WO2012082832A2 - Lepidopteran moth control using double-stranded rna constructs - Google Patents

Lepidopteran moth control using double-stranded rna constructs Download PDF

Info

Publication number
WO2012082832A2
WO2012082832A2 PCT/US2011/064795 US2011064795W WO2012082832A2 WO 2012082832 A2 WO2012082832 A2 WO 2012082832A2 US 2011064795 W US2011064795 W US 2011064795W WO 2012082832 A2 WO2012082832 A2 WO 2012082832A2
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
double
ribonucleic acid
dsrna
complementary
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/064795
Other languages
French (fr)
Other versions
WO2012082832A3 (en
Inventor
Robert K. Vander Meer
Man Yeon Choi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
US Department of Agriculture USDA
Original Assignee
US Department of Agriculture USDA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by US Department of Agriculture USDA filed Critical US Department of Agriculture USDA
Publication of WO2012082832A2 publication Critical patent/WO2012082832A2/en
Publication of WO2012082832A3 publication Critical patent/WO2012082832A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N63/00Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
    • A01N63/60Isolated nucleic acids
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N57/00Biocides, pest repellants or attractants, or plant growth regulators containing organic phosphorus compounds
    • A01N57/10Biocides, pest repellants or attractants, or plant growth regulators containing organic phosphorus compounds having phosphorus-to-oxygen bonds or phosphorus-to-sulfur bonds
    • A01N57/16Biocides, pest repellants or attractants, or plant growth regulators containing organic phosphorus compounds having phosphorus-to-oxygen bonds or phosphorus-to-sulfur bonds containing heterocyclic radicals
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1136Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against growth factors, growth regulators, cytokines, lymphokines or hormones
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • C12N15/8279Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
    • C12N15/8286Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for insect resistance
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]

