WO2012122534A2 - N-quinolin-benzensulfonamides and related compounds for the treatment of cancer, autoimmune disorders and inflammation - Google Patents

N-quinolin-benzensulfonamides and related compounds for the treatment of cancer, autoimmune disorders and inflammation Download PDF

Info

Publication number
WO2012122534A2
WO2012122534A2 PCT/US2012/028619 US2012028619W WO2012122534A2 WO 2012122534 A2 WO2012122534 A2 WO 2012122534A2 US 2012028619 W US2012028619 W US 2012028619W WO 2012122534 A2 WO2012122534 A2 WO 2012122534A2
Authority
WO
WIPO (PCT)
Prior art keywords
compounds
compound
cancer
cell
nqbs
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/028619
Other languages
French (fr)
Other versions
WO2012122534A3 (en
Inventor
Donald W. Landry
Owen O'connor
Shi-Xian Deng
Matko KALAC
K. Alison RINDERSPACHER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Columbia University in the City of New York
Original Assignee
Columbia University in the City of New York
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Columbia University in the City of New York filed Critical Columbia University in the City of New York
Publication of WO2012122534A2 publication Critical patent/WO2012122534A2/en
Priority to US14/020,363 priority Critical patent/US9896420B2/en
Anticipated expiration legal-status Critical
Publication of WO2012122534A3 publication Critical patent/WO2012122534A3/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D215/00Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems
    • C07D215/02Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen atoms or carbon atoms directly attached to the ring nitrogen atom
    • C07D215/16Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen atoms or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D215/38Nitrogen atoms
    • C07D215/40Nitrogen atoms attached in position 8
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • A61K31/4709Non-condensed quinolines and containing further heterocyclic rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D409/00Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
    • C07D409/02Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings
    • C07D409/12Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links

