also leads to an improvement in a phenotype of the fungal host cell. Any suitable method for deleting gene finds use in the present invention. There are numerous methods well known in the art.
- recombinant host cells of the present invention have certain native genes deleted from the host genome in order to improve the utilization of pentose sugars (e.g., xylose), increase transport of xylose into the host cell, increase xylulose kinase activity, increase flux through the pentose phosphate pathway, decrease sensitivity to catabolite repression, increase tolerance to ethanol/acetate, increase tolerance to increased osmolarity, increase tolerance to organic acids (low pH), reduce production of by-products, and other like properties related to increasing flux through the relevant pathways to produce ethanol and other desired metabolic products at higher levels, where comparison is made with respect to the corresponding host cell without the deletion(s).
- Genes targeted for deletion include, but are not limited to genes encoding enzymes in the pentose phosphate pathway, a glycolytic enzyme, and/or an ethanologenic enzyme.
- GRE3 aldose reductase
- SOR1/SOR2 sorbitol dehydrogenases
- GDH1 glutamate dehydrogenase
- GND 6- phosphogluconate dehydrogenase
- ZWF1 glucose-5 -phosphate dehydrogenase
- genes encoding these enzymes in many fungi are known in the art. Those having ordinary skill in the art appreciate that additional genes encoding these enzymes can be readily identified by microarray analysis (See e.g., Sedlak et al, Yeast 21 :671-684 [2004]), metabolic flux analysis (See e.g Sonderegger et al, Appl.
- the host cells employed in the practice of the present invention are mutagenized and/or evolved to exhibit further desired phenotypes, for example, further improvement in the utilization of pentose sugars (e.g., xylose, arabinose, etc.), increased transport of xylose into the host cell, increased xylulose kinase activity, increased flux through the pentose phosphate pathway, decreased sensitivity to catabolite repression, increased tolerance to ethanol/acetate, increased tolerance to increased osmolarity, increased tolerance to organic acids (low pH), reduced production of by-products, and other like properties related to increasing flux through the pentose phosphate and glycolysis pathways to produce a desired metabolic product/intermediate at higher levels.
- pentose sugars e.g., xylose, arabinose, etc.
- increased transport of xylose into the host cell increased xylulose kinase activity
- increased flux through the pentose phosphate pathway decreased sensitivity to
- the desired metabolic product is an alcohol (e.g., ethanol).
- the host cells are mutagenized and/or evolved using known methods either prior to or after transformation with the xylose reductase and/or xylitol dehydrogenase polynucleotide. These methods include, but are not limited to classical mutagenesis, whole genome shuffling, evolutionary engineering methods, which employ screening and/or selection methods, or any combination of such well known methods.
- Classical mutagenesis methods include, but are not limited to treatment of the host cell with a mutagen such as a chemical mutagen or irradiation exposure (e.g., ultraviolet or gamma-irradiation).
- a mutagen such as a chemical mutagen or irradiation exposure (e.g., ultraviolet or gamma-irradiation).
- Whole genome shuffling methods involving, for example, recombination of genomic DNA between native genomic DNA sequences and/or variants thereof, can be facilitated by sexual mating, protoplast fusion methods and other methods well known in the art (See e.g., WO 98/31837 and WO 2000/04190, incorporated herein by reference). These methods are coupled with screening and/or selection methods to identify altered fungal host cells that exhibit the desired phenotype. For example, such methods find use in altering or engineering a fungal host cell to overexpress one or more desired polynucleotides.
- Mutagenesis may be performed in accordance with any of the techniques known in the art, including random and site-specific mutagenesis.
- Directed evolution can be performed with any of the techniques known in the art to screen for improved promoter variants including shuffling. Mutagenesis and directed evolution methods are well known in the art (See e.g., US Patent Nos.
- Evolutionary engineering can be done by prolonged cultivation and selection of strains under desired conditions through chemostat, turbidostat or batch cultures. Evolutionary engineering methods can be practiced under either aerobic or anaerobic conditions. Selection strategies can be optimized by varying culture conditions, for example, carbon source, nitrogen source, aeration, pH and temperature. Methods for evolutionary engineering are well known in the art ⁇ See e.g., Wisselink et al, Appl. Environ. Microbiol, 75(4):907-914 [2009]; Kuyper et al, FEMS Yeast Res., 5:399-409 [2005]; and Sauer, Adv. Biochem. Engineer. Biotechnol, 73 : 129-169 [2001], all of which are incorporated herein by reference).