Definitions

  • This invention relates to a method to control Helicoverpa zea via double-stranded RNA interference of the PBAN/Pyrokinin gene.
  • Insect pests cost the general public billions of dollars annually in losses. These losses include the expense of controlling insect pests as well as crop loss and property damage caused by the pests. Helicoverpa zea has the capacity to inflict devastating yield losses to
  • agronomically important crops Depending the type of plant the larva feeds on, the pest is known commonly as the cotton bollworm when it feeds on cotton or corn earworm when it feeds on corn.
  • Helicoverpa zea is typically controlled through the use of pyrethroid and Bacillus thuringiensis (Bt) insecticides.
  • Chemical pesticides are the primary tools used to combat these insect pests.
  • RNA interference pathway to knockdown the gene of interest via double-stranded RNA.
  • Double-stranded RNA induces sequence - specific post- transcriptional gene silencing in many organisms by a process known as RNA interference (RNAi).
  • RNAi is a post-transcriptional, highly conserved process in eukaryotes that leads to specific gene silencing through degradation of the target mRNA.
  • the silencing mechanism is mediated by dsRNA that is homologous in sequence to the gene of interest.
  • the dsRNA is processed into small interfering RNA (siRNA) by an endogenous enzyme called DICER inside the target pest, and the siRNAs are then incorporated into a multi-component RNA-induced silencing complex (RISC), which finds and cleaves the target mRNA.
  • RISC RNA-induced silencing complex
  • Fire, et al. (U.S. Pat. No. 6,506,559) discloses a process of introducing RNA into a living cell to inhibit gene expression of a target gene in that cell.
  • the RNA has a region with double- stranded structure. Inhibition is sequence-specific in that the nucleotide sequences of the duplex region of the RNA and of a portion of the target gene are identical.
  • Fire, et al. U.S. Pat. No.
  • 6,506,559 discloses a method to inhibit expression of a target gene in a cell, the method comprising introduction of a double-stranded ribonucleic acid into the cell in an amount sufficient to inhibit expression of the target gene, wherein the RNA is a double- stranded molecule with a first ribonucleic acid strand consisting essentially of a ribonucleotide sequence which corresponds to a nucleotide sequence of the target gene and a second ribonucleic acid strand consisting essentially of a ribonucleotide sequence which is complementary to the nucleotide sequence of the target gene. Furthermore, the first and the second ribonucleotide strands are separately complementary strands that hybridize to each other to form the said double-stranded construct, and the double-stranded construct inhibits expression of the target gene.
  • dsRNA construct in vivo as disclosed in Liu, et al. (U.S. Pat. No. 6,846,482).
  • Salient to Liu is contacting an insect with a recombinant baculovirus wherein a first ribonucleic acid sequence corresponds to at least a portion of at least one gene endogenous to the insect to control the insect.
  • a first ribonucleic acid sequence corresponds to at least a portion of at least one gene endogenous to the insect to control the insect.
  • RNA interference As a method to regulate gene expression for control, a specific essential gene needs to be targeted. Genes associated with neurohormones represent novel potential targets.
  • One neurohoromone gene family is the pheromone-biosynthesis- activating neuropeptide (PBAN)/pyrokinin gene family.
  • PBAN/pyrokinin gene produces multiple peptides, each of which are defined by a similar 5-amino-acid C-terminal sequence (FXPPvLamide) that is the active core fragment for these peptides as reported in Raina, A. K. and T. G. Kempe (1992).
  • a method for controlling Helicoverpa zea comprising: constructing a double-stranded ribonucleic acid construct that is complementary to a gene that encodes an PBAN/Pyrokinin gene sequence, dissolving the double-stranded ribonucleic acid to form a solution, and contacting an effective amount of said solution to Helicoverpa zea, wherein RNA interference is induced and Helicoverpa zea mortality occurs.
  • one strain of the double-stranded ribonucleic acid is complementary to the nucleotide sequence of SEQ. ID. NO. 2.
  • one strain of the double-stranded ribonucleic acid is complementary to the nucleotide sequence of SEQ. ID. NO. 3.
  • SEQ. ID. NO. 2 and SEQ. ID. NO. 3 form a complementary double-stranded ribonucleic acid construct.
  • the double-stranded ribonucleic acid construct is dissolved in water to form a solution.
  • the solution is applied to Helicoverpa zea bait material.
  • the bait material contains a phago stimulant.
  • Another aspect of the invention is the double-stranded ribonucleic acid construct solution is applied topically to Helicoverpa zea.
  • dsRNA double-stranded ribonucleic acid
  • dsRNA comprises a sense strand comprising a first sequence and an antisense strand comprising a second sequence
  • One aspect of the invention is the double-stranded ribonucleic acid is expressed in a plant cell.
  • dsRNA for inhibiting the expression of a pheromone -biosynthesis-activating neuropeptide/pyrokynin peptide in a cell
  • said dsRNA comprises a sense strand comprising a first sequence and an antisense strand comprising a second sequence complementary to SEQ ID NO: 3, wherein said first sequence is
  • One aspect of the invention is the double-stranded ribonucleic acid is expressed in a plant cell.
  • FIG. 3 is a graph depicting the effect of PBAN RNAi on sex pheromone production in H. zea female adults.
  • HezPBAN dsRNA (1 ⁇ g/3 ⁇ iL), water (3 ⁇ iL) or GFP (1 ⁇ g/3 ⁇ iL) was injected into 4-5-day old pupae.
  • GACAAAGTACTTCTCCCCAAGGCTCGGCAGAACCATGAACTTCTCACCACGACTCGG CAGGGAACTGTCTTATGATATGATGCCAAATAAAATCAGGGTAGTCAGGAGTACAA ACAAAACGCGATCAACATAA is the PBAN/pyrokinin gene cDNA of Helicoverpa zea.
  • SEQ. ID. NO. 2 is a 5' to 3' construct forming one strand of the dsRNA product referred to as HezPBAN dsRNA construct.
  • ACAAACAAAACGCGA is the dsRNA sequence structure of PBAN/pyrokinin gene of
  • SEQ. ID. NO. 3 is a 3' to 5' construct forming one strand of the dsRNA product referred to as HezPBAN dsRNA construct.
  • dsRNA constructs that target PBAN/Pyrokinin gene expression.
  • dsRNA inhibiting expression of the PBAN/Pyrokinin gene as a means of interfering with critical functions of the PBAN/Pyrokinin gene peptide products, a novel method to develop nucleic acid control for pest management is disclosed.
  • a cell includes a plurality of cells, including mixtures thereof.
  • the term "gene” refers to a DNA sequence involved in producing a polypeptide or precursor thereof.
  • the polypeptide can be encoded by a full-length coding sequence or by any portion of the coding sequence, such as exon sequences.
  • the gene target is a PBAN/Pyrokinin gene of an insect.
  • neuropeptide/pyrokynin peptide for Helicoverpa zea, refer to four gene product peptides comprising:
  • NDVKDGAASGAHSDRLGLWFGPPvL SEQ. ID. NO. 10
  • VIFTPKL SEQ. ID. NO. 11
  • SLAYDDKSFENVEFTPRL SEQ. ID. NO. 12
  • LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL SEQ. ID. NO. 13
  • TMNFSPRL SEQ. ID. NO. 14
  • oligonucleotide refers to a molecule comprising a plurality of
  • Oligonucleotide may be generated in any manner, including chemical synthesis, DNA replication, reverse transcription, polymerase chain reaction, or a combination thereof.
  • the present invention embodies utilizing the oligonucleotide in the form of dsRNA as means of interfering with a critical developmental or reproductive process that leads to control.
  • mononucleotides are synthesized to construct oligonucleotides in a manner such that the 5' phosphate of one mononucleotide pentose ring is attached to the 3' oxygen of its neighbor in one direction via a phosphodiester linkage
  • oligonucleotide is referred to as the "5' end” if its 5' phosphate is not linked to the 3' oxygen of a mononucleotide pentose ring and as the "3' end” if its 3' oxygen is not linked to a 5' phosphate of a subsequent mononucleotide pentose ring.
  • a nucleic acid sequence even if internal to a larger oligonucleotide, also may be said to have 5' and 3' ends.
  • the former When two different, non- overlapping oligonucleotides anneal to different regions of the same linear complementary nucleic acid sequence, and the 3' end of one oligonucleotide points towards the 5' end of the other, the former may be called the "upstream” oligonucleotide and the latter the "downstream” oligonucleotide.
  • primer refers to an oligonucleotide, which is capable of acting as a point of initiation of synthesis when placed under conditions in which primer extension is initiated.
  • An oligonucleotide "primer” may occur naturally, as in a purified restriction digest or may be produced synthetically.
  • a primer is selected to be "substantially complementary" to a strand of specific sequence of the template.
  • a primer must be sufficiently complementary to hybridize with a template strand for primer elongation to occur.
  • a primer sequence need not reflect the exact sequence of the template. For example, a non-complementary nucleotide fragment may be attached to the 5' end of the primer, with the remainder of the primer sequence being
  • Non- complementary bases or longer sequences can be interspersed into the primer, provided that the primer sequence is sufficiently complementary with the sequence of the template to hybridize and thereby form a template primer complex for synthesis of the extension product of the primer.
  • double-stranded RNA or “dsRNA” refers to two substantially