Definitions

  • the present invention relates to N-(quinolin-8-yl) benzenesulfonamides ("NQBS”) and related compounds and their use as agents for treating cancer, autoimmune disorders and inflammatory conditions.
  • NQBS N-(quinolin-8-yl) benzenesulfonamides
  • NF- ⁇ nuclear factor- ⁇
  • NF-KB represents a family of five proteins (pi 05/50, pl00/p52, c-Rel, RelA/p65 and RelB) that affect over 400 genes, many of which are important in the context of cancer cell growth and survival (Perkins, 2007, Nature Rev. Mol. Cell Biol. 8:40-62). Many of these gene activate genes that: promote cancer cell growth; inhibit those mechanisms responsible for cell cycle arrest; and promote resistance to cell death. All NF-KB members contain a Rel homology domain (“RHD”), an approximately 300 amino acid long residue, which is a highly conserved sequence (e.g.
  • RHD Rel homology domain
  • SEQ ID NO:l from AF134870 and see Lopez-Rodriguez et al., 1999, Proc. Natl. Acad. Sci. 96:7214-7219) near their N terminus of the RHD. This domain is the site that mediates binding to DNA, dimerization with other NF- ⁇ subunits, and nuclear localization.
  • SEQ ID NO: 1 is a human sequence as follows:
  • NF- ⁇ subunits translocate to the nucleus where they exert their effect on gene transcription by binding to DNA.
  • the ability to transactivate specific genes in DNA is absolutely dependent on the ability of the NF-KB subunits to enter the nucleus, the site of all DNA replication and transcription.
  • NF- ⁇ activation pathways There are at least three known NF- ⁇ activation pathways: (1 ) the canonical or classical pathway, which is an ⁇ dependent pathway activated by extracellular signals such as TNFa, IL-l and LPS; (2) the non-canonical or alternative pathway, which is an ⁇ independent pathway activated by CD40/CD40L interaction, and (3) the atypical pathway, which is stimulated by various signals including genotoxic stress, hypoxia and ROS (Perkins, 2007, Nature Rev. Mol. Cell Biol. 8:40-62).
  • NF- ⁇ transcription factors are sequestered in the cytoplasm in their inactive state by the ⁇ family of inhibitory proteins (hcBa, ⁇ , IxBe, ⁇ 105/ ⁇ and plOO/d).
  • ⁇ kinase phosphorylates ⁇ , rendering it a substrate for ubiquitination and subsequent proteosome mediated degradation. Removal of the IKB allow s for nuclear translocation of the NF-KB complex, and activation of its target genes (Perkins, 2007, Nature Rev. Mol. Cell Biol. 8:40-62).
  • IKK directly phosphorylates i 00 which in turn induces the processing of plOO to p52, which is then translocated to the nucleus with subsequent activation of the target genes.
  • the atypical pathway can lead to NF-KB activation in a IKK independent way (hypoxia and ROS activate Tyr kinase) or an IKK dependent way (genotoxic stress).
  • Over expression and constitutive activation of NF- ⁇ is thought to be one of the central events leading to cancer. This biology, first described in normal lymphocytes, is thought to play a pivotal role in the formation of lymphomas. Identifying pharmacologic strategies to inhibit the activation of target NF- ⁇ genes has been a major pursuit for cancer research laboratories over the past 2 decades.
  • bortezomib (Velcade), a proteasome inhibitor advocated as an NF ⁇ KB inhibitor which has been approved for the treatment of myeloma and mantle cell lymphoma. While bortezomib inhibits the degradation of ⁇ , it also affects more than 90% of the protein turnover in the cell, and thus affects virtually every important cellular process known. Clinically, while effective, the drug is neurotoxic and is associated with an irreversible painful neuropathy. Clearly, more specific NF-KB inhibitors are needed. To date, direct binding of NQBS to the target protein (p65 and p50) has not yet been described within published literature and therefore represents a novel mode of action for a drug that inhibits NF- ⁇ pathway.
  • the present invention relates to the NQBS class of molecules and related compounds. It is based, at least in part, on the discovery that a representative group of compounds have been observed to inhibit nuclear translocation of NF- ⁇ subunits.
  • this inhibition of nuclear translocation may be mediated by either (i) binding of the NQBS compound to the C-terminus of the RHD, which specifically mediates the nuclear internalization; or (ii) NQBS-mediated stabilization of the NF-KB dimer/ ⁇ complex, disallowing dissociation of the active NF- KB monomers, and thus, inhibiting the generation of the subunits necessary to enter the nucleus.
  • the NQBS class of molecules may be used in therapeutic applications where inhibition of NF-KB translocation is beneficial, including but not limited to the treatment of cancer, autoimmune disorders, and inflammatory states.
  • FIGURE 1A-E Compounds (A) O-l ; ( ⁇ ) 0-5; (C) 0-2; (D) 0-3; and (E) 0-4. These are examples of NQBS compounds having the C7-locked (A) or C7-open (C- E) configurations.
  • FIGURE 2 Growth inhibition IC50 values (micromolar; ⁇ ) calculated with Calcusyn Software across DLBCL and TNFa unstimulated HUVEC lines for 0-1 and 0-4 luminescence assays.
  • FIGURE 3A,B Flow cytometric analysis showing percentage of apoptotic cells in DLBCL lines treated with (A) O-l or (B) 0-4 (72 hour time point).
  • FIGURE 4A-B Laser confocal microscopy showing, via immunofluorescence of pl05/p50 NF- ⁇ ), the effects of compounds 0-1, 0-2, 0-3, and 0-4, as compared to control, in either (A) LylO or (B) HBL-1 DLBCL cell lines.
  • FIGURE 5 Nuclear NF-KB presence in HBL-1 (lanes 1 and 2) or Lyl O (lanes 3-18) DLBCL cell lines (EMSA), either untreated (lanes 1, 3 and 7) or treated with various compounds as indicated.
  • FIGURE 6 Effect of NQBS compounds on transcription factors other than NF- ⁇ .
  • FIGURE 7 Results of toxicity studies in SCID beige mice, as assessed by animal weight.
  • Compound 0-3 an open-ring NQBS compound
  • FIGURE 8 A- J. Table summarizing all tested NQBS compounds with growth inhibition IC 50 values (luminescence assays) and EMSA and/or IF assay results for NF-KB translocation inhibition.
  • FIGURE 9 Cytotoxicity of 0-4 and 0-19 toward solid tumors.
  • FIGURE 10 Ribbon diagram showing association between 0-4 and p65.
  • FIGURE 11 A-C. Thermal shift studies of the interaction between 0-4 and p50 or 65.
  • FIGURE 12A-D Results of an in vivo experiment in which treatment with 0-4 resulted in remission of an aggressive lymphoma, as demonstrated in a mouse transgenic for both myc and cherry luciferase reporter genes.
  • FIGURE 13 Results of an in vivo experiment in SCID beige mice with human DLBCL xenografts (OCI-Lyl cell line) treated with 0-4, which significantly inhibited growth of tumors when compared to the control mice which were treated with saline and 10% DMSO; downward arrows indicate treatment with compound 0-4 at a dose of 1 Omg/kg.
  • FIGURE 14 Compound 47, 55, 69, 74 and 75. 5. DETAILED DESCRIPTION OF THE INVENTION
  • the present invention relates to a compound of Formula I :
  • R 1 , R 2 , R 3 , R 4 and R 5 are independently selected for each occurrence from the group consisting of hydrogen, halogen, alkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, alkoxy, aryloxy, alkylthiol, arylthiol, CN, and N0 2 ; and
  • R 10 is selected from the group consisting of substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl and substituted or unsubstituted alkenyl.
  • R 1 , R 2 , R 3 , R 4 and R 5 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Ci - C 4 alkyl, for example methyl), alkoxy (e.g., Q - C 4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), alkyl halide (e.g. CF3 ⁇ 4 aryl, CN, alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • alkyl e.g., Ci - C 4 alkyl, for example methyl
  • alkoxy e.g., Q - C 4 alkoxy, for example methoxy
  • halogen e.g. CI, F, or Br
  • alkyl halide e.g. CF3 ⁇ 4 aryl, CN, alkoxy, aryloxy, N0
  • R 4 and R 5 are hydrogen, and R 1 , R 2 , and R 3 are independently hydrogen, halogen, alkyl (e.g., C] - C 4 alkyl), aryl, CN, alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • alkyl e.g., C] - C 4 alkyl
  • aryl e.g., aryl
  • CN e.g., alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • R 10 is selected from the group consisting of substituted or unsubstituted phenyl, substituted or unsubstituted naphthyl, substituted or unsubstituted thiophenyl, substituted or unsubstituted furanyl, substituted or unsubstituted quinolinyl, substituted or unsubstituted isoquinolinyl, 2-Nitrophenyl, 3- Nitrophenyl, 4-Nitrophenyl, 4-Chlorophenyl, 3-fluorophenyl, 4- fluorophenyl, 4-Methyl- 2-nitrophenyl, 2-Methyl-5-nitrophenyl, 2-Nitro-4-(trifluoromethyl)phenyl, 4-Methoxy-2- nitrophenyl, 2-Methyl-5-nitrophenyl, 4-Methyl-2-nitrophenyl, 4-Methylphenyl, 2- Aminophenyl, 2-Amino-4-methyl
  • R 10 of Formula I is a substituted or unsubstituted phenyl, where , if substituted, one or more of the following substituents are present: C ⁇ - C 4 alkyl, Ci - C 4 alkoxy, halogen, for example chlorine, fluorine or bromine, halogen-substituted C : - C 4 alkyl, amino, or N0 2 .
  • halogen for example chlorine, fluorine or bromine
  • halogen-substituted C : - C 4 alkyl, amino, or N0 2 .
  • at least three of R 1 - R 5 are H and the remaining R group(s) is Ci - C 4 alkyl
  • R 10 of Formula I is a substituted or unsubstituted thiophenyl, where , if substituted, one or more of the following substituents are present: halogen, for example chlorine or bromine, Cj - C 4 alkyl, or N0 2 .
  • halogen for example chlorine or bromine
  • Cj - C 4 alkyl or N0 2 .
  • at least three of R 1 - R 5 are H and the remaining R grou (s) is Ci - C 4 alkyl
  • R 10 of Formula I is a substituted or unsubstituted furan, where , if substituted, one or more of the following substituents are present: halogen, for example chlorine or bromine, Ci - C 4 alkyl, or N0 2 .
  • halogen for example chlorine or bromine
  • Ci - C 4 alkyl or N0 2 .
  • at least three of R 1 - R 5 are H and the remaining R group(s) is Ci - C 4 alkyl
  • the present invention relates to a compound of Formula la:
  • R 1 , R 2 , R 3 , 4 and R S are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Cj - C 4 alkyl, for example methyl), alkoxy (e.g., Ci - C 4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), alkyl halide (e.g. CF3 ) , aryl, CN, alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • alkyl e.g., Cj - C 4 alkyl, for example methyl
  • alkoxy e.g., Ci - C 4 alkoxy, for example methoxy
  • halogen e.g. CI, F, or Br
  • alkyl halide e.g. CF3
  • R 4 and R 5 are hydrogen, and R 1 , R 2 , and R 3 are independently hydrogen, halogen, alkyl (e.g., - C 4 alkyl), aryl, CN, alkoxy, aryloxy, N0 2 , alkylthio, and arylthio; and where R 1 1 , R 12 and R 13 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Ci - C 4 alkyl, for example methyl), alkoxy (e.g., Ci - C 4 alkoxy, for example methoxy), chlorine, bromine, fluorine, NH 2 and N0 2 .
  • the present invention relates to a compound of Formula ⁇ :
  • R 1 , R 2 , R 3 , R 4 and R 5 are independently selected for each occurrence from the group consisting of hydrogen, halogen, alkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, alkoxy, aryloxy, alkylthiol, arylthiol, CN, and N(3 ⁇ 4, and in non-limiting embodiments, R 1 , R 2 , R 3 , R 4 and R 5 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Ci - C 4 alkyl, for example methyl), alkoxy (e.g., C 1 - C 4 alkoxy, for example methoxy), halogen (e.g.
  • alkyl halide e.g. CF3 ⁇ 4 aryl, CN, alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • R 4 and R 5 are hydrogen
  • R 1 , R 2 , and R J are independently hydrogen, halogen, alkyl (e.g., Q - C 4 alkyl), aryl, CN, alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • R 6 , R 7 , R 8 and R 9 are independently selected for each occurrence from the group consisting of hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubsituted cycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkoxy, substituted or unsubstituted aryloxy, substituted or unsubstituted alkylthiol, substituted or unsubstituted arylthiol, CN, NH 2 and N ⁇ 3 ⁇ 4.
  • R 4 and R 5 are hydrogen, and R 1 , R 2 , and R 3 are independently hydrogen, halogen, alkyl, aryl, CN, alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 and R 9 are independently selected for each occurrence from the group consisting of hydrogen, methyl, CI, OCH 3 , CF 3 and F.
  • the present invention relates to a compound of Formula III:
