WO2012125626A2 - Decorin compositions and use thereof - Google Patents
Decorin compositions and use thereof Download PDFInfo
- Publication number
- WO2012125626A2 WO2012125626A2 PCT/US2012/028911 US2012028911W WO2012125626A2 WO 2012125626 A2 WO2012125626 A2 WO 2012125626A2 US 2012028911 W US2012028911 W US 2012028911W WO 2012125626 A2 WO2012125626 A2 WO 2012125626A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- decorin
- medium
- core protein
- protein
- hydroxyapatite
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4725—Proteoglycans, e.g. aggreccan
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/036—Fusion polypeptide containing a localisation/targetting motif targeting to the medium outside of the cell, e.g. type III secretion
Definitions
- the present invention relates to improved decorin compositions and methods of their production.
- Proteoglycans carrying one or more glycosaminoglycan (GAG) chains form a large gene family that may be classifed into five groups according to the structural properties of the core protein.
- One of the groups is the small Leucine -rich proteoglycan family comprised of decorin (DCN), biglycan, fibromodulin and lumican. These are characterized by 40 kDa core proteins that contain Leucine-rich repeats of approximately 12 amino acids.
- DCN is a prototype of the group and is also referred to as PG-S2, PG40, proteodermatan sulphate and DS-PGII. It contains one dermatan chondroitin sulphate GAG chain covalently linked to a Serine of the mature core protein and is considered to be a multifunctional proteoglycan.
- DCN The proposed functions of DCN include, but are not limited to, regulation of collagen fibrillogenesis, maintenance of tissue integrity via binding with fibronectin and
- TGF- ⁇ transforming growth factor ⁇
- decorin Infusion of decorin into experimental rodent spinal cord injuries has been shown to suppress scar formation and promote axon growth. Decorin has also been shown to have anti-tumorigenic properties in an experimental murine tumor model and is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for the decorin gene. Mutations in the decorin gene are associated with congenital stromal corneal dystrophy.
- the present invention relates to improved decorin compositions and methods of their production.
- the present invention provides a fusion protein comprising a heterologous signal peptide operably linked to a sequence encoding decorin.
- the signal sequence is an alpha-lactalbumin signal sequence.
- the alpha lactalbumin sequence is a bovine alpha-lactalbumin signal sequence.
- the sequence encoding decorin encodes a decorin core protein.
- the decorin core protein comprises a mutation at position 4 of the mature decorin core protein.
- the mutation is a serine to alanine mutation.
- the decorin core protein lacks substantial modification by
- glycosaminoglycans molecules at position 4 of the mature decorin core protein are glycosaminoglycans molecules at position 4 of the mature decorin core protein.
- the present invention provides a vector encoding the fusion proteins described above.
- the vector comprises a nucleic acid sequence encoding an alpha-lactalbumin signal sequence operably linked to a sequence encoding a decorin core protein.
- the present invention provides a host cell comprising the vectors described above.
- the present invention provides methods of producing a non- gagylated decorin core protein comprising: providing host cells expressing non-gagylated decorin core protein; culturing said host cell so that said non-gagylated decorin core protein is produced; and purifying said non-gagylated decorin core protein.
- the non-gagylated decorin core protein is secreted into medium used to culture said host cells.
- the purifying comprises contacting said culture medium with an ion exchange medium.
- the purifying comprises contacting said culture medium with a hydroxyapatite medium.
- the purifying comprises contacting said culture medium with at least one ion exchange medium and at least one hydroxyapatite medium in any order.
- the purifying comprises:
- the methods further comprise further purification of said second decorin- containing eluate with an ion exchange membrane or column.
- the ion exchange membrane is a Q ion exchange membrane.
- the methods further comprise a viral inactivation step.
- the viral inaction step comprises treatment with a surfactant.
- the surfactant is Triton X-100.
- the methods further comprise a viral filtration step.
- the methods further comprise concentrating said decorin.
- the non-gagylated decorin core protein is produced by said host cells at a rate of about greater than 1, 5, or 10 pg/cell/day.
- the present invention provides methods for purifying decorin from a decorin-containing medium comprising: contacting said decorin-containing medium with a cation exchange medium; washing said cation exchange medium; eluting a first decorin-containing eluate from said cation exchange medium; contacting said at first decorin- containing eluate with a hydroxyapatite medium; washing said hydroxyapatite medium; eluting a second decorin-containing eluate from said hydroxyapatite medium; filtering said second decorin-containing eluate with an ion exchange membrane to provide a decorin- containing filtrate; treating said filtrate to remove viruses; and concentrating decorin from said filtrate.
- the present invention provides compositions comprising a purified decorin core protein comprising a mutation at position 4 of the mature decorin core protein so that said decorin protein is substantially non-gagylated, said composition comprising less than about 100 ng residual host cell protein/mg decorin core protein in said composition and less than about 20 pg residual host cell DNA/mg decorin core protein.
- the compositions comprise less than about 5 ng residual host cell protein/mg decorin core protein in said composition and less than about 5 pg residual host cell DNA mg decorin core protein.
- the decorin is formulated as an aqueous solution.
- the aqueous solution comprises a phosphate buffered solution with a pH of from about 6.5 to about 7.5.
- FIG. 1 Decorin expression gene sequence (SEQ ID NO:8).
- FIG. 1 Decorin expression protein sequence (SEQ ID NO:4).
- Figure 3 The integral of viable cell concentration is plotted versus decorin production throughout the 15 day bioreactor run.
- the slope of the regression line for each run corresponds to the cell productivity in picograms/cell/day (p/c/d). These two runs averaged 24.4 p/c/d. Maximum production reached -1.8 g/L for one run and 1.7 g/L for the other run.
- corin refers to a protein molecule having a mature protein sequence that is at least 80% identical to SEQ ID NO:4.
- corin core protein refers to a decorin protein molecule that has a mutation at amino acid 4 of mature decorin and that substantially lacks
- glycosaminoglycan i.e., is non-gagylated
- the term "host cell” refers to any eukaryotic cell (e.g., mammalian cells, avian cells, amphibian cells, plant cells, fish cells, and insect cells), whether located in vitro or in vivo.
- the term "cell culture” refers to any in vitro culture of cells. Included within this term are continuous cell lines (e.g., with an immortal phenotype), primary cell cultures, finite cell lines (e.g., non-transformed cells), and any other cell population maintained in vitro, including oocytes and embryos.
- vector refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences between cells.
- vector includes cloning and expression vehicles, as well as viral vectors.
- the terms “complementary” or “complementarity” are used in reference to polynucleotides (i.e., a sequence of nucleotides) related by the base-pairing rules.
- sequence “5'-A-G-T-3', M is complementary to the sequence "3 -T-C-A-5'.”
- Complementarity may be “partial,” in which only some of the nucleic acids' bases are matched according to the base pairing rules. Or, there may be “complete” or “total” complementarity between the nucleic acids.
- the degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. This is of particular importance in amplification reactions, as well as detection methods that depend upon binding between nucleic acids.
- a partially complementary sequence is one that at least partially inhibits a completely complementary sequence from hybridizing to a target nucleic acid sequence and is referred to using the functional term "substantially homologous.”
- the inhibition of hybridization of the completely complementary sequence to the target sequence may be examined using a hybridization assay (Southern or Northern blot, solution hybridization and the like) under conditions of low stringency.
- a substantially homologous sequence or probe i.e., an oligonucleotide which is capable of hybridizing to another oligonucleotide of interest
- conditions of low stringency are such that non-specific binding is permitted; low stringency conditions require that the binding of two sequences to one another be a specific (i.e., selective) interaction.
- the absence of non-specific binding may be tested by the use of a second target which lacks even a partial degree of
- operable combination refers to the linkage of nucleic acid sequences in such a manner that a nucleic acid molecule capable of directing the transcription of a given gene and/or the synthesis of a desired protein molecule is produced.
- the term also refers to the linkage of amino acid sequences in such a manner so that a functional protein is produced.
- the term "signal sequence” refers to any DNA sequence which, when operably linked to a recombinant DNA sequence, encodes a signal peptide which is capable of causing the secretion of the recombinant polypeptide.
- the signal peptides comprise a series of about 15 to 30 hydrophobic amino acid residues (See, e.g., Zwizinski et al, J. Biol. Chem. 255(16): 7973-77 [1980], Gray et al, Gene 39(2): 247-54 [1985], and Martial et al, Science 205: 602-607 [1979]).
- secretion signal sequences are preferably derived from genes encoding polypeptides secreted from the cell type targeted for tissue-specific expression (e.g., secreted milk proteins for expression in and secretion from mammary secretory cells).
- Secretory DNA sequences are not limited to such sequences.
- Secretory DNA sequences from proteins secreted from many cell types and organisms may also be used (e.g., the secretion signals for t-PA, serum albumin, lactoferrin, and growth hormone, and secretion signals from microbial genes encoding secreted polypeptides such as from yeast, filamentous fungi, and bacteria).
- purified refers to molecules, either nucleic or amino acid sequences, that are removed from their normal environment, isolated or separated.
- An "isolated nucleic acid sequence” is therefore a purified nucleic acid sequence.
- substantially purified molecules are at least 60% free, preferably at least 75% free, and more preferably at least 90% free from other components with which they are normally associated.
- the present invention relates to improved decorin compositions and methods of their production, and to the use of decorin for the treatment of patients.
- Native decorin is a glycoprotein with an attached glycosaminoglycan and an average molecular weight of 90-140 kD.
- the present invention contemplates the production recombinant decorin.
- the decorin is decorin core protein, i.e., a substantially non-gagylated decorin.
- the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4 th amino acid from the N-terminus) of the mature decorin core protein molecule.
- the mutation is a serine to alanine mutation.
- the decorin core protein is at least 90%, 95% , 99% or 100% identical to SEQ ID NO: l (mature decorin core protein), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4 th amino acid from the N-terminus) of the mature decorin core protein molecule.
- Decorin is commonly expressed as a pre-pro-protein.
- the present invention provides decorin fusion molecules comprising a heterologous signal sequence in operable association with the decorin pro-peptide and mature peptide sequences.
- the heterologous signal polypeptide is an alpha-lactalbumin signal polypeptide.
- the alpha-lactalbumin signal polypeptide is a bovine alpha-lactalbumin signal polypeptide.
- the heterologous signal polypeptide is at least 80%, 90%), or 100%) identical to SEQ ID NO:2.
- the propeptide sequence is at least 80%, 90%, or 100% identical to SEQ ID NO:3.
- the decorin core protein portion of the fusion polypeptide is at least 90%>, 95% , 99% or 100%) identical to SEQ ID NO: 1 (mature decorin core protein), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4 th amino acid from the N-terminus) of the mature decorin core protein molecule.