  • Identity is the relationship between two or more polynucleotide sequences, as determined by comparing the sequences. Identity also means the degree of sequence relatedness between polynucleotide sequences, as determined by the match between strings of such sequences. Identity can be readily calculated (see, .e.g, Computation Molecular Biology, Lesk, A. M., eds., Oxford University Press, New York (1998), and Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York (1993), both of which are incorporated by reference herein).
  • Substantially identical means there is a very high degree of homology (preferably 100% sequence identity) between the inhibitory dsRNA and the corresponding part of the target gene.
  • dsR A having greater than 90% or 95% sequence identity may be used in the present invention, and thus sequence variations that might be expected due to genetic mutation, strain polymorphism, or evolutionary divergence can be tolerated.
  • 100% identity is preferred, the dsRNA may contain single or multiple base pair random mismatches between the RNA and the target gene, provided that the mismatches occur at a distance of at least three nucleotides from the fusion site.
  • target gene refers to a section of a DNA strand of a double-stranded DNA that is complementary to a section of a DNA strand, including all transcribed regions, that serves as a matrix for transcription.
  • the target gene is therefore usually the sense strand.
  • complementary RNA strand refers to the strand of the dsRNA, which is complementary to an mRNA transcript that is formed during expression of the target gene, or its processing products.
  • dsRNA refers to a ribonucleic acid molecule having a duplex structure comprising two complementary and anti-parallel nucleic acid strands. Not all nucleotides of a dsRNA must exhibit Watson-Crick base pairs. The maximum number of base pairs is the number of nucleotides in the shortest strand of the dsRNA.
  • GFP dsRNA refers to a control dsRNA construct.
  • the green fluorescent protein (GFP) is commonly used as a reporter gene and was originally isolated from jellyfish and widely used as control in prokaryotic and eukaryotic systems.
  • RNA interference refers to a cellular mechanism for the destruction of targeted ribonucleic acid molecules. Under endogenous conditions, RNAi mechanism operates when dsRNA is cleaved to siRNA via an enzyme, DICER. The siRNA is processed to a single strand of anti-sense ribonucleic acid and coupled with a protein complex named RISC. The antisense R A then targets a complementary gene construct, such as messenger RNA that is cleaved by ribonuclease.
  • RISC protein complex
  • siRNA can be constructed via RNA oligonucleotide synthesis such as those disclosed in Scaringe, S., Methods Enzymol., 2000, Vol. 317:3 and incorporated herein by reference.
  • knock-down is defined as the act of binding an oligonucleotide with a complementary nucleotide sequence of a gene as such that the expression of the gene or mRNA transcript decreases.
  • knock-down of a PBAN/pyrokinin gene occurs via injection of a dsRNA that can have multiple negative effects on the target insect, such as incomplete metamorphosis to the adult stage and untimely death of the target insect.
  • Evidence of dsRNA having a negative effect on a targeted insect includes incomplete eclosion.
  • substantially single-stranded when used in reference to a nucleic acid product means that the product molecule exists primarily as a single strand of nucleic acid in contrast to a double-stranded product which exists as two strands of nucleic acids which are held together by inter-strand base pairing interactions.
  • Oligonucleotide primers matching or complementary to a gene sequence refers to oligonucleotide primers capable of facilitating the template-dependent synthesis of single or double- stranded nucleic acids. Oligonucleotide primers matching or complementary to a gene sequence may be used in PCRs, RT-PCRs and the like.
  • the term "corresponds to” as used herein means a polynucleotide sequence homologous to all or a portion of a reference polynucleotide sequence, or a polypeptide sequence that is identical to a reference polypeptide sequence.
  • the term “complementary to” is used herein to mean that the complementary sequence is homologous to all or a portion of a reference polynucleotide sequence.
  • the nucleotide sequence "TAT AC” corresponds to a reference sequence "TATAC” and is complementary to a reference sequence "GTATA".
  • an "effective amount” is an amount sufficient to effect desired beneficial or deleterious results.
  • An effective amount can be administered in one or more administrations.
  • an "effective amount” is that amount sufficient to make the target pest nonfunctional by causing an adverse effect on that pest, including (but not limited to) physiological damage to the pest; inhibition or modulation of pest growth; inhibition or modulation of pest reproduction; or death of the pest.
  • a dsRNA containing solution is fed to a target insect wherein critical developmental and/or reproductive functions of said insect are disrupted as a result of ingestion.
  • solvent includes any liquid that holds another substance in solution.
  • solvents include but are not limited to water and organic solvents such as acetone, ethanol, dimethyl sulfoxide (DMSO), and dimethylformamide (DMF).
  • phagostimulant refers to any substance that will entice the insect to ingest the dsRNA.
  • suitable phago stimulants include but are not limited to syrups, honey, aqueous solutions of sucrose, artificial sweeteners such as sucralose, saccharin, and other artificial sweeteners, amino acids, and other proteins.
  • Example 1 Constructing dsRNA construct for Helicoverpa zea
  • a mRNA was isolated from the dissected brain-subesophageal ganglion (Br-SGs) of the adult moths (Helicoverpa zea) by Micro Fast mRNA purification kit (Invitrogen), and used to synthesize cDNA with the GeneRacer cDNA synthesis kit (Invitrogen). Cloning the full length Hez-PBAN cDNA was carried out using Generacer kit (Invitrogen) as described by the manufacturer. The primers, 5 ' - AAGATGTTCAATCAAACTCAGTTG-3 ' (SEQ. ID. NO. 4) and 5 ' - AAATT ATGTTGATCGCGTTTTGTTTGT-3 ' (SEQ. ID. NO.
  • PCR was performed with the following temperature program: 33 cycles at 95 °C for 30 s, 52 °C for 30 s, and 72 °C for 1 min.
  • the PCR product was gel purified and cloned using TOPO TA cloning kit (Invitrogen) and sequenced. The obtained full-length sequence information was aligned and sequences compared with our partial sequence using DNA analysis software.
  • Hez-PBAN dsRNA PCR primer set was designed 5 '-T7-appended: 5'- TAATACGACTCACTATAGGG GTGTTTGCATTGTGTACCGC-3 ' (SEQ. ID. NO. 6), and 5 '-TAATACGACTCACTATAGGGTATAGGAAG GGGTTGATGGC-3 ' (SEQ. ID. NO. 7), to amplify 508-bp of Hez-PBAN DNA, which serves as the template for dsRNA synthesis using the MEGAscript RNA kit (Ambion).
  • a green fluorescence protein (GFP) dsRNA was purchased from Ambion or was synthesized from a 546-bp GFP DNA template amplified by these primers 5 '-T AATACGACTCACTAT AGGGACGT AAA CGGCCACA AGTTC-3' (SEQ. ID. NO. 8) and 5'-
  • Hez-PBAN dsRNA (SEQ. ID. NO. 1) was constructed from the full length of Hez-PBAN cDNA, 585-bp (SEQ. ID. NO. 2 and SEQ. ID. NO. 3).
  • the dsRNA construct comprising the complementary strands of SEQ. ID. NO. 2 and SEQ. ID. NO. 3 was injected into 4 to 5 day old female pupae. Specifically 1 ⁇ g of Hez-PBAN dsRNA was injected into 13 female pupae and observed until adult emergence. For a control, 1 ⁇ g of GFP dsRNA as disclosed was injected into 13 female pupae. 3 ⁇ of distilled water was also injected into 13 female pupae as an additional control. The pupae were then observed for mortality. As depicted in FIG.
  • the dsRNA construct comprising the complementary strands of SEQ. ID. NO. 2 and SEQ. ID. NO. 3 was injected into Helicoverpa zea pupae. Specifically, 1 ⁇ g/3 ⁇ iL of the dsRNA construct, water (3 ⁇ iL), or GFP (1 ⁇ g/3 ⁇ iL) was injected into female pupae as detailed in Example 2. Sex pheromone from female adults was then extracted 4-hr after light-off in the 2nd scotophase after adult emergence, then analyzed by via gas chromatography.
  • the Helicoverpa zea pheromone glands were dissected at room temperature and soaked in a hexane solvent containing 100 ng czs-9-tetradecenal (Z9-14:Ald) as an internal standard.
  • a gas chromatography (GC) 6890N (Agilent Technologies) equipped with a 30 m x 0.25 mm DB-23 capillary column (J&W) was used to quantify the amount of cis- 11 -hexadecenal (Zl l-16:Ald), a major sex pheromone component for H. zea.
  • the gas chromatography oven temperature was programmed at 80 °C for 1 min, then 10 °C/min to 230 °C and held for 8 min. As detailed in FIG. 3, pheromone production was reduced approximately 53% when compared against the water and GFP dsRNA controls.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Chemical & Material Sciences (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Plant Pathology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Pest Control & Pesticides (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Dentistry (AREA)
  • Environmental Sciences (AREA)
  • Agronomy & Crop Science (AREA)
  • Virology (AREA)
  • Cell Biology (AREA)
  • Insects & Arthropods (AREA)
  • Endocrinology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Agricultural Chemicals And Associated Chemicals (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Saccharide Compounds (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Disclosed is a dsRNA construct that relates to a method to control Lepidopteran moths via double-stranded RNA interference of the PBAN/Pyrokinin gene.