  • R 1 , R 2 , R 3 , R 4 and R 5 are independently selected for each occurrence from the group consisting of hydrogen, halogen, alkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, alkoxy, aryloxy, alkylthiol, arylthiol, CN, and NO2, and in non-limiting embodiments, R 1 , R 2 , R 3 , R 4 and R 5 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., C 1 - C alkyl, for example methyl), alkoxy (e.g., Ci - C 4 alkoxy, for example methoxy), halogen (e.g.
  • alkyl halide e.g. CF 3
  • aryl, CN alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • R 4 and R 5 are hydrogen
  • R 1 , R 2 , and R 3 are independently hydrogen, halogen, alkyl (e.g., Ci - C 4 alkyl), aryl, CN, alkoxy, aryloxy, N0 2 , alkylthio, and arylthio.
  • R 6 , R 7 , R 8 and R 9 are independently selected for each occurrence from the group consisting of hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubsituted cycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkoxy, substituted or unsubstituted aryloxy, substituted or unsubstituted alkylthiol, substituted or unsubstituted arylthiol, CN, NH 2 and N0 2 .
  • R 4 and R 5 are hydrogen, and R 1 , R 2 , and R 3 are independently hydrogen, halogen, alkyl, aryl, CN, alkoxy, aryloxy, N(3 ⁇ 4, alkylthio, and arylthio.
  • R ! , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 and R 9 are independently selected for each occurrence from the group consisting of hydrogen, methyl, Ci, OCH 3 , CF 3 and F.
  • the present invention further contemplates the use of compounds that are structurally related to, but fall outside of, the abovelisted formulas.
  • Examples of such related compounds include compounds of Formulas IV and V, as described below.
  • the present invention relates to a compound of Formula IV:
  • Xi, X 2 , X 3 , and X4 may independently be C or N
  • R 14 , R t5 , R 16 , R 17 , R 18 , R 19 , and R 20 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., C ⁇ - C 4 alkyl, for example methyl), alkoxy (e.g., Ci - C 4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), and alkyl halide (e.g.
  • R , R", and R are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Ci - C 4 alkyl, for example methyl), chlorine, bromine, fluorine, NH 2 and N0 2 .
  • the present invention relates to a compound of Formula V:
  • R 24 , R 25 , R 26 , R 27 , and R 28 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., C - C 4 alkyl, for example methyl), alkoxy (e.g., Ci - C 4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), or alkyl halide (e.g.
  • R" , R , R , R , and R are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Cj - C 4 alkyl, for example methyl), alkoxy (e.g., Q - C 4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), and alkyl halide (e.g. CF 3 ),.
  • alkyl e.g., Cj - C 4 alkyl, for example methyl
  • alkoxy e.g., Q - C 4 alkoxy, for example methoxy
  • halogen e.g. CI, F, or Br
  • alkyl halide e.g. CF 3
  • R 29 , R 30 , R 31 , R 32 , and R 33 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., C f - C 4 alkyl, for example methyl), alkoxy (e.g., Ci - C 4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), alkyl halide (e.g. CF 3 ), NH 2 and N0 2 .
  • alkyl e.g., C f - C 4 alkyl, for example methyl
  • alkoxy e.g., Ci - C 4 alkoxy, for example methoxy
  • halogen e.g. CI, F, or Br
  • alkyl halide e.g. CF 3
  • compounds that may be used according to the invention include compounds 0-1, 0-2, 0-3, 0-4, and 0-5 (FIGURE 1A-E) and compounds 1-90 (FIGURE 8A-J; compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, and 90).
  • the compound is selected from the group consisting of compounds 19, 47, 55, 69, 74 and 75.
  • compounds of Formula I may be synthesized according to the following scheme:
  • R f , R 2 , R 3 , R 4 , R 5 and R i0 are defined as above for Formula I.
  • compounds of Formula II may be synthesized according to the following scheme:
  • R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 and R 9 are defined as above for Formula II.
  • compounds of Formula II may be synthesized by any means known in the art.
  • the compounds of Formula II may be synthesized according to the following scheme:
  • R ! , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 and R 9 are defined as above
  • compounds of Formula III may be synthesized according to the following scheme:
  • R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 and R 9 are defined as above for Formula III.
  • compounds of Formula III may be synthesized by any means known in the art.
  • the compounds of Formula III may be synthesized according to the following scheme:
  • a compound of Formula I, la, II, III, IV or V or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71 , 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 39, 47, 55, 69, 74 and/or 75,that inhibits NFKB activity may be used, in an effective
  • the present invention provides for methods of treating diseases related to dysfunction of cell proliferation, the immune system and/or inflammation in a subject in need of such treatment by administration of a therapeutic formulation which comprises at least one compound of Formulas I, la, II, III, Iv or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 and in particular one or more of
  • the formulation may be administered to a subject in need of such treatment in an amount effective to inhibit NFkB activity.
  • the formulation may be administered systemically ⁇ e.g. by intravenous injection, oral administration, inhalation, subcutaneous, intramuscular, etc.), intraventricularly, intrathecal! y, or by any other means known in the art.
  • the amount of the formulation to be administered may be determined using methods known in the art, for example, by performing dose response studies in one or more model system, followed by approved clinical testing in humans.
  • the subject or patient has been diagnosed with, or has been identified as having an increased risk of developing a disease associated with dysfunction of cell proliferation, the immune system and/or inflammation.
  • the present invention provides for methods of reducing in a subject, the risk of inflammatory damage comprising administering to the subject, an effective amount of a composition according to the invention.
  • An effective amount may be a local concentration or, in a pharmaceutical composition, an amount that, when administered to a subject, results in a therapeutic benefit.
  • an effective amount is an amount of at least one compound of Formulas I, la, II, III, IV or V, or any one or more of compounds 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71 , 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, which reduces one or more clinical symptom of one or
  • the ability of a compound to reduce translocation of NF- ⁇ into the nucleus may be used as an indicator.
  • such an assay may comprise a cell- based assay that utilizes an agent, for example, a cytokine such as TNF , to stimulate nuclear translocation of endogenous NFkB. Stimulation by the agent may result in proteasome degradation of IkBa and subsequent translocation of NFkB from the cytoplasm to the nucleus, while in the absence of such a stimulatory agent, NFkB is sequestered in the cytoplasm due to its binding to IkBa.
  • an agent for example, a cytokine such as TNF
  • nuclear translocation of NFkB for example, the endogenous p65 RelA subunit
  • nuclear translocation of NFkB may be detected and/or measured following stimulation with the agent through the use of, for example, but not limited to, fluorescent antibody detection and an automated imaging platform.
  • Compounds of the invention may be contacted with cells of the in vitro assay, wherein a reduction in NFkB nuclear transport compared to a cell not contacted with the compound is indicative of the compound's ability to inhibit NFKB activity.
  • a reduction in nuclear translocation of NFKB may be correlative with the compound's therapeutic efficacy.
  • an effective amount of a compound of Formulas I, la, II, III, IV, or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be that amount which inhibits NFKB induced gene activation with an efficacy of at least about
  • an effective amount of a compound of Formulas I, la, II, III, IV, or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be that amount which inhibits NFKB nuclear-translocation by at least 50% when the
  • such an assay may comprise contacting a cell expressing the NFKB -dependent reporter construct, and monitoring the level of ⁇ -lactamase expression, wherein a decrease in expression compared to a cell not contacted with the compound indicates a reduction in NFKB activity.
  • the reduction in expression of the NFi B-dependent reporter may be correlative with the compound's therapeutic efficacy.
  • the component or components of a pharmaceutical composition of the invention may be administered to a subject by means including but not limited to intravenous, intra-arterial, intramuscular, intradermal, transdermal, subcutaneous, oral, intraperitoneal, intraventricular, and/or intrathecal administration.
  • the therapeutic compound can be delivered in a controlled or sustained release system.
  • a compound or composition may be administered using intravenous infusion, an implantable osmotic pump, a transdermal patch, liposomes, or other modes of administration.
  • a pump may be used (see Seflon, 1987, CRC Crit. Ref. Biomed. Eng.
  • polymeric materials can be used (see Langer and Wise eds., 1974, Medical Applications of Controlled Release, CRC Press: Boca Raton, Fla; Smolen and Ball eds., 1984, Controlled Drug Bioavailability, Drug Product Design and Performance, Wiley, N.Y.; Ranger and Peppas, 1983, J. Macromol. Sci. Rev. Macromol. Chem., 23:63 ; Levy et al., 1985, Science 228:190; During et al., 1989, Ann. Neurol., 25:351; Howard et al., 9189, J.Neurosurg. 71 :105).
  • a controlled release system can be placed in proximity of the therapeutic target, i.e., the heart or a blood vessel, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, 1984, in Medical Applications of Controlled Release, supra, Vol. 2, pp. 115- 138).
  • Other controlled release systems known in the art may also be used.
  • compositions of the invention may be formulated as pharmaceutical compositions by admixture with a pharmaceutically acceptable carrier or excipient.
  • the pharmaceutical composition may comprise an effective amount of at least one compound of Formulas I, la, II, III, IV or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71 , 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, and a physiologically acceptable diluent or carrier.
  • the pharmaceutical composition may
  • pharmaceutically acceptable indicates that a substance is physiologically tolerable when administered to a subject.
  • pharmaceutically acceptable means approved by a regulatory agency of the federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
  • carrier refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered.
  • Such pharmaceutical carriers can be sterile liquids, such as water and oils, or, for solid dosage forms, may be standard tabletting excipients. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Suitable
  • the therapeutic compound can be delivered in a vesicle, in particular a liposome (see Langer, 1990, Science 249:1527-1533; Treat et al., 1989, in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler eds., Liss: New York, pp. 353-365; Lopez-Berestein, ibid., pp. 317-327; see generally Lopez-Berestein, ibid.).
  • a liposome see Langer, 1990, Science 249:1527-1533; Treat et al., 1989, in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler eds., Liss: New York, pp. 353-365; Lopez-Berestein, ibid., pp. 317-327; see generally Lopez-Berestein, ibid.).
  • FIGURE 3 shows the results of flow cytometric analysis of DLBCL cell lines treated with compound O-l or 0-4 for 72 hours. Although both compounds were found to induce apoptosis in these cells, the C7 open structure (0-4) was found to induce more apoptosis across a diverse panel of DLBCL cells relative to the 0-1, the closed structure,
  • a binding site has been predicted for NQBS within the RHD of both p65 and p50 (FIGURE 10), supporting the hypothesis regarding the potential novel mechanism of action (MOA) for this class of compounds. Direct binding data using thermal shift assays was also obtained, further corroborating the MOA (FIGURE 1 1 A-C).