- the fusion protein is at least 80%, 90%, 95%, 99% or 100% identical to SEQ ID NO:4(signal-propeptide decorin core protein), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4 th amino acid from the N-terminus) of the mature decorin core protein molecule.
- the present invention further provides nucleic acid sequences encoding the fusion proteins, as well as vectors comprising the nucleic acid sequences.
- the heterologous signal polypeptide is at least 80%, 90%, or 100% identical to SEQ ID NO:5.
- the propeptide sequence is at least 80%>, 90%>, or 100% identical to SEQ ID NO:6.
- the decorin core protein portion of the fusion is at least 80%, 90%>, or 100% identical to SEQ ID NO:6.
- polypeptide is at least 90%, 95% , 99% or 100% identical to SEQ ID NO:7 (mature decorin core protein), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4 th amino acid from the N-terminus) of the mature decorin core protein molecule.
- the fusion protein is at least 80%>, 90%>, 95%, 99% or 100% identical to SEQ ID NO: 8 (signal-propeptide decorin core protein) ), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4 th amino acid from the N- terminus) of the mature decorin core protein molecule.
- the decorin polynucleotides of the present invention may be employed for producing decorin polypeptides by recombinant techniques.
- the polynucleotide may be included in any one of a variety of expression vectors for expressing a polypeptide.
- vectors include, but are not limited to, retroviral vectors, chromosomal, nonchromosomal and synthetic DNA sequences (e.g., derivatives of SV40, bacterial plasmids, phage DNA; baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and viral DNA such as vaccinia, adenovirus, fowl pox virus, and pseudorabies). It is contemplated that any vector may be used as long as it is replicable and viable in the host.
- the vectors are retroviral vectors as described in US Pat. Nos. 6,852,510 and 7,332,333 and U.S. pat. Publ. Nos.
- the vectors are pseudotyped retroviral vectors.
- some embodiments of the present invention provide recombinant constructs comprising one or more of the sequences as broadly described above (e.g., SEQ ID NO: 8).
- the constructs comprise a vector, such as a plasmid or viral vector, into which a sequence of the invention has been inserted, in a forward or reverse orientation.
- the heterologous structural sequence e.g., SEQ ID NO: 8
- the appropriate DNA sequence is inserted into the vector using any of a variety of procedures. In general, the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by procedures known in the art.
- vectors include, but are not limited to, the following vectors: 1) Bacterial— pQE70, pQE60, pQE-9 (Qiagen), pBS, pDIO, phagescript, psiX174, pbluescript SK, pBSKS, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene); ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia); 2) Eukaryotic-pWLNEO, pSV2CAT, pOG44, PXT1 , pSG (Stratagene) pSVK3, pBPV, pMSG, pSVL (Pharmacia); and 3) Baculovirus- pPbac and pMbac (Stratagene).
- Bacterial— pQE70, pQE60, pQE-9 Qi
- mammalian expression vectors comprise an origin of replication, a suitable promoter and enhancer, and also any necessary ribosome binding sites, polyadenylation sites, splice donor and acceptor sites, transcriptional termination sequences, and 5' flanking non-transcribed sequences.
- DNA sequences derived from the SV40 splice, and polyadenylation sites may be used to provide the required non-transcribed genetic elements.
- the DNA sequence in the expression vector is operatively linked to an appropriate expression control sequence(s) (promoter) to direct mRNA synthesis.
- Promoters useful in the present invention include, but are not limited to, the LTR or SV40 promoter, the E. coli lac or trp, the phage lambda P L and PR, T3 and T7 promoters, and the cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, and mouse metallothionein-I promoters and other promoters known to control expression of gene in prokaryotic or eukaryotic cells or their viruses.
- CMV cytomegalovirus
- HSV herpes simplex virus
- thymidine kinase thymidine kinase
- recombinant expression vectors include origins of replication and selectable markers permitting transformation of the host cell (e.g., dihydrofolate reductase or neomycin resistance for eukaryotic cell culture, or tetracycline or ampicillin resistance in E. coli).
- transcription of the DNA encoding the polypeptides of the present invention by higher eukaryotes is increased by inserting an enhancer sequence into the vector. Enhancers are cis-acting elements of DNA, usually about from 10 to 300 bp that act on a promoter to increase its transcription.
- Enhancers useful in the present invention include, but are not limited to, the SV40 enhancer on the late side of the replication origin bp 100 to 270, a cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
- the expression vector also contains a ribosome binding site for translation initiation and a transcription terminator.
- the vector may also include appropriate sequences for amplifying expression.
- the present invention provides host cells containing the above-described constructs.
- the host cell is a higher eukaryotic cell (e.g., a mammalian or insect cell).
- the host cell is a lower eukaryotic cell (e.g., a yeast cell).
- the host cell can be a prokaryotic cell (e.g., a bacterial cell).
- a prokaryotic cell e.g., a bacterial cell.
- host cells include, but are not limited to, Escherichia coli, Salmonella typhimurium, Bacillus subtilis, and various species within the genera
- the constructs in host cells can be used in a conventional manner to produce the gene product encoded by the recombinant sequence.
- introduction of the construct into the host cell can be accomplished by retroviral transduction, calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation (See e.g., Davis et al.
- polypeptides of the invention can be synthetically produced by conventional peptide synthesizers.
- Proteins can be expressed in mammalian cells, yeast, bacteria, or other cells under the control of appropriate promoters. Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the present invention. Appropriate cloning and expression vectors for use with prokaryotic and eukaryotic hosts are described by Sambrook, et al. (1989) Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y.
- protein is secreted and cells are cultured for an additional period.
- cells are typically harvested by centrifugation, disrupted by physical or chemical means, and the resulting crude extract retained for further purification.
- microbial cells employed in expression of proteins can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
- the present invention also provides methods for recovering and purifying decorin from recombinant cell cultures including, but not limited to, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography.
- the present invention provides improved methods for the purification of decorin, especially decorin core protein.
- the processes comprise two column
- cation exchange chromatography is used to capture decorin from medium containing decorin, preferably a clarified medium.
- the cation exchange chromatography medium is SP-Sepharose FF.
- the cation exchange medium is equilibrated at about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 20 to 70 mM NaCL, preferably about 50 mM NaCL at a neutral pH.
- the cation exchange medium is washed.
- the wash buffer comprises about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 20 to 70 mM NaCL, preferably about 50 mM NaCL.
- decorin is then eluted from the cation exchange medium.
- the elution buffer comprises about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 150 to 250 mM NaCL, preferably about 200 mM NaCL.
- the eluate containing decorin from the cation exchange chromatography step is applied to a hydroxyapatite medium.
- the hydroxyapatite medium is CHT Type 1.
- the hydroxyapatite medium is equilibrated at about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 150 to 250 mM NaCL, preferably about 200 mM NaCL.
- the decorin containing medium is applied to the hydroxyapatite medium.
- the wash buffer comprises about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 150 to 250 mM NaCL, preferably about 200 mM NaCL.
- decorin is then eluted from the hydroxyapatite medium.
- the elution buffer comprises about 0.2 to 0.4 M sodium phosphate, preferably 0.3 M sodium phosphate, and 150 to 250 mM NaCL, preferably about 200 mM NaCL.
- the eluate containing decorin from the hydroxyapatite chromatography step is buffer exchanged and applied to an ion exchange membrane.
- the ion exchange membrane is a Q ion exchange membrane, for examples a Mustang Q ion exchange medium.
- the membrane is equilibrated with from about 30 mM to 70 mM Tris-HCl, preferably about 50 mM Tris-HCl.
- the membrane is washed and the decorin passes through the membrane.
- the wash buffer comprises from about 30 mM to 70 mM Tris-HCl, preferably about 50 mM Tris-HCl.
- the decorin is preferably concentrated to a desired concentration, for example by flow filtration.
- solutions of containing the decorin are treated to inactivate or remove viruses.
- solutions comprising decorin are treated with a surfactant to inactivate viruses.
- the surfactant is Triton X-100.
- the surfactant treating step is performed after the cation exchange chromatography step.
- the solutions comprising decorin are filtered to remove viruses.
- the solutions are filtered through a a viral Filter (e.g., a Virosart viral filter).
- the filtrations step is performed after the hydroxyapatite chromatography step.
- compositions suitable for clinical use in human patients.
- the compositions comprise a purified decorin core protein comprising a mutation at position 4 of the mature decorin core protein so that the decorin protein is substantially non-gagylated.
- the compositions provide purified decorin proteins, and the compositions are characterized in comprising less than about 100, 50, 20, 10, 5 or 2 ng residual host cell protein/mg decorin core protein in the composition and/or less than about 20, 10, 5, or 2 pg residual host cell DNA/mg decorin core protein.
- the decorin is provided in a aqueous solution.
- the aqueous solution is phosphate buffered saline (e.g., lOmM sodium phosphate, 150mM sodium chloride), with a pH of from about 6.5 to 7.5, preferably about 7.0.
- phosphate buffered saline e.g., lOmM sodium phosphate, 150mM sodium chloride
- a CHO cell line was made using the GPEx® process and the above gene construct. Decorin was produced and purified. N-terminal amino acid sequencing was done on the purified protein. The resulting sequence is shown below.
- the sequence corresponds to the expected sequence of the mature protein.
- the alanine mutation was incorporated as expected and the signal peptide and pro-protein cleaved to yield the correct mature Decorin N-terminal sequence.
- HyClone (Logan, UT, USA) HyQ PF-CHO Liquid Soy (LS) with L-glutamine and 0.1% Pluronic F68. The medium was received as a complete, sterile liquid.
- HyQ PF-CHO LS is a proprietary protein-free cell culture medium formulation from HyClone. The exact ingredients are not known, however, HyClone does hold a Type II Device File for Serum-Free Medium with the FDA for HyQ PF- CHO LS (reference number BBMF8302).
- HyQ CellBoost R15.4 is proprietary media supplement formulations from HyClone used in the production culture. 1.2 Production of DCP
- Production lot 09018 was initiated by thawing a MCB vial, Lot number 06005 (Vial #182) in a 37° C water bath. After thawing the frozen MCB vial, the cells were added to a single shake flask (250 mL) (Thermo Fisher Scientific) containing 35 mL of HyQ PF-CHO LS cell culture medium. The initial cell count, determined using a hemacytometer, was 2.25 x 10 5 cells/mL and 90.4% viability.
- the culture was then placed on an Orbit shaker (90 rpm) within an incubator maintained at 37°C in a humidified, 5% C0 2 environment.
- Subculture steps targeted inoculation densities of approximately 2.0 x 10 5 cells/ml.
- the day 3 cell count and percent viability in the flask was 14.24 x 10 5 cells/mL with 95.8% viability and the flask was subcultured to 1 L flask.