Description

LEPIDOPTERAN MOTH CONTROL USING DOUBLE-STRANDED RNA
CONSTRUCTS
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This present application claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Serial No.: 61/422,721, which was filed on December 14, 2010, and is hereby incorporated by reference.
FIELD OF THE INVENTION
[0002] This invention relates to a method to control Helicoverpa zea via double-stranded RNA interference of the PBAN/Pyrokinin gene.
BACKGROUND OF INVENTION
[0003] Insect pests cost the general public billions of dollars annually in losses. These losses include the expense of controlling insect pests as well as crop loss and property damage caused by the pests. Helicoverpa zea has the capacity to inflict devastating yield losses to
agronomically important crops. Depending the type of plant the larva feeds on, the pest is known commonly as the cotton bollworm when it feeds on cotton or corn earworm when it feeds on corn. Helicoverpa zea is typically controlled through the use of pyrethroid and Bacillus thuringiensis (Bt) insecticides.
[0004] Chemical pesticides are the primary tools used to combat these insect pests.
However, use of traditional chemical pesticides has disadvantages, including non-target effects on neutral or beneficial insects, as well as other animals. Chemical pesticide usage also can lead to chemical residue run-off into streams and seepage into water supplies resulting in
ecosystem/environment damage. In addition, animals higher in the food chain are at risk when they consume pesticide contaminated crops or insects. The handling and application of chemical pesticides also presents exposure danger to the public and professionals, and could lead to accidental dispersal into unintended environmentally sensitive areas. In addition, prolonged chemical pesticide application may result in an insect population becoming resistance to a chemical pesticide. In order to control a traditionally chemical resistant-pest, new more potent chemical pesticides must be utilized, which in turn will lead to another resistance cycle. As such, there is a need in the art to control pest populations without the disadvantages of traditional chemical pesticides.
[0005] An approach to decrease dependence on chemical pesticides is by causing a specific gene(s) of the target-pest to malfunction by either over expression or silencing gene expression. The silencing approach utilizes RNA interference pathways to knockdown the gene of interest via double-stranded RNA. Double-stranded RNA (dsRNA) induces sequence - specific post- transcriptional gene silencing in many organisms by a process known as RNA interference (RNAi). RNAi is a post-transcriptional, highly conserved process in eukaryotes that leads to specific gene silencing through degradation of the target mRNA. The silencing mechanism is mediated by dsRNA that is homologous in sequence to the gene of interest. The dsRNA is processed into small interfering RNA (siRNA) by an endogenous enzyme called DICER inside the target pest, and the siRNAs are then incorporated into a multi-component RNA-induced silencing complex (RISC), which finds and cleaves the target mRNA. The dsRNA inhibits expression of at least one gene within the target, which exerts a deleterious effect upon the target.
[0006] Fire, et al. (U.S. Pat. No. 6,506,559) discloses a process of introducing RNA into a living cell to inhibit gene expression of a target gene in that cell. The RNA has a region with double- stranded structure. Inhibition is sequence-specific in that the nucleotide sequences of the duplex region of the RNA and of a portion of the target gene are identical. Specifically, Fire, et al. (U.S. Pat. No. 6,506,559) discloses a method to inhibit expression of a target gene in a cell, the method comprising introduction of a double-stranded ribonucleic acid into the cell in an amount sufficient to inhibit expression of the target gene, wherein the RNA is a double- stranded molecule with a first ribonucleic acid strand consisting essentially of a ribonucleotide sequence which corresponds to a nucleotide sequence of the target gene and a second ribonucleic acid strand consisting essentially of a ribonucleotide sequence which is complementary to the nucleotide sequence of the target gene. Furthermore, the first and the second ribonucleotide strands are separately complementary strands that hybridize to each other to form the said double-stranded construct, and the double-stranded construct inhibits expression of the target gene.
[0007] In using dsRNA in controlling a target insect, one method is to engineer a baculovirus to produce a dsRNA construct in vivo as disclosed in Liu, et al. (U.S. Pat. No. 6,846,482).
Salient to Liu is contacting an insect with a recombinant baculovirus wherein a first ribonucleic acid sequence corresponds to at least a portion of at least one gene endogenous to the insect to control the insect. Given the advances made in the field of transfection efficiency and RNA interference, there is a need in the art to utilize RNA interference technology without using a baculovirus as a vector. Such a method would mediate control of a target-pest without depending on variables associated with a baculovirus, such as expression and transfection of dsRNA by the baculovirus.
[0008] To utilize RNA interference as a method to regulate gene expression for control, a specific essential gene needs to be targeted. Genes associated with neurohormones represent novel potential targets. One neurohoromone gene family is the pheromone-biosynthesis- activating neuropeptide (PBAN)/pyrokinin gene family. The PBAN/pyrokinin gene produces multiple peptides, each of which are defined by a similar 5-amino-acid C-terminal sequence (FXPPvLamide) that is the active core fragment for these peptides as reported in Raina, A. K. and T. G. Kempe (1992). "Structure activity studies of PBAN of Helicoverpa zea (Lepidoptera: Noctuidae)." Insect Biochem Mol Biol 22(3): 221 -225. It was subsequently determined that the five C-terminal amino acids, FXPRLamide, represented the minimal sequence required for activity as reported in Raina, A.K. and T.G. Kempe (1992) id.; Fonagy, A., L. Schoofs, et al. (1992). "Functional cross-reactivities of some locusta myotropins and Bombyx pheromone biosynthesis activating neuropeptide." J Insect Physiol 38(9): 651 -657; Kuniyoshi, H., H.
Nagasawa, et al. (1992). "Cross-activity between pheromone biosynthesis activating
neuropeptide (PBAN) and myotropic pyrokinin insect peptides." Biosci Biotechnol Biochem 56(1): 167-8; and Raina, A. K. and T. G. Kempe (1990). "A pentapeptide of the C-terminal sequence of PBAN with pheromonotropic activity." Insect Biochem 20(8): 849-851.
[0009] To date, over 200 PBAN/pyrokinin family peptides including peptides deduced from 37 species PBAN/pyrokinin genes have been identified. While it is one of the largest neuropeptide families in insects, the physiological functions of the PBAN/Pyrokinin peptides are only partially known. Members of the PBAN/pyrokinin family have been shown to have a variety of functions in insects such as: 1) stimulate pheromone biosynthesis in female moths (Raina et al., 1989); 2) induce melanization in moth larvae (Matsumoto et al., 1990; Altstein et al., 1996); 3) induce embryonic diapause and seasonal polyphenism in moths (Suwan et al., 1994; Uehara et al., 201 1); 4) stimulate visceral muscle contraction (Nachman et al., 1986; Predel and Nachman, 2001); 5) accelerate puparium formation in several flies (Zdarek et al., 1997; Verleyen et al., 2004); 6) terminate pupal diapause in heliothine moths (Sun et al., 2003; Xu and Denlinger, 2003).
[0010] As such there is a need in the art to investigative whether the PBAN/Pyrokinin pathway can be used to interfere with essential developmental and/or reproductive functions of the targeted insect pests and result in abnormal development and/or lack of reproduction.
[0011] Furthermore there is a need for novel control methods that would interfere with essential developmental and/or reproductive functions of species that do not have the undesirable characteristics of traditional chemical pesticides. To that end, there is a need to develop dsRNA constructs that are engineered to interfere with essential developmental and/or reproductive functions of specific pest insects that would overcome some of the disadvantages of using traditional pesticides.
BRIEF SUMMARY OF THE INVENTION
[0012] Disclosed herewith is a method for controlling Helicoverpa zea, the method comprising: constructing a double-stranded ribonucleic acid construct that is complementary to a gene that encodes an PBAN/Pyrokinin gene sequence, dissolving the double-stranded ribonucleic acid to form a solution, and contacting an effective amount of said solution to Helicoverpa zea, wherein RNA interference is induced and Helicoverpa zea mortality occurs.
[0013] In an embodiment of the invention, one strain of the double-stranded ribonucleic acid is complementary to the nucleotide sequence of SEQ. ID. NO. 2. In another embodiment of the invention, one strain of the double-stranded ribonucleic acid is complementary to the nucleotide sequence of SEQ. ID. NO. 3. In an embodiment of the invention, SEQ. ID. NO. 2 and SEQ. ID. NO. 3 form a complementary double-stranded ribonucleic acid construct. [0014] In another embodiment of the invention the double-stranded ribonucleic acid construct is dissolved in water to form a solution. One aspect of the invention is the solution is applied to Helicoverpa zea bait material. In one embodiment, the bait material contains a phago stimulant. Another aspect of the invention is the double-stranded ribonucleic acid construct solution is applied topically to Helicoverpa zea.
[0015] Another embodiment of the invention, disclosed is a double-stranded ribonucleic acid (dsRNA) for inhibiting the expression of a pheromone-biosynthesis-activating
neuropeptide/pyrokynin peptide in a cell, wherein said dsRNA comprises a sense strand comprising a first sequence and an antisense strand comprising a second sequence
complementary to SEQ ID NO: 2, wherein said first sequence is complementary to said second sequence. One aspect of the invention is the double-stranded ribonucleic acid is expressed in a plant cell.