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The present invention relates to the NQBS class of molecules. It is based, at least in part, on the discovery that a representative group of compounds have been observed to inhibit nuclear translocation of NF-κΒ subunits. Without being bound by any particular theory, this inhibition of nuclear translocation may be mediated by either (i) binding of the NQBS or related compound to the C-terminus of the RHD, which specifically mediates the nuclear internalization; or (ii) NQBS-mediated stabilization of the dimer/ΙκΒ complex, disallowing dissociation of the active NF~KB monomers, and thus, inhibiting the generation of the subunits necessary to enter the nucleus. The NQBS class of molecules, and related molecules, may be used in therapeutic applications where inhibition of NF-κΒ translocation is beneficial, including but not limited to the treatment of cancer, autoimmune disorders, and inflammatory states.

Description

N-QUINOLIN-BENZENSULFONAMIDES AND RELATED COMPOUNDS FOR THE
TREATMENT
OF CANCER, AUTOIMMUNE DISORDERS AND INFLAMMATION PRIORITY CLAIM
This application claims priority to U.S. Provisional Application Serial No. 61/451,408, filed March 10, 2011 , the contents of which are incorporated by reference in their entirety herein. GRANT INFORMATION
This invention was made with government support under P50 AG08702 and 5R01 AT001643 awarded by the National Institutes of Health. The government has certain rights in the invention. 1. INTRODUCTION
The present invention relates to N-(quinolin-8-yl) benzenesulfonamides ("NQBS") and related compounds and their use as agents for treating cancer, autoimmune disorders and inflammatory conditions. 2. BACKGROUND OF THE INVENTION
One of the most ubiquitously implicated transcription factors in all of carcinogenesis is nuclear factor-κΒ (NF-κΒ). NF-KB represents a family of five proteins (pi 05/50, pl00/p52, c-Rel, RelA/p65 and RelB) that affect over 400 genes, many of which are important in the context of cancer cell growth and survival (Perkins, 2007, Nature Rev. Mol. Cell Biol. 8:40-62). Many of these gene activate genes that: promote cancer cell growth; inhibit those mechanisms responsible for cell cycle arrest; and promote resistance to cell death. All NF-KB members contain a Rel homology domain ("RHD"), an approximately 300 amino acid long residue, which is a highly conserved sequence (e.g. SEQ ID NO:l from AF134870 and see Lopez-Rodriguez et al., 1999, Proc. Natl. Acad. Sci. 96:7214-7219) near their N terminus of the RHD. This domain is the site that mediates binding to DNA, dimerization with other NF-κΒ subunits, and nuclear localization. SEQ ID NO: 1 is a human sequence as follows:
LS QLTTDNKGNS KAGN GTLENQKGTG VKKS PMLCGQ YP VKS EGKELKI V VQPET QHRARYLTEG S RGS VKDRTQQGFPT VKLEGHNEP WLQ VF VGND S GRVKPHGF YQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSN MTLAVDCVGILKLRNADVEA RIGIAGSKKKSTRARLVFRV IMRKDGSTLTLQTPSSPILCTQPAGVPEIL KSLHS CSVKGEEEVFLIGKNFLKGT VIFQENVSDENSW SEAEIDMELFHQNHLIVKVPP YHDQHITLPVSVGIYV VTNAGRSHDVQPFTYTPD.
In normal cells, following an activation signal from the surface of the cell,
NF-κΒ subunits translocate to the nucleus where they exert their effect on gene transcription by binding to DNA. The ability to transactivate specific genes in DNA is absolutely dependent on the ability of the NF-KB subunits to enter the nucleus, the site of all DNA replication and transcription.
There are at least three known NF-κΒ activation pathways: (1 ) the canonical or classical pathway, which is an ΙκΒ dependent pathway activated by extracellular signals such as TNFa, IL-l and LPS; (2) the non-canonical or alternative pathway, which is an ΙκΒ independent pathway activated by CD40/CD40L interaction, and (3) the atypical pathway, which is stimulated by various signals including genotoxic stress, hypoxia and ROS (Perkins, 2007, Nature Rev. Mol. Cell Biol. 8:40-62). Within the classical pathway, NF-κΒ transcription factors are sequestered in the cytoplasm in their inactive state by the ΙκΒ family of inhibitory proteins (hcBa, ΙκΒβ, IxBe, ρ105/κ and plOO/d). Upon an activation signal, ΙκΒ kinase (IKK) phosphorylates ΙκΒ, rendering it a substrate for ubiquitination and subsequent proteosome mediated degradation. Removal of the IKB allow s for nuclear translocation of the NF-KB complex, and activation of its target genes (Perkins, 2007, Nature Rev. Mol. Cell Biol. 8:40-62).
In the alternative pathway, IKK directly phosphorylates i 00 which in turn induces the processing of plOO to p52, which is then translocated to the nucleus with subsequent activation of the target genes. The atypical pathway can lead to NF-KB activation in a IKK independent way (hypoxia and ROS activate Tyr kinase) or an IKK dependent way (genotoxic stress). Over expression and constitutive activation of NF-κΒ is thought to be one of the central events leading to cancer. This biology, first described in normal lymphocytes, is thought to play a pivotal role in the formation of lymphomas. Identifying pharmacologic strategies to inhibit the activation of target NF-κΒ genes has been a major pursuit for cancer research laboratories over the past 2 decades.
Over the years, select agents indirectly affecting NF-κΒ biology have been identified, as discussed below. These agents affect NF-κΒ biology by inhibiting IKB kinase, which inhibits the phosphorylation and subsequent degradation of IKB, or by inhibiting the proteasome, and thus the proteolytic degradation of IKB. NF-κΒ promotes the dysregulated growth and survival of many cancers, including most lymphomas. Efforts to inhibit NF-κΒ over the years have been fraught with many challenges, not the least of which has been the development of relatively NF- KB non-specific agents. One such example is bortezomib (Velcade), a proteasome inhibitor touted as an NF~KB inhibitor which has been approved for the treatment of myeloma and mantle cell lymphoma. While bortezomib inhibits the degradation of ΙκΒ, it also affects more than 90% of the protein turnover in the cell, and thus affects virtually every important cellular process known. Clinically, while effective, the drug is neurotoxic and is associated with an irreversible painful neuropathy. Clearly, more specific NF-KB inhibitors are needed. To date, direct binding of NQBS to the target protein (p65 and p50) has not yet been described within published literature and therefore represents a novel mode of action for a drug that inhibits NF-κΒ pathway.
3. SUMMARY OF THE INVENTION
The present invention relates to the NQBS class of molecules and related compounds. It is based, at least in part, on the discovery that a representative group of compounds have been observed to inhibit nuclear translocation of NF-κΒ subunits.
Without being bound by any particular theory, this inhibition of nuclear translocation may be mediated by either (i) binding of the NQBS compound to the C-terminus of the RHD, which specifically mediates the nuclear internalization; or (ii) NQBS-mediated stabilization of the NF-KB dimer/ΙκΒ complex, disallowing dissociation of the active NF- KB monomers, and thus, inhibiting the generation of the subunits necessary to enter the nucleus. The NQBS class of molecules may be used in therapeutic applications where inhibition of NF-KB translocation is beneficial, including but not limited to the treatment of cancer, autoimmune disorders, and inflammatory states.
4. BRIEF DESCRIPTION OF THE FIGURES
FIGURE 1A-E. Compounds (A) O-l ; (Β) 0-5; (C) 0-2; (D) 0-3; and (E) 0-4. These are examples of NQBS compounds having the C7-locked (A) or C7-open (C- E) configurations.
FIGURE 2. Growth inhibition IC50 values (micromolar; μΜ) calculated with Calcusyn Software across DLBCL and TNFa unstimulated HUVEC lines for 0-1 and 0-4 luminescence assays. FIGURE 3A,B. Flow cytometric analysis showing percentage of apoptotic cells in DLBCL lines treated with (A) O-l or (B) 0-4 (72 hour time point).
FIGURE 4A-B. Laser confocal microscopy showing, via immunofluorescence of pl05/p50 NF-κΒ), the effects of compounds 0-1, 0-2, 0-3, and 0-4, as compared to control, in either (A) LylO or (B) HBL-1 DLBCL cell lines.
FIGURE 5. Nuclear NF-KB presence in HBL-1 (lanes 1 and 2) or Lyl O (lanes 3-18) DLBCL cell lines (EMSA), either untreated (lanes 1, 3 and 7) or treated with various compounds as indicated.
FIGURE 6. Effect of NQBS compounds on transcription factors other than NF-κΒ.
FIGURE 7. Results of toxicity studies in SCID beige mice, as assessed by animal weight. Compound 0-3 (an open-ring NQBS compound) was administered at doses of 10 mg/kg, 1 mg/kg, or 0.1 mg/kg.
FIGURE 8 A- J. Table summarizing all tested NQBS compounds with growth inhibition IC 50 values (luminescence assays) and EMSA and/or IF assay results for NF-KB translocation inhibition.
FIGURE 9. Cytotoxicity of 0-4 and 0-19 toward solid tumors.
FIGURE 10. Ribbon diagram showing association between 0-4 and p65.
FIGURE 11 A-C. Thermal shift studies of the interaction between 0-4 and p50 or 65.
FIGURE 12A-D. Results of an in vivo experiment in which treatment with 0-4 resulted in remission of an aggressive lymphoma, as demonstrated in a mouse transgenic for both myc and cherry luciferase reporter genes. (A) day 0 (B) day 4 (C) day 15 (D) NF-KB induced luciferase activity over time; downward arrows indicate treatment with compound 0-4 at a dose of 1 Omg/kg .
FIGURE 13. Results of an in vivo experiment in SCID beige mice with human DLBCL xenografts (OCI-Lyl cell line) treated with 0-4, which significantly inhibited growth of tumors when compared to the control mice which were treated with saline and 10% DMSO; downward arrows indicate treatment with compound 0-4 at a dose of 1 Omg/kg.
FIGURE 14. Compound 47, 55, 69, 74 and 75. 5. DETAILED DESCRIPTION OF THE INVENTION
For clarity of description, and not by way of limitation, the detailed description of the invention is divided into the following subsections:
(i) NQBS and related compounds;
(ii) synthetic schemes for NQBS and related compounds of the invention;
(iii) methods of treatment using NQBS and related compound
(iv) pharmaceutical compositions.
5.1 NOBS AND RELATED COMPOUNDS
In particular non-limiting embodiments, the present invention relates to a compound of Formula I :
Figure imgf000006_0001
and to salts, esters and prodrugs of the compounds of Formula I. Additionally, the present invention describes methods of synthesizing and using compounds of Fommla I. In Formula I:
R1, R2, R3, R4 and R5 are independently selected for each occurrence from the group consisting of hydrogen, halogen, alkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, alkoxy, aryloxy, alkylthiol, arylthiol, CN, and N02; and
R10 is selected from the group consisting of substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl and substituted or unsubstituted alkenyl.
In non-limiting embodiments, R1, R2, R3, R4 and R5 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Ci - C4 alkyl, for example methyl), alkoxy (e.g., Q - C4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), alkyl halide (e.g. CF¾ aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio. In specific non-limiting embodiments, R4 and R5 are hydrogen, and R1, R2, and R3 are independently hydrogen, halogen, alkyl (e.g., C] - C4 alkyl), aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio.
In other particular embodiments, R10 is selected from the group consisting of substituted or unsubstituted phenyl, substituted or unsubstituted naphthyl, substituted or unsubstituted thiophenyl, substituted or unsubstituted furanyl, substituted or unsubstituted quinolinyl, substituted or unsubstituted isoquinolinyl, 2-Nitrophenyl, 3- Nitrophenyl, 4-Nitrophenyl, 4-Chlorophenyl, 3-fluorophenyl, 4- fluorophenyl, 4-Methyl- 2-nitrophenyl, 2-Methyl-5-nitrophenyl, 2-Nitro-4-(trifluoromethyl)phenyl, 4-Methoxy-2- nitrophenyl, 2-Methyl-5-nitrophenyl, 4-Methyl-2-nitrophenyl, 4-Methylphenyl, 2- Aminophenyl, 2-Amino-4-methyl phenyl, Thiophen-2-yl, 5-Chlorothiophen-2-yI, 5,4- dichlorothiophen-2-yl,5-Bromothiophen-2~yl, 5-chloro-4-bromothiophen-2-yl.
In one subset of non-limiting embodiments, R10 of Formula I is a substituted or unsubstituted phenyl, where , if substituted, one or more of the following substituents are present: C\ - C4 alkyl, Ci - C4 alkoxy, halogen, for example chlorine, fluorine or bromine, halogen-substituted C: - C4 alkyl, amino, or N02. In specific non- limiting embodiments of this subset, at least three of R1- R5 are H and the remaining R group(s) is Ci - C4 alkyl