- the Day 3 average viable cell count from the 1 L flask was 23.43 x 10 5 cells/mL with 98.1% viability.
- the 1 L flask was subcultured to a Wave Bioreactor System 20EH with a 10 L disposable Wave Bag (GE Healthcare Bioscience Bioprocess Corp, Somerset, NJ) at an initial culture volume and an initial target cell density of 1000 mL and 2.0 x 10 5 cells/mL, respectively.
- the Wave Bioreactor System 20EH with a 10 L disposable Wave Bag (GE Healthcare Bioscience Bioprocess Corp, Somerset, NJ) at an initial culture volume and an initial target cell density of 1000 mL and 2.0 x 10 5 cells/mL, respectively.
- Bioreactor operating settings were 37.0° C incubation temperature, 15.0 cpm rocker speed, 11.0° rocking angle, and 5.0% C0 2 concentration in the aeration gas with gas flow rate of 0.25 L/minute.
- the viable cell density in the Wave Bag was 10.28 xlO 5 cells/ml
- fresh HyQ PF-CHO LS was added bringing the culture volume to 4992 mL.
- the viable cell density was 18.37 x 10 5 cells/mL and the volume in the Wave Bag was transferred to the 30L bioreactor.
- the operating set-points in the 30 L bioreactor for temperature, pH, dissolved oxygen, pressure, and agitation rate were 37° C, 40%> air saturation, 1 psig pressure, and 50 rpm agitation rate, respectively.
- the pH controller was not activated, allowing for the cells to naturally drift toward a pH of 7.
- VCC Viable cell count
- HyQ PF-CHO LS cell culture medium 137 Kg of HyQ PF-CHO LS cell culture medium and 4.3 Kg HyQ Cell Boost R15.4 12% (w/v) solution were added to the 200 L bioreactor. "Day 0" of the production culture was considered the day the 200 L bioreactor was inoculated.
- the viable cell density in the 30 L bioreactor was 14.87 x 10 5 cells/mL on day two of culture, which was sufficient to inoculate the 200 L bioreactor at an initial target density of 2.00 x 10 5 cells/mL.
- the entire contents of the 30 L were transferred and the post inoculum weight, cell density and viability were 171.9 Kg, 2.90 x 10 5 cells/mL and 93.9%,
- the operating set-points in the 200 L bioreactor for temperature, pH, dissolved oxygen, pressure, and agitation rate were 37° C, pH 7.0, 40% air saturation, 1 psig pressure, and 35 rpm agitation rate, respectively.
- the pH deadband was initially set at actual pH value minus 7.0, prior to inoculation. This was done to prevent the addition of C0 2 , and allow the cells to naturally drift toward a pH of 7.0.
- the initial deadband setting was 0.32.
- the pH was checked daily and the deadband adjusted to actual pH value minus 7.0. On day 1, the pH deadband was decreased to 0.22 and on day three, the deadband was set to 0.05 and remained at this setting for the rest of the run.
- the first feed was to occur on day 2 or 3, when the glucose level fell below ⁇ 5g/l, or on day 3 by default.
- glucose level fell below 5g/L, so an additional 4.4kg (L) of 12% w/v HyQ Cell Boost R15.4 + 120mM L-glutamine solution was added to the bioreactor.
- the next feed was to occur on day 4 or 5, when the glucose level fell below ⁇ 5g/L.
- the glucose level fell below 5g/L which triggered an additional feed of 9g/L (14.2L) of 12%> w/v HyQ Cell Boost R15.4 solution.
- the temperature was reduced from 37°C to 31°C.
- the viable cell density peaked on day 5 at 61.00 x 10 5 cells/mL with a viability of 95.7%).
- the bioreactor was harvested on 11/03/09, (day 14) at a cell viability of 50.2%>, with a final weight of the bioreactor at 191.8 Kg.
- the integrated cell number (ICN) was generated and plotted against protein results to give a curve of which the slope gives the pcd (27.316) for the 14 day run.
- This lot was harvested on day 14, at a viability of 50.2% and a titer of 1.240g/L.
- the batch was transferred to downstream and purified per the downstream batch processing record.
- the harvested material from the 200L batch was purified as outlined below resulting in 21 lg (at 5mg/mL) in a final volume of 42L.
- the final bulk drug substance met the specifications previously approved for this batch. All concentrations were determined by absorbance unless otherwise stated. 1.4 Clarification (March 3rd 2009)
- the harvest material (189L) was filtered through a Cuno 60M02 Maximizer filter (2 x 16ft 2 ) at a volume / area of 5.9L/ft 2 at an initial flow rate of 3L / min and through a 0.22 ⁇ 10" Millipore Opticap filter.
- the filter housing was blown down with compressed nitrogen to maximize product recovery.
- SP-Sepharose FF SP-Sepharose FF (GE Healthcare) was used for the capture of the protein from the clarified media.
- the clarified media was diluted to reduce the conductivity prior to capture on to the column. The conditions of this run are shown below along with the analysis of the various fractions.
- the clarified media was processed as two sub batches.
- the two SP-Sepharose sub lots were individual subjected to viral inactivation using
- CHT Type I (BioRad) was used to further purify DCP from residual CHO protein in the
- SP-Sepharose pools as well as to remove the Triton from the inactivation step.
- the conditions of this run are shown below along with the analysis of the various fractions.
- the SP- Sepharose pools were processed as two sub-batches as described above.
- the two CHT pools (47.8L) were combined and diluted with an equal volume of water giving a total volume of 95.6L. This was concentrated ⁇ 2 fold to ⁇ 45L and approximately -6.57 mg/mL, using a 0.6m 2 Prep/Scale TFF cartridge (Millipore), 10KMWCO. The recirculation flow rate was 5L/min and a back pressure of approximately 20psi was maintained.
- the concentrate was then continuously diafiltered against 7.9 volumes of 25mM Tris- HC1 pH7.5. (55.5L) and the permeate conductivity at the end of the buffer exchange was confirmed to be at ⁇ 5mS/cm (4.40mS/cm).
- the filter was washed and this and the concentrate were combined and 0.2um filtered prior to storage at 2-8°C.
- the Mustang Q (Pall) step was carried out in flow through mode, with any bound material being eluted with a sodium chloride strip.
- the Buffer exchanged pool was loaded directly onto the conditioned Mustang Q membrane. Table 14 Mustang Q Membrane Parameters
- the Mustang Q pool was viral filtered using a Virosart filter.
- the filter was wetted with 3L of water for injection (WFI) at 30psi nitrogen.
- Prep/Scale TFF cartridge (Millipore), 10KMWCO.
- the re-circulation flow rate was 5L/min and a feed pressure of 20psi was maintained.
- the viral filtrate was continuously diafiltered against 6.9 volumes of lOmM sodium phosphate, 150mM sodium chloride, pH 7.0 to a final volume of 48.5L. This bulk was then concentrated down to approximately 40L and then the cartridge was flushed with 2.4L of lOmM sodium phosphate, 150mM sodium chloride, pH 7.0, to remove any remaining protein. This was pooled with the concentrate and the concentration determined to be 5.0g/L (42.2L total volume). The final bulk was then filtered into a bag with a 0.2 ⁇ filter. Table 19 Analysis of Formulation Samples
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Dermatology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Biomedical Technology (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention relates to improved decorin compositions and methods of their production.
Description
DECORIN COMPOSITIONS AND USE THEREOF
FIELD OF THE INVENTION
The present invention relates to improved decorin compositions and methods of their production.
BACKGROUND OF THE INVENTION
Proteoglycans carrying one or more glycosaminoglycan (GAG) chains form a large gene family that may be classifed into five groups according to the structural properties of the core protein. One of the groups is the small Leucine -rich proteoglycan family comprised of decorin (DCN), biglycan, fibromodulin and lumican. These are characterized by 40 kDa core proteins that contain Leucine-rich repeats of approximately 12 amino acids. DCN is a prototype of the group and is also referred to as PG-S2, PG40, proteodermatan sulphate and DS-PGII. It contains one dermatan chondroitin sulphate GAG chain covalently linked to a Serine of the mature core protein and is considered to be a multifunctional proteoglycan.
The proposed functions of DCN include, but are not limited to, regulation of collagen fibrillogenesis, maintenance of tissue integrity via binding with fibronectin and
thrombospondin, and a reservoir of transforming growth factor β (TGF-β). The latter function of DCN is achieved through its core protein sequestering the growth factor in the
extracellular milieu from receptors expressed on the cell surface.
Infusion of decorin into experimental rodent spinal cord injuries has been shown to suppress scar formation and promote axon growth. Decorin has also been shown to have anti-tumorigenic properties in an experimental murine tumor model and is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for the decorin gene. Mutations in the decorin gene are associated with congenital stromal corneal dystrophy.
What is needed in the art are improved methods of producing decorin, especially for therapeutic use. SUMMARY OF THE INVENTION
The present invention relates to improved decorin compositions and methods of their production.
Accordingly, in some embodiments, the present invention provides a fusion protein comprising a heterologous signal peptide operably linked to a sequence encoding decorin. In some embodiments, the signal sequence is an alpha-lactalbumin signal sequence. In some embodiments, the alpha lactalbumin sequence is a bovine alpha-lactalbumin signal sequence. In some embodiments, the sequence encoding decorin encodes a decorin core protein. In some embodiments, the decorin core protein comprises a mutation at position 4 of the mature
decorin core protein. In some embodiments, the mutation is a serine to alanine mutation. In some embodiments, the decorin core protein lacks substantial modification by
glycosaminoglycans molecules at position 4 of the mature decorin core protein.
In some embodiments, the present invention provides a vector encoding the fusion proteins described above. In some embodiments, the vector comprises a nucleic acid sequence encoding an alpha-lactalbumin signal sequence operably linked to a sequence encoding a decorin core protein.
In some embodiments, the present invention provides a host cell comprising the vectors described above.
In some embodiments, the present invention provides methods of producing a non- gagylated decorin core protein comprising: providing host cells expressing non-gagylated decorin core protein; culturing said host cell so that said non-gagylated decorin core protein is produced; and purifying said non-gagylated decorin core protein. In some embodiments, the non-gagylated decorin core protein is secreted into medium used to culture said host cells. In some embodiments, the purifying comprises contacting said culture medium with an ion exchange medium. In some embodiments, the purifying comprises contacting said culture medium with a hydroxyapatite medium. In some embodiments, the purifying comprises contacting said culture medium with at least one ion exchange medium and at least one hydroxyapatite medium in any order. In some embodiments, the purifying comprises:
contacting said culture medium with a cation exchange medium; washing said cation exchange medium; eluting a first decorin-containing eluate from said cation exchange medium; contacting said first decorin-containing eluate with a hydroxyapatite medium;
washing said hydroxyapatite medium; eluting a second decorin-containing eluate from said hydroxyapatite medium. In some embodiments, the cation exchange medium is SP-Sepharose FF. In some embodiments, the hydroxyapatite medium is ceramic hydroxyapatite type I. In some embodiments, the methods further comprise further purification of said second decorin- containing eluate with an ion exchange membrane or column. In some embodiments, the ion exchange membrane is a Q ion exchange membrane. In some embodiments, the methods further comprise a viral inactivation step. In some embodiments, the viral inaction step comprises treatment with a surfactant. In some embodiments, the surfactant is Triton X-100. In some embodiments, the methods further comprise a viral filtration step. In some embodiments, the methods further comprise concentrating said decorin. In some
embodiments, the non-gagylated decorin core protein is produced by said host cells at a rate of about greater than 1, 5, or 10 pg/cell/day.