- the recombinant fungal host cell comprising a xylose reductase and/or xylitol dehydrogenase polynucleotide exhibits an improved phenotype relative to the corresponding fungal host cell without the xylose reductase and/or xylitol dehydrogenase polynucleotide.
- whole genome shuffling and evolutionary engineering methods result in increased copy number of xylose reductase and/or xylitol dehydrogenase and/or xylulokinase from two to fifty copies. It is not intended that the present invention be limited to any particular copy number of xylose reductase and/or xylitol dehydrogenase genes and/or xylulokinase, as any suitable number of copies finds use in the present invention.
- the nucleic acid constructs comprise any combination of wild-type and/or variant xylose reductase and/or xylitol dehydrogenase and/or xylulokinase.
- any suitable method of increasing copies of either xylose reductase and/or xylitol dehydrogenase and/or xylulokinase finds use in the present invention.
- the improved phenotype comprises further improvement in the utilization of pentose sugars (e.g., xylose, arabinose, etc.), increased transport of xylose into the host cell, increased xylulose kinase activity, increased flux through the pentose phosphate pathway, decreased sensitivity to catabolite repression, increased tolerance to ethanol/acetate, increased tolerance to increased osmolarity, increased tolerance to organic acids (low pH), and reduced production of by products, or other properties.
- pentose sugars e.g., xylose, arabinose, etc.
- increased transport of xylose into the host cell e.g., xylose, arabinose, etc.
- increased xylulose kinase activity e.g., xylulose kinase activity
- increased flux through the pentose phosphate pathway e.g., decreased sensitivity to catabolite repression
- the present invention provides processes for producing fermentation products, wherein the method comprises: (a) providing the recombinant fungal cell of the present invention; (b) providing a fermentation medium comprising xylose; (c) contacting the fermentation medium with the recombinant fungal cell under conditions suitable for generating the fermentation product; and optionally (d) recovering the fermentation product.
- the fermentation product is an alcohol (e.g., ethanol, butanol, etc.), a fatty alcohol (e.g., a C8-C20 fatty alcohol), a fatty acid (e.g., a C8-C20 fatty acid), lactic acid, 3-hydroxypropionic acid, acrylic acid, acetic acid, succinic acid, citric acid, malic acid, fumaric acid, an amino acid, 1,3 -propanediol, ethylene, glycerol, and/or a ⁇ -lactam (e.g., cephalosporin).
- a fatty alcohol e.g., a C8-C20 fatty alcohol
- a fatty acid e.g., a C8-C20 fatty acid
- lactic acid 3-hydroxypropionic acid
- acrylic acid e.g., succinic acid, citric acid, malic acid, fumaric acid
- an amino acid 1,3 -propanediol,
- the fermentation medium is feedstock from a cellulosic
- feedstocks include, but are not limited to carbohydrates (e.g., lignocellulose, xylans, cellulose, starch, etc.), other sugars (e.g., glucose, xylose, arabinose, etc.), and other compositions.
- carbohydrates e.g., lignocellulose, xylans, cellulose, starch, etc.
- other sugars e.g., glucose, xylose, arabinose, etc.
- compositions of fermentation media suitable for the growth of yeast and filamentous fungi are well known in the art and there are various reference texts that provide recipes for these media.
- Fermentation conditions suitable for generating desired fermentation products are well known in the art and any suitable method finds use in the present invention.
- the fermentation process is carried out under aerobic or microaerobic (i.e., where the concentration of oxygen is less than that in air), or anaerobic conditions.
- fermentation is conducted under anaerobic conditions (i.e., no detectable oxygen), or less than about 5, about 2.5, or about 1 mmol/L/h oxygen.
- anaerobic conditions i.e., no detectable oxygen
- the NADH produced in glycolysis cannot be oxidized by oxidative phosphoiylation.
- pyruvate or a derivative thereof may be utilized by the host cell as an electron and hydrogen acceptor in order to generated NAD+.