In one subset of non-limiting embodiments, R10 of Formula I is a substituted or unsubstituted thiophenyl, where , if substituted, one or more of the following substituents are present: halogen, for example chlorine or bromine, Cj - C4 alkyl, or N02. In specific non-limiting embodiments of this subset, at least three of R1- R5 are H and the remaining R grou (s) is Ci - C4 alkyl
In one subset of non-limiting embodiments, R10 of Formula I is a substituted or unsubstituted furan, where , if substituted, one or more of the following substituents are present: halogen, for example chlorine or bromine, Ci - C4 alkyl, or N02. In specific non-limiting embodiments of this subset, at least three of R1- R5 are H and the remaining R group(s) is Ci - C4 alkyl In other non-limiting embodiments, the present invention relates to a compound of Formula la:
Figure imgf000008_0001
where R1 , R2, R3, 4 and RS are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Cj - C4 alkyl, for example methyl), alkoxy (e.g., Ci - C4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), alkyl halide (e.g. CF3), aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio. In specific non-limiting embodiments, R4 and R5 are hydrogen, and R1 , R2, and R3 are independently hydrogen, halogen, alkyl (e.g.,
Figure imgf000008_0002
- C4 alkyl), aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio; and where R1 1 , R12 and R13 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Ci - C4 alkyl, for example methyl), alkoxy (e.g., Ci - C4 alkoxy, for example methoxy), chlorine, bromine, fluorine, NH2 and N02.
In other non-limiting embodiments, the present invention relates to a compound of Formula ΙΪ:
Figure imgf000008_0003
and to salts, esters and prodrugs of the compounds of Formula II. Additionally, the present invention describes methods of synthesizing and using compounds of Formula II. In Formula II:
1, R2, R3, R4 and R5 are independently selected for each occurrence from the group consisting of hydrogen, halogen, alkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, alkoxy, aryloxy, alkylthiol, arylthiol, CN, and N(¾, and in non-limiting embodiments, R1, R2, R3, R4 and R5 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Ci - C4 alkyl, for example methyl), alkoxy (e.g., C1 - C4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), alkyl halide (e.g. CF¾ aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio. In specific non-limiting embodiments, R4 and R5 are hydrogen, and R1, R2, and RJ are independently hydrogen, halogen, alkyl (e.g., Q - C4 alkyl), aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio.
R6, R7, R8 and R9 are independently selected for each occurrence from the group consisting of hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubsituted cycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkoxy, substituted or unsubstituted aryloxy, substituted or unsubstituted alkylthiol, substituted or unsubstituted arylthiol, CN, NH2 and N<¾. In a specific non-limiting embodiment, R4 and R5 are hydrogen, and R1, R2, and R3 are independently hydrogen, halogen, alkyl, aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio.
In a non-limiting embodiment, R1, R2, R3, R4, R5, R6, R7, R8 and R9 are independently selected for each occurrence from the group consisting of hydrogen, methyl, CI, OCH3, CF3 and F.
In further non-limiting embodiments, the present invention relates to a compound of Formula III:
Figure imgf000009_0001
and to salts, esters and prodrugs of the compounds of Formula III. Additionally, the present invention describes methods of synthesizing and using compounds of Formula III. In Formula III:
R1, R2, R3, R4 and R5 are independently selected for each occurrence from the group consisting of hydrogen, halogen, alkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, alkoxy, aryloxy, alkylthiol, arylthiol, CN, and NO2, and in non-limiting embodiments, R1, R2, R3, R4 and R5 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., C1 - C alkyl, for example methyl), alkoxy (e.g., Ci - C4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), alkyl halide (e.g. CF3), aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio. In specific non-limiting embodiments, R4 and R5 are hydrogen, and R1, R2, and R3 are independently hydrogen, halogen, alkyl (e.g., Ci - C4 alkyl), aryl, CN, alkoxy, aryloxy, N02, alkylthio, and arylthio.
R6, R7, R8 and R9 are independently selected for each occurrence from the group consisting of hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubsituted cycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkoxy, substituted or unsubstituted aryloxy, substituted or unsubstituted alkylthiol, substituted or unsubstituted arylthiol, CN, NH2 and N02. In a specific non-limiting embodiment, R4 and R5 are hydrogen, and R1, R2, and R3 are independently hydrogen, halogen, alkyl, aryl, CN, alkoxy, aryloxy, N(¾, alkylthio, and arylthio.
In a non-limiting embodiment, R!, R2, R3, R4, R5, R6, R7, R8 and R9 are independently selected for each occurrence from the group consisting of hydrogen, methyl, Ci, OCH3, CF3 and F.
The present invention further contemplates the use of compounds that are structurally related to, but fall outside of, the abovelisted formulas. Examples of such related compounds include compounds of Formulas IV and V, as described below.
In certain non-limiting embodiments, the present invention relates to a compound of Formula IV:
Figure imgf000011_0001
and to salts, esters and prodrugs of the compounds of Formula IV, where Xi, X2, X3, and X4 may independently be C or N, where R14, Rt5, R16, R17, R18, R19, and R20 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., C\ - C4 alkyl, for example methyl), alkoxy (e.g., Ci - C4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), and alkyl halide (e.g. CF3), and where R , R", and R are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Ci - C4 alkyl, for example methyl), chlorine, bromine, fluorine, NH2 and N02.
In certain non-limiting embodiments, the present invention relates to a compound of Formula V:
Figure imgf000011_0002
and to salts, esters and prodrugs of the compounds of Formula V, where R24, R25, R26, R27, and R28 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., C - C4 alkyl, for example methyl), alkoxy (e.g., Ci - C4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), or alkyl halide (e.g. CF3>, R" , R , R , R , and R are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Cj - C4 alkyl, for example methyl), alkoxy (e.g., Q - C4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), and alkyl halide (e.g. CF3),. and where R29, R30, R31, R32, and R33 are independently selected for each occurrence from the group consisting of hydrogen, branched or unbranched alkyl (e.g., Cf - C4 alkyl, for example methyl), alkoxy (e.g., Ci - C4 alkoxy, for example methoxy), halogen (e.g. CI, F, or Br), alkyl halide (e.g. CF3), NH2 and N02.
In specific, non-limiting embodiments, compounds that may be used according to the invention include compounds 0-1, 0-2, 0-3, 0-4, and 0-5 (FIGURE 1A-E) and compounds 1-90 (FIGURE 8A-J; compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, and 90).
In particular non-limiting embodiments, the compound is selected from the group consisting of compounds 19, 47, 55, 69, 74 and 75.
5.2 SYNTHETIC SCHEMES FOR NOBS AND RELATED COMPOUNDS
In one non-limiting embodiment, compounds of Formula I may be synthesized according to the following scheme:
Figure imgf000012_0001
wherein Rf, R2, R3, R4, R5 and Ri0 are defined as above for Formula I. In another non-limiting embodiment, compounds of Formula II may be synthesized according to the following scheme:
wherein R1, R2, R3, R4, R5, R6, R7, R8 and R9 are defined as above for Formula II.
In other non-limiting embodiments, compounds of Formula II may be synthesized by any means known in the art.
In other non-limiting embodiments, the compounds of Formula II may be synthesized according to the following scheme:
Figure imgf000013_0002
9i R1 = CH3, R2 = H, R3 = H 9j R
9k F
wherein R!, R2, R3, R4, R5, R6, R7, R8 and R9 are defined as above
In non-limiting embodiments, compounds of Formula III may be synthesized according to the following scheme:
Figure imgf000014_0001
wherein R1, R2, R3, R4, R5, R6, R7, R8 and R9 are defined as above for Formula III.
In other non-limiting embodiments, compounds of Formula III may be synthesized by any means known in the art.
In other non-limiting embodiments, the compounds of Formula III may be synthesized according to the following scheme:
Figure imgf000014_0002
Methods analogous to those set forth above may be used to synthesize compounds of formulas la, IV and V. 5.3 METHODS OF TREATMENT USING NOBS AND RELATED COMPOUNDS In accordance with the invention, there are provided methods of using the compounds of Formulas I-V and compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, and 90. The compounds of the instant disclosure can inhibit NFkB activity to exert beneficial effects. A compound of Formula I, la, II, III, IV or V or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71 , 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 39, 47, 55, 69, 74 and/or 75,that inhibits NFKB activity may be used, in an effective amount, for the treatment of conditions including, but not limited to, cancer (for example, but not limited to, leukemia, lymphoma, glioblastoma, melanoma, squamous cell carcinoma, breast cancer, lung cancer, gastric cancer, liver cancer, renal cancer, pancreatic cancer, colon cancer, ovarian cancer, uterine cancer, cervical cancer, bladder cancer, prostate cancer, and testicular cancer), and inflammatory conditions including, but not limited to, type I hypersensitivity, atopy, anaphylaxis, asthma, osteoarthritis, rheumatoid arthritis, septic arthritis, gout, juvenile idiopathic arthritis, Still's disease, ankylosing spondylitis, inflammatory bowel disease (Ulcerative colitis and Crohn's disease) or inflammation associated with vertebral disc herniation. In addition, the present invention is directed to the treatment of diseases related to dysfunction of cell proliferation, the immune system and/or inflammation.
5.3.1 Treatment Of Disease Related to Dysfunction of Cell
Proliferation, the Immune System and/or Inflammation
In non-limiting embodiments, the present invention provides for methods of treating diseases related to dysfunction of cell proliferation, the immune system and/or inflammation in a subject in need of such treatment by administration of a therapeutic formulation which comprises at least one compound of Formulas I, la, II, III, Iv or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75.
In particular embodiments, the formulation may be administered to a subject in need of such treatment in an amount effective to inhibit NFkB activity. Where the formulation is to be administered to a subject in vivo, the formulation may be administered systemically {e.g. by intravenous injection, oral administration, inhalation, subcutaneous, intramuscular, etc.), intraventricularly, intrathecal! y, or by any other means known in the art. The amount of the formulation to be administered may be determined using methods known in the art, for example, by performing dose response studies in one or more model system, followed by approved clinical testing in humans.
In one embodiment, the subject or patient has been diagnosed with, or has been identified as having an increased risk of developing a disease associated with dysfunction of cell proliferation, the immune system and/or inflammation.
In other non-limiting embodiments, the present invention provides for methods of reducing in a subject, the risk of inflammatory damage comprising administering to the subject, an effective amount of a composition according to the invention. An effective amount may be a local concentration or, in a pharmaceutical composition, an amount that, when administered to a subject, results in a therapeutic benefit.
According to the invention, an effective amount is an amount of at least one compound of Formulas I, la, II, III, IV or V, or any one or more of compounds 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71 , 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, which reduces one or more clinical symptom of one or more of the aforementioned diseases. Working examples exemplifying
experiments for assessing the efficacy of compounds of the invention are set forth below in section 6. For example, the ability of a compound to inhibit proliferation of a cell manifesting a dysfunction in cell proliferation may be used as an indication of