In some embodiments, the present invention provides methods for purifying decorin from a decorin-containing medium comprising: contacting said decorin-containing medium with a cation exchange medium; washing said cation exchange medium; eluting a first decorin-containing eluate from said cation exchange medium; contacting said at first decorin-
containing eluate with a hydroxyapatite medium; washing said hydroxyapatite medium; eluting a second decorin-containing eluate from said hydroxyapatite medium; filtering said second decorin-containing eluate with an ion exchange membrane to provide a decorin- containing filtrate; treating said filtrate to remove viruses; and concentrating decorin from said filtrate.
In some embodiments, the present invention provides compositions comprising a purified decorin core protein comprising a mutation at position 4 of the mature decorin core protein so that said decorin protein is substantially non-gagylated, said composition comprising less than about 100 ng residual host cell protein/mg decorin core protein in said composition and less than about 20 pg residual host cell DNA/mg decorin core protein. In some embodiments, the compositions comprise less than about 5 ng residual host cell protein/mg decorin core protein in said composition and less than about 5 pg residual host cell DNA mg decorin core protein. In some embodiments, the decorin is formulated as an aqueous solution. In some embodiments, the aqueous solution comprises a phosphate buffered solution with a pH of from about 6.5 to about 7.5.
DESCRIPTION OF THE FIGURES
Figure 1 : Decorin expression gene sequence (SEQ ID NO:8).
Figure 2: Decorin expression protein sequence (SEQ ID NO:4).
Figure 3 : The integral of viable cell concentration is plotted versus decorin production throughout the 15 day bioreactor run. The slope of the regression line for each run corresponds to the cell productivity in picograms/cell/day (p/c/d). These two runs averaged 24.4 p/c/d. Maximum production reached -1.8 g/L for one run and 1.7 g/L for the other run.
DEFINITIONS
To facilitate understanding of the invention, a number of terms are defined below. As used herein, the term "decorin" refers to a protein molecule having a mature protein sequence that is at least 80% identical to SEQ ID NO:4.
As used herein, the term "decorin core protein" refers to a decorin protein molecule that has a mutation at amino acid 4 of mature decorin and that substantially lacks
modification with a glycosaminoglycan (GAG; i.e., is non-gagylated) at amino acid 4.
As used herein, the term "host cell" refers to any eukaryotic cell (e.g., mammalian cells, avian cells, amphibian cells, plant cells, fish cells, and insect cells), whether located in vitro or in vivo.
As used herein, the term "cell culture" refers to any in vitro culture of cells. Included within this term are continuous cell lines (e.g., with an immortal phenotype), primary cell cultures, finite cell lines (e.g., non-transformed cells), and any other cell population maintained in vitro, including oocytes and embryos.
As used herein, the term "vector" refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences between cells. Thus, the term includes cloning and expression vehicles, as well as viral vectors.
As used herein, the terms "complementary" or "complementarity" are used in reference to polynucleotides (i.e., a sequence of nucleotides) related by the base-pairing rules. For example, the sequence "5'-A-G-T-3',M is complementary to the sequence "3 -T-C-A-5'." Complementarity may be "partial," in which only some of the nucleic acids' bases are matched according to the base pairing rules. Or, there may be "complete" or "total" complementarity between the nucleic acids. The degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. This is of particular importance in amplification reactions, as well as detection methods that depend upon binding between nucleic acids.
The terms "homology" and "percent identity" when used in relation to nucleic acids refers to a degree of complementarity. There may be partial homology (i.e., partial identity) or complete homology (i.e., complete identity). A partially complementary sequence is one that at least partially inhibits a completely complementary sequence from hybridizing to a target nucleic acid sequence and is referred to using the functional term "substantially homologous." The inhibition of hybridization of the completely complementary sequence to the target sequence may be examined using a hybridization assay (Southern or Northern blot, solution hybridization and the like) under conditions of low stringency. A substantially homologous sequence or probe (i.e., an oligonucleotide which is capable of hybridizing to another oligonucleotide of interest) will compete for and inhibit the binding (i.e., the hybridization) of a completely homologous sequence to a target sequence under conditions of low stringency. This is not to say that conditions of low stringency are such that non-specific binding is permitted; low stringency conditions require that the binding of two sequences to one another be a specific (i.e., selective) interaction. The absence of non-specific binding may be tested by the use of a second target which lacks even a partial degree of
complementarity (e.g., less than about 30% identity); in the absence of non-specific binding the probe will not hybridize to the second non-complementary target.
The terms "in operable combination," "in operable order," and "operably linked" as used herein refer to the linkage of nucleic acid sequences in such a manner that a nucleic acid molecule capable of directing the transcription of a given gene and/or the synthesis of a
desired protein molecule is produced. The term also refers to the linkage of amino acid sequences in such a manner so that a functional protein is produced.
As used herein, the term "signal sequence" refers to any DNA sequence which, when operably linked to a recombinant DNA sequence, encodes a signal peptide which is capable of causing the secretion of the recombinant polypeptide. In general, the signal peptides comprise a series of about 15 to 30 hydrophobic amino acid residues (See, e.g., Zwizinski et al, J. Biol. Chem. 255(16): 7973-77 [1980], Gray et al, Gene 39(2): 247-54 [1985], and Martial et al, Science 205: 602-607 [1979]). Such secretion signal sequences are preferably derived from genes encoding polypeptides secreted from the cell type targeted for tissue- specific expression (e.g., secreted milk proteins for expression in and secretion from mammary secretory cells). Secretory DNA sequences, however, are not limited to such sequences. Secretory DNA sequences from proteins secreted from many cell types and organisms may also be used (e.g., the secretion signals for t-PA, serum albumin, lactoferrin, and growth hormone, and secretion signals from microbial genes encoding secreted polypeptides such as from yeast, filamentous fungi, and bacteria).
As used herein, the term "purified" refers to molecules, either nucleic or amino acid sequences, that are removed from their normal environment, isolated or separated. An "isolated nucleic acid sequence" is therefore a purified nucleic acid sequence. "Substantially purified" molecules are at least 60% free, preferably at least 75% free, and more preferably at least 90% free from other components with which they are normally associated.
DETAILED DESCRIPTION OF THE INVENTION
The present invention relates to improved decorin compositions and methods of their production, and to the use of decorin for the treatment of patients.
Decorin
Native decorin is a glycoprotein with an attached glycosaminoglycan and an average molecular weight of 90-140 kD. The present invention contemplates the production recombinant decorin. In some preferred embodiments, the decorin is decorin core protein, i.e., a substantially non-gagylated decorin. In some embodiments, the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4th amino acid from the N-terminus) of the mature decorin core protein molecule. In some embodiments, the mutation is a serine to alanine mutation. In some embodiments, the decorin core protein is at least 90%, 95% , 99% or 100% identical to SEQ ID NO: l (mature decorin core protein), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4th amino acid from the N-terminus) of the mature decorin core protein molecule.
Decorin is commonly expressed as a pre-pro-protein. The present invention provides decorin fusion molecules comprising a heterologous signal sequence in operable association
with the decorin pro-peptide and mature peptide sequences. In some embodiments, the heterologous signal polypeptide is an alpha-lactalbumin signal polypeptide. In some
embodiments, the alpha-lactalbumin signal polypeptide is a bovine alpha-lactalbumin signal polypeptide. In some embodiments, the heterologous signal polypeptide is at least 80%, 90%), or 100%) identical to SEQ ID NO:2. In some embodiments, the propeptide sequence is at least 80%, 90%, or 100% identical to SEQ ID NO:3. In some embodiments, the decorin core protein portion of the fusion polypeptide is at least 90%>, 95% , 99% or 100%) identical to SEQ ID NO: 1 (mature decorin core protein), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4th amino acid from the N-terminus) of the mature decorin core protein molecule. In some embodiments, the fusion protein is at least 80%, 90%, 95%, 99% or 100% identical to SEQ ID NO:4(signal-propeptide decorin core protein), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4th amino acid from the N-terminus) of the mature decorin core protein molecule.
The present invention further provides nucleic acid sequences encoding the fusion proteins, as well as vectors comprising the nucleic acid sequences. In some embodiments, the heterologous signal polypeptide is at least 80%, 90%, or 100% identical to SEQ ID NO:5. In some embodiments, the propeptide sequence is at least 80%>, 90%>, or 100% identical to SEQ ID NO:6. In some embodiments, the decorin core protein portion of the fusion
polypeptide is at least 90%, 95% , 99% or 100% identical to SEQ ID NO:7 (mature decorin core protein), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4th amino acid from the N-terminus) of the mature decorin core protein molecule. In some embodiments, the fusion protein is at least 80%>, 90%>, 95%, 99% or 100% identical to SEQ ID NO: 8 (signal-propeptide decorin core protein) ), provided that that the decorin core protein comprises a mutation at amino acid 4 (i.e., the 4th amino acid from the N- terminus) of the mature decorin core protein molecule.