- pyruvate when the fermentation process is carried out under anaerobic conditions, may be reduced to a fermentation product such as ethanol, butanol, lactic acid, 3-hydroxypropionic acid, acrylic acid, acetic acid, succinic acid, citric acid, malic acid, fumaric acid, an amino acid, 1,3- propanediol, ethylene, glycerol, and/or a ⁇ -lactam (e.g., a cephalosporin).
- a fermentation product such as ethanol, butanol, lactic acid, 3-hydroxypropionic acid, acrylic acid, acetic acid, succinic acid, citric acid, malic acid, fumaric acid, an amino acid, 1,3- propanediol, ethylene, glycerol, and/or a ⁇ -lactam (e.g., a cephalosporin).
- the fermentation process is typically run at a temperature that is optimal for the recombinant fungal cell.
- the fermentation process is performed at a temperature in the range of from about 25°C to about 42°C.
- the process is carried out a temperature that is less than about 38°C, less than about 35°C, less than about 33°C, or less than about 38°C, but at least about 20°C, 22°C, or 25°C.
- recombinant host cells of the present invention are grown under batch or continuous fermentation conditions.
- Classical batch fermentation is a closed system, wherein the composition of the medium is set at the beginning of the fermentation and is not subject to artificial alterations during the fermentation.
- a variation of the batch system is a fed-batch fermentation, which also finds use in the present invention. In this variation, the substrate is added in increments as the fermentation progresses.
- Fed-batch systems are useful when catabolite repression is likely to inhibit the metabolism of the cells and/or where it is desirable to have limited amounts of substrate in the medium.
- Batch and fed-batch fermentations are common and well known in the art.
- Continuous fermentation is an open system where a defined fermentation generally maintains the culture at a constant high density where cells are primarily in log phase growth. Continuous fermentation systems strive to maintain steady state growth conditions. Methods for modulating nutrients and growth factors for continuous
- SEQ ID NO:2 provides the polypeptide sequence of P. stipitis xylose reductase ("XR.l")
- SEQ ID NO: 1 provides the native polynucleotide sequence
- SEQ ID NO:3 provides one codon optimized DNA sequence (“XR.2”)
- SEQ ID NO:4 provides an alternative codon optimized DNA sequence (“XR.3”)
- SEQ ID NO:6 provides the polypeptide sequence of P. stipitis xylitol dehydrogenase ("XD.
- SEQ ID NO: 5 provides the native polynucleotide sequence
- SEQ ID NO:7 provides one codon optimized DNA sequence ("XD.2")
- SEQ ID NO:8 provides an alternative codon optimized DNA sequence ("XD.3”
- SEQ ID NO: 10 provides the polypeptide sequence of S. cerevisiae xylulokinase ("XK.l")
- SEQ ID NO:9 provides the native polynucleotide sequence
- SEQ ID NO: 11 provides one codon optimized DNA sequence (“XK.2”)
- SEQ ID NO: 12 provides an alternative codon optimized DNA sequence (“XK.3").
- APIDFEQLITHRYKFKDAIEAYDLVRAGKGAVKCLIDGPE SEQ ID NO:6 ATGACTGCTAACCCTTCCTTGGTGTTGAACAAGATCGACGACATTTCGTTCGAAACTTACGA
- CTGTTAAGTGTTTGATTGACGGTCCAGAATAATAA (SEQ ID NO: 8)
- RVRISPLLSDSNASSQQRLNEDTIVKEDYDESPLRDYLNKRPERTFFVGGASKNDArViaCFAQVIG ATKGNFRLETPNSCALGGCYKAMWSLLYDSNKMVPFDKFLNDNFPWHVMESISDVDNENWDR YNSKTVPLSELEKTLI SEQ ID NO: 10.
- Xylose reductase from Pichis stipitis (XR.2; SEQ ID NO:3), xylitol dehydrogenase from Pichia stipitis (XD.2; SEQ ID NO:7), and xylulose kinase (XK.2; SEQ ID NO: 11) from Saccharomyces cerevisiae were synthesized with codon optimization for expression in yeast.