effectiveness in vivo. As another example, the ability of a compound to reduce translocation of NF-κΒ into the nucleus may be used as an indicator. In a non-limiting embodiment, the effective amount of at least one compound of Formulas I, la, II, III, IV or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be determined, for example, via an in vitro assay wherein the effective amount of a compound of Formulas I, la, II, III, IV or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 455 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, may be correlated with the compound's ability to reduce the nuclear translocation of NFKB. By way of example, and not of limitation, such an assay may comprise a cell- based assay that utilizes an agent, for example, a cytokine such as TNF , to stimulate nuclear translocation of endogenous NFkB. Stimulation by the agent may result in proteasome degradation of IkBa and subsequent translocation of NFkB from the cytoplasm to the nucleus, while in the absence of such a stimulatory agent, NFkB is sequestered in the cytoplasm due to its binding to IkBa.
In the nuclear-translocation in vitro assay, nuclear translocation of NFkB, for example, the endogenous p65 RelA subunit, may be detected and/or measured following stimulation with the agent through the use of, for example, but not limited to, fluorescent antibody detection and an automated imaging platform. Compounds of the invention may be contacted with cells of the in vitro assay, wherein a reduction in NFkB nuclear transport compared to a cell not contacted with the compound is indicative of the compound's ability to inhibit NFKB activity. According to the invention, a reduction in nuclear translocation of NFKB may be correlative with the compound's therapeutic efficacy.
In one embodiment, an effective amount of a compound of Formulas I, la, II, III, IV or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be correlated with the compound's ability to inhibit NFKB induced gene activation , wherein a greater level of inhibition at a lower concentration when compared to a control level of inhibition, for example, as exhibited by a known NFKB nuclear- translocation inhibitor, such as BAY 11-7082, is indicative of greater therapeutic efficacy of the compound.
In one embodiment, an effective amount of a compound of Formulas I, la, II, III, IV, or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be that amount which inhibits NFKB induced gene activation with an efficacy of at least about 10-20%, at least about 20-50%, at least about 50-80%, or at least about 80-100%> or more when compared to the NFKB induced gene activation inhibition achieved by a known inhibitor, such as BAY 11 -7082.
In one non-limiting embodiment, an effective amount of a compound of Formulas I, la, II, III, IV, or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be that amount which inhibits NFKB nuclear-translocation by at least 50% when the compound is administered at a concentration ranging from about 200 μΜ to about 0.01 μΜ, preferably from about 100 μΜ to about 0.01 μΜ, more preferably from about 50 μΜ to about 0.01 μΜ, and more preferably from about 10 μΜ to about
0.01 μΜ in the in vitro assay, wherein inhibition of NFKB nuclear-translocation at a lower concentration in the in vitro assay is correlative with the compound's therapeutic efficacy.
In another non-limiting embodiment, the effective amount of at least one compound of Formulas I, la, II, III, IV, or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be determined, for example, via an in vitro assay wherein the effective amount of a compound of Formulas Ϊ, la, II, Πϊ, IV, or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, may be correlated with the compound's ability to reduce expression of an NFKB- dependent reporter construct, for example, a β-Iactamase reporter (ΝΐκΒ-bla). By way of example, and not of limitation, such an assay may comprise contacting a cell expressing the NFKB -dependent reporter construct, and monitoring the level of β-lactamase expression, wherein a decrease in expression compared to a cell not contacted with the compound indicates a reduction in NFKB activity. According to the invention, the reduction in expression of the NFi B-dependent reporter may be correlative with the compound's therapeutic efficacy.
In one non-limiting embodiment, an effective amount of a compound of Formulas I, II, III, IV or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be that amount which reduces expression of an NFi B-Wa construct by at least 50% when the compound is administered at a concentration ranging from about 200 μΜ to about 0.01 μΜ, preferably from about 100 μΜ to about 0.01 μΜ, more preferably from about 50 μΜ to about 0.01 μΜ, and more preferably from about 10 μΜ to about 0.01 μΜ in the in vitro assay, wherein a reduction of NFicB-δ/α expression at a lower concentration in the in vitro assay is correlative with the compound's therapeutic efficacy.
In one non-limiting embodiment, an effective amount of a compound of Formulas I, II, III, IV, or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 62, 63, 64, 65, 66,67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, may be an amount which achieves a local concentration at the therapeutic site of about 100 μΜ to about 0.01 μΜ, preferably from about 50 μΜ to about 0.01 μΜ, more preferably from about 20 μΜ to about 0.01 μΜ, and more preferably from about 10 μΜ to about 0.01 μΜ in the in vitro assay.
5.3.2 Administration of Treatments
According to the invention, the component or components of a pharmaceutical composition of the invention may be administered to a subject by means including but not limited to intravenous, intra-arterial, intramuscular, intradermal, transdermal, subcutaneous, oral, intraperitoneal, intraventricular, and/or intrathecal administration.
In particular non-limiting embodiments, the therapeutic compound can be delivered in a controlled or sustained release system. For example, a compound or composition may be administered using intravenous infusion, an implantable osmotic pump, a transdermal patch, liposomes, or other modes of administration. In one embodiment, a pump may be used (see Seflon, 1987, CRC Crit. Ref. Biomed. Eng.
14:201 ; Buchwald et al., 1980, Surgery 88:507; Saudek et al., 1989, N. Engl. J. Med.
321 :574). In another embodiment, polymeric materials can be used (see Langer and Wise eds., 1974, Medical Applications of Controlled Release, CRC Press: Boca Raton, Fla; Smolen and Ball eds., 1984, Controlled Drug Bioavailability, Drug Product Design and Performance, Wiley, N.Y.; Ranger and Peppas, 1983, J. Macromol. Sci. Rev. Macromol. Chem., 23:63 ; Levy et al., 1985, Science 228:190; During et al., 1989, Ann. Neurol., 25:351; Howard et al., 9189, J.Neurosurg. 71 :105). In yet another embodiment, a controlled release system can be placed in proximity of the therapeutic target, i.e., the heart or a blood vessel, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, 1984, in Medical Applications of Controlled Release, supra, Vol. 2, pp. 115- 138). Other controlled release systems known in the art may also be used.
5.4 Pharmaceutical Compositions
The compounds and compositions of the invention may be formulated as pharmaceutical compositions by admixture with a pharmaceutically acceptable carrier or excipient.
For example, the pharmaceutical composition may comprise an effective amount of at least one compound of Formulas I, la, II, III, IV or V, or any one or more of compounds 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,67, 68, 69, 70, 71 , 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, or 90, and in particular one or more of compounds 19, 47, 55, 69, 74 and/or 75, and a physiologically acceptable diluent or carrier. The pharmaceutical composition may further comprise a second drug, for example, but not by way of limitation, an anti-cancer drug, an anti-inflammatory drug, for example, but not limited to, a steroid compound and/or a non-steroidal antiinflammatory drug.
The phrase "pharmaceutically acceptable" indicates that a substance is physiologically tolerable when administered to a subject. Preferably, but not by way of limitation, as used herein, the term "pharmaceutically acceptable" means approved by a regulatory agency of the federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term "carrier" refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, or, for solid dosage forms, may be standard tabletting excipients. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Suitable
pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E.W. Martin, 38th Edition, or other editions.
In a specific embodiment, the therapeutic compound can be delivered in a vesicle, in particular a liposome (see Langer, 1990, Science 249:1527-1533; Treat et al., 1989, in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler eds., Liss: New York, pp. 353-365; Lopez-Berestein, ibid., pp. 317-327; see generally Lopez-Berestein, ibid.).
The present invention is not to be limited in scope by the specific embodiments described herein and the Examples that follow. Indeed, various
modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and the accompanying Examples and Figures. Such modifications are intended to fall within the scope of the appended claims. 6· WORKING EXAMPLE
Using a novel cell based assay, a unique scaffold structure of NQBS compounds has been identified having either the C7 locked or C7 open configuration (FIGURE 1) that appears to selectively inhibit NF-κΒ mediated gene activation. In particular, a series of first, second and third generation compounds have been screened and found to exhibit the following properties.
Both C-7 closed and open configurations of compound were found to exhibit potent and reproducible concentration dependent cytotoxicity and induction of apoptosis in a panel of 12 highly drug resistant lymphoma cell lines (including B~ and T- cell lymphomas), with low micromolar potency (FIGURES 2 and 3). The 0-1 and 0-4 (as well as 0-2 and 0-3) analogs were found to be highly potent in both GC and ABC DLBCL (0-5 was found to be inactive). While C7 open structures appeared to be more potent, there were minimal differences in the activities of these compounds. Cytotoxicity was not found to be significantly influenced by the duration of exposure. FIGURE 3 shows the results of flow cytometric analysis of DLBCL cell lines treated with compound O-l or 0-4 for 72 hours. Although both compounds were found to induce apoptosis in these cells, the C7 open structure (0-4) was found to induce more apoptosis across a diverse panel of DLBCL cells relative to the 0-1, the closed structure,
Treatment of these cell lines with the NQBS analogs was observed to sequester the p50 subunit to the cytoplasm (FIGURE 4A-B), which has been confirmed using a 'gold standard' electrophoretic mobility shift assay ("EMSA"; FIGURE 5). The NQBS compounds tested were found not to affect other non-NF-κΒ dependent transcription factors involved in normal cell cycle regulation (eg: MCM3 and Ku80) (FIGURE 6). Further, open ring structure NQBS compounds were found not to exhibit significant toxicity in SCID beige mice (no weight loss and no toxic deaths) at doses as high as 10 mg/kg, well in excess of the in vitro IC50 (FIGURE 7).
The foregoing analysis was used to generate structure activity relationships (SAR) that have informed new rounds of synthesis, producing additional NQBS structures (FIGURES 8A-J ). The results of in vitro cytotoxicity screens of these compounds demonstrating their activity is shown in FIGURE 9.
A binding site has been predicted for NQBS within the RHD of both p65 and p50 (FIGURE 10), supporting the hypothesis regarding the potential novel mechanism of action (MOA) for this class of compounds. Direct binding data using thermal shift assays was also obtained, further corroborating the MOA (FIGURE 1 1 A-C).
Finally, using a transgenic mouse created to represent an in vivo model for aggressive lymphoma, it has been shown that one of the NQBS analogs (0-4) produces a complete remission of the lymphoma following daily dosing (FIGURE 12A-D).
Furthermore, activity of 0-4 was shown in SCID beige mice with human DLBCL xenografts, where 0-4 significantly inhibited growth of tumors compared to the control (Figure 13).
Various publications are cited herein, the contents of which are hereby incorporated by reference in their entireties.