SEQ ID NO. Sequence
SEQ ID NO: l DEAAGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPK Decorin core DLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAF protein TPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVR VTFNG
LNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIPvIADTNITSIPQGLPPS
LTELHLDGNKISPvVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTP
HLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPG
HNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
SEQ ID NO:2 MMSFVSLLLVGILFHATQA
Alpha- lactalbumin
signal sequence
SEQ ID NO:3 GPFQQRGLFDFMLE
Decorin
propeptide
SEQ ID NO:4 MMSFVSLLLVGILFHATQAGPFQQRGLFDFMLEDEAAGIGPEVPDDR signal-propeptide DFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNN
-decorin core KITEIKDGDFK LK LHALILVNNKISKVSPGAFTPLVKLERLYLSK protein QLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPL
KSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISR
VDAASLKGL NLAKLGLSFNSISAVDNGSLANTPHLRELHLD NKLT
RVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSL
FSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
SEQ ID NO:5 ATGATGTCCTTTGTCTCTCTGCTCCTGGTAGGCATCCTATTCCATG Alpha- CCACCCAGGCC
lactalbumin
signal sequence
SEQ ID NO:6 GGCCCGTTTCAACAGAGAGGCTTATTTGACTTTATGCTAGAA Decorin
propeptide
SEQ ID NO:7 GATGAGGCTGCAGGGATAGGCCCAGAAGTTCCTGATGACCGCGA Decorin core CTTCGAGCCCTCCCTAGGCCCAGTGTGCCCCTTCCGCTGTCAATGC protein CATCTTCGAGTGGTCCAGTGTTCTGATTTGGGTCTGGACAAAGTG
CCAAAGGATCTTCCCCCTGACACAACTCTGCTAGACCTGCAAAAC
AACAAAATAACCGAAATCAAAGATGGAGACTTTAAGAACCTGAA
GAACCTTCACGCATTGATTCTTGTCAACAATAAAATTAGCAAAGT
TAGTCCTGGAGCATTTACACCTTTGGTGAAGTTGGAACGACTTTAT
CTGTCCAAGAATCAGCTGAAGGAATTGCCAGAAAAAATGCCCAA
AACTCTTCAGGAGCTGCGTGCCCATGAGAATGAGATCACCAAAGT
GCGAAAAGTTACTTTCAATGGACTGAACCAGATGATTGTCATAGA
ACTGGGCACCAATCCGCTGAAGAGCTCAGGAATTGAAAATGGGG
CTTTCCAGGGAATGAAGAAGCTCTCCTACATCCGCATTGCTGATA
CCAATATCACCAGCATTCCTCAAGGTCTTCCTCCTTCCCTTACGGA
ATTACATCTTGATGGCAACAAAATCAGCAGAGTTGATGCAGCTAG
CCTGAAAGGACTGAATAATTTGGCTAAGTTGGGATTGAGTTTCAA
CAGCATCTCTGCTGTTGACAATGGCTCTCTGGCCAACACGCCTCAT
CTGAGGGAGCTTCACTTGGACAACAACAAGCTTACCAGAGTACCT
GGTGGGCTGGCAGAGCATAAGTACATCCAGGTTGTCTACCTTCAT
AACAACAATATCTCTGTAGTTGGATCAAGTGACTTCTGCCCACCT
GGACACAACACCAAAAAGGCTTCTTATTCGGGTGTGAGTCTTTTC
AGCAACCCGGTCCAGTACTGGGAGATACAGCCATCCACCTTCAGA TGTGTCTACGTGCGCTCTGCCATTCAACTCGGAAACTATAAGTGA SEQ ID NO: 8 ATGATGTCCTTTGTCTCTCTGCTCCTGGTAGGCATCCTATTCCATG signal- CCACCCAGGCCGGCCCGTTTCAACAGAGAGGCTTATTTGACTTTA propeptide- TGCTAGAAGATGAGGCTGCAGGGATAGGCCCAGAAGTTCCTGAT decorin core GACCGCGACTTCGAGCCCTCCCTAGGCCCAGTGTGCCCCTTCCGC protein TGTCAATGCCATCTTCGAGTGGTCCAGTGTTCTGATTTGGGTCTGG
ACAAAGTGCCAAAGGATCTTCCCCCTGACACAACTCTGCTAGACC TGCAAAACAACAAAATAACCGAAATCAAAGATGGAGACTTTAAG AACCTGAAGAACCTTCACGCATTGATTCTTGTCAACAATAAAATT AGCAAAGTTAGTCCTGGAGCATTTACACCTTTGGTGAAGTTGGAA CGACTTTATCTGTCCAAGAATCAGCTGAAGGAATTGCCAGAAAAA ATGCCCAAAACTCTTCAGGAGCTGCGTGCCCATGAGAATGAGATC ACCAAAGTGCGAAAAGTTACTTTCAATGGACTGAACCAGATGATT GTCATAGAACTGGGCACCAATCCGCTGAAGAGCTCAGGAATTGA AAATGGGGCTTTCCAGGGAATGAAGAAGCTCTCCTACATCCGCAT TGCTGATACCAATATCACCAGCATTCCTCAAGGTCTTCCTCCTTCC CTTACGGAATTACATCTTGATGGCAACAAAATCAGCAGAGTTGAT GCAGCTAGCCTGAAAGGACTGAATAATTTGGCTAAGTTGGGATTG AGTTTCAACAGCATCTCTGCTGTTGACAATGGCTCTCTGGCCAAC ACGCCTCATCTGAGGGAGCTTCACTTGGACAACAACAAGCTTACC AGAGTACCTGGTGGGCTGGCAGAGCATAAGTACATCCAGGTTGTC TACCTTCATAACAACAATATCTCTGTAGTTGGATCAAGTGACTTCT GCCCACCTGGACACAACACCAAAAAGGCTTCTTATTCGGGTGTGA GTCTTTTCAGCAACCCGGTCCAGTACTGGGAGATACAGCCATCCA CCTTCAGATGTGTCTACGTGCGCTCTGCCATTCAACTCGGAAACTA TAAGTGA
The decorin polynucleotides of the present invention may be employed for producing decorin polypeptides by recombinant techniques. Thus, for example, the polynucleotide may be included in any one of a variety of expression vectors for expressing a polypeptide. In some embodiments of the present invention, vectors include, but are not limited to, retroviral vectors, chromosomal, nonchromosomal and synthetic DNA sequences (e.g., derivatives of SV40, bacterial plasmids, phage DNA; baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and viral DNA such as vaccinia, adenovirus, fowl pox virus, and pseudorabies). It is contemplated that any vector may be used as long as it is replicable and viable in the host. In some preferred embodiments, the vectors are retroviral
vectors as described in US Pat. Nos. 6,852,510 and 7,332,333 and U.S. pat. Publ. Nos.
200402335173 and 20030224415, all of which are incorporated herein by references in their entirety. In some especially preferred embodiments, the vectors are pseudotyped retroviral vectors.
In particular, some embodiments of the present invention provide recombinant constructs comprising one or more of the sequences as broadly described above (e.g., SEQ ID NO: 8). In some embodiments of the present invention, the constructs comprise a vector, such as a plasmid or viral vector, into which a sequence of the invention has been inserted, in a forward or reverse orientation. In still other embodiments, the heterologous structural sequence (e.g., SEQ ID NO: 8) is assembled in appropriate phase with translation initiation and termination sequences. In preferred embodiments of the present invention, the appropriate DNA sequence is inserted into the vector using any of a variety of procedures. In general, the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by procedures known in the art.
Large numbers of suitable vectors are known to those of skill in the art, and are commercially available. Such vectors include, but are not limited to, the following vectors: 1) Bacterial— pQE70, pQE60, pQE-9 (Qiagen), pBS, pDIO, phagescript, psiX174, pbluescript SK, pBSKS, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene); ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia); 2) Eukaryotic-pWLNEO, pSV2CAT, pOG44, PXT1 , pSG (Stratagene) pSVK3, pBPV, pMSG, pSVL (Pharmacia); and 3) Baculovirus- pPbac and pMbac (Stratagene). Any other plasmid or vector may be used as long as they are replicable and viable in the host. In some preferred embodiments of the present invention, mammalian expression vectors comprise an origin of replication, a suitable promoter and enhancer, and also any necessary ribosome binding sites, polyadenylation sites, splice donor and acceptor sites, transcriptional termination sequences, and 5' flanking non-transcribed sequences. In other embodiments, DNA sequences derived from the SV40 splice, and polyadenylation sites may be used to provide the required non-transcribed genetic elements.
In certain embodiments of the present invention, the DNA sequence in the expression vector is operatively linked to an appropriate expression control sequence(s) (promoter) to direct mRNA synthesis. Promoters useful in the present invention include, but are not limited to, the LTR or SV40 promoter, the E. coli lac or trp, the phage lambda PL and PR, T3 and T7 promoters, and the cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, and mouse metallothionein-I promoters and other promoters known to control expression of gene in prokaryotic or eukaryotic cells or their viruses. In other embodiments of the present invention, recombinant expression vectors include origins of replication and selectable markers permitting transformation of the host cell (e.g., dihydrofolate reductase or neomycin resistance for eukaryotic cell culture, or tetracycline or ampicillin resistance in E. coli).
In some embodiments of the present invention, transcription of the DNA encoding the polypeptides of the present invention by higher eukaryotes is increased by inserting an enhancer sequence into the vector. Enhancers are cis-acting elements of DNA, usually about from 10 to 300 bp that act on a promoter to increase its transcription. Enhancers useful in the present invention include, but are not limited to, the SV40 enhancer on the late side of the replication origin bp 100 to 270, a cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
In other embodiments, the expression vector also contains a ribosome binding site for translation initiation and a transcription terminator. In still other embodiments of the present invention, the vector may also include appropriate sequences for amplifying expression.
In a further embodiment, the present invention provides host cells containing the above-described constructs. In some embodiments of the present invention, the host cell is a higher eukaryotic cell (e.g., a mammalian or insect cell). In other embodiments of the present invention, the host cell is a lower eukaryotic cell (e.g., a yeast cell). In still other
embodiments of the present invention, the host cell can be a prokaryotic cell (e.g., a bacterial cell). Specific examples of host cells include, but are not limited to, Escherichia coli, Salmonella typhimurium, Bacillus subtilis, and various species within the genera
Pseudomonas, Streptomyces, and Staphylococcus, as well as Saccharomycees cerivisiae, Schizosaccharomycees pombe, Drosophila S2 cells, Spodoptera Sf9 cells, Chinese hamster ovary (CHO) cells, COS-7 lines of monkey kidney fibroblasts, (Gluzman, Cell 23: 175
[1981]), C127, 3T3, 293, 293T, HeLa and BHK cell lines.
The constructs in host cells can be used in a conventional manner to produce the gene product encoded by the recombinant sequence. In some embodiments, introduction of the construct into the host cell can be accomplished by retroviral transduction, calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation (See e.g., Davis et al.
[1986] Basic Methods in Molecular Biology). Alternatively, in some embodiments of the present invention, the polypeptides of the invention can be synthetically produced by conventional peptide synthesizers.
Proteins can be expressed in mammalian cells, yeast, bacteria, or other cells under the control of appropriate promoters. Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the present invention. Appropriate cloning and expression vectors for use with prokaryotic and eukaryotic hosts are described by Sambrook, et al. (1989) Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y.
In some embodiments of the present invention, following transformation of a suitable host strain and growth of the host strain to an appropriate cell density in media, protein is secreted and cells are cultured for an additional period. In other embodiments of the present invention, cells are typically harvested by centrifugation, disrupted by physical or chemical
means, and the resulting crude extract retained for further purification. In still other embodiments of the present invention, microbial cells employed in expression of proteins can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
The present invention also provides methods for recovering and purifying decorin from recombinant cell cultures including, but not limited to, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. In some embodiments, the present invention provides improved methods for the purification of decorin, especially decorin core protein. In some embodiments, the processes comprise two column
chromatography steps and a polishing step.