- the genes were synthesized with the following 5' and 3' flanks to introduce specific restriction enzyme sites:
- the yeast vector p427TEF (Dualsystems Biotech AG) was used for gene expression.
- the vector contains a kanamycin resistance gene that allows for selection in yeast, an ampicillin resistance gene that allows for selection in E.coli, and a 2micron origin of replication that allows for propagation of plasmids in high copy numbers in yeast.
- p427TEF was digested with Sad md Xhol restriction enzymes. The larger fragment (6235 bp) was ligated with an oligomer of the following sequence,
- XR.2, XD.2 and XK.2 genes were then cloned into PLS1565 using yeast recombinational cloning. To amplify all the pieces, the primer sets provided in Table 1-2 were used.
- PS.XR.2 CTT GCT CAT TAG AAA GAA AGC CTA TAA ATC GTA AAG ACA TAA GAG
- PS.XD.2 TAC CAA GCA TAC AAT CAA CTA TAA TAA AAA TCA TAA ATC ATA AGA
- PLS 1565 was digested with BamHUXhol and gel purified. Then, a 3: 1 mass ratio of each insert:digested PLS 1565 was used. Transformants were selected using G418 and confirmed by sequencing. The resulting plasmid (PLS2802) with the 3 genes cloned is depicted in Figure 3.
- PLS2802 was used to transform S.cerevisiae (THERMOSACC®; LYCC6825; Lallemand). Transformants were selected on YPD agar plates with 200ug/ml G418 at 30°C for 48hrs. Single colonies were used to inoculate 250 ⁇ 1 of defined media (60g/L glucose; 3g/L potassium phosphate, 5g/L ammonium sulphate, 0.5 g/L magnesium sulphate, 100 mM MES pH 5.5) in Axygen 96-well plates. The cultures were grown at 30°C for 72hrs with 85% relative humidity.
- defined media 60g/L glucose; 3g/L potassium phosphate, 5g/L ammonium sulphate, 0.5 g/L magnesium sulphate, 100 mM MES pH 5.5
- 40 ⁇ 1 of the culture was used to inoculate 360 ⁇ 1 of 3: 1 mixture of defined media (60g L glucose; 3g/L potassium phosphate, 5g/L ammonium sulphate, 0.5 g L magnesium sulphate, 100 mM MES pH 5.5) to plant (wheat straw) biomass hydro lysates containing xylose in 96-well Costar deep well plates for propagating the cells.
- the cultures were grown at 30°C for 40hrs with 250rpm shaking. At 40hrs, the cells were spun down at 22°C for lOmins and evaluated for xylose fermentation activity.
- the residual xylose in the supernatant was measured using a spectrophotometric assay (e.g., Megazyme xylose assay; Cat no. K-XYLOSE) performed according to the manufacture's protocol. Strains transformed with the empty vector were used as a control. Strains transformed with the xylose pathway consumed significantly higher amounts of xylose at each of the timepoints tested compared to the vector control.
- a spectrophotometric assay e.g., Megazyme xylose assay; Cat no. K-XYLOSE
- XR and XD genes were tested. Each of the genes were synthesized with either their native Pichia stiptis sequence (XR.1, XD.l) or with codon optimization towards highly expressed yeast sequences (XR.3; XD.3) (Brat et al Appl. Environ. Microbiol., 75:2304-2311 [2009]).
- XR and XD genes were cloned into vector PLS1448 with different combinations (XR.1-XD.1-XK.2; XR.2-XD.1-XK.2; XR.3-XD.1-XK.2; XR.1-XD.2-XK.2; XR.1-XD.3-XK.2).
- the variants were used to transform
- Pichia stipitis xylose reductase and xylitol dehydrogenase were subjected to directed evolution algorithms to improve xylose utilization activity using methods as loiown in the art (See e.g., WO 2010/144103).
- Purified PCR products encoding XR and/or XD variants (i.e., comprising amino acidsubstitutions) and the vector portion of plasmid PLS2802 were pooled and used to transform
- Pichia stipitis xylitol dehydrogenase (XD.2) was subjected to directed evolution to improve xylose utilization activity using PCR amplification known in the art (See e.g., WO 2010/144103). Purified PCR products were pooled and transformed into S.
- Table 4-6 provides results for XR and XD combinatorial variants with improved activity compared to a positive control having the active mutations indicated in the Table.
- Variant 3 has active substitutions in both the XR and XD (R276F and F209S/N21 IK, respectively), as well as XR silent mutations (t81 Ia/c812g/c816t), as shown in SEQ ID NOS:50 and 51 (XR DNA and amino acid sequences, respectively), and SEQ ID NOS:52 and 53 (XD DNA and amino acid sequences, respectively).
- APIDFEQLITHRYKFKDAIEAYDLVRAGKGAVKCLIDGPE SEQ ID NO:53
- variant 152 P2T/A49G/R276W in XR
- SEQ ID NOS:54 and 55 The DNA and amino acid sequences of variant 152 (P2T/A49G/R276W in XR) are provided below (SEQ ID NOS:54 and 55).
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
Claims
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12762824.6A EP2691517A4 (en) | 2011-03-30 | 2012-03-26 | Pentose fermentation by a recombinant microorganism |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161469505P | 2011-03-30 | 2011-03-30 | |
| US61/469,505 | 2011-03-30 | ||
| US201161496152P | 2011-06-13 | 2011-06-13 | |
| US61/496,152 | 2011-06-13 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2012135110A1 true WO2012135110A1 (en) | 2012-10-04 |
Family
ID=46927737
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/030549 Ceased WO2012135110A1 (en) | 2011-03-30 | 2012-03-26 | Pentose fermentation by a recombinant microorganism |
Country Status (3)
| Country | Link |
|---|---|
| US (3) | US8663962B2 (en) |
| EP (1) | EP2691517A4 (en) |
| WO (1) | WO2012135110A1 (en) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018106792A1 (en) | 2016-12-06 | 2018-06-14 | Novozymes A/S | Improved processes for production of ethanol from xylose-containing cellulosic substrates using engineered yeast strains |
| WO2018114973A1 (en) | 2016-12-20 | 2018-06-28 | Novozymes A/S | Recombinant yeast strains for pentose fermentation |
| WO2018220116A1 (en) | 2017-05-31 | 2018-12-06 | Novozymes A/S | Xylose fermenting yeast strains and processes thereof for ethanol production |
| WO2021119304A1 (en) | 2019-12-10 | 2021-06-17 | Novozymes A/S | Microorganism for improved pentose fermentation |
| WO2022261003A1 (en) | 2021-06-07 | 2022-12-15 | Novozymes A/S | Engineered microorganism for improved ethanol fermentation |
| WO2024258820A2 (en) | 2023-06-13 | 2024-12-19 | Novozymes A/S | Processes for producing fermentation products using engineered yeast expressing a beta-xylosidase |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8647642B2 (en) | 2008-09-18 | 2014-02-11 | Aviex Technologies, Llc | Live bacterial vaccines resistant to carbon dioxide (CO2), acidic PH and/or osmolarity for viral infection prophylaxis or treatment |
| US8663962B2 (en) * | 2011-03-30 | 2014-03-04 | Codexis, Inc. | Pentose fermentation by a recombinant microorganism |
| DE102014223904A1 (en) * | 2014-11-24 | 2016-05-25 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Capacitor and method of making the same |
| US10676723B2 (en) | 2015-05-11 | 2020-06-09 | David Gordon Bermudes | Chimeric protein toxins for expression by therapeutic bacteria |
| US11129906B1 (en) | 2016-12-07 | 2021-09-28 | David Gordon Bermudes | Chimeric protein toxins for expression by therapeutic bacteria |
| US11180535B1 (en) | 2016-12-07 | 2021-11-23 | David Gordon Bermudes | Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria |
| CN110358745B (en) * | 2019-08-22 | 2022-04-19 | 苏州科宁多元醇有限公司 | 4-xylitol dehydrogenase mutant and application thereof |
| CN115806886B (en) * | 2022-09-08 | 2024-06-07 | 西北农林科技大学 | Neurospora crassa xylulokinase gene knockout mutant strain and application thereof |
| CN118546899A (en) * | 2023-02-27 | 2024-08-27 | 山东恒鲁生物科技有限公司 | Alcohol dehydrogenase and application thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20060110809A1 (en) * | 2004-05-19 | 2006-05-25 | Biotechnology Research And Development Corp. And Agricultural Research Serv., U.S. Dept. Of Agric. | Methods for production of xylitol in microorganisms |
| US20080148432A1 (en) * | 2005-12-21 | 2008-06-19 | Mark Scott Abad | Transgenic plants with enhanced agronomic traits |
| US20100291645A1 (en) * | 2007-07-12 | 2010-11-18 | Biotechnology Research And Development Corporation | Xylose reductase mutants and uses thereof |
Family Cites Families (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE3009104C2 (en) | 1980-03-10 | 1990-10-04 | Odenwald-Chemie GmbH, 6901 Schönau | Use of an epoxy resin for the production of fire-retardant layers or coatings and processes for the production of the same |
| CA1338400C (en) | 1983-08-31 | 1996-06-18 | David H. Gelfand | Recombinant fungal cellulases |
| FR2679920A1 (en) | 1991-08-02 | 1993-02-05 | Rhone Poulenc Rorer Sa | Highly stable recombinant yeasts for the production of recombinant proteins, their preparation and their use |
| US6395547B1 (en) | 1994-02-17 | 2002-05-28 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| US20060257890A1 (en) | 1996-05-20 | 2006-11-16 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US5834252A (en) | 1995-04-18 | 1998-11-10 | Glaxo Group Limited | End-complementary polymerase reaction |
| US6406855B1 (en) | 1994-02-17 | 2002-06-18 | Maxygen, Inc. | Methods and compositions for polypeptide engineering |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| US5837458A (en) | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US6995017B1 (en) | 1994-02-17 | 2006-02-07 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| US6117679A (en) | 1994-02-17 | 2000-09-12 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| US6335160B1 (en) | 1995-02-17 | 2002-01-01 | Maxygen, Inc. | Methods and compositions for polypeptide engineering |
| US6309883B1 (en) | 1994-02-17 | 2001-10-30 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US6165793A (en) | 1996-03-25 | 2000-12-26 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| US5928905A (en) | 1995-04-18 | 1999-07-27 | Glaxo Group Limited | End-complementary polymerase reaction |
| CN101659926A (en) | 1994-06-30 | 2010-03-03 | 诺沃奇梅兹有限公司 | Non-toxic, non-toxigenic, non-pathogenic fusarium expression system and promoters and terminators for use therein |
| FI104465B (en) | 1995-06-14 | 2000-02-15 | Valio Oy | Protein hydrolyzates for the treatment and prevention of allergies and their preparation and use |
| US6096548A (en) | 1996-03-25 | 2000-08-01 | Maxygen, Inc. | Method for directing evolution of a virus |
| US6506602B1 (en) | 1996-03-25 | 2003-01-14 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| KR100570935B1 (en) | 1997-01-17 | 2006-04-13 | 맥시겐, 인크. | Improvement of whole cells and organisms by repetitive sequence recombination |
| US6326204B1 (en) | 1997-01-17 | 2001-12-04 | Maxygen, Inc. | Evolution of whole cells and organisms by recursive sequence recombination |
| US7148054B2 (en) | 1997-01-17 | 2006-12-12 | Maxygen, Inc. | Evolution of whole cells and organisms by recursive sequence recombination |
| US6365408B1 (en) | 1998-06-19 | 2002-04-02 | Maxygen, Inc. | Methods of evolving a polynucleotides by mutagenesis and recombination |
| US6376246B1 (en) | 1999-02-05 | 2002-04-23 | Maxygen, Inc. | Oligonucleotide mediated nucleic acid recombination |
| US6917882B2 (en) | 1999-01-19 | 2005-07-12 | Maxygen, Inc. | Methods for making character strings, polynucleotides and polypeptides having desired characteristics |
| US6436675B1 (en) | 1999-09-28 | 2002-08-20 | Maxygen, Inc. | Use of codon-varied oligonucleotide synthesis for synthetic shuffling |
| US6368861B1 (en) | 1999-01-19 | 2002-04-09 | Maxygen, Inc. | Oligonucleotide mediated nucleic acid recombination |
| US7702464B1 (en) | 2001-08-21 | 2010-04-20 | Maxygen, Inc. | Method and apparatus for codon determining |
| ES2341217T3 (en) | 1999-01-19 | 2010-06-17 | Maxygen, Inc. | RECOMBINATION OF NUCLEIC ACIDS MEDIATED BY OLIGONUCLEOTIDES. |
| US7024312B1 (en) | 1999-01-19 | 2006-04-04 | Maxygen, Inc. | Methods for making character strings, polynucleotides and polypeptides having desired characteristics |
| US6961664B2 (en) | 1999-01-19 | 2005-11-01 | Maxygen | Methods of populating data structures for use in evolutionary simulations |
| AU3391900A (en) | 1999-03-05 | 2000-09-21 | Maxygen, Inc. | Encryption of traits using split gene sequences |
| US7430477B2 (en) | 1999-10-12 | 2008-09-30 | Maxygen, Inc. | Methods of populating data structures for use in evolutionary simulations |
| US6519065B1 (en) | 1999-11-05 | 2003-02-11 | Jds Fitel Inc. | Chromatic dispersion compensation device |
| US20050084907A1 (en) | 2002-03-01 | 2005-04-21 | Maxygen, Inc. | Methods, systems, and software for identifying functional biomolecules |
| JP5319865B2 (en) | 2002-03-01 | 2013-10-16 | コデクシス メイフラワー ホールディングス, エルエルシー | Methods, systems, and software for identifying functional biomolecules |
| US7747391B2 (en) | 2002-03-01 | 2010-06-29 | Maxygen, Inc. | Methods, systems, and software for identifying functional biomolecules |
| EP1488335A4 (en) | 2002-03-09 | 2006-11-15 | Maxygen Inc | OPTIMIZATION OF CROSSING POINTS FOR DIRECTED EVOLUTION PURPOSES |
| CA2650773C (en) | 2006-05-19 | 2014-12-02 | Jay D. Keasling | Microorganisms transformed with acetyl-coa carboxylase and wax synthase for production of fatty acid derivatives |
| US20090312196A1 (en) * | 2008-06-13 | 2009-12-17 | Codexis, Inc. | Method of synthesizing polynucleotide variants |
| DK3023494T3 (en) | 2008-06-13 | 2019-02-25 | Codexis Inc | PROCEDURE FOR SYNTHESIS OF POLYNUCLEOTIDE VARIETIES |
| US20120184007A1 (en) | 2009-07-09 | 2012-07-19 | Stephen Picataggio | Engineered microorganisms with enhanced fermentation activity |
| US8663962B2 (en) * | 2011-03-30 | 2014-03-04 | Codexis, Inc. | Pentose fermentation by a recombinant microorganism |
-
2012
- 2012-03-26 US US13/429,710 patent/US8663962B2/en not_active Expired - Fee Related
- 2012-03-26 EP EP12762824.6A patent/EP2691517A4/en not_active Withdrawn
- 2012-03-26 WO PCT/US2012/030549 patent/WO2012135110A1/en not_active Ceased
-
2014
- 2014-01-14 US US14/154,488 patent/US9169468B2/en not_active Expired - Fee Related
-
2015
- 2015-10-26 US US14/923,147 patent/US20160040139A1/en not_active Abandoned
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20060110809A1 (en) * | 2004-05-19 | 2006-05-25 | Biotechnology Research And Development Corp. And Agricultural Research Serv., U.S. Dept. Of Agric. | Methods for production of xylitol in microorganisms |
| US20080148432A1 (en) * | 2005-12-21 | 2008-06-19 | Mark Scott Abad | Transgenic plants with enhanced agronomic traits |
| US20100291645A1 (en) * | 2007-07-12 | 2010-11-18 | Biotechnology Research And Development Corporation | Xylose reductase mutants and uses thereof |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP2691517A1 * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018106792A1 (en) | 2016-12-06 | 2018-06-14 | Novozymes A/S | Improved processes for production of ethanol from xylose-containing cellulosic substrates using engineered yeast strains |
| WO2018114973A1 (en) | 2016-12-20 | 2018-06-28 | Novozymes A/S | Recombinant yeast strains for pentose fermentation |
| US11046938B2 (en) | 2016-12-20 | 2021-06-29 | Novozymes A/S | Recombinant yeast strains for pentose fermentation |
| EP4001416A1 (en) | 2016-12-20 | 2022-05-25 | Novozymes A/S | Recombinant yeast strains for pentose fermentation |
| EP4624568A2 (en) | 2016-12-20 | 2025-10-01 | Novozymes A/S | Recombinant yeast strains for pentose fermentation |
| WO2018220116A1 (en) | 2017-05-31 | 2018-12-06 | Novozymes A/S | Xylose fermenting yeast strains and processes thereof for ethanol production |
| US11091753B2 (en) | 2017-05-31 | 2021-08-17 | Novozymes A/S | Xylose fermenting yeast strains and processes thereof for ethanol production |
| WO2021119304A1 (en) | 2019-12-10 | 2021-06-17 | Novozymes A/S | Microorganism for improved pentose fermentation |
| WO2022261003A1 (en) | 2021-06-07 | 2022-12-15 | Novozymes A/S | Engineered microorganism for improved ethanol fermentation |
| WO2024258820A2 (en) | 2023-06-13 | 2024-12-19 | Novozymes A/S | Processes for producing fermentation products using engineered yeast expressing a beta-xylosidase |
Also Published As
| Publication number | Publication date |
|---|---|
| US20120252074A1 (en) | 2012-10-04 |
| US20140127780A1 (en) | 2014-05-08 |
| EP2691517A1 (en) | 2014-02-05 |
| US20160040139A1 (en) | 2016-02-11 |
| EP2691517A4 (en) | 2015-04-22 |
| US9169468B2 (en) | 2015-10-27 |
| US8663962B2 (en) | 2014-03-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9169468B2 (en) | Pentose fermentation by a recombinant microorganism | |
| CN105121637B (en) | Electron-consuming ethanol production pathway for substituted glycerol formation in Saccharomyces cerevisiae | |
| US9090889B2 (en) | Xylose isomerases and their uses | |
| JP5321320B2 (en) | Yeast with improved fermentation ability and use thereof | |
| US9611515B2 (en) | Pentose fermentation by a recombinant microorganism | |
| US8778652B2 (en) | Pentose fermentation by a recombinant microorganism | |
| JP2004532008A (en) | Engineering fungi for utilization of L-arabinose | |
| JP5608999B2 (en) | Method for producing useful substances using xylose | |
| WO2012009272A2 (en) | Pentose fermentation by a recombinant microorganism | |
| CN105073990A (en) | Method for producing ethanol using recombinant yeast | |
| WO2018172328A1 (en) | Improved glycerol free ethanol production | |
| EP2576804A1 (en) | Pentose fermentation by a recombinant microorganism | |
| WO2013059326A1 (en) | Xylitol production from cellulosic biomass | |
| WO2024040001A1 (en) | Genetically modified yeast and fermentation processes for the production of ethanol | |
| US10017788B2 (en) | Recombinant yeast and method for producing ethanol using the same | |
| JP7667817B2 (en) | Yeast that suppresses xylitol accumulation | |
| WO2020032233A1 (en) | Recombinant yeast, and method for producing ethanol using same | |
| JP7298673B2 (en) | Mutant gene involved in improving ethanol productivity by ethanol fermentation and ethanol production method using the same | |
| JP7298674B2 (en) | Mutant gene involved in improving ethanol productivity by ethanol fermentation and ethanol production method using the same | |
| WO2012024046A2 (en) | Pentose fermentation by a recombinant microorganism | |
| Demeke et al. | Engineering Saccharomyces cerevisiae for efficient D-xylose and L-arabinose fermentation |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12762824 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012762824 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013025100 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112013025100 Country of ref document: BR Free format text: CORRIGIR A DATA DE DEPOSITO DA PRIORIDADE, NA PETICAO INICIAL. |
|
| ENPW | Started to enter national phase and was withdrawn or failed for other reasons |
Ref document number: 112013025100 Country of ref document: BR Free format text: PEDIDO RETIRADO, POR NAO CUMPRIMENTO DA EXIGENCIA PUBLICADA NA RPI 2487 DE 04/09/2018. |


