[0016] In another embodiment of the invention, for inhibiting the expression of a pheromone -biosynthesis-activating neuropeptide/pyrokynin peptide in a cell, wherein said dsRNA comprises a sense strand comprising a first sequence and an antisense strand comprising a second sequence complementary to SEQ ID NO: 3, wherein said first sequence is
complementary to said second sequence. One aspect of the invention is the double-stranded ribonucleic acid is expressed in a plant cell.
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] The present invention together with the disclosed embodiments may best be understood from the following detailed description of the drawings, wherein: [0018] FIG. 1 is a graph depicting pupal mortality of Helicoverpa zea after PBAN dsRNA injection of HezPBAN dsRNA (1 μg/3 \iL), water (3 \iL), or GFP (1 μg/3 \iL) injected into 4-5- day old female pupae (N = 13).
[0019] FIG. 2 is a photo depicting eclosion failure or problems for the adults leading to mortality from HezPBAN dsRNA injection. Data were analyzed by Kaplan-Meier survival curve comparison (PBAN vs. GFP & water, P = 0.011 & 0.002, n > 13).
[0020] FIG. 3 is a graph depicting the effect of PBAN RNAi on sex pheromone production in H. zea female adults. HezPBAN dsRNA (1 μg/3 \iL), water (3 \iL) or GFP (1 μg/3 \iL) was injected into 4-5-day old pupae. Sex pheromone was extracted 2-4 hr after light-off from 2-3- day old female adults. Bars with different letters are significantly different (unpaired i-test, two- tailed, PBAN vs. GFP & water, P = 0.019 & 0.031 , n > 5).
BRIEF DESCRIPTION OF THE SEQUENCES
[0021] SEQ. ID. NO. 1 :
ATGTTCAATCAAACTCAGTTGTTTGTTTTTCTCGCTGTATTCACTACGAGCAGTGTTT
TAGGGAATAACAATGATGTTAAGGATGGCGCAGCGAGTGGAGCTCACAGCGACCGA
CTAGGTCTTTGGTTCGGTCCCCGGCTAGGCAAGCGCTCGCTCAGAATATCTACCGAA
GATAACAGACAAGCATTCTTCAAATTACTCGAAGCCGCCGACGCTTTGAAATACTAT
TACGACCAGCTACCTTATGAGATGCAAGCTGATGAACCTGAAACCAGGGTCACCAA
GAAGGTGATCTTCACCCCCAAGTTAGGCAGAAGCCTCGCATACGATGACAAAAGCT
TTGAGAACGTGGAGTTCACGCCCAGACTCGGCAGGAGACTGTCCGATGATATGCCT
GCCACCCCCGCTGACCAGGAAATGTACCGCCAAGACCCTGAACAGATTGACAGCAG
GACAAAGTACTTCTCCCCAAGGCTCGGCAGAACCATGAACTTCTCACCACGACTCGG CAGGGAACTGTCTTATGATATGATGCCAAATAAAATCAGGGTAGTCAGGAGTACAA ACAAAACGCGATCAACATAA is the PBAN/pyrokinin gene cDNA of Helicoverpa zea.
[0022] SEQ. ID. NO. 2: is a 5' to 3' construct forming one strand of the dsRNA product referred to as HezPBAN dsRNA construct.
[0023] SEQ. ID. NO. 2:
CAAUGAUGUUAAGGAUGGCGCAGCGAGUGGAGCUCACAGCGACCGACUAGGUCU
UUGGUUCGGUCCCCGGCUAGGCAAGCGCUCGCUCAGAAUAUCUACCGAAGAUAAC
AGACAAGCAUUCUUCAAAUUACUCGAAGCCGCCGACGCUUUGAAAUACUAUUACG
ACCAGCUACCUUAUGAGAUGCAAGCUGAUGAACCUGAAACCAGGGUCACCAAGAA
GGUGAUCUUCACCCCCAAGUUAGGCAGAAGCCUCGCAUACGAUGACAAAAGCUUU
GAGAACGUGGAGUUCACGCCCAGACUCGGCAGGAGACUGUCCGAUGAUAUGCCUG
CCACCCCCGCUGACCAGGAAAUGUACCGCCAAGACCCUGAACAGAUUGACAGCAG
GACAAAGUACUUCUCCCCAAGGCUCGGCAGAACCAUGAACUUCUCACCACGACUC
GGCAGGGAACUGUCUUAUGAUAUGAUGCCAAAUAAAAUCAGGGUAGUCAGGAGU
ACAAACAAAACGCGAis the dsRNA sequence structure of PBAN/pyrokinin gene of
Helicoverpa zea.
[0024] SEQ. ID. NO. 3: is a 3' to 5' construct forming one strand of the dsRNA product referred to as HezPBAN dsRNA construct.
SEQ. ID. NO. 3:
GUUACUACAAUUCCUACCGCGUCGCUCACCUCGAGUGUCGCUGGCUGAUCCAGAA ACCAAGCCAGGGGCCGAUCCGUUCGCGAGCGAGUCUUAUAGAUGGCUUCUAUUGU CUGUUCGUAAGAAGUUUAAUGAGCUUCGGCGGCUGCGAAACUUUAUGAUAAUGC UGGUCGAUGGAAUACUCUACGUUCGACUACUUGGACUUUGGUCCCAGUGGUUCU UCCACUAGAAGUGGGGGUUCAAUCCGUCUUCGGAGCGUAUGCUACUGUUUUCGA
AACUCUUGCACCUCAAGUGCGGGUCUGAGCCGUCCUCUGACAGGCUACUAUACGG
ACGGUGGGGGCGACUGGUCCUUUACAUGGCGGUUCUGGGACUUGUCUAACUGUC
GUCCUGUUUCAUGAAGAGGGGUUCCGAGCCGUCUUGGUACUUGAAGAGUGGUGC
UGAGCCGUCCCUUGACAGAAUACUAUACUACGGUUUAUUUUAGUCCCAUCAGUCC
UCAUGUUUGUUUUGCGCU
DETAILED DESCRIPTION OF THE INVENTION
[0025] Disclosed here are specific insect pest dsRNA constructs that target PBAN/Pyrokinin gene expression. Using dsRNA inhibiting expression of the PBAN/Pyrokinin gene as a means of interfering with critical functions of the PBAN/Pyrokinin gene peptide products, a novel method to develop nucleic acid control for pest management is disclosed.
[0026] Definitions
[0027] As used in the specification and claims, the singular form "a", "an" and "the" include plural references unless the context clearly dictates otherwise. For example, the term "a cell" includes a plurality of cells, including mixtures thereof.
[0028] The term "gene" refers to a DNA sequence involved in producing a polypeptide or precursor thereof. The polypeptide can be encoded by a full-length coding sequence or by any portion of the coding sequence, such as exon sequences. In one embodiment of the invention, the gene target is a PBAN/Pyrokinin gene of an insect.
[0029] The term "pheromone-biosynthesis-activating neuropeptide/pyrokynin peptide" for Helicoverpa zea, refer to four gene product peptides comprising:
NDVKDGAASGAHSDRLGLWFGPPvL (SEQ. ID. NO. 10), VIFTPKL (SEQ. ID. NO. 11), SLAYDDKSFENVEFTPRL (SEQ. ID. NO. 12), LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL (SEQ. ID. NO. 13), and TMNFSPRL (SEQ. ID. NO. 14).
[0030] The term "oligonucleotide" refers to a molecule comprising a plurality of
deoxyribonucleotides or ribonucleotides. Oligonucleotide may be generated in any manner, including chemical synthesis, DNA replication, reverse transcription, polymerase chain reaction, or a combination thereof. The present invention embodies utilizing the oligonucleotide in the form of dsRNA as means of interfering with a critical developmental or reproductive process that leads to control. Inasmuch as mononucleotides are synthesized to construct oligonucleotides in a manner such that the 5' phosphate of one mononucleotide pentose ring is attached to the 3' oxygen of its neighbor in one direction via a phosphodiester linkage, an end of an
oligonucleotide is referred to as the "5' end" if its 5' phosphate is not linked to the 3' oxygen of a mononucleotide pentose ring and as the "3' end" if its 3' oxygen is not linked to a 5' phosphate of a subsequent mononucleotide pentose ring. As used herein, a nucleic acid sequence, even if internal to a larger oligonucleotide, also may be said to have 5' and 3' ends.
[0031] When two different, non- overlapping oligonucleotides anneal to different regions of the same linear complementary nucleic acid sequence, and the 3' end of one oligonucleotide points towards the 5' end of the other, the former may be called the "upstream" oligonucleotide and the latter the "downstream" oligonucleotide.
[0032] The term "primer" refers to an oligonucleotide, which is capable of acting as a point of initiation of synthesis when placed under conditions in which primer extension is initiated. An oligonucleotide "primer" may occur naturally, as in a purified restriction digest or may be produced synthetically. [0033] A primer is selected to be "substantially complementary" to a strand of specific sequence of the template. A primer must be sufficiently complementary to hybridize with a template strand for primer elongation to occur. A primer sequence need not reflect the exact sequence of the template. For example, a non-complementary nucleotide fragment may be attached to the 5' end of the primer, with the remainder of the primer sequence being
substantially complementary to the strand. Non- complementary bases or longer sequences can be interspersed into the primer, provided that the primer sequence is sufficiently complementary with the sequence of the template to hybridize and thereby form a template primer complex for synthesis of the extension product of the primer.
[0034] The term "double-stranded RNA" or "dsRNA" refers to two substantially
complementary strands of ribonucleic acid. "Identity," as used herein, is the relationship between two or more polynucleotide sequences, as determined by comparing the sequences. Identity also means the degree of sequence relatedness between polynucleotide sequences, as determined by the match between strings of such sequences. Identity can be readily calculated (see, .e.g, Computation Molecular Biology, Lesk, A. M., eds., Oxford University Press, New York (1998), and Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York (1993), both of which are incorporated by reference herein). While there exist a number of methods to measure identity between two polynucleotide sequences, the term is well known to skilled artisans (see, e.g., Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press (1987); and Sequence Analysis Primer, Gribskov., M. and Devereux, J., eds., M Stockton Press, New York (1991)). Methods commonly employed to determine identity between sequences include, for example, those disclosed in Carillo, H., and Lipman, D., SIAMJ. Applied Math. (1988) 48: 1073. "Substantially identical" as used herein, means there is a very high degree of homology (preferably 100% sequence identity) between the inhibitory dsRNA and the corresponding part of the target gene. However, dsR A having greater than 90% or 95% sequence identity may be used in the present invention, and thus sequence variations that might be expected due to genetic mutation, strain polymorphism, or evolutionary divergence can be tolerated. Although 100% identity is preferred, the dsRNA may contain single or multiple base pair random mismatches between the RNA and the target gene, provided that the mismatches occur at a distance of at least three nucleotides from the fusion site.
[0035] As used herein, "target gene" refers to a section of a DNA strand of a double-stranded DNA that is complementary to a section of a DNA strand, including all transcribed regions, that serves as a matrix for transcription. The target gene is therefore usually the sense strand.
[0036] The term "complementary RNA strand" refers to the strand of the dsRNA, which is complementary to an mRNA transcript that is formed during expression of the target gene, or its processing products. "dsRNA" refers to a ribonucleic acid molecule having a duplex structure comprising two complementary and anti-parallel nucleic acid strands. Not all nucleotides of a dsRNA must exhibit Watson-Crick base pairs. The maximum number of base pairs is the number of nucleotides in the shortest strand of the dsRNA.
[0037] As used herein, the term "GFP dsRNA" refers to a control dsRNA construct. The green fluorescent protein (GFP) is commonly used as a reporter gene and was originally isolated from jellyfish and widely used as control in prokaryotic and eukaryotic systems.
[0038] "Small interfering RNA" or "siRNA" refers to a short double-strand of ribonucleic acid, approximately 18 to 30 nucleotides in length. The term "RNA interference" or "RNAi" refers to a cellular mechanism for the destruction of targeted ribonucleic acid molecules. Under endogenous conditions, RNAi mechanism operates when dsRNA is cleaved to siRNA via an enzyme, DICER. The siRNA is processed to a single strand of anti-sense ribonucleic acid and coupled with a protein complex named RISC. The antisense R A then targets a complementary gene construct, such as messenger RNA that is cleaved by ribonuclease. While the examples infra discloses constructing dsRNA constructs via enzymatic techniques with the enzyme RNA polymerase, it is contemplated that siRNA can be constructed via RNA oligonucleotide synthesis such as those disclosed in Scaringe, S., Methods Enzymol., 2000, Vol. 317:3 and incorporated herein by reference.
[0039] As used herein, "knock-down" is defined as the act of binding an oligonucleotide with a complementary nucleotide sequence of a gene as such that the expression of the gene or mRNA transcript decreases. In an embodiment, knock-down of a PBAN/pyrokinin gene occurs via injection of a dsRNA that can have multiple negative effects on the target insect, such as incomplete metamorphosis to the adult stage and untimely death of the target insect. Evidence of dsRNA having a negative effect on a targeted insect includes incomplete eclosion.
[0040] The term "substantially single-stranded" when used in reference to a nucleic acid product means that the product molecule exists primarily as a single strand of nucleic acid in contrast to a double-stranded product which exists as two strands of nucleic acids which are held together by inter-strand base pairing interactions.
[0041] "Oligonucleotide primers matching or complementary to a gene sequence" refers to oligonucleotide primers capable of facilitating the template-dependent synthesis of single or double- stranded nucleic acids. Oligonucleotide primers matching or complementary to a gene sequence may be used in PCRs, RT-PCRs and the like.
[0042] The term "corresponds to" as used herein means a polynucleotide sequence homologous to all or a portion of a reference polynucleotide sequence, or a polypeptide sequence that is identical to a reference polypeptide sequence. In contradistinction, the term "complementary to" is used herein to mean that the complementary sequence is homologous to all or a portion of a reference polynucleotide sequence. For example, the nucleotide sequence "TAT AC" corresponds to a reference sequence "TATAC" and is complementary to a reference sequence "GTATA".
[0043] An "effective amount" is an amount sufficient to effect desired beneficial or deleterious results. An effective amount can be administered in one or more administrations. In terms of treatment, an "effective amount" is that amount sufficient to make the target pest nonfunctional by causing an adverse effect on that pest, including (but not limited to) physiological damage to the pest; inhibition or modulation of pest growth; inhibition or modulation of pest reproduction; or death of the pest. In one embodiment of the invention, a dsRNA containing solution is fed to a target insect wherein critical developmental and/or reproductive functions of said insect are disrupted as a result of ingestion.
[0044] The term "solvent" includes any liquid that holds another substance in solution. Examples of solvents include but are not limited to water and organic solvents such as acetone, ethanol, dimethyl sulfoxide (DMSO), and dimethylformamide (DMF).
[0045] The term "phagostimulant" refers to any substance that will entice the insect to ingest the dsRNA. For insects, suitable phago stimulants include but are not limited to syrups, honey, aqueous solutions of sucrose, artificial sweeteners such as sucralose, saccharin, and other artificial sweeteners, amino acids, and other proteins.
[0046] Methods which are well known to those skilled in the art may be used to construct expression vectors containing sequences encoding PBAN/Pyrokinin gene and appropriate transcriptional and trans lational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described in Sambrook, J. et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Plainview, N.Y, and Ausubel, F. M. et al. (1989) Current Protocols in Molecular Biology, John Wiley & Sons, New York, N.Y.
[0047] While the examples provided wherein describe dsRNA constructs cloned from GenBank Accession No. U08109 (Helicoverpa zea), it is contemplated that when read in conjunction with the teaching disclosed herein, the construction of other dsRNA constructs targeting PBAN/pyrokinin gene sequences of other insect orders would be feasible to those skilled the in the art. For example, including but not limited to the PBAN/pyrokinin gene/amino acid sequences disclosed in Table 1 , it is contemplated that a dsRNA construct targeting the species disclosed in Table 1 of known PBAN/pyrokinin genes would control that respective insect. Additionally it is contemplated that a single dsRNA construct would be effective in controlling a plurality of insect species.
Table 1 :
Figure imgf000017_0001
Samia cynthia ricini AY286544
Manduca sexta AY 172672
Bombyx mori NM 001043856
Bombyx mandarina J. Sericultural Science of Japan, 68: 373-379
Ascotis selenaria cretacea AB308061
Adoxophyes. sp AF395670
Plutella xylostella AY904342
Drosophila melanogaster AY047528
Drosophila mauritiana EF386943
Drosophila sechellia EF386942
Diptera Drosophila simulans EF386941
Aedes aegypti XM 001650839/XM 001662162
Culex quinquefasciatus XM 001847366
Anopheles gambiae XM 307885
Coleoptera Tribolium castaneum EFA11568
Apis melifera NM 001110712
Nasonia vitripennis NM_001167725
Solenopsis invicta FJ223176
Solenopsis richteri GQ872200
Solenopsis geminata GQ872197
Hymenoptera
Solenopsis pergandei GQ872198
Solenopsis carolinenesis GQ872199
Harpegnathos saltator GL445232
Camponotus floridanus GL439118
Linepithema humile Unpublished data
Acyrthosiphon pisum (pea aphid) Gene ID: ACYPIG 135047
Hemiptera
Rhodnius prolixus GU230851
Example 1: Constructing dsRNA construct for Helicoverpa zea
Cloning and sequencing of Hez-PBAN/pyrokinin gene from Helicoverpa zea
[0048] A mRNA was isolated from the dissected brain-subesophageal ganglion (Br-SGs) of the adult moths (Helicoverpa zea) by Micro Fast mRNA purification kit (Invitrogen), and used to synthesize cDNA with the GeneRacer cDNA synthesis kit (Invitrogen). Cloning the full length Hez-PBAN cDNA was carried out using Generacer kit (Invitrogen) as described by the manufacturer. The primers, 5 ' - AAGATGTTCAATCAAACTCAGTTG-3 ' (SEQ. ID. NO. 4) and 5 ' - AAATT ATGTTGATCGCGTTTTGTTTGT-3 ' (SEQ. ID. NO. 5) were designed from the sequence registered on the GenBank (Accession number: U08109). PCR was performed with the following temperature program: 33 cycles at 95 °C for 30 s, 52 °C for 30 s, and 72 °C for 1 min. The PCR product was gel purified and cloned using TOPO TA cloning kit (Invitrogen) and sequenced. The obtained full-length sequence information was aligned and sequences compared with our partial sequence using DNA analysis software.
Construction of Hez-PBAN/pyrokinin dsRNA Construct and dsGFP control
[0049] To construct Hez-PBAN dsRNA PCR primer set was designed 5 '-T7-appended: 5'- TAATACGACTCACTATAGGG GTGTTTGCATTGTGTACCGC-3 ' (SEQ. ID. NO. 6), and 5 '-TAATACGACTCACTATAGGGTATAGGAAG GGGTTGATGGC-3 ' (SEQ. ID. NO. 7), to amplify 508-bp of Hez-PBAN DNA, which serves as the template for dsRNA synthesis using the MEGAscript RNA kit (Ambion). For a negative control, a green fluorescence protein (GFP) dsRNA was purchased from Ambion or was synthesized from a 546-bp GFP DNA template amplified by these primers 5 '-T AATACGACTCACTAT AGGGACGT AAA CGGCCACA AGTTC-3' (SEQ. ID. NO. 8) and 5'-
TAATACGACTCACTATAGGGTGCTCAGGTAGTGGTTGTCG-3' (SEQ. ID. NO. 9) using the same kit as above. The length of Hez-PBAN dsRNA (SEQ. ID. NO. 1) was constructed from the full length of Hez-PBAN cDNA, 585-bp (SEQ. ID. NO. 2 and SEQ. ID. NO. 3).
Example 2: Hez-PBAN dsRNA injected into Pupae and Adult Helicoverpa zea Bioassay
[0050] The dsRNA construct comprising the complementary strands of SEQ. ID. NO. 2 and SEQ. ID. NO. 3 was injected into 4 to 5 day old female pupae. Specifically 1 μg of Hez-PBAN dsRNA was injected into 13 female pupae and observed until adult emergence. For a control, 1 μg of GFP dsRNA as disclosed was injected into 13 female pupae. 3 μΐ of distilled water was also injected into 13 female pupae as an additional control. The pupae were then observed for mortality. As depicted in FIG. 1, it was observed that 53.8% of Helicoverpa zea pupae died as compared to 7.7% mortality and 0.5% mortality of dsRNA GFP and distilled water, respectively. This mortality was recorded as a failure of adult emergence as the pupae developed to adult tissue, but failed to escape from their cocoon as depicted in FIG. 2. Additionally, mortality was recorded as an event if the emerging Helicoverpa zea failed to expand their wings and appendages upon emergence.
Example 3: Inhibition of Pheromone Production via Hez-PBAN dsRNA in Helicoverpa zea Pupae Bioassay
[0051] The dsRNA construct comprising the complementary strands of SEQ. ID. NO. 2 and SEQ. ID. NO. 3 was injected into Helicoverpa zea pupae. Specifically, 1 μg/3 \iL of the dsRNA construct, water (3 \iL), or GFP (1 μg/3 \iL) was injected into female pupae as detailed in Example 2. Sex pheromone from female adults was then extracted 4-hr after light-off in the 2nd scotophase after adult emergence, then analyzed by via gas chromatography. The Helicoverpa zea pheromone glands were dissected at room temperature and soaked in a hexane solvent containing 100 ng czs-9-tetradecenal (Z9-14:Ald) as an internal standard. A gas chromatography (GC) 6890N (Agilent Technologies) equipped with a 30 m x 0.25 mm DB-23 capillary column (J&W) was used to quantify the amount of cis- 11 -hexadecenal (Zl l-16:Ald), a major sex pheromone component for H. zea. The gas chromatography oven temperature was programmed at 80 °C for 1 min, then 10 °C/min to 230 °C and held for 8 min. As detailed in FIG. 3, pheromone production was reduced approximately 53% when compared against the water and GFP dsRNA controls.
[0052] While the invention has been described with reference to details of the illustrated embodiment, these details are not intended to limit the scope of the invention as defined in the appended claims. The embodiment of the invention in which exclusive property or privilege is claimed is defined as follows:

Claims

1. A double- stranded ribonucleic acid (dsRNA) for inhibiting the expression of a pheromone -biosynthesis-activating neuropeptide/pyrokynin peptide in a cell, wherein said dsRNA comprises a sense strand comprising a first sequence and an antisense strand comprising a second sequence complementary to SEQ ID NO: 2, wherein said first sequence is
complementary to said second sequence.
2. The double-stranded ribonucleic acid of claim 1 wherein the double-stranded ribonucleic acid is expressed in a plant cell.
3. A double- stranded ribonucleic acid (dsRNA) for inhibiting the expression of a pheromone -biosynthesis-activating neuropeptide/pyrokynin peptide in a cell, wherein said dsRNA comprises a sense strand comprising a first sequence and an antisense strand comprising a second sequence complementary to SEQ ID NO: 3, wherein said first sequence is
complementary to said second sequence.
4. The double-stranded ribonucleic acid of claim 3 wherein the double-stranded ribonucleic acid is expressed in a plant cell.
5. A method for controlling Helicoverpa zea, the method comprising: constructing a double-stranded ribonucleic acid construct that is complementary to a gene that encodes an PBAN/Pyrokinin gene sequence, dissolving the double-stranded ribonucleic acid to form a solution, and contacting an effective amount of said solution to Helicoverpa zea, wherein RNA interference is induced and Helicoverpa zea mortality occurs.
6. The method of claim 5, wherein one strain of the double-stranded ribonucleic acid is complementary to the nucleotide sequence of SEQ. ID. NO. 2.
7. The method of claim 5, wherein one strain of the double-stranded ribonucleic acid is complementary to the nucleotide sequence of SEQ. ID. NO. 3.
8. The method of claim 5, wherein the double-stranded ribonucleic acid construct is dissolved in water.
9. The method of claim 5, wherein the solution is applied to Helicoverpa zea bait material.
10. The method of claim 9, wherein the bait material contains a phagostimulant.
11. The method of claim 5, wherein the solution is applied topically to Helicoverpa zea.
12. The method of claim 5, wherein pheromone production in Helicoverpa zea is decreased.
13. The method of claim 6, wherein the pheromone is cis-l 1-hexadecenal.
PCT/US2011/064795 2010-12-14 2011-12-14 Lepidopteran moth control using double-stranded rna constructs Ceased WO2012082832A2 (en)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US42272110P 2010-12-14 2010-12-14
US61/422,721 2010-12-14
US13/324,005 US9617542B2 (en) 2010-12-14 2011-12-13 Lepidopteran moth control using double-stranded RNA constructs
US13/324,005 2011-12-13

Publications (2)

Publication Number Publication Date
WO2012082832A2 true WO2012082832A2 (en) 2012-06-21
WO2012082832A3 WO2012082832A3 (en) 2012-09-07

Family

ID=46199606

Family Applications (3)

Application Number Title Priority Date Filing Date
PCT/US2011/064795 Ceased WO2012082832A2 (en) 2010-12-14 2011-12-14 Lepidopteran moth control using double-stranded rna constructs
PCT/US2011/064780 Ceased WO2012082823A2 (en) 2010-12-14 2011-12-14 Formicidae (ant) control using double-stranded rna constructs
PCT/US2011/064816 Ceased WO2012082844A2 (en) 2010-12-14 2011-12-14 Double-stranded rna constructs to control insect pests

Family Applications After (2)

Application Number Title Priority Date Filing Date
PCT/US2011/064780 Ceased WO2012082823A2 (en) 2010-12-14 2011-12-14 Formicidae (ant) control using double-stranded rna constructs
PCT/US2011/064816 Ceased WO2012082844A2 (en) 2010-12-14 2011-12-14 Double-stranded rna constructs to control insect pests

Country Status (2)

Country Link
US (4) US8575328B2 (en)
WO (3) WO2012082832A2 (en)

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8575328B2 (en) * 2010-12-14 2013-11-05 The United States Of America, As Represented By The Secretary Of Agriculture Formicidae (ant) control using double-stranded RNA constructs
US9000145B2 (en) * 2012-09-28 2015-04-07 The United States Of America, As Represented By The Secretary Of Agriculture Control of insect pests through RNAi of pheromone biosynthesis activating neuropeptide receptor
CN106536545B (en) * 2014-02-07 2026-03-03 先锋国际良种公司 Insecticidal proteins and methods of use thereof
KR101647293B1 (en) * 2014-06-05 2016-08-11 안동대학교 산학협력단 dsRNA for the control of Helicoverpa assulta, insecticide composition and control method comprising it
BR102017001164A2 (en) 2016-01-26 2019-03-06 Embrapa - Empresa Brasileira De Pesquisa Agropecuária DOUBLE TAPE RNA COMPOSITIONS FOR CITRI DIAPHORINE CONTROL AND METHODS OF USE.
US20190343122A1 (en) * 2016-05-27 2019-11-14 Provivi, Inc. Improved insect control strategies utilizing pheromones and rnai
WO2018046312A2 (en) * 2016-09-06 2018-03-15 Syngenta Participations Ag Improvements in or relating to gene silencing
CN110269014B (en) * 2019-07-23 2021-01-12 中国海洋大学 RNA interference method of urechis unicinctus larvae
CN110915815A (en) * 2019-12-09 2020-03-27 海南省粮油科学研究所 A kind of red pseudo grain thief attractant
CN114736907B (en) * 2022-04-14 2023-07-11 浙江大学 Wax synthesis gene PsFAR of Hibiscus rosa-sinensis mealy bugs and application thereof
CN115786334B (en) * 2022-07-27 2023-07-18 广东省农业科学院植物保护研究所 Small-molecule RNA for regulating and controlling reproduction of solenopsis invicta and application thereof

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL109405A0 (en) * 1994-04-24 1994-07-31 Israel State Peptide fragments and analogs derived from pban 1-33 nh2 for controlling moths
US6506559B1 (en) * 1997-12-23 2003-01-14 Carnegie Institute Of Washington Genetic inhibition by double-stranded RNA
CA2429814C (en) * 2000-12-01 2014-02-18 Thomas Tuschl Rna interference mediating small rna molecules
EP2500429A3 (en) * 2005-05-31 2015-10-28 Devgen N.V. RNAi for the control of insects and arachnids
CA2627795C (en) * 2006-01-12 2019-01-22 Devgen N.V. Dsrna as insect control agent
US20080124279A1 (en) * 2006-11-17 2008-05-29 Antoine Andremont Colonic delivery using Zn/pectin beads with a Eudragit coating
CN101195821A (en) * 2006-12-04 2008-06-11 中国科学院上海生命科学研究院 Method for Improving Plant Insect Resistance Using RNAi Technology
US20090004668A1 (en) * 2007-06-22 2009-01-01 The Board Of Trustees Of The Leland Stanford Junior University Pre-miRNA loop-modulated target regulation
JP5213105B2 (en) 2008-01-17 2013-06-19 株式会社日立製作所 Video network system and video data management method
US8575328B2 (en) * 2010-12-14 2013-11-05 The United States Of America, As Represented By The Secretary Of Agriculture Formicidae (ant) control using double-stranded RNA constructs

Also Published As

Publication number Publication date
US20120148525A1 (en) 2012-06-14
US10093925B2 (en) 2018-10-09
US8575328B2 (en) 2013-11-05
US20130305417A1 (en) 2013-11-14
WO2012082832A3 (en) 2012-09-07
WO2012082844A2 (en) 2012-06-21
WO2012082844A3 (en) 2012-10-26
US20120148524A1 (en) 2012-06-14
US10093928B2 (en) 2018-10-09
WO2012082823A2 (en) 2012-06-21
US20170175119A1 (en) 2017-06-22
WO2012082823A3 (en) 2012-08-16
US9617542B2 (en) 2017-04-11

Similar Documents

Publication Publication Date Title
US10093925B2 (en) Lepidopteran moth control using double-stranded RNA constructs
Turner et al. RNA interference in the light brown apple moth, Epiphyas postvittana (Walker) induced by double‐stranded RNA feeding
Zhang et al. Silencing of two alternative splicing-derived mRNA variants of chitin synthase 1 gene by RNAi is lethal to the oriental migratory locust, Locusta migratoria manilensis (Meyen)
Katoch et al. RNAi for insect control: current perspective and future challenges
Mao et al. Co-silence of the coatomer β and v-ATPase A genes by siRNA feeding reduces larval survival rate and weight gain of cotton bollworm, Helicoverpa armigera
WO2015153339A4 (en) Compositions and methods for controlling insect pests
Park et al. RNA interference of cadherin gene expression in Spodoptera exigua reveals its significance as a specific Bt target
Kang et al. Fused: a promising molecular target for an RNAi-based strategy to manage Bt resistance in Plutella xylostella (L.)
US10808261B2 (en) Double strand RNA-mediated RNA interference through feeding detrimental to larval Lymantria dispar (gypsy moth)
US9714425B2 (en) Double stranded RNA constructs for aphid control
Rebijith et al. Diet-delivered dsRNAs for juvenile hormone-binding protein and vacuolar ATPase-H implied their potential in the management of the melon aphid (Hemiptera: Aphididae)
US10975386B2 (en) Method and compositions for controlling pest insects on plants by silencing genes of the chitin synthase and of the vitellogenin family, as well as alternatively by expressing the gene of a cry toxin
Wang et al. Evaluation of some potential target genes and methods for RNAi-mediated pest control of the corn earworm Helicoverpa zea
US9000145B2 (en) Control of insect pests through RNAi of pheromone biosynthesis activating neuropeptide receptor
Zeng et al. Molecular and functional analysis of chitin synthase genes in Chilo suppressalis (Lepidoptera: Crambidae)
Tan et al. New insights into expanding the insecticidal spectrum of dsRNA mediated by the high sequence identity between dsRNA and nontarget mRNA
US10822609B2 (en) Genetic control method and compositions against insect pests in cotton plants by the silencing of genes of the laccase family
US10182571B2 (en) Method and compositions for the genetic control of insect pests in cotton plants by chitin synthase gene silencing
Namin Characterization of acaricide resistance, plant-mediated RNAi against two-spotted spider mites (Tetranychus urticae Koch), and assessing off-and non-target effects
Yates RNA interference as a tool for the functional analysis of genes in the Colorado potato beetle, Leptinotarsa decemlineata (Say)
JANGID Master of Science (Agri.)
BR102021011530A2 (en) GENE SILENCING FOR PROTEIN CADHERIN - APPLICATION IN THE CONTROL OF THE INSECT PEST, ANTHONOMUS GRANDIS, VIA INTERFERING RNA
BR102020004312A2 (en) METHOD TO PRODUCE INSECT PEST RESISTANT PLANT, INSECT PEST RESISTANT PLANT AND NUCLEIC ACID MOLECULES USED TO OBTAIN SUCH PLANT THROUGH ECDISE-RELATED DS-RNAS
Ramu et al. Plant protection through RNAi: alternative for pesticides and chemical approaches to pest control
Hosseinzadeh Namin Characterization of Acaricide Resistance, Plant-Mediated RNAi Against Two-Spotted Spider Mites (Tetranychus urticae Koch), and Assessing Off-and Non-Target Effects

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11848935

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 11848935

Country of ref document: EP

Kind code of ref document: A2