In some preferred embodiments, cation exchange chromatography is used to capture decorin from medium containing decorin, preferably a clarified medium. In some embodiments, the cation exchange chromatography medium is SP-Sepharose FF. In some embodiments, the cation exchange medium is equilibrated at about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 20 to 70 mM NaCL, preferably about 50 mM NaCL at a neutral pH. In some embodiments, after application of the decorin containing medium to the cation exchange medium, the cation exchange medium is washed. In some embodiments, the wash buffer comprises about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 20 to 70 mM NaCL, preferably about 50 mM NaCL. In some embodiments, decorin is then eluted from the cation exchange medium. In some embodiments, the elution buffer comprises about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 150 to 250 mM NaCL, preferably about 200 mM NaCL.
In some embodiments, the eluate containing decorin from the cation exchange chromatography step is applied to a hydroxyapatite medium. In some embodiments, the hydroxyapatite medium is CHT Type 1. In some embodiments, the hydroxyapatite medium is equilibrated at about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 150 to 250 mM NaCL, preferably about 200 mM NaCL. In some embodiments, after application of the decorin containing medium to the hydroxyapatite medium, the
hydroxyapatite medium is washed. In some embodiments, the wash buffer comprises about 5 to 15 mM sodium phosphate, preferably 10 mM sodium phosphate, and 150 to 250 mM NaCL, preferably about 200 mM NaCL. In some embodiments, decorin is then eluted from the hydroxyapatite medium. In some embodiments, the elution buffer comprises about 0.2 to 0.4 M sodium phosphate, preferably 0.3 M sodium phosphate, and 150 to 250 mM NaCL, preferably about 200 mM NaCL.
In some embodiments, the eluate containing decorin from the hydroxyapatite chromatography step is buffer exchanged and applied to an ion exchange membrane. In some embodiments, the ion exchange membrane is a Q ion exchange membrane, for examples a Mustang Q ion exchange medium. In some embodiments, the membrane is equilibrated with from about 30 mM to 70 mM Tris-HCl, preferably about 50 mM Tris-HCl. In some embodiments, after application of the decorin-containing solution to the membrane, the membrane is washed and the decorin passes through the membrane. In some
embodiments, the wash buffer comprises from about 30 mM to 70 mM Tris-HCl, preferably about 50 mM Tris-HCl. Following purification, the decorin is preferably concentrated to a desired concentration, for example by flow filtration.
In other embodiments of the present invention, solutions of containing the decorin are treated to inactivate or remove viruses. In some embodiments, solutions comprising decorin are treated with a surfactant to inactivate viruses. In some embodiments, the surfactant is Triton X-100. In some embodiments, the surfactant treating step is performed after the cation exchange chromatography step. In some embodiments, the solutions comprising decorin are filtered to remove viruses. In some embodiments, the solutions are filtered through a a viral Filter (e.g., a Virosart viral filter). In some embodiments, the filtrations step is performed after the hydroxyapatite chromatography step.
The processes of the present invention preferably provide decorin compositions suitable for clinical use in human patients. In some embodiments, the compositions comprise a purified decorin core protein comprising a mutation at position 4 of the mature decorin core protein so that the decorin protein is substantially non-gagylated. In some embodiments, the compositions provide purified decorin proteins, and the compositions are characterized in comprising less than about 100, 50, 20, 10, 5 or 2 ng residual host cell protein/mg decorin core protein in the composition and/or less than about 20, 10, 5, or 2 pg residual host cell DNA/mg decorin core protein. In some embodiments, the decorin is provided in a aqueous solution. In some embodiments, the aqueous solution is phosphate buffered saline (e.g., lOmM sodium phosphate, 150mM sodium chloride), with a pH of from about 6.5 to 7.5, preferably about 7.0.
EXPERIMENTAL
Example 1
Expression and Production Optimization of a Mutated Form of Human Decorin An expression construct was produced for a mutant form of Decorin. A serine to alanine modification was made at amino acid 4 of mature Decorin. The mutation prevents a GAG from being attached to the Decorin molecule. The expression construct uses the bovine
alpha-lactalbumin signal peptide instead of the endogenous signal peptide for protein production and secretion. The construct is depicted in Figures 7 and 8.
To confirm that the expression construct resulted in formation of the correct protein, a CHO cell line was made using the GPEx® process and the above gene construct. Decorin was produced and purified. N-terminal amino acid sequencing was done on the purified protein. The resulting sequence is shown below.
Asp - Glu - Ala - Ala - Gly - He - Gly - Pro - Glu - Val - Pro - Asp - Asp - Arg - Asp - Phe - Glu - Pro - Ser - Leu (SEQ ID NO:9)
The sequence corresponds to the expected sequence of the mature protein. The alanine mutation was incorporated as expected and the signal peptide and pro-protein cleaved to yield the correct mature Decorin N-terminal sequence.
Clonal cell lines that produce mutated Decorin were generated using GPEx®. The top expressing cell line was selected by screening different culture conditions and Master cell banked. Production of the cell line was examined in two 10L bioreactor runs using fed-batch conditions. The results of the run are shown in Figure 9.
Example 2
Purification of Decorin Core Protein
1.0 Summary
The development of a purification was developed at a small scale and this was applied to One 200L batch , produced in a GMP suite using fed batch feed strategy. This batch was harvested on day 14 at approximately a 50% viability level. Protein concentration level was 1.240g/l on day 14 (harvest date) of the bioreactor.
1.1 Components Used in the Synthesis of DCP
The cell culture medium used for all culture steps was HyClone (Logan, UT, USA) HyQ PF-CHO Liquid Soy (LS) with L-glutamine and 0.1% Pluronic F68. The medium was received as a complete, sterile liquid. HyQ PF-CHO LS is a proprietary protein-free cell culture medium formulation from HyClone. The exact ingredients are not known, however, HyClone does hold a Type II Device File for Serum-Free Medium with the FDA for HyQ PF- CHO LS (reference number BBMF8302). HyQ CellBoost R15.4 is proprietary media supplement formulations from HyClone used in the production culture.
1.2 Production of DCP
Descript ion Comp in Product
Number
HyQ PF-CHO LS with L- HyClone SH30359.02
glutamine and 0.1%
Pluronic F68 (1 L Bottle)
HyQ PF-CHO LS with L- HyClone SH3A1568.07
glutamine and 0.1%
Pluronic F68 (30 L Bag)
HyQ PF-CHO LS with L- HyClone SH3A1568.08
glutamine and 0.1%
Pluronic F68 (175 L Bag)
HyQ Cell Boost Rl 5.4 HyClone SH30857.03
Supplement 1.2.1 Scale-up of 200L Production Culture Inoculum
Details for each subculture step are presented in the Processing Steps for Inoculum Culture Scale-up table below. Production lot 09018 was initiated by thawing a MCB vial, Lot number 06005 (Vial #182) in a 37° C water bath. After thawing the frozen MCB vial, the cells were added to a single shake flask (250 mL) (Thermo Fisher Scientific) containing 35 mL of HyQ PF-CHO LS cell culture medium. The initial cell count, determined using a hemacytometer, was 2.25 x 105 cells/mL and 90.4% viability. The culture was then placed on an Orbit shaker (90 rpm) within an incubator maintained at 37°C in a humidified, 5% C02 environment. Subculture steps targeted inoculation densities of approximately 2.0 x 105 cells/ml. The day 3 cell count and percent viability in the flask was 14.24 x 105 cells/mL with 95.8% viability and the flask was subcultured to 1 L flask. The Day 3 average viable cell count from the 1 L flask was 23.43 x 105 cells/mL with 98.1% viability. The 1 L flask was subcultured to a Wave Bioreactor System 20EH with a 10 L disposable Wave Bag (GE Healthcare Bioscience Bioprocess Corp, Somerset, NJ) at an initial culture volume and an initial target cell density of 1000 mL and 2.0 x 105 cells/mL, respectively. The Wave
Bioreactor operating settings were 37.0° C incubation temperature, 15.0 cpm rocker speed, 11.0° rocking angle, and 5.0% C02 concentration in the aeration gas with gas flow rate of 0.25 L/minute. After 2 days the viable cell density in the Wave Bag was 10.28 xlO5 cells/ml, fresh HyQ PF-CHO LS was added bringing the culture volume to 4992 mL. After three days, the viable cell density was 18.37 x 105 cells/mL and the volume in the Wave Bag was transferred to the 30L bioreactor. The operating set-points in the 30 L bioreactor for temperature, pH, dissolved oxygen, pressure, and agitation rate were 37° C, 40%> air
saturation, 1 psig pressure, and 50 rpm agitation rate, respectively. The pH controller was not activated, allowing for the cells to naturally drift toward a pH of 7.
Abbreviations: VCC, Viable cell count
1.2.2 Culture in 200L Production Bioreactor
Initially, 137 Kg of HyQ PF-CHO LS cell culture medium and 4.3 Kg HyQ Cell Boost R15.4 12% (w/v) solution were added to the 200 L bioreactor. "Day 0" of the production culture was considered the day the 200 L bioreactor was inoculated.
The viable cell density in the 30 L bioreactor was 14.87 x 105 cells/mL on day two of culture, which was sufficient to inoculate the 200 L bioreactor at an initial target density of 2.00 x 105 cells/mL. The entire contents of the 30 L were transferred and the post inoculum weight, cell density and viability were 171.9 Kg, 2.90 x 105 cells/mL and 93.9%,
respectively. The operating set-points in the 200 L bioreactor for temperature, pH, dissolved
oxygen, pressure, and agitation rate were 37° C, pH 7.0, 40% air saturation, 1 psig pressure, and 35 rpm agitation rate, respectively.
The pH deadband was initially set at actual pH value minus 7.0, prior to inoculation. This was done to prevent the addition of C02, and allow the cells to naturally drift toward a pH of 7.0. The initial deadband setting was 0.32. After inoculation, the pH was checked daily and the deadband adjusted to actual pH value minus 7.0. On day 1, the pH deadband was decreased to 0.22 and on day three, the deadband was set to 0.05 and remained at this setting for the rest of the run.