Claims

WHAT IS CLAIMED IS:
1. A method for inhibiting the activity of a Nuclear factor- B (NFKB) in a cell which comprises contacting the cell with a compound selected from the group consisting of compounds 47, 55, 69, 74 and/or 75 in an amount effective to inhibit Nuclear factor-κ B (NFKB) activity.
2. The method of claim 1, wherein the inhibition of Nuclear factor-κ B (NFKB) activity reduces nuclear translocation of the Nuclear factor-κ B (NFKB).
3. The method of claim 1 , wherein the cell is a mammalian cell.
4. The method of claim 1 , wherein the cell is contacted in vitro.
5. A method for treating a disease related to dysfunction of cell proliferation, the immune system, and/or inflammation in an individual, which method comprises administering to the individual an effective amount of a compound selected from the group consisting of compounds 47, 55, 69, 74 and/or 75.
6. The method of claim 5, where the disease is cancer.
7. The method of claim 5, where the cancer is lymphoma.
8. A composition comprising compound 47, 55, 74 and/or 75 for use in a method for inhibiting the activity of a Nuclear factor-κ B (NFKB) in a cell.
9. The composition of claim 8 wherein the inhibition of Nuclear factor-κ B (NFKB) activity reduces nuclear translocation of the Nuclear factor-κ B (NFKB).
10. A composition comprising compound 47, 55, 74 and/or 75 for use in treating a disease related to dysfunction of cell proliferation, the immune system, and/or inflammation.
11. The composition of claim 10, where the disease is cancer.
12. The composition of claim 1 1, where the disease is lymphoma.
PCT/US2012/028619 2011-03-10 2012-03-09 N-quinolin-benzensulfonamides and related compounds for the treatment of cancer, autoimmune disorders and inflammation Ceased WO2012122534A2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/020,363 US9896420B2 (en) 2011-03-10 2013-09-06 N-quinolin-benzensulfonamides and related compounds for the treatment of cancer, autoimmune disorders and inflammation

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161451408P 2011-03-10 2011-03-10
US61/451,408 2011-03-10

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US14/020,363 Continuation US9896420B2 (en) 2011-03-10 2013-09-06 N-quinolin-benzensulfonamides and related compounds for the treatment of cancer, autoimmune disorders and inflammation

Publications (2)

Publication Number Publication Date
WO2012122534A2 true WO2012122534A2 (en) 2012-09-13
WO2012122534A3 WO2012122534A3 (en) 2014-04-24

Family

ID=46798850

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/028619 Ceased WO2012122534A2 (en) 2011-03-10 2012-03-09 N-quinolin-benzensulfonamides and related compounds for the treatment of cancer, autoimmune disorders and inflammation

Country Status (2)

Country Link
US (1) US9896420B2 (en)
WO (1) WO2012122534A2 (en)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150147291A1 (en) * 2012-07-30 2015-05-28 Institute For Cancer Research D/B/A The Research Institute Of Fox Chase Cancer Center Zinc Chelating Agents for Depleting Xiap and Sensitizing Tumor Cells to Apoptosis
CN105147686A (en) * 2015-07-17 2015-12-16 中山大学 Application of quinoline-sulfamide compound as inhibitor for Th17 cell differentiation
WO2016025779A1 (en) * 2014-08-14 2016-02-18 Rigel Pharmaceuticals, Inc. Quinoline derivatives useful as ubiquitination inhibitors
WO2016071283A1 (en) * 2014-11-03 2016-05-12 Iomet Pharma Ltd Inhibitors of tryptophan-2,3-dioxygenase or indoleamine-2,3-dioxygenase
WO2019125185A1 (en) * 2017-12-20 2019-06-27 Otago Innovation Limited Quinoline sulfonamide compounds and their use as antibacterial agents
CN116806218A (en) * 2021-02-09 2023-09-26 新基公司 Sulfonamide and its use for the treatment of parasitic helminth infections and diseases
CN117865886A (en) * 2024-03-07 2024-04-12 中国药科大学 A N-(quinolin-8-yl)quinoline-8-sulfonamide compound and its application
WO2024229040A1 (en) * 2023-05-01 2024-11-07 Seed Therapeutics, Inc Heteroaromatic indolesulfonamides

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20190337899A1 (en) * 2015-11-28 2019-11-07 Russell Dahl Quinoline sulfonamides useful to treat disease
US12606528B2 (en) 2019-11-21 2026-04-21 University of Pittsburgh—of the Commonwealth System of Higher Education Methods and materials for inhibiting NF-kB activity

Family Cites Families (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3337555A (en) 1963-02-26 1967-08-22 Indiana University Foundation Method of precipitating metal ions with 8-sulfonamidoquinolines
JP3907149B2 (en) 1998-09-08 2007-04-18 富士フイルム株式会社 Light emitting device material and light emitting device using the same
WO2001057141A1 (en) 2000-02-02 2001-08-09 Amersham Biosciences Uk Limited. Detection reagent
WO2001092437A1 (en) 2000-06-01 2001-12-06 Nippon Steel Chemical Co., Ltd. Organic electroluminescent element material and organic electroluminescent element
GB0016890D0 (en) 2000-07-11 2000-08-30 Univ Glasgow Herpes zinc finger motifs
AU2002310099A1 (en) 2001-05-22 2002-12-03 President And Fellows Of Harvard College Identification of anti-protozoal agents
US7528161B2 (en) * 2002-05-31 2009-05-05 Michigan State University NF-kappaB inhibitors and uses thereof
US20070207509A1 (en) 2003-04-22 2007-09-06 Frederickson Christopher J Zinc-based screening test and kit for early diagnosis of prostate cancer
WO2004094652A2 (en) 2003-04-22 2004-11-04 Neurobiotex, Inc. Zinc-based screening test and kit for early diagnosis of prostate cancer
US8614204B2 (en) 2003-06-06 2013-12-24 Fibrogen, Inc. Enhanced erythropoiesis and iron metabolism
WO2005049026A1 (en) 2003-11-19 2005-06-02 Acrux Dds Pty Ltd Method and composition for treatment or prophylaxis of amyloidosis disorders
US20060024691A1 (en) * 2004-03-25 2006-02-02 Buck Institute For Age Research Novel pathways in the etiology of cancer
EP1742627A4 (en) 2004-05-06 2009-08-26 Plexxikon Inc Pde4b inhibitors and uses therefor
EP1854482A4 (en) 2005-01-31 2010-08-11 Riken AGENT FOR REGULATING DEACTIVATION REACTION AND PRODUCTION OF CYTOKINE
JP2006206538A (en) 2005-01-31 2006-08-10 Institute Of Physical & Chemical Research Antigen-presenting cell function regulator
WO2006121219A1 (en) 2005-05-13 2006-11-16 Osaka University Agent for controlling epithelial-mesenchymal transition
FR2889525A1 (en) 2005-08-04 2007-02-09 Palumed Sa NOVEL POLYQUINOLINE DERIVATIVES AND THEIR THERAPEUTIC USE.
US20070254894A1 (en) 2006-01-10 2007-11-01 Kane John L Jr Novel small molecules with selective cytotoxicity against human microvascular endothelial cell proliferation
CN101534826A (en) 2006-04-14 2009-09-16 普拉纳生物技术有限公司 Methods of treating age-related macular degeneration (AMD)
RU2310676C1 (en) 2006-07-10 2007-11-20 Некоммерческая организация Учреждение Институт проблем химической физики Российской академии наук (статус государственного учреждения) (ИПХФ РАН) Electroluminescent material containing organic luminescent substance
WO2008074068A1 (en) 2006-12-20 2008-06-26 Prana Biotechnology Limited Substituted quinoline derivatives as antiamyloidogeneic agents
US7956989B2 (en) 2007-01-22 2011-06-07 University Of North Texas Health Science Center At Fort Worth Surface plasmon assisted microscope
WO2008131192A2 (en) 2007-04-18 2008-10-30 The Trustees Of Columbia University In The City Of New York Crystalline cholestrol and prevention of atherosclerosis
US20100093611A1 (en) 2007-05-16 2010-04-15 Horrigan Stephen K Compounds and methods for treating or preventing autoimmune diseases
KR20090015766A (en) 2007-08-09 2009-02-12 강원대학교산학협력단 Composition for the prophylaxis or treatment of inflammatory diseases, immune diseases or tumors containing 8-tosylaminoquinoline
GB0721616D0 (en) 2007-11-02 2007-12-12 Queen Mary & Westfield College Treatment of spinal cord injury
WO2009086303A2 (en) 2007-12-21 2009-07-09 University Of Rochester Method for altering the lifespan of eukaryotic organisms
US8159676B2 (en) 2008-01-21 2012-04-17 University Of North Texas, Health Science Center At Fort Worth Ratiometric surface plasmon coupled emission detector
US7901852B2 (en) 2008-02-29 2011-03-08 Freescale Semiconductor, Inc. Metrology of bilayer photoresist processes
ES2586459T3 (en) 2008-05-01 2016-10-14 Glaxosmithkline Llc Quinolines and related analogues as sirtuin modulators
EP2306821B1 (en) 2008-05-30 2014-10-01 University Of Cincinnati Use of zinc chelators comprising dtpa to inhibit biofilm formation
WO2010051064A1 (en) * 2008-10-30 2010-05-06 The Trustees Of Columbia University In The City Of New York COMPOUNDS THAT INHIBIT NFκB ACTIVITY
US20120214803A1 (en) 2011-02-18 2012-08-23 Vifor (International) Ag Novel Sulfonaminoquinoline Hepcidin Antagonists

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150147291A1 (en) * 2012-07-30 2015-05-28 Institute For Cancer Research D/B/A The Research Institute Of Fox Chase Cancer Center Zinc Chelating Agents for Depleting Xiap and Sensitizing Tumor Cells to Apoptosis
US9320736B2 (en) * 2012-07-30 2016-04-26 Institute For Cancer Research Zinc chelating agents for depleting XIAP and sensitizing tumor cells to apoptosis
JP2017524017A (en) * 2014-08-14 2017-08-24 ライジェル ファーマシューティカルズ, インコーポレイテッド Quinoline derivatives useful as ubiquitination inhibitors
WO2016025779A1 (en) * 2014-08-14 2016-02-18 Rigel Pharmaceuticals, Inc. Quinoline derivatives useful as ubiquitination inhibitors
US10040766B2 (en) 2014-08-14 2018-08-07 Rigel Pharmaceuticals, Inc. Ubiquitination inhibitors
US10287252B2 (en) 2014-11-03 2019-05-14 Iomet Pharma Ltd. Inhibitors of tryptophan-2,3-dioxygenase or indoleamine-2,3-dioxygenase
US20180037553A1 (en) * 2014-11-03 2018-02-08 Iomet Pharma Ltd. Inhibitors of tryptophan-2,3-dioxygenase or indoleamine-2,3-dioxygenase
WO2016071283A1 (en) * 2014-11-03 2016-05-12 Iomet Pharma Ltd Inhibitors of tryptophan-2,3-dioxygenase or indoleamine-2,3-dioxygenase
CN105147686A (en) * 2015-07-17 2015-12-16 中山大学 Application of quinoline-sulfamide compound as inhibitor for Th17 cell differentiation
WO2019125185A1 (en) * 2017-12-20 2019-06-27 Otago Innovation Limited Quinoline sulfonamide compounds and their use as antibacterial agents
US11691949B2 (en) 2017-12-20 2023-07-04 Otago Innovation Limited Quinoline sulfonamide compounds and their use as antibacterial agents
AU2018391531B2 (en) * 2017-12-20 2024-01-18 Otago Innovation Limited Quinoline sulfonamide compounds and their use as antibacterial agents
CN116806218A (en) * 2021-02-09 2023-09-26 新基公司 Sulfonamide and its use for the treatment of parasitic helminth infections and diseases
WO2024229040A1 (en) * 2023-05-01 2024-11-07 Seed Therapeutics, Inc Heteroaromatic indolesulfonamides
CN117865886A (en) * 2024-03-07 2024-04-12 中国药科大学 A N-(quinolin-8-yl)quinoline-8-sulfonamide compound and its application
CN117865886B (en) * 2024-03-07 2024-05-10 中国药科大学 A N-(quinoline-8-yl)quinoline-8-sulfonamide compound and its application

Also Published As

Publication number Publication date
US20140073668A1 (en) 2014-03-13
WO2012122534A3 (en) 2014-04-24
US9896420B2 (en) 2018-02-20

Similar Documents

Publication Publication Date Title
WO2012122534A2 (en) N-quinolin-benzensulfonamides and related compounds for the treatment of cancer, autoimmune disorders and inflammation
Pan et al. Discovery of thieno [2, 3-d] pyrimidine-based hydroxamic acid derivatives as bromodomain-containing protein 4/histone deacetylase dual inhibitors induce autophagic cell death in colorectal carcinoma cells
Yu et al. Design, synthesis, and biological evaluation of imidazo [1, 2-a] pyridine derivatives as novel PI3K/mTOR dual inhibitors
AU2007254179B2 (en) Intracellular kinase inhibitors
Ren et al. Discovery of STAT3 and histone deacetylase (HDAC) dual-pathway inhibitors for the treatment of solid cancer
KR102827788B1 (en) Agonist of interferon gene stimulator STING
US8518968B2 (en) Hydrazone and diacyl hydrazine compounds and methods of use
JP6193268B2 (en) CDK8 / CDK19 selective inhibitors and their use in methods of anti-metastasis and chemoprotection for cancer
EP2780326B1 (en) Method for inhibition of deubiquitinating activity
Yu et al. Discovery of an orally selective inhibitor of signal transducer and activator of transcription 3 using advanced multiple ligand simultaneous docking
Ugwu et al. Synthesis and structural activity relationship study of antitubercular carboxamides
Li et al. Structure-based design and synthesis of N-substituted 3-amino-β-carboline derivatives as potent αβ-tubulin degradation agents
JP2007084494A (en) Pim-1 activity inhibitor
Yue et al. Development of hydrazide-based hdac6 selective inhibitors for treating nlrp3 inflammasome-related diseases
WO2019183373A1 (en) Small molecules for disrupting the super elongation complex and inhibiting transcription elongation for cancer therapy
WO2020221376A1 (en) Compound for preventing and/or treating cancer, and preparation method therefor and application thereof
US20230339942A1 (en) Inhibitors of ubiquitin specific peptidase 22 (usp22) and uses thereof for treating diseases and disorders
WO2022006292A1 (en) Nek2 proteolysis targeting chimeras for use in malignant disease
US20190092723A1 (en) Chemical modulators of store-operated calcium channels and their therapeutic applications
CN114685496B (en) Synthesis and use of HDAC6 inhibitors based on hydroxamic acid
Tariq et al. Papaverine Derivatives, a Potent Inhibitor of Neuroinflammation in Epileptic Seizures, A Pharmacological and In-Silico Approach Against TNF-α as a Targeted Receptor.
TW202521112A (en) Novel compound, and a pharmaceutical composition for the prevention or treatment of cancer or tumors comprising the same
AU2013200229B2 (en) Intracellular kinase inhibitors
WO2017083242A1 (en) Inhibitors of suppression of tumorigencity 2 (st2) and methods using the same
AU2014250696A1 (en) Intracellular kinase inhibitors

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12755439

Country of ref document: EP

Kind code of ref document: A2

122 Ep: pct application non-entry in european phase

Ref document number: 12755439

Country of ref document: EP

Kind code of ref document: A2