WO2012065262A1 - Expression, purification and refolding of recombinant chlamydia proteins, compositions and related methods - Google Patents

Expression, purification and refolding of recombinant chlamydia proteins, compositions and related methods Download PDF

Info

Publication number
WO2012065262A1
WO2012065262A1 PCT/CA2011/050704 CA2011050704W WO2012065262A1 WO 2012065262 A1 WO2012065262 A1 WO 2012065262A1 CA 2011050704 W CA2011050704 W CA 2011050704W WO 2012065262 A1 WO2012065262 A1 WO 2012065262A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
ala
momp
thr
gly
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CA2011/050704
Other languages
French (fr)
Inventor
John Riley
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sanofi Pasteur Ltd
Original Assignee
Sanofi Pasteur Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sanofi Pasteur Ltd filed Critical Sanofi Pasteur Ltd
Publication of WO2012065262A1 publication Critical patent/WO2012065262A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/295Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Chlamydiales (O)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/118Chlamydiaceae, e.g. Chlamydia trachomatis or Chlamydia psittaci
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55561CpG containing adjuvants; Oligonucleotide containing adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59

Definitions

  • the present invention relates generally to recombinant protein purification and more particularly, to methods of purifying and folding recombinantly expressed proteins.
  • Chlamydiale bacteria are obligate intracellular pathogens of eukaryotic cells.
  • Four chlamydial species are currently known— C. trachomatis, C. pneumoniae, C. pecorum and C. psittaci— and genomic sequences for each of these are publicly available ((1999) Nature Genetics 21 :385-389; (2000) Nucleic Acids Res 28: 1397-1406; (2000) Nucleic Acids Res 28:2311-2314; ( 1998) Science 282:754-759).
  • C. trachomatis organisms are dimorphic, and alternate between 1) infectious "elementary bodies” (EBs) which are endocytosed by mucosal cells into vesicular inclusions; and 2) metabolically active, intracellular “reticulate bodies” (RBs). RBs replicate and redifferentiate into EBs before being released to infect neighbouring cells.
  • EBs infectious "elementary bodies”
  • RBs metabolically active, intracellular "reticulate bodies”
  • MOMP is expressed in both EBs and RBs and is situated on the outer membrane where it functions as a porin. It constitutes about 60% of the membrane protein of the infectious EB. Structural and functional analysis has shown that native MOMP exists as an oligomer; the native conformation of C. trachomatis MOMP is a trimer with monomers that have a ⁇ -barrel, ⁇ -sheet secondary structure. In EB, MOMP forms trimers twith disulfide bridges within and between its individual monomers ( ⁇ 40 kDa) and also between trimers (J. Bacterid. 189:6222-6235, 2007).
  • C. trachomatis serovars capable of infecting humans ⁇ i.e., A to K, Ba, Da, la, Ja, LI to L3 and L2a
  • these serovars have been typed based on serological differentiation of the antigenic epitopes on MOMP.
  • the MOMPs encoded by each of these 19 different serovars share five well-conserved regions and four variable sequence segments or domains (termed VS or VD 1 to VD 4).
  • the subspecies and serovar specific antigenic epitopes or determinants are located on the variable domains.
  • the serovars have been subdivided into the following serogroups or classes: B class (B, Ba, D, Da, E, LI, L2 and L2a), C class (A, C, H, I, la, J, K and L3), and intermediate class (F and G).
  • B class B, Ba, D, Da, E, LI, L2 and L2a
  • C class A, C, H, I, la, J, K and L3
  • intermediate class F and G.
  • Infection with any C. trachomatis serovar may result in disease: serovars A, B, Ba and C cause trachoma; serovars L1-L3 are the agents of lymphogranuloma venereum; serovars D-K cause sexually transmitted infections; and serovars G, I and D have been associated with cervical cancer.
  • Chlamydial infection itself causes disease, and failure to clear the infection results in persistent immune stimulation which may lead to chronic infection with severe consequences (e.g., sterility and blindness).
  • the precise immune correlates of protection remain to be determined, but cell-mediated immune responses and antibody mediated immune responses are each involved; the bacterium is an intracellular parasite, and as such, it can typically evade antibody-mediated immune responses, but antibodies to the C. trachomatis MOMP protein neutralize EB infectivity and B-cell-deficient mice are unable to prevent re-infection (which suggests a functional role for B cells in adaptive immunity) (Morrison et al, 2005). While antibiotics may clear an infection, in many cases women are asymptomatic and therefore, are unlikely to seek treatment.
  • Vaccines may be useful: (a) as a prophylactic vaccine by immunizing against chlamydial infection or against Chlamydia-induced disease; and/or (b) as a therapeutic vaccine by eradicating an established chronic chlamydial infection.
  • OMPs outer membrane proteins
  • MOMPs outer membrane proteins
  • a MOMP protein (either recombinantly expressed or extracted directly from the bacteria) needs to assume some degree of its native conformation such that it presents the conformational epitopes required to induce a therapeutically effective immune response. For example, in a study using EB-MOMP extracted from C.
  • trachomatis mouse pneumonitis (MoPn) (a natural pathogen of mice) under conditions to maintain its native trimeric conformation
  • this trimeric native-like form of EB-MOMP was able to induce in mice a protective response as effective as that elicited by live organisms against a genital challenge (Infect. Immun. 73 : 8153-8160, 2005).
  • MOMP metal-oxide-semiconductor
  • heterologous bacterial expression systems are commonly associated with the production of improperly folded recombinant proteins in insoluble aggregates, referred to as inclusion bodies. Solubilizing these aggregates and then refolding the proteins into their native conformation is problematic and often leads to low recovery.
  • MOMP is a detergent resistant, cysteine-rich protein, and as such, recombinantly expressed MOMP (rMOMP) can aggregate when oxidized or interact with, and form extensive disulfide bonds with other cysteine-rich proteins making it prone to misfolding and aggregation and difficult to purify and refold (Mol Microbiol 1992, 6: 1087-1094; BMC Microbiology 2005, 5:5).
  • Recombinant MOMP has been expressed in E. coli using full-length ompA genes that include the signal sequence to target the translated protein to the outer membrane but this approach too has proven problematic as the protein tends to misfold and aggregate (Manning et al. 1993).
  • the present invention generally relates to methods for preparing soluble and immunogenic recombinant Chlamydial membrane outer membrane (MOMP) proteins. More particularly, the present invention relates to methods for obtaining recombinant Chlamydial MOMP that is expressed as an insoluble aggregate in a heterologous host, in a soluble and immunogenic form.
  • the methods of the present invention are generally accomplished by:
  • step (c) purifying the denatured protein from step (b) by subjecting the mixture of step (b) to at least one chromatographic purification in the presence of denaturing agent and collecting eluted solution of purified denatured protein;
  • step (d) admixing the purified denatured protein solution from step (c) with a reducing agent and at least one small molecule additive to enhance protein folding and/or suppress protein aggregation;
  • Immunogenic compositions and methods for eliciting an immune response against Chlamydia infections are also described.
  • Preferred examples include immunogenic compositions comprising immunogenic recombinant MOMP proteins, methods for their production and their use.
  • the recombinant MOMP proteins can be from any one of the known 19 different human serovars of C. trachomatis or any of the known serovars of C. pneumoniae.
  • methods of immunizing a subject against disease caused by infection with a strain of Chlamydia comprising administering to the subject an effective amount of a Chlamydia protein made in accordance to the methods described herein.
  • the recombinant MOMP proteins obtained by the methods of the present invention are immunogenic and administration of these proteins (e.g. , in the compositions of the present invention) to a subject elicits an immune response and/or an immunoprotective response against infections by Chlamaydia (e.g., C. trachomatis).
  • the methods of the present invention can be used to obtain soluble recombinant MOMP in substantially oligomeric forms.
  • the methods of the present invention can be used to obtain recombinant MOMP suitable for use in the preparation of immunogenic compositions (e.g., vaccines).
  • Figure 1 shows a schematic representation of one embodiment of the purification, refolding process for recombinant proteins
  • Figure 2 shows a representative SDS PAGE gel of rMOMP protein samples obtained after the various steps of the purification and refolding method
  • Figures 3 shows a representative Blue Native PAGE gel analysis of rMOMP (serovar E, C.
  • pilot scale lot was approximately 10 fold larger than lab scale.
  • the actual yields of the lots were as follows: pilot lot JR3182: 1.59 g, lab scale JR3081 : 180 mg, JR3095: 121.9 mg, JR3097: 101.4 mg.
  • Figure 4 shows a representative SDS-PAGE gel of rMOMP (serovar E, C. trachomatis) protein samples prepared in accordance to an embodiment of the invention demonstrating the quaternary structure of the rMOMP protein at various steps (i.e., samples of the solubilized IBs, the purified denatured MOMP (Q pool), the folded protein, and the final product)
  • steps i.e., samples of the solubilized IBs, the purified denatured MOMP (Q pool), the folded protein, and the final product
  • Figure 5 shows representative SDS-PAGE gels comparing two protein samples purified in accordance to an alternative embodiment. While the same starting material was used to prepare the samples run in the left panel gel and those run in the right panel gel, each panel of samples underwent a different purification process. In both gels, lanes are loaded in triplicate with 4 ⁇ g of protein. Improved purity is evident in the samples of the right panel.
  • Figures 6A, 6B, 6C show representative BN-PAGE gel analysis of rMOMP protein samples prepared in accordance to an embodiment of the invention.
  • Figure 7 shows representative SE-HPLC chromatograms for SerE rMOMP lots.
  • Figure 8 shows representative SE-HPLC chromatograms for SerF, la, and J rMOMP lots.
  • Figure 9 shows a representative graphical comparison of elicited IgG titers as assessed using two different ELISA assays (the commercially available MedacTM assay and an ELISA developed using rMOMP made in accordance to the invention).
  • Figure 10 shows a representative graphical correlation between sera IgG titers (as measured by IgG ELISA) and sera neutralization capacity.
  • a strong positive correlation was evident between IgG levels measured by the sp-IgG ELISA and neutralization titres in all participants ( Figure 10A). The correlation was still evident when the 4 most visually obvious outliers were removed from the analysis ( Figure 10B).
  • Figure 11 shows a representative graphical correlation between sera IgG3 titers and neutralization capacity.
  • a strong positive correlation was evident between IgG3 levels (as measured by the SP-IgG3 ELISA) and neutralization titers in all participants ( Figure 1 1 A), even when the most visually obvious outliers were excluded ( Figure 1 IB).
  • the present invention provides novel methods of obtaining a recombinant Chlamydial MOMP proteins that have been recombinantly expressed in a host as an insoluble aggregate, in a soluble, immunogenic and substantially oligomeric form. Also provided are novel methods of purifying and/or refolding chlamydial outer membrane proteins that have been recombinantly expressed in a host cell as an insoluble aggregate. The present invention further provides novel recombinant proteins, particularly recombinant proteins obtained by these novel methods and immunogenic compositions comprising these proteins. These compositions are useful for eliciting an immune response (e.g., a neutralizing immune response) against a Chlamydia infection and/or for treating and/or preventing Chlamydial infections.
  • an immune response e.g., a neutralizing immune response
  • the methods for preparing such proteins are generally accomplished by: a) isolating the insoluble aggregated protein (e.g., by isolating inclusion body fractions enriched in MOMP protein); b) admixing the insoluble aggregated protein in an aqueous solution comprising a denaturing agent to denature (i.e., solubilize) the insoluble aggregated protein to provide a solution containing denatured MOMP protein; c) purifying the denatured MOMP protein by subjecting the mixture of step (b) to at least one chromatographic purification in the presence of denaturing agent and collecting eluted solution of purified denatured protein; d) renaturing (refolding) the purified denatured MOMP protein by admixing a reducing agent and at least one small molecule additive (and in preferred examples of the invention, using n-lauroyl sarcosine and in other preferred examples of the invention, using DTT, 1-arginine and n-lauroyl sarco
  • Adjuvant refers to agents or substances that modulate the immunogenicity of an antigen. “Modulate the immunogenicity” includes enhancing the magnitude, duration and/or specificity or type of an immune response stimulated by an antigen.
  • heterologous host refers to a host cell (e.g. , prokaryotic, eukaryotic) that is transfected with a construct encoding a target protein not normally found in said host.
  • a host cell e.g. , prokaryotic, eukaryotic
  • immunogenicity refers to the ability of a substance to induce an immune response when administered to a subject (e.g., a cellular immunogen-specific immune response and/or a humoral antibody response).
  • antigenicity is the ability of an antibody to recognize and bind to a protein (e.g., an antigen).
  • an "immunoprotective response”, as used herein, is meant to encompass humoral and/or cellular immune responses that are sufficient to: 1) inhibit or prevent infection by a microbial organism, particularly a pathogenic microbial organism; and/or 2) prevent onset of disease, reduce the risk of onset of disease, or reduce the severity of disease symptoms caused by infection by a microbial organism, particularly a pathogenic microbial organism.
  • inclusion bodies are insoluble protein aggregates.
  • insoluble aggregates and “inclusion bodies” are used herein interchangeably.
  • isolated is meant to describe a compound of interest that is in an environment different from that in which the compound naturally occurs. “Isolated” is meant to include compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.
  • Oligomeric proteins contain a number of polypetide chains or subunits (e.g., monomer units). Dimers, trimers and tetramers are examples of oligomers.
  • the term “substantially purified” refers to a compound that is removed from its natural environment and is at least 60% free, preferably 75% free, more preferably 80% free and most preferably 90% free from other components with which it is naturally associated.
  • the "% purity" of a compound refers to % by which the compound is free from detectable quantities of contaminants.
  • a protein made in accordance to the method described herein is greater than 80% pure. Purity may be assessed using sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and scanning densitometry as described herein.
  • the term "subject" is meant any mammalian subject, particularly humans. Other subjects may include cattle, sheep (e.g. in detection of sheep at risk of abortion due to chlamydial infection), dogs, cats (e.g. in detection of cats having eye and/or respiratory infections), birds (e.g. chickens or other poultry), pigs, rabbits, rats, mice, horses, and so on. Of particular interest are subjects having or susceptible to Chlamydia infection, particularly to infection by C. trachomatis, C. psittaci and/or C. pneumoniae.
  • the term "effective amount” or “therapeutically effective amount” means a dosage sufficient to provide for treatment for the disease state being treated or to otherwise provide the desired effect (e.g. induction of an effective immune response or reduction of bacterial load).
  • the precise dosage will vary according to a variety of factors such as subject- dependent variables (e.g., age, immune system health, etc), the disease (e.g., the species of the infecting pathogen), and the treatment being effected.
  • an "effective amount” is that amount necessary to substantially improve the likelihood of treating the infection, in particular that amount which improves the likelihood of successfully preventing infection or eliminating infection when it has occurred.
  • non-reducing conditions for gel electrophoresis such as blue native polyacrylamide gel electrophoresis (BN-PAGE) means the preparation of samples without boiling and without the addition of reducing agents such as diothiothreitol (DTT) or 2-mercaptoethanol or beta-mercaptoethanol (BME).
  • DTT diothiothreitol
  • BME beta-mercaptoethanol
  • Treatment or “treating” as used herein means any therapeutic intervention in a subject, usually a mammalian subject, generally a human subject, including: (i) prevention, that is, causing the clinical symptoms not to develop, e.g. preventing infection and/or preventing progression to a harmful state; (ii) inhibition, that is, arresting the development or further development clinical, symptoms, e.g.
  • a polypeptide used with the invention may comprise an amino acid sequence that:
  • sequence identity e.g. 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more
  • Variants of MOMP polypeptides may comprise an amino acid sequence having 80% or more sequence identity (e.g. 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to the serovar sequences disclosed herein (e.g. SEQ IDs 3, 8, 11, 13, 15, and 17) or any other know or existing in the art.
  • Immunogenic compositions of the invention may be useful as vaccines.
  • Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat infection), but will typically be prophylactic.
  • vaccine refers to a pharmaceutically acceptable formulation of at least one antigen.
  • Such pharmaceutical acceptable formulations of an antigen may also include for example, adjuvants, excipients, diluents, and/or other similar substances that enhance the activity, stability, and/or other properties of a formulation or administration.
  • the present invention provides a method of obtaining an outer membrane protein (e.g., rMOMP) that is recombinantly expressed as an insoluble aggregate in a heterologous host, in a soluble and immunogenic form.
  • an outer membrane protein e.g., rMOMP
  • the isolation, purification and refolding of recombinantly expressed MOMP proteins into a form having a degree of fidelity to the native oligomeric form, is desirable.
  • Recombinant proteins such as for example, rMOMP
  • Recombinant proteins often form aggregates or inclusion bodies when over expressed in heterologous expression systems usually in an insoluble form. This usually occurs because the expressed protein is not correctly folded.
  • various steps are required (e.g., disruption of the host cells, isolation of the inclusion bodies, and then dissolving (i.e., denaturing) them in a chaotropic agent).
  • the denatured protein is then transferred to an environment that favours a return to its native conformation; during the process the protein undergoes a transition through various semi- stable intermediates, any of which can lead to aggregation as opposed to the desired native conformation.
  • the present invention provides an efficient method for purifying and refolding a recombinant Chlamydia outer membrane protein from a denatured state, which overcomes the shortcomings of current methods.
  • a suitable heterologous host cell e.g., E. coli
  • a construct encoding the target protein e.g., MOMP of any serovar of a species of Chlamydia
  • Suitable host cells can be prokaryotic or eukaryotic.
  • suitable hosts cells that can be used to express recombinant proteins include bacteria, yeast, insect and mammalian cells. Bacteria cells are particularly useful, especially E. coli.
  • Methods of expressing a heterologous protein in a host cell are well known in the art and examples are provided herein.
  • the present invention encompasses a wide variety of recombinant proteins. These proteins include outer membrane proteins (such as for example, MOMP, OmcA, OmcB and PorB) of each Chlamydial species (C. trachomatis, C. pneumonaie, C. pecorum, C. psittaci).
  • outer membrane proteins such as for example, MOMP, OmcA, OmcB and PorB
  • the present methods also can enhance the expression recovery and purification of these recombinant outer membrane proteins.
  • MOMP expressed recombinantly typically is produced intracellularly in an insoluble aggregated form (i.e., as inclusion bodies).
  • the cells expressing the target protein in an insoluble aggregated form are collected and lysed, to isolate the insoluble aggregates.
  • Cell lysis can occur prior to, or coincident with, the solubilization procedures described below. Cell lysis can be accomplished by, for example, mechanical sheer such as a French pressure cell, enzymatic digestion, sonification, homogenization, glass bead vortexing, detergent treatment, organic solvents, freeze thaw, grinding with alumina or sand, treatment with a denaturing agent as defined below, and the like.
  • inclusion bodies can be separated from soluble proteins by various methods such as centrifugation, filtration (including ultrafiltration), precipitation or settling.
  • the inclusion bodies are separated from cell debris using low- speed centrifugation after cell lysis as they are denser than most of the cellular components.
  • These recovered inclusion bodies may be contaminated with E. coli cell wall and outer membrane components. The later may largely be removed by selective extraction with detergents and low concentration of either urea or guanidine-HCl to produce wash pellets.
  • the application of mild detergents to cell lyates will promote dissolution of most cellular structures, while leaving the inclusion bodies intact, which can then be collected by low speed centrifugation.
  • the insoluble aggregated material is solubilized (i.e., rendered soluble, denatured or monomelic) by exposing the insoluble aggregated material (or whole cells without prior lysis) to a denaturing agent.
  • denaturing agents include chaptropic reagents such as urea, guanidine (guanidine hydrochloride), agents such as arginine, and sodium thiocyanate, extremes in pH (dilute acids or bases), detergents (e.g., SDS, N-lauroyl sarcosine), salts (e.g., chlorides, nitrates, thiocyanates, cetylmethylammonium salts, tricholoroacetates), chemical derivatization (e.g., sulfitolysis, reaction with citraconic anhydride), solvents (e.g., 2-amino-2-methyl-l-propanol or other alcohols, DMSO, DMF).
  • chaptropic reagents such as urea
  • the denaturing agent is guanidine and/or urea.
  • Useful concentrations of either guanidine or urea are 1-8M with 6-8M being preferred concentrations.
  • Chelating agents such as EDTA may be used in this step to prevent metal catalyzed air oxidation of cysteines during the removal of chaptrotic reagents (such as for e.g., guanidine, urea).
  • a disulfide reducing agent is also used in conjunction with the denaturing agent.
  • Useful disulfide reducing agents include thiol compounds such as diothiothreitol (DTT) or beta-mercaptoethanol. These compounds can be used in the range of 1-100 mM with - 10 mM being a typical concentration.
  • inclusion bodies are solubilized in guanidine (e.g., 6M). Prior to purification, the guaninidine is exchanged with urea (e.g., 8M urea) for example, by tangenitial flow filtration. In a further example, inclusion bodies are recovered by centrifugation and the inclusion body pellet is solubilized in 8M urea (at about pH 12.5).
  • the solubilization solution also includes a reducing agent such as for example, DTT (e.g., lOmM).
  • isolated inclusion bodies are solubilized by adding (20-40 mL/g) in 8M Urea, pH 12.5 and incubating mixture for about 30 minutes. Following incubation, DTT (lOmM) is added and the pH of the solution is reduced to about pH 6 with citrate/phosphate buffer. The solubilization supernatant is then diluted with Urea (e.g., 8M with lOmM DTT) to reach a conductivity of preferably about 2.0-2.5 mS/cm. The resulting supernatant is then filtered. Following solubilization, the soluble and denatured protein is recovered and isolated from other proteins in the soluble fraction (mixture).
  • Urea e.g., 8M with lOmM DTT
  • Such recovery and purification methods are known or readily determined by those skilled in the art, including for example, centrifugation, filtration, dialysis, chromatography, including size exclusion, ion-exchange, hydrophobic interaction and affinity chromatography procedures and the like.
  • the denatured protein solution subjected to at least one chromatographic purification (such as for example, ion-exchange, hydrophobic interaction and affinity chromatography).
  • the solution is subjected to at least one anion exchange chromatography.
  • the solution is subjected first to cation exchange chromatography (to capture impurities) and then to anion exchange chromatography.
  • the column is preferably washed with a solution comprising Urea and a salt (e.g., 8M Urea, 15 mM NaCl) and the rMOMP protein may be eluted from the column using a solution of Urea with a higher salt concentration (e.g., (8M Urea, 30-90 mM NaCl).
  • a salt e.g. 8M Urea, 15 mM NaCl
  • a higher salt concentration e.g., (8M Urea, 30-90 mM NaCl.
  • the next step in the process is to refold the solubilized and purified protein to obtain the desired conformation.
  • the protein is soluble, immunogenic and in form that is similar to the native oligomeric form.
  • the protein is capable of eliciting neutralizing antibodies to the corresponding species (and/or serovar) of Chlamydia from which it was derived.
  • the protein is in a substantially oligomeric form which preferably includes at least a trimeric form and preferably includes less than 6% of the monomeric form. Preferably, less than 5% is in the monomelic form.
  • the purification of a denatured protein before subjecting it to refolding conditions is unconventional; chromatographic approaches for purification are generally not well suited to protein mixtures containing the high levels of strong denaturants (e.g., 8 M urea or 6 M guanidine hydrochloride) required to solubilize inclusion body preparations.
  • strong denaturants e.g. 8 M urea or 6 M guanidine hydrochloride
  • the aqueous solution of purified protein is mixed with a reducing agent (e.g., DTT, DTE, or 2-mercaptoethanol) and at least one small molecule additive.
  • a reducing agent e.g., DTT, DTE, or 2-mercaptoethanol
  • Refolding is achieved by reducing the concentrations of the denaturing agent and the reducing agent to levels sufficient to allow the protein to re-nature into a soluble, conformationally native-like form (i.e., oligomeric). This can be achieved by dialysis, dilution, gel filtration, precipitation of the protein or by immobilization on a resin followed by buffer washes.
  • concentrations are reduced using at least one tangential flow filtration.
  • Conditions for this step are chosen to allow for regeneration of the protein's native disulfide bond(s) and therefore consider the redox environment.
  • a reducing agent such as DTT, DTE, or 2-mercaptoethanol is used to reduce disulfide bonds to the sulfhydral state when the protein is denatured, ensuring complete unfolding. Re-establishment of these disulfide bonds, which confers appropriate secondary structure, occurs when the buffer environment is allowed to promote oxidation, when the protein is newly and correctly re-folded. Alternatively, this can be accomplished through the addition of an oxidizing agent and a reducing agent, to catalyze a disulfide exchange reaction.
  • a reagent or combination of reagents are chosen that result in native disulfide bond formation (e.g., oxygen, cysteine/oxygen, cysteine/cystine, cysteine/cystamine, cysteamine/cystamine, reduced glutathione/oxidized glutathione, and the like).
  • Small molecule additives may be added to guide the protein towards the correct conformation.