The first feed was to occur on day 2 or 3, when the glucose level fell below <5g/l, or on day 3 by default. On day 2, glucose level fell below 5g/L, so an additional 4.4kg (L) of 12% w/v HyQ Cell Boost R15.4 + 120mM L-glutamine solution was added to the bioreactor. The next feed was to occur on day 4 or 5, when the glucose level fell below <5g/L. On day 4, the glucose level fell below 5g/L which triggered an additional feed of 9g/L (14.2L) of 12%> w/v HyQ Cell Boost R15.4 solution. On day 5, the temperature was reduced from 37°C to 31°C. Day 6 through harvest, the glucose level was checked daily and the addition of a 20%> glucose solution to yield a 3g/L increase in glucose was to occur on any day the glucose level fell below <5g/L. On day 8 and 12, the glucose level fell to 4.84 and 4.98g/l, respectively. On day 8 and 12, 2.9 and 3.0 kg(L) of 20%> glucose solution was added to the bioreactor.
The viable cell density peaked on day 5 at 61.00 x 105 cells/mL with a viability of 95.7%). The bioreactor was harvested on 11/03/09, (day 14) at a cell viability of 50.2%>, with a final weight of the bioreactor at 191.8 Kg.
The integrated cell number (ICN) was generated and plotted against protein results to give a curve of which the slope gives the pcd (27.316) for the 14 day run.
1.4 Summary of Upstream Production
This lot was harvested on day 14, at a viability of 50.2% and a titer of 1.240g/L. The batch was transferred to downstream and purified per the downstream batch processing record.
DCP 200L Downstream Purification 1.3 Summary
The harvested material from the 200L batch was purified as outlined below resulting in 21 lg (at 5mg/mL) in a final volume of 42L. The final bulk drug substance met the specifications previously approved for this batch. All concentrations were determined by absorbance unless otherwise stated.
1.4 Clarification (November 3rd 2009)
The harvest material (189L) was filtered through a Cuno 60M02 Maximizer filter (2 x 16ft2) at a volume / area of 5.9L/ft2 at an initial flow rate of 3L / min and through a 0.22μιη 10" Millipore Opticap filter. The filter housing was blown down with compressed nitrogen to maximize product recovery.
Table 1 Analysis of Clarification Step
* concentration based on RP-HPLC.
1.5 Capture - Cation Exchange Chromatography
SP-Sepharose FF (GE Healthcare) was used for the capture of the protein from the clarified media. The clarified media was diluted to reduce the conductivity prior to capture on to the column. The conditions of this run are shown below along with the analysis of the various fractions. The clarified media was processed as two sub batches.
Table 2 SP-Sepharose Column Parameters
Actual Load (mg/mL resin) - Sub 12.8
Batch B
Capture - SP-Sepharose Sub Batch A Table 3 SP-Sepharose Process Conditions
Table 4 SP-Sepharose Sub-Lot A Fractions
*this concentration was determined using RP-HPLC, pre dilution. ** measured by Reversed Phase HPLC
1.5.1 Capture - SP-Sepharose Sub Batch B
Table 5 SP-Sepharose Sub Batch B Process Conditions
Table 6 Analysis of SP-Sepharose Sub Lot B Fractions
*this concentration was determined using RP-HPLC, pre dilution.
** measured by Reversed Phase HPLC
1.6 Viral Inactivation
The two SP-Sepharose sub lots were individual subjected to viral inactivation using
11% (w/v) Triton X-100 diluted to a concentration of 1%. The volumes were incubated at room temperature, with gentle mixing, for 60-90 minutes prior to CHT chromatography. Subsequent processing of the viral inactivated material occurred in the ISO 7 suite.
Table 7 Viral Inactivation Details
1.7 Intermediate - Ceramic Hydroxyapatite (CHT) Chromatography
CHT Type I (BioRad) was used to further purify DCP from residual CHO protein in the
SP-Sepharose pools as well as to remove the Triton from the inactivation step. The conditions of this run are shown below along with the analysis of the various fractions. The SP- Sepharose pools were processed as two sub-batches as described above.
Table 9 CHT Process Conditions
Table 10 CHT Sub-Lot A Fractions
*this concentration was determined from the SP-Sepharose pools prior to Triton inactivation. ** measured by Reversed Phase HPLC
1.7.2 Intermediate - CHT Sub Batch B
Table 11 CHT Sub Batch B Process Conditions
Table 12 Analysis of CHT Sub Lot B Fractions
*this concentration was determined from the SP-Sepharose pools prior to Triton inactivation. ** measured by Reversed Phase HPLC
1.8 Intermediate Buffer Exchange of CHT Pools
The two CHT pools (47.8L) were combined and diluted with an equal volume of water giving a total volume of 95.6L. This was concentrated ~2 fold to ~45L and approximately -6.57 mg/mL, using a 0.6m2 Prep/Scale TFF cartridge (Millipore), 10KMWCO. The recirculation flow rate was 5L/min and a back pressure of approximately 20psi was maintained.
The concentrate was then continuously diafiltered against 7.9 volumes of 25mM Tris- HC1 pH7.5. (55.5L) and the permeate conductivity at the end of the buffer exchange was
confirmed to be at <5mS/cm (4.40mS/cm). The filter was washed and this and the concentrate were combined and 0.2um filtered prior to storage at 2-8°C.
Table 13 Intermediate Buffer Exchanged Fractions
*this concentration was determined from combining the data from the two CHT pools. 1.9 Polishing - Mustang Q Filtration
The Mustang Q (Pall) step was carried out in flow through mode, with any bound material being eluted with a sodium chloride strip. The Buffer exchanged pool was loaded directly onto the conditioned Mustang Q membrane. Table 14 Mustang Q Membrane Parameters
Table 15 Mustang Q Process Conditions
Table 16 Analysis of Mustang Q Fractions
1.10 Viral Filtration
The Mustang Q pool was viral filtered using a Virosart filter.
Table 17 Viral Filter Parameters
The Mustang Q pool was passed through the filter under 30 psi nitrogen. The filter was then flushed with 5L of WFI. Table 18 Analysis of Viral Filtration Fractions
1.11 Concentration and formulation The Viral Filtrate (48.0L) was concentrated buffer exchanged, using 2 x 0.6m2
Prep/Scale TFF cartridge (Millipore), 10KMWCO. The re-circulation flow rate was 5L/min and a feed pressure of 20psi was maintained.
The viral filtrate was continuously diafiltered against 6.9 volumes of lOmM sodium phosphate, 150mM sodium chloride, pH 7.0 to a final volume of 48.5L. This bulk was then concentrated down to approximately 40L and then the cartridge was flushed with 2.4L of lOmM sodium phosphate, 150mM sodium chloride, pH 7.0, to remove any remaining protein. This was pooled with the concentrate and the concentration determined to be 5.0g/L (42.2L total volume). The final bulk was then filtered into a bag with a 0.2μιη filter. Table 19 Analysis of Formulation Samples
* measured by QC
2 Step Recovery Table
The table below shows the step recovery of each of the steps used in the purification of this batch Note: these values do not account for viral validation sampling.
Table 20 Analysis of Formulation Samples
All publications and patents mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described method and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the field of this invention are intended to be within the scope of the following claims.
Claims
What is claimed is: 1. A method of producing a non-gagylated decorin core protein comprising:
providing host cells expressing non-gagylated decorin core protein;
culturing said host cell so that said non-gagylated decorin core protein is produced; and
purifying said non-gagylated decorin core protein.
2. The method of Claim 1, wherein said non-gagylated decorin core protein is secreted into medium used to culture said host cells.
3. The method of Claim 2, wherein said purifying comprises contacting said culture medium with an ion exchange medium.
4. The method of Claim 2, wherein said purifying comprises contacting said culture medium with a hydroxyapatite medium.
5. The method of Claim 2, wherein said purifying comprises contacting said culture medium with at least one ion exchange medium and at least one hydroxyapatite medium in any order.
6. The method of Claim 2, wherein said purifying comprises:
contacting said culture medium with a cation exchange medium;
washing said cation exchange medium;
eluting a first decorin-containing eluate from said cation exchange medium;
contacting said first decorin-containing eluate with a hydroxyapatite medium;
washing said hydroxyapatite medium;
eluting a second decorin-containing eluate from said hydroxyapatite medium.
7. The method of Claim 6, wherein said cation exchange medium is SP-Sepharose FF.
8. The method of Claim 6, wherein said hydroxyapatite medium is ceramic hydroxyapatite type I.
9. The method of Claim 6, further comprising further purification of said second decorin-containing eluate with an ion exchange membrane or column.
10. The method of Claim 9, wherein said ion exchange membrane is a Q ion exchange membrane.
11. The method of Claim 6, further comprising a viral inactivation step.
12. The method of Claim 1, wherein said viral inaction step comprises treatment with a surfactant.
13. The method of Claim 2, wherein said surfactant is Triton X- 100.
14. The method of Claim 6, further comprising a viral filtration step.
15. The method of Claim 6, further comprising concentrating said decorin.
16. The method of Claim 1, wherein said non-gagylated decorin core protein is produced by said host cells at a rate of about greater than 1, 5, or 10 pg/cell/day.
17. A method for purifying decorin from a decorin-containing medium comprising: contacting said decorin-containing medium with a cation exchange medium;
washing said cation exchange medium;
eluting a first decorin-containing eluate from said cation exchange medium;
contacting said at first decorin-containing eluate with a hydroxyapatite medium; washing said hydroxyapatite medium;
eluting a second decorin-containing eluate from said hydroxyapatite medium;
filtering said second decorin-containing eluate with an ion exchange membrane to provide a decorin-containing filtrate;
treating said filtrate to remove viruses;
concentrating decorin from said filtrate.
18. A composition comprising a purified decorin core protein comprising a mutation at position 4 of the mature decorin core protein so that said decorin protein is substantially non- gagylated, said composition comprising less than about 100 ng residual host cell protein/mg decorin core protein in said composition and less than about 20 pg residual host cell DNA/mg decorin core protein.
19. The composition of Claim 18, said composition comprising less than about 5 ng residual host cell protein/mg decorin core protein in said composition and less than about 5 pg residual host cell DNA/mg decorin core protein.
20. The composition of Claim 18, wherein said decorin is formulated as an aqueous solution.
21. The composition of Claim 20, wherein said aqueous solution comprises a phosphate buffered solution with a pH of from about 6.5 to about 7.5.
22. A fusion protein comprising a heterologous signal peptide operably linked to a sequence encoding decorin.
23. The fusion protein of Claim 22, wherein said signal sequence is an alpha-lactalbumin signal sequence.
24. The fusion protein of Claim 23, wherein said alpha lactalbumin sequence is a bovine alpha-lactalbumin signal sequence.
25. The fusion protein of Claim 22, wherein said sequence encoding decorin encodes a decorin core protein.
26. The fusion protein of Claim 25, wherein said decorin core protein comprises a mutation at position 4 of the mature decorin core protein.
27. The fusion protein of Claim 26, wherein said mutation is a serine to alanine mutation.
28. The fusion protein of Claim 25, wherein said decorin core protein lacks substantial modification by glycosaminoglycans molecules at position 4 of the mature decorin core protein.
29. A vector encoding the fusion protein of Claim 22.
30. The vector of Claim 29, wherein said vector comprises a nucleic acid sequence encoding an alpha-lactalbumin signal sequence operably linked to a sequence encoding a decorin core protein.
31. A host cell comprising the vector of Claim 29.
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP18169033.0A EP3456837A3 (en) | 2011-03-14 | 2012-03-13 | Decorin compositions and use thereof |
| EP12757556.1A EP2686335B1 (en) | 2011-03-14 | 2012-03-13 | Decorin compositions and use thereof |
| JP2013558110A JP5965927B2 (en) | 2011-03-14 | 2012-03-13 | Decorin composition and use thereof |
| DK12757556.1T DK2686335T3 (en) | 2011-03-14 | 2012-03-13 | DECORINE COMPOSITIONS AND APPLICATION THEREOF |
| CN201280013702.2A CN103917655B (en) | 2011-03-14 | 2012-03-13 | Decorin compositions and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161452299P | 2011-03-14 | 2011-03-14 | |
| US61/452,299 | 2011-03-14 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP18169033.0A Previously-Filed-Application EP3456837A3 (en) | 2011-03-14 | 2012-03-13 | Decorin compositions and use thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012125626A2 true WO2012125626A2 (en) | 2012-09-20 |
| WO2012125626A3 WO2012125626A3 (en) | 2014-04-24 |
Family
ID=46828968
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/028911 Ceased WO2012125626A2 (en) | 2011-03-14 | 2012-03-13 | Decorin compositions and use thereof |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US20120238727A1 (en) |
| EP (2) | EP3456837A3 (en) |
| JP (3) | JP5965927B2 (en) |
| CN (1) | CN103917655B (en) |
| DK (1) | DK2686335T3 (en) |
| WO (1) | WO2012125626A2 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2016519110A (en) * | 2013-04-22 | 2016-06-30 | キャタレント ファーマ ソリューションズ リミテッド ライアビリティ カンパニー | Veterinary decorin compositions and their use |
| US10870710B2 (en) | 2013-05-14 | 2020-12-22 | Medimmune Limited | Synthetic oligosaccharide subunits of the Psl exopolysaccharide of pseudomonas aeruginosa and uses thereof |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2018048053A (en) | 2016-09-23 | 2018-03-29 | 昭和電工株式会社 | CRUCIBLE FOR SiC SINGLE CRYSTAL GROWTH |
| US11377488B2 (en) * | 2018-07-03 | 2022-07-05 | Catalent Pharma Solutions, Llc | Multifunctional protein molecules comprising decorin and use thereof |
| US11725043B2 (en) | 2020-03-05 | 2023-08-15 | DiaMedica USA Inc. | Ulinastatin polypeptides |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030224415A1 (en) | 2001-06-29 | 2003-12-04 | Gala Design, Inc. | Selection free growth of host cells containing multiple integrating vectors |
| US20040235173A1 (en) | 2000-07-03 | 2004-11-25 | Gala Design, Inc. | Production of host cells containing multiple integrating vectors by serial transduction |
| US6852510B2 (en) | 2000-07-03 | 2005-02-08 | Gala Design Inc | Host cells containing multiple integrating vectors |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6509314B1 (en) * | 1988-06-28 | 2003-01-21 | The Burnham Institute | Methods of preventing or reducing scarring with decorin or biglycan |
| US5654270A (en) * | 1988-06-28 | 1997-08-05 | La Jolla Cancer Research Foundation | Use of fibromodulin to prevent or reduce dermal scarring |
| JP2887325B2 (en) * | 1988-06-28 | 1999-04-26 | ラ ホヤ キャンサー リサーチ ファウンデーション | Inhibition of cell proliferation by decorin |
| WO1993009800A1 (en) * | 1991-11-14 | 1993-05-27 | La Jolla Cancer Research Foundation | Inhibitors of cell regulatory factors and methods for preventing or reducing scarring |
| FI944575L (en) * | 1992-04-03 | 1994-11-29 | Jolla Cancer Res Found | Decorin fragments and methods for inhibiting cellular regulatory factors |
| US5567807A (en) * | 1994-07-08 | 1996-10-22 | La Jolla Cancer Research Foundation | Processes for the purification of human recombinant decorin and the detection of guanidinium ions |
| NZ522971A (en) * | 2000-05-05 | 2005-02-25 | Gtc Biotherapeutics Inc | Transgenically produced decorin in the mammary gland of a transgenic animal |
| US20030124152A1 (en) * | 2001-11-02 | 2003-07-03 | Pang Danny Zhong Der | Use of decorin in a cosmetic or dermatologic composition |
| KR100495126B1 (en) * | 2002-04-16 | 2005-06-14 | 한국생명공학연구원 | Fusion protein containing a activity of N-acetylgalactosaminyltransferase, a gene encoding the fusion protein and a transformed cell line transfected by the gene |
| CA2681294C (en) * | 2007-03-23 | 2014-05-06 | Asahi Kasei Pharma Corporation | Method for producing high-purity soluble thrombomodulin |
| US8945895B2 (en) * | 2009-07-31 | 2015-02-03 | Baxter International Inc. | Methods of purifying recombinant ADAMTS13 and other proteins and compositions thereof |
-
2012
- 2012-03-13 EP EP18169033.0A patent/EP3456837A3/en active Pending
- 2012-03-13 DK DK12757556.1T patent/DK2686335T3/en active
- 2012-03-13 CN CN201280013702.2A patent/CN103917655B/en active Active
- 2012-03-13 EP EP12757556.1A patent/EP2686335B1/en active Active
- 2012-03-13 JP JP2013558110A patent/JP5965927B2/en active Active
- 2012-03-13 US US13/419,045 patent/US20120238727A1/en not_active Abandoned
- 2012-03-13 WO PCT/US2012/028911 patent/WO2012125626A2/en not_active Ceased
-
2016
- 2016-04-15 JP JP2016082308A patent/JP2016185952A/en active Pending
-
2018
- 2018-08-03 JP JP2018146607A patent/JP6831813B2/en active Active
-
2021
- 2021-07-02 US US17/366,284 patent/US20220073579A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040235173A1 (en) | 2000-07-03 | 2004-11-25 | Gala Design, Inc. | Production of host cells containing multiple integrating vectors by serial transduction |
| US6852510B2 (en) | 2000-07-03 | 2005-02-08 | Gala Design Inc | Host cells containing multiple integrating vectors |
| US7332333B2 (en) | 2000-07-03 | 2008-02-19 | Gala Design, Inc. | Host cells containing multiple integrating vectors |
| US20030224415A1 (en) | 2001-06-29 | 2003-12-04 | Gala Design, Inc. | Selection free growth of host cells containing multiple integrating vectors |
Non-Patent Citations (6)
| Title |
|---|
| GLUZMAN, CELL, vol. 23, 1981, pages 175 |
| GRAY ET AL., GENE, vol. 39, no. 2, 1985, pages 247 - 54 |
| MARTIAL ET AL., SCIENCE, vol. 205, 1979, pages 602 - 607 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 2nd ed.", 1989, COLD SPRING HARBOR, N.Y |
| See also references of EP2686335A4 |
| ZWIZINSKI ET AL., J. BIOL. CHEM., vol. 255, no. 16, 1980, pages 7973 - 77 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2016519110A (en) * | 2013-04-22 | 2016-06-30 | キャタレント ファーマ ソリューションズ リミテッド ライアビリティ カンパニー | Veterinary decorin compositions and their use |
| US10137168B2 (en) | 2013-04-22 | 2018-11-27 | Catalent Pharma Solutions, Llc | Veterinary decorin compositions and use thereof |
| US10870710B2 (en) | 2013-05-14 | 2020-12-22 | Medimmune Limited | Synthetic oligosaccharide subunits of the Psl exopolysaccharide of pseudomonas aeruginosa and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2018191647A (en) | 2018-12-06 |
| US20120238727A1 (en) | 2012-09-20 |
| JP5965927B2 (en) | 2016-08-10 |
| JP2016185952A (en) | 2016-10-27 |
| EP2686335A4 (en) | 2015-11-25 |
| WO2012125626A3 (en) | 2014-04-24 |
| JP6831813B2 (en) | 2021-02-17 |
| EP2686335A2 (en) | 2014-01-22 |
| JP2014518508A (en) | 2014-07-31 |
| CN103917655B (en) | 2016-05-25 |
| DK2686335T3 (en) | 2018-07-30 |
| US20220073579A1 (en) | 2022-03-10 |
| EP2686335B1 (en) | 2018-04-25 |
| EP3456837A2 (en) | 2019-03-20 |
| EP3456837A3 (en) | 2019-04-24 |
| CN103917655A (en) | 2014-07-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220073579A1 (en) | Decorin compositions and use thereof | |
| EP2516464B1 (en) | Recombinant factor h and variants and conjugates thereof | |
| US6777205B1 (en) | Host cells expressing recombinant human erythropoietin | |
| JP2010213699A (en) | Host cell expressing recombinant human erythropoietin | |
| US20260083883A1 (en) | Recombinant human type iii collagen for promoting angiogenesis, and preparation method and application method thereof | |
| JPH06217778A (en) | Sequence of human MK gene and protein | |
| JPH10507452A (en) | Purification of keratinocyte growth factor | |
| HK40004571A (en) | Decorin compositions and use thereof | |
| RU2733423C1 (en) | Methylotrophic yeast strain pichia pastoris yst-hsa-pdi1, producing recombinant human serum albumin | |
| CN119823257A (en) | Preparation method of recombinant engineering bacterium for expressing XVII type collagen COL17A1 | |
| CN117466992A (en) | Fibronectin mutant and preparation and application thereof | |
| CN120554493B (en) | An elastin peptide that improves skin elasticity and its preparation method | |
| CN121471378B (en) | A recombinant type XVII collagen, its preparation method and application | |
| CN119798465B (en) | Recombinant type III collagen with high thermal stability and high transdermal absorption and its application | |
| CN107058332B (en) | A nucleic acid fragment encoding rhFGF-6, expression vector, host cell, production method and application | |
| EP2989208A1 (en) | Veterinary decorin compositions and use thereof | |
| CN117402263A (en) | Recombinant metallothionein and preparation method and application thereof | |
| CN113801867A (en) | Camel prochymosin mutant protein and its encoding gene and application | |
| CN114057886A (en) | Somaltulipide derivative and preparation method thereof | |
| VOLVULUS | CLONED N-CARBAMOYL SARCOSINE AMIDOHYDROLASE | |
| MXPA00005180A (en) | Novel i(dkr) polypeptides |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12757556 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2013558110 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012757556 Country of ref document: EP |




