  • small molecule additives for use in the disclosed methods include those which enhance protein folding and/or suppress protein aggregation.
  • small molecule additives for use in the disclosed methods include 1- arginine, N-lauroyl sarcosine, sucrose and ammonium sulfate.
  • Preferred small molecule additives are 1-arginine and N-lauroyl sarcosine.
  • the purified protein is refolded by removing or reducing the concentration of the denaturant and any excess reducing agent.
  • concentration of the denaturant e.g., uniform Urea or guanidine hydrochloride
  • concentration of the denaturant is reduced over a few minutes, to provide a stable, folded protein.
  • intermediate folding states of the protein from which insoluble misfolded aggregates can form and these intermediate folding states are sensitive to concentration as they follow second order kinetics. Reducing the concentration of the denaturant (and reducing agent if applicable) in a minimal amount of time reduces the opportunity for mis-folding.
  • the refolding process involves a diafiltration of a volume of purified denatured recombinant protein (e.g., rMOMP) in urea (e.g., 8M) mixed with equal volumes of arginine (e.g., 1M - 3M) and NLS (e.g., 2-30% v/v) and DTT (e.g., 10 mM).
  • a volume of purified denatured recombinant protein e.g., rMOMP
  • urea e.g., 8M
  • arginine e.g., 1M - 3M
  • NLS e.g., 2-30% v/v
  • DTT e.g. 10 mM
  • the recombinant proteins obtained according to these methods can be further processed if desired. For example, residual contaminates can be removed.
  • the isolated rMOMP protein is preferably in a buffered solution having a pH of 7.0 to 8.5, and preferably 7.5 to 8.5.
  • the protein solution preferably has a residual concentration of NLS of 0.5% (w/v) or less, of DTT of 24 ⁇ g/ml or less, and of urea of 10 mg/ml or less.
  • the purified recombinant MOMP proteins obtained by the methods of the present invention are identifiable via their known physical, chemical, immunological or biological properties (e.g., by means of SDS-PAGE, BN-PAGE, isoelectric focusing, specific monoclonal antibodies, and immunological parameters such as, antibody ELISA, neutralizing antibody titres, cytokine levels, lymphoproliferative responses.
  • the yield of rMOMP obtained by the methods of the present invention is 75-95% or higher.
  • the protein preparations produced by the present methods can be used for a variety of in vitro and in vivo applications.
  • the proteins and their derivatives of the present invention can be used for research, diagnostic, prophylactic or therapeutic purposes.
  • In vitro uses include, for example the use of the protein for screening, detecting and/or purifying other proteins.
  • the present invention provides immunogenic compositions useful for treating and/or preventing Chlamydial infections.
  • the present invention provides methods of inducing anti-chlamydial immunity by administering the immunogenic compositions provided, either alone or in a prime boost protocol.
  • An anti-chlamydial immune response can be defined as a reduction in bacterial load in the immunized host upon challenge with live Chlamydia, and/or the stimulation of protective levels of IFN- ⁇ in the host cells (immunoprotective response).
  • compositions comprising recombinantly expressed outer membrane proteins e.g., rMOMP
  • rMOMP recombinantly expressed outer membrane proteins
  • compositions e.g., vaccine compositions
  • adjuvants generally are substances that can enhance the immunogenicity of antigens.
  • Adjuvants may play a role in both acquired and innate immunity (e.g., toll-like receptors) and may function in a variety of ways, not all of which are understood.
  • the antigen induces a Thl biased response or a balanced Thl/Th2 response.
  • adjuvants may include, but are not limited to, mineral salts, squalene mixtures, muramyl peptide, saponin derivatives, mycobacterium cell wall preparations, certain emulsions, monophosphoryl lipid A, mycolic acid derivatives, nonionic block copolymer surfactants, Quil A, cholera toxin B subunit, polyphosphazene and derivatives, immunostimulating complexes (ISCOMs), cytokine adjuvants, MF59 adjuvant, lipid adjuvants, mucosal adjuvants, certain bacterial exotoxins and other components, certain oligonucleotides, PLG, and others. These adjuvants may be used in the compositions and methods described herein.
  • the composition comprises at least one Chlamydial MOMP protein (produced in accordance to the methods of the invention), and an adjuvant, characterized in that the adjuvant comprises at least:
  • oil-in-water emulsion comprising at least squalene, an aqueous solvent, a polyoxyethylene alkyl ether hydrophilic nonionic surfactant, a hydrophobic nonionic surfactant, wherein said oil-in-water emulsion is obtainable by a phase inversion temperature process and wherein 90% of the population by volume of the oil drops has a size less than 200 nm, and optionally less than 150 nm;
  • TLR4 agonist such as for example, the product E6020 having CAS Number 287180-63-6.
  • WO2007006939 Vaccine Composition Comprising a Thermoinversable Emulsion
  • the product E6020 is described in US2007/0082875 (which is incorporated herein by reference in its entirety).
  • the immunogenic composition includes at least one Chlamydia outer membrane protein made in accordance to the methods described herein with or without an adjuvant.
  • the immunogenic composition may include MOMP from at least one serovar of a Chlamydia species (e.g. , C. trachomatis) and preferably, it includes MOMP from at least two or at least three or more serovars of a Chlamydia species.
  • the immunogenic composition prevents infection in a subject by inducing functional antibodies and appropriate CD4 and CD8 T-cell responses.
  • the composition elicits appropriate functional antibodies and IFN- ⁇ producing CD4 T-cells (analogous to a Thl type response in mice).
  • the immunogenic compositions of the present invention are preferably in liquid form, but they may be lyophilized (as per standard methods) or foam dried (as described in WO2009012601, Antigen-Adjuvant Compositions and Methods).
  • a composition according to one embodiment of the invention is in a liquid form.
  • An immunization dose may be formulated in a volume of between 0.5 and 1.0 ml.
  • Liquid formulations may be in any form suitable for administration including for example, a solution, or suspension.
  • the pH of the formulation (and composition) is preferably between about 6.4 and about 9. More preferably, the pH is about 7.4.
  • the pH may be maintained by the use of a buffer.
  • the pharmaceutical formulations of the immunogenic compositions of the present invention may also optionally include one or more excipients (e.g., diluents, buffers, preservatives, detergents and/or immunostimulants) which are well known in the art. Suitable excipients are compatible with the antigen and with the adjuvant as is known in the art. Examples of detergents include a Tween (polysorbate) such as Tween 80.
  • excipients e.g., diluents, buffers, preservatives, detergents and/or immunostimulants
  • Suitable excipients are compatible with the antigen and with the adjuvant as is known in the art.
  • detergents include a Tween (polysorbate) such as Tween 80.
  • the immunogenic compositions of the invention find use in methods of preventing or treating a disease, disorder condition or symptoms associated with Chlamydia.
  • the terms disease disorder and condition will be used interchangeably herein.
  • the prophylactic and therapeutic methods comprise administration of a therapeutically effective amount of a pharmaceutical composition to a subject.
  • methods for preventing or treating Chlamydia are provided.
  • preventing a disease or disorder is intended to mean administration of a therapeutically effective amount of a pharmaceutical composition of the invention to a subject in order to protect the subject from the development of the particular disease or disorder associated with Chlamydia.
  • a disease or disorder is intended administration of a therapeutically effective amount of a pharmaceutical composition of the invention to a subject that is afflicted with a disease caused by Chlamydia or that has been exposed to Chlamydia where the purpose is to cure, heal alleviate relive alter remedy ameliorate improve or affect the condition or the symptoms of the disease.
  • a therapeutically effective amount refers to an amount that provides a therapeutic effect for a given condition and administration regimen.
  • a therapeutically effective amount can be determined by the ordinary skilled medical worker based on patient characteristics (e.g., age, weight, gender, condition, complications other diseases). The therapeutically effective amount will be further influenced by the route of administration of the composition.
  • one skilled in the art can readily determine the appropriate dose, frequency of dosing and route of administration. Factors in making such determinations include, without limitation, the nature of the protein to be administered, the condition to be treated, potential patient compliance, the age and weight of the patient and the like.
  • the immunogenic preparations and vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective (i.e., protective against Chlamydial infection).
  • the quantity to be administered is subject dependent, including for example the capacity of the individual's immune system to synthesize antibodies to the composition and produce a cell -mediated immune response.
  • Suitable dosage ranges are readily determinable by one skilled in the art and may be of the order of about 1 ⁇ g to about lmg of the soluble, immunogenic recombinant protein (e.g., rMOMP). Suitable regimes for initial administration and booster doses are also variable but may include an initial administration followed by subsequent administration. The dosage may also depend on the route of administration and will vary according to the size of the subject.
  • the invention also provides compositions including antigenic material of several pathogens (combined vaccines). Such combined vaccines contain for example material from various pathogens or from various strains of the same pathogen, or from combinations of various pathogens.
  • the present invention provides methods of inducing anti-chlamydial immunity by administering the immunogenic compositions provided, either alone or in a prime boost protocol.
  • An anti-chlamydial immune response can be defined as a reduction in bacterial load in the immunized host upon challenge with live chlamydia, and/or administration of protective levels of IFN- ⁇ in the host cells.
  • Immunogenic compositions may be presented in a kit form comprising the immunogenic composition and an adjuvant or a reconstitution solution comprising one or more pharmaceutically acceptable diluents to facilitate reconstitution of the composition for administration to a mammal using conventional or other devices.
  • a kit would optionally include the device for administration of the liquid form of the composition (e.g. hypodermic syringe, microneedle array) and/or instructions for use.
  • the present disclosure also provides methods of eliciting an immune response in a subject by administering the immunogenic compositions, or formulations thereof, to subjects.
  • This may be achieved by the administration of a pharmaceutically acceptable formulation of the compositions to the subject to effect exposure of the immunogenic polypeptide and/or adjuvant to the immune system of the subject.
  • the administrations may occur once or may occur multiple times.
  • the one or more administrations may occur as part of a so-called "prime- boost" protocol.
  • Compositions of the invention can be administered by an appropriate route such as for example, percutaneous (e.g. , intramuscular, intravenous, intraperitoneal or subcutaneous), transdermal, or mucosal (e.g.
  • intranasal in amounts and in regimes determined to be appropriate by those skilled in the art.
  • Exposure of the subject to the compositions disclosed herein may result in establishment of a temporary or permanent immune response in the subject.
  • the immune response may protect the subject from subsequent exposure to the antigen, often by subsequent exposure to an infectious agent from which the antigen was derived. Therapeutic effects may also be possible.
  • compositions may be administered in dosage unit formulations containing conventional pharmaceutically acceptable carriers and vehicles.
  • pharmaceutically acceptable carrier refers to one or more formulation materials suitable for accomplishing or enhancing the delivery of a protein or polypeptide as a pharmaceutical composition.
  • a pharmaceutical composition is a composition comprising a therapeutically effective amount of a polypeptide or protein.
  • effective amount and “therapeutically effective amount” each refer to the amount of a polypeptide or protein used to induce or enhance an effective immune response. It is preferred that compositions of the present invention provide for the induction or enhancement of an immune response in a host which protects the host from the development of an infection or allows the host to eliminate an existing infection from the body.
  • compositions and vaccines disclosed herein may also be incorporated into various delivery systems.
  • the compositions may be applied to a "microneedle array” or "microneedle patch” delivery system for administration.
  • These microneedle arrays or patches generally comprise a plurality of needle-like projections attached to a backing material and coated with a dried form of a vaccine. When applied to the skin of a subject, the needle-like projections pierce the skin and achieve delivery of the vaccine, effecting immunization of the subject.
  • compositions of the invention can be administered as the sole active pharmaceutical agent, they can also be used in combination with one or more other compositions or agents (i.e. , other chlamydial antigens, co-stimulatory molecules, adjuvants).
  • other compositions or agents i.e. , other chlamydial antigens, co-stimulatory molecules, adjuvants.
  • the individual components can be formulated as separate compositions administered at the same time or different times, or the components can be combined as a single composition.
  • This Example describes the cloning of the MOMP gene (and MOMP gene fragments) from the C. trachomatis mouse pneumonitis strain (MoPn), a natural murine pathogen.
  • MOMP DNA sequence (full-length but lacking the signal peptide) was amplified from genomic DNA of Chlamydia MoPn with primers containing Ndel and Xhol sites (SEQ ID NOs. 1 and 2) .
  • the resulting PCR product was digested with Ndel and Xhol and ligated into Ndel and Xhol digested and dephosphorylated pET24b(+).
  • the ligation mixture was transformed into chemically competent E. Coli DH5a and positive clones were selected by plating on Luria agar containing 5C ⁇ g/ml kanamycin.
  • Single colonies were cultured overnight in Luria Broth containing 5C ⁇ g/ml kanamycin and plasmid DNA was isolated using a QIAprep Spin Miniprep Kit. Ndel/ Xhol digests were performed to determine which clones had the correct fragment. Clone pKNE38 had the correct size fragment and an aliquot was sent for DNA sequence analysis, confirming the correct MOMP DNA sequence (and the predicted amino acid sequence of inserted coding sequence is set out as SEQ ID NO:3). Plasmid DNA from pKNE38 was transformed into chemically competent E. Coli BL21(DE3) cells using heat shock. Protein expression was assessed by culturing a single colony and inducing expression with 1 mM IPTG. Glycerol stocks were made from the overnight culture of this material for subsequent use. SDS-PAGE and Western analysis were used to identify protein expressed.
  • Primer No.1 A GAA TCA GTC ACA TAT GCT GCC TGT GGG GAA TCC TGC (SEQ ID NO: 1)
  • Example IB Recombinant Cloning of MOMP from human afflicting serovars of C.
  • This Example describes the cloning of MOMP from C. trachomatis serovars that afflict humans.
  • the rMOMP cloned as described below were used in various studies, as described in the examples that follow.
  • the nucleotide sequence of full-length MOMP (but lacking signal sequence) was amplified from genomic DNA of C. trachomatis serovar D strain UW-3/Cx , and the resulting PCR product was digested and ligated into pET24b(+). The ligation mixture was transformed into chemically competent E. Coli DH5a and positive clones were selected and single colonies were cultured overnight. Plasmid DNA was isolated using a QIAprep Spin Miniprep Kit. A single clone was selected and DNA sequence analysis, confirmed the presence of the correct MOMP DNA sequence (SEQ ID NO: 9). The predicted amino acid sequence of the insert is SEQ ID NO: 8. Plasmid DNA from the clone was transformed into chemically competent E. Coli BL21(DE3) cells and MOMP protein expression was induced with ImM IPTG, confirmed by SDS-PAGE and Western analysis (and was considered sufficient for downstream protein purification).
  • MOMP was cloned in a substantially similar manner from serovars E, F, J and la. Corresponding DNA and amino acid sequences for cloned serovar E, F, J and la rMOMP proteins are set out below. For serovars J and la, Primer Nos. 2A and 2B were utilizing for cloning. The primers utilized for cloning of MOMP from serovars E and F are provided below. Sequencing of cloned proteins from all serovars was done using the T7 and 7294. BB primers.
  • T7 TAA TAC GAC TCA CTA TAG GG (SEQ ID NO: 4)
  • Primer No.2A GCA TGA CAT ATG CCT GTG GGG AAT CCT GC
  • Primer No. 2B CGA TCG GGA TCC TTA GAA GCG GAA TTG TGC ATT TAC (SEQ ID NO:7)
  • JL CCTGTGGGGAATCCTGCTGAA (SEQ ID NO: 18)
  • JL TTTGGGTCGACCTATTAGAAGCGGAATTGTGCATTTACGTGA ( SEQ ID NO: 19)
  • MOMP-RK GGGGTACCCTATTAGAAGCGGAATTGTGCATTTACGTGA (SEQ ID NO: 21)
  • This example illustrates one embodiment of the process for purification and refolding of recombinant MOMP for immunization.
  • MOMP protein derived from the mouse pneumonitis strain (MoPn) and two human serovars (serovars D and E) of C. trachomatis were each independently expressed in E. coli, grown in fermenters, and subjected to a purification and folding procedure.
  • a schematic diagram of the method is set out in Figure 1 and is described further below.
  • This embodiment of the purification and refolding process of the present invention uses, for illustrative purposes, MOMP cloned from serovar D of C. trachomatis .
  • E. coli cells expressing recombinant serovar D of C. trachomatis MOMP were grown in a shake flask at 37°C overnight, after which the culture is used to inoculate a 20L fermenter with an initial OD of 0.5.
  • the fermentation was carried out under the following conditions: 37 °C, pH 6.8, 30% dissolved oxygen, 700-1200 rpm agitation. Fermentation was carried out in a fed-batch mode using a pH- stat method. Glucose was fed into the fermenter to maintain a glucose concentration between 0 to 2 g/L.
  • the culture was induced with ImM IPTG, and then grown for 4-6 hours.
  • the final fermenter OD reached approximately 30-40.
  • the fermenter broth was harvested and concentrated using 0.2 ⁇ tangential flow filtration (TFF) unit.
  • Cell disruption was performed at 13000 psi using a homogenizer.
  • a centrifugation step was followed by homogenization to remove most impurities and to reduce viscosity of the homogenate.
  • lysozyme was added to the thawed broth following centrifugation.
  • the inclusion bodies IBs; sedimentable detergent insoluble MOMP of a purity of about 50 %) were then washed with buffer containing Triton X-100.
  • the IB pellets were solubilized in 6M guanidine hydrochloride (a charged denaturant) and following solubilization, this denaturant was exchanged with 8M urea (a non-charged denaturant) using tangential flow filtration (TFF).
  • the urea solution was applied to a chromatography column containing a Q-type anion exchange material column (Q Ceramic HyperD® 20 Chromatography Sorbent, Pall Corporation).
  • the running, washing, and elution buffers used also contained about 8 M urea at a pH of about 8.5 (pH range 7.5 to 9.0) to maintain the protein denatured and soluble throughout the purification procedure.
  • the recombinant MOMP protein was eluted from the column with 50-90 mM sodium chloride. The purity of the resulting protein was evaluated by SDS-PAGE (see Figure 2). Protein gel densitometry following Coomassie staining indicated a purity of approximately 90% or greater.
  • TFF TFF
  • the pooled eluate from the chromatography step was mixed with equal volumes of about 10% v/v of the detergent sodium N-lauroyl sarcosine (NLS) (range for NLS is about 6 to 10% v/v), and 1 M 1-arginine; DTT was added to a final concentration of 10 mM.
  • NLS detergent sodium N-lauroyl sarcosine
  • DTT was added to a final concentration of 10 mM.
  • This mixture was then subjected to TFF diafiltration using a 10 kDa MWCO membrane filter, in which the replacement
  • the above-described purification and folding method was also applied to rMOMP derived from MoPn and to rMOMP derived from C. trachomatis serovar E, with similar results. This method may also be applied to rMOMP derived from the other C. trachomatis serovars (e.g. F, la, and J) and from serovars of C. pneumoniae.
  • C. trachomatis serovars e.g. F, la, and J
  • the rMOMP derived from MoPn demonstrated immunological protection in at least one animal study using a mouse protection model, and recognition of at least one conformational epitope by a monoclonal antibody that specifically recognizes native MOMP.
  • This example describes an alternative process for preparing rMOMP from C. trachomatis serovars D, E, F, J and la using Urea and pH shock (as a denaturing agent rather than guanidine hydrochloride) and a reduced concentration of NLS.
  • rMOMP was cloned from each of serovar in substantial accordance with the teaching set out in Example IB.
  • IB fractions/pellets were prepared in substantial accordance with the teaching set out in Example 2 and were then subjected to the purification and folding process described further below.
  • the IB fraction/pellet was mixed at a ratio of 20 mL/g wet weight with a solubilization buffer containing about 25 mM KCl, 25 mM NaOH, 8 M urea at a pH of approximately 12.5. The pH of the mixture was adjusted following re-suspension of the pellet to about 12.5. Following incubation at room temperature, the mixture was subjected to centrifugation (10397 g, 4°C). The supernatant, containing solubilized rMOMP, was mixed with an equal volume of buffer (50 mM Tris-HCl pH 7.0 and 8M urea), and the pH was adjusted with 6 N HC1 to pH 8.5. DTT was added to achieve a concentration of 10 mM.
  • a solubilization buffer containing about 25 mM KCl, 25 mM NaOH, 8 M urea at a pH of approximately 12.5. The pH of the mixture was adjusted following re-suspension of the pellet to about 12.5. Following incuba
  • Conductivity was reduced to 2.0-2.5 mS by dilution with a buffer of 50 mM Tris-HCL (pH 8.5), 8 M urea, 1 mM EDTA and the solution was then filtered. Chromatographic operations were carried out using an AKTA Explorer 100 (G.E. Healthcare) chromatography unit with a column packed with Pall BioSepra Q Ceramic HyperD F anion exchange sorbent.
  • NaCl sodium chloride
  • Refolding procedure involved the reduction of rMOMP 's disulfide bonds with DTT (e.g., by adding about lOmM DTT), the addition of the small molecule additive 1-arginine, (e.g. about 333 mM), and the addition of the small molecule additive (and detergent) n-lauroyl sarcosine (NLS), (e.g. about 2% NLS).
  • DTT e.g., by adding about lOmM DTT
  • the small molecule additive 1-arginine e.g. about 333 mM
  • NLS n-lauroyl sarcosine
  • TFF was operated in the diafiltration mode for approximately five volumes of Tris buffer.
  • Protein concentration was estimated by micro BCA assay. Endotoxin was assessed (Endo safe; Charles River Labs) and NLS content was estimated spectrophotometrically using a wavelength of 210 nm. SDS-PAGE gel protein analysis with scanning densitometry was used to assess for protein purity, and protein conformation was assessed by Blue Native PAGE (representative gels are provided in Figures 3,6A,B,C).
  • outer membrane proteins e.g. , MOMP
  • outer membrane proteins e.g. , MOMP
  • pH shock i.e., pH shock
  • reducing the NLS concentration in the refolding process to a final concentration of 2% does not adversely effect the refolding process and results in a final protein product with a reduced concentration of residual NLS (e.g., ⁇ 0.5).
  • This example describes a process utilized for preparing pilot scale lots of rMOMP from C.
  • Preceding examples have related to lab scale lot processes. Such processes are at a scale sufficient to provide a protein preparation sufficient for characterization and animal studies and typically, start with 6-12 g of MOMP IB material. For pilot scale lots, the MOMP production process is sufficiently scaled up such that 50% of the product of a 20 L fermenter run can be processed in one series of unit operations.
  • Example IB C. trachomatis Serovar E rMOMP was cloned in substantial accordance to the procedure set out in Example IB.
  • An inclusion body fraction of the protein was prepared substantially in accordance with the procedure set out in Example 2 except that fermentation was conducted using a 20L fermenter.
  • the IB fraction/pellet was mixed in a solubilization buffer (of 25 mM KCl, 25 mM NaOH and 8 M urea at pH 12.5) at a ratio of approximately 20 mL/g wet weight of IB pellet.
  • the mass of Ser E MOMP IB pellet used was about 118.5 g.
  • the pH was adjusted with NaOH following re-suspension of the pellet to about 12.5, and the mixture was incubated at room temperature with gentle agitation for 40 min. Following incubation, the mixture was subjected to centrifugation (10397 g, 20 min, 4°C).
  • the conductivity of the solution was checked with a conductivity meter, and was reduced to 2.0-2.5 mS by dilution with 50 mM Tris-HCL pH 8.5, 8 M urea, 1 mM EDTA.
  • the solution was filtered through a dead end 0.22 um filter; the final volume was 5.5 L.
  • Chromatographic operations were carried out using an AKTA Pilot (G.E. Healthcare) chromatography unit with a column (BPG100, G.E. Healthcare) packed with Pall BioSepra Q Ceramic HyperD F anion exchange sorbant.
  • the column was washed, regenerated, and equilibrated as previously described at the lab scale (as described in Example 3).
  • the flow rate for all operations, unless noted otherwise, was 160 mL/min.
  • 5 L of the starting material was loaded onto the column.
  • the chase volume (with equilibration buffer) was about 4 CV, and this was followed by a wash step at about 5 CV with equilibration buffer to which was added NaCl to 25 mM.
  • a suitable range of NaCl concentration in wash buffer is 20 mM - 40 mM and a preferred concentration is 20 mM NaCl.
  • Elution was performed with 4.5 CVs equilibration buffer containing 75 mM NaCl.
  • a suitable range of NaCl concentration in elution buffer is 40 mM - 90 mM and a preferred concentration is 40 mM NaCl.
  • MOMP folding procedure The purified rMOMP was treated with DTT, arginine, and NLS, followed by a two part TFF operation which induces folding and reduces residual NLS detergent.
  • the refolding procedure involved the reduction of rMOMP's disulfide bonds with DTT (e.g., about lOmM DTT), the addition of the molecular chaperone, 1-arginine, (e.g. about 333 mM), and the addition of the detergent n-lauroyl sarcosine (NLS), (e.g. about 2% NLS).
  • DTT e.g., about lOmM DTT
  • 1-arginine e.g. about 333 mM
  • NLS detergent n-lauroyl sarcosine
  • the MOMP-arginine-NLS mixture (7.5L) was then subjected to the two-part TFF operation, substantially as described in Example 3. Volume reduced 3 fold to 2.5L with filtrations. Diafiltration ensued for 7 volumes, using a diafiltration buffer consisting of 50 mM Tris-HCL pH 8. The solution was then diluted 1 :3 (to 7.5L) with 50 mM Tris-HCL pH 8, then another 7 volume diafiltration step with the diafiltration buffer containing 0.1% v/v NLS. Following the second diafiltration, the material was concentrated to 1.2L and EDTA (ImM) was added.
  • ImM EDTA
  • the TFF operations had a total elapsed time of ⁇ 2.5 h, similar to the target time established for lab scale (2-4 h).
  • Previous investigations found that prolonged TFF folding, originally adopted to reduce shear forces and provide a gentler environment, was in fact deleterious to the folding attempt, in which the development of aggregated protein as indicated by BN-PAGE gel analysis occurred.
  • the folding process was considered successful if the resulting protein product was soluble in aqueous buffers at > lmg/mL, and the characteristic ladder pattern in BN-PAGE gels was evident.
  • the presence of discrete bands of MOMP protein over a range of molecular weights is indicative of multimeric units (somewhat analogous to the putative trimeric state found with the native protein).
  • Figure 3 illustrates BN-PAGE gel patterns with the pilot scale lot and three lots of lab scale Ser E rMOMP protein. Patterns are similar, with the presence of a ladder consisting of at least four bands of similar apparent molecular weight. Additionally, there is little evidence of monomelic rMOMP, normally seen just below the 66 kDa marker (not shown).
  • the purity of the final protein product was assessed by scanning densitometry of SDS- PAGE gels.
  • Figure 4 shows an image of an SDS-P AGE purity gel for the pilot Ser E lot. Protein purity was assessed as approximately 88% by scanning densitometry, with a low molecular weight band accounting for 6% of the total protein. The percentage assessed may be an underestimate of MOMP purity as putative MOMP related bands (fragments, complexes) on the gel were not identified.
  • endotoxin content was 0.005 EU ⁇ g protein
  • residual NLS was 0.49% (i.e., approximately 0.24% at 1 mg/mL).
  • Example IB C. trachomatis rMOMP was cloned from serovar E in substantial accordance with the teaching set out in Example IB.
  • IB fraction/pellet of the recombinant protein was prepared in substantial accordance with the teaching set out in Example 2.
  • a wash buffer was prepared consisting of 50 mM Tris-HCl pH 8.0, 2 M Urea, 0.5% v/v/ NLS. Thawed IB material was mixed with NLS buffer at 20 mL per IB gram for approximately 30 minutes. The IB mixture was divided equally into centrifuge bottles and then centrifuged. The supernatant was decanted and the pellet (with the target protein) was retained and was subjected to a purification and folding process in substantial accordance to the teaching in Example 3.
  • Protein concentration was estimated by BCA assay and purity was assessed by SDS- PAGE with scanning densitometry. A number of lab scale lots were similarly prepared using an IB fraction wash buffer with either 0.5% NLS or 0.5% Triton X-100, and 2 or 4 M urea.
  • An IB fraction prepared in substantial accordance with the teaching of Example 2 was divided into multiple samples. One sample of the IB fraction was subjected to a purification and folding process in substantial accordance to the method described in Example 3. A second sample of the IB fraction was first washed (in substantial accordance to the method described above in this Example) and was then subjected to substantially the same purification and folding process as was the first sample of the IB fraction except that the NaCl concentration in the wash buffer and the elution buffer was increased from 15 mM to 20 mM and 30 mM to 40 mM, respectively.
  • Protein concentration and purity of the resulting purified and folded protein product from each of samples 1 and 2 was estimated by BCA assay and SDS-PAGE with scanning densitometry, respectively.
  • the resulting SDS-PAGE gels are illustrated in Figure 5.
  • the left panel illustrates a gel with samples (run in three lanes) from the first preparation and the right panel illustrates a gel with three lanes loaded with samples from the second preparation. In both gels, lanes are loaded in triplicate with 4 ⁇ g of protein.
  • the purity of the resulting material was approximately 75% whereas with the second preparation, protein purity was approximately 98%.
  • a number of lab scale and pilot scale lots have been prepared using the additional IB buffer wash and increased NaCl concentration and similar increases in protein purity have been noted (with an average increase in protein purity was about 10%, and providing protein with a purity as high as 100%).
  • This example describes the evaluation of the immunogenicity of the rMOMP (purified and refolded in accordance to the process of the present invention) in an animal model.
  • Recombinant MOMP derived from C. trachomatis serovar E was prepared in substantial accordance with the teaching of Example 4.
  • Each dose of immunization contained 5C ⁇ g of rMOMP protein and adjuvant [i.e., ADJ.A, ADJ.SQ, aluminum hydroxide (Alhydrogel), Montanide/CpG] in a volume of 50 ⁇ 1.
  • Blood samples were taken periodically following immunization in order to conduct a number of tests, including detection of anti-Chlamydia antibodies by ELISA, quantification of total IgG and Thl/Th2 sub-typing.
  • mice Female BALB/c mice (15 per group) (Charles River) were immunized intramuscularly three times, at approximately 3 week intervals with 50 ⁇ 1 of the applicable composition (as noted in Table 4). The mice were approximately 7-8 weeks of age at the time of the 1 st immunization. As a control, 4 groups were administered compositions of adjuvanted Ovalbumin. Pre-bleed samples were obtained approximately 4 days before the first immunization.
  • Table 4 Vaccine component and volume to inoculate per mouse
  • Formulations were freshly prepared before each immunization. Antigens, buffers and adjuvants were stored at 4°C. First, antigen (i.e. , Ovalbumin or rMOMP) 15 ⁇ g/dose was diluted in buffer 50 mM Tris, pH 8.0, 0.1% NLS (30 ⁇ 1 ⁇ 1 ⁇ 8 ⁇ ). To this mixture the applicable adjuvant was added, plus buffer when necessary to obtain an immunization dose of 50 ⁇ 1.
  • antigen i.e. , Ovalbumin or rMOMP
  • Aluminum adjuvant used is the one called Alhydrogel which is aluminum oxyhydroxyde or AIOOH, at a concentration of 9.9 mg/ml.
  • the final quantity of aluminum in the immunization doses is 50 ⁇ g/dose
  • Adjuvant A (AD J. A) was prepared as follows: In a 1st container, the following ingredients were mixed, under agitation and at 40°C: 39.37g of Phosphate Buffer, (Eurobio); 4.68g of mannitol, (Roquette); 4.822g of EumulginTM B l, (Cognis); and 20.3 mg of E6020 (Eisai). This aqueous phase had a weight of 48.91g. In a 2nd container, 30.48g of squalene were mixed with 4.52g of Montane TM80 under agitation at ambient temperature. This oily phase had a weight of 35g.
  • thermoreversible oil- in-water emulsion in which more than 90% of the population by volume of the oil droplets had a size ⁇ 200nm and in which the composition by weight was as follows: 32.5% of squalene, 6.18% of ceteareth-12 (EumulginTMB l), 4.82% of sorbitan monooleate (MontaneTM80), 6% of mannitol, 0.026% of E6020 and 50.5% of PBS.
  • This stock solution was then diluted at 1/5 with phosphate buffer (IX) to obtain an emulsion having 6.5% squalene.
  • antigen samples 10 ⁇ g of antigen suspended in 25 ⁇ buffer
  • volume of composition inoculated was 50 ⁇ .
  • the second Adjuvant, ADJ.SQ was prepared from a stock solution prepared as ADJ.A's with the exception that no E6020 was included. As such, the stock solution of ADJ.SQ was diluted at 1/6.5 with PBS to get an emulsion comprising 5% squalene.
  • mice were euthanized and their spleens removed aseptically. Single cell suspensions were prepared. Splenocytes from mice belonging to the same group were pooled and were pelleted by centrifugation. Erythrocytes in the suspension were lysed. The cell suspension was transferred to another tube and centrifuged to pellet the cells. Process was repeated to ensure that most of the erythrocytes were lysed. The cell pellet was resuspended, cells were counted and plated. Cells were stimulated with Ovalbumin, rMOMP, UV-inactivated C. trachomatis MoPn EB MOMP, or PMA.
  • Thl/Th2 responses were analyzed by quantifying the antigen-specific IgG2a (Thl) and IgGl (Th2) antibody response and by measuring levels of cytokines (e.g., IFN- ⁇ (Thl), interleukin-10 (Th2) in antigen-stimulated splenocyte culture (i.e. , by assaying in vitro cytokine production by splenic T cells).
  • cytokines e.g., IFN- ⁇ (Thl), interleukin-10 (Th2) in antigen-stimulated splenocyte culture (i.e. , by assaying in vitro cytokine production by splenic T cells).
  • the immunogenic composition with unadjuvanted rMOMP was weakly immunogenic and of the IgG classes tested, solely IgGl was detectable.
  • the carrier Aluminum hydroxide was not an effective adjuvant for rMOMP.
  • Adjuvanting rMOMP with the other carrier, ADJ.SQ elicited strong immune responses (i.e., total IgG) but the response was pre-dominantly a Th2 type, not a Thl/Th2 balanced response (e.g., no detectable IgG2a was elicited).
  • Adjuvanting rMOMP with ADJ.A an adjuvant comprising E6020 or CpG/Montanide elicited strong immune responses with balanced Thl/Th2 subclasses, at comparable levels.
  • ADJ.A switched the immune profile induced by un-adjuvanted rMOMP from an IgGl only, to a balanced Thl/Th2 antibody response.
  • the capacity of the sera from immunized mice to neutralize C. trachomatis serovar E was assessed with an in vitro neutralization assay against serovar E EBs.
  • the in vitro neutralization assay was performed substantially as follows: The assay utilized 96 well round bottom plates. Dilutions of each serum sample were prepared using PBS and 5% baby rabbit complement (Sigma). Into each dilution sample well, 1500 IFU/50 ⁇ of EBs from C. trachomatis (diluted in PBS + 5% baby rabbit complement just prior to use), was added and the mixtures were incubated at 37°C for 45 minutes with gentle rocking.
  • a 96 well plate containing a HeLa cell monolayer (of HeLa cells seeded at 5 x 104 cells/well, about 24 hours earlier) was prepared and 50 ⁇ 1 of each dilution sample was transferred to sample wells in the HeLa cell monolayer plate. The plate was centrifuged for 60 minutes at room temperature at 1800 rpm. DMEM with L-glutamine and sodium pyruvate (Invitrogen) supplemented with 1 ⁇ g/ml cyclohexamide, 10% FBS, gentamicin was added to each sample well and plates were incubated at 35°C with 5% C02 for 44-48 hours. As controls, dilutions of EBs alone and dilutions of PBS + 5% baby rabbit complement sera alone were also prepared and added to specific wells of the HeLa cell plate.
  • Inclusion bodies were stained and the 50% neutralization titre was determined by calculating the value of percent neutralization for each of the sample dilutions by applying the formula, (IFU prebleed - IFU bleed)/IFU prebleed x 100. Alternatively, the value could be determined by taking the average of the control samples with EBs alone in place of prebleed IFU. For each sample, the 50% neutralization titre was the lowest dilution with a value greater or equal to 50% (e.g., if a 1 :400 dilution had 71% neutralization and a 1 : 800 had 34% neutralization, the 50% neutralization titre of that sample was 400). A summary of the results obtained are set out in Table 5.
  • compositions comprising rMOMP and ADJ.A comprising E6020.
  • strong antibody responses of predominantly IgGl subclass
  • mice immunized with compositions comprising rMOMP and ADJ.SQ the sera from these mice had no detectable neutralizing capacity.
  • those including rMOMP adjuvanted with ADJ.A or CpG/Montanide stimulated neutralizing antibodies to serovar E.
  • Immunogenic compositions comprising rMOMP (2 different doses) adjuvanted with Adjuvant No. l (ADJ.A) with varying concentrations of a TLR4 agonist (E6020), were evaluated in an animal model.
  • Recombinant MOMP derived from C. trachomatis serovar E was prepared in substantial accordance with the teaching of Example 4.
  • Groups of female CDI mice (6 to 12 per group) (Charles River) were immunized intramuscularly on three separate occasions (at about 3 week intervals) with 50 ⁇ 1 of the applicable composition (as noted in Table 7).
  • Two doses of antigen (rMOMP) were used, 10 ⁇ g and 25 ⁇ g.
  • E6020 were tested at 3 doses, 0.25 ⁇ g, 0 ⁇ g and ⁇ g.
  • a group of mice was also tested with one carrier alone, this being the group with ADJ.SQ considered as 0 ⁇ g of E6020.
  • CD l is an outbred strain, in contrast to Balb/C which is an inbred strain.
  • mice were approximately 7-8 weeks of age at the time of the 1 st immunization.
  • groups E and F were administered compositions of adjuvanted Ovalbumin. Pre-bleed samples were obtained a few days before the first immunization.
  • Table 7 Vaccine component and volume to inoculate per mouse
  • Formulations were freshly prepared before each immunization. Proteins, buffers and adjuvant were stored at 4°C. Mixtures were prepared by diluting protein (Ovalbumin or rMOMP) in buffer (50mM Tris, pH 8.0, 0.1% NLS), 25 ⁇ 1 ⁇ 1 ⁇ 8 ⁇ and then adding to this mixture the applicable adjuvant. Mixtures including E6020 were vortexed on high for about lmin. Prepared formulations were placed on ice until required.
  • ADJ.SQ was prepared as previously described in Example 6.
  • ADJ.A was prepared as described in Example 6, and diluted by ADJ.SQ to reach the requisite concentration of E6020. This means that for Groups B, F and H, the ADJ.A used was the same as the one described in Example 6 having 5% squalene and 40 ⁇ g/ml of E6020.
  • the ADJ.A used is the same as the one used for the preceding group which has been diluted once at 1 ⁇ 2 with ADJ.SQ to have a concentration of E6020 of 20 ⁇ g/ml.
  • ADJ.A used has been diluted once more at 1 ⁇ 2 by ADJ.SQ to have a concentration of E6020 which is 10 ⁇ g/ml.
  • One mouse from group F3 was found dead 2 days following the 2nd immunization (and was bled out). Sera was collected from immunized animals about 2 weeks post-immunization and was pooled for each group to assess antibody response by ELISA.
  • mice were euthanized and their spleens removed aseptically. Single cell suspensions were prepared. Splenocytes from mice belonging to the same group were pooled. The splenocytes were restimulated in vitro with rMOMP (or as a control, with Ovalbumin, rMOMP, UV-inactivated C. trachomatis MoPn EB-MOMP, or PMA) for 3 days. The culture supernatants were collected and the cytokine production was measured for IFN- ⁇ , IL-4, IL-5, and IL-10 by MSD. Isotyping analysis of the antibody profile generated was done using ELISA based reagents.
  • Thl/Th2 responses were analyzed by quantifying the antigen-specific IgG2a (Thl) and IgGl (Th2) antibody response and by measuring levels of cytokines (e.g., IFN- ⁇ (Thl), interleukin-10 (Th2) in antigen-stimulated splenocyte culture (i.e. , by assaying in vitro cytokine production by splenic T cells).
  • cytokines e.g., IFN- ⁇ (Thl), interleukin-10 (Th2)
  • compositions of rMOMP adjuvanted with ADJ.SQ i.e., lacking the TLR4 agonist, E6020
  • elicited levels of total IgG including IgGl and IgG2 subclasses
  • total IgG including IgGl and IgG2 subclasses
  • the neutralizing capacity of the anti-sera was lower in comparison to anti-sera elicited by compositions comprising rMOMP adjuvanted with ADJ.A.
  • ADJ.SQ compositions stimulated a Th2-biased immune response (i.e., elicited high levels of Th2 cytokines and low levels of IFN- ⁇ ).
  • a TLR4 agonist e.g., E6020
  • Immunogenic compositions comprising rMOMP adjuvanted with ADJ.A produced by one of several different processes.
  • Groups of female CDI mice (10 per group) were immunized intramuscularly on three separate occasions (at about 3 week intervals) with 50 ⁇ 1 of formulations comprising either 1 or 10 ⁇ g of rMOMP, and having ⁇ g of E6020 with the carrier comprising a squalene emulsion.
  • the adjuvant was prepared in one of several different ways: either the product E6020 was introduced in the aqueous phase before the emulsification took place, or it was introduced in the oily phase, or even in some cases, it was simply added to the emulsion.
  • the adjuvant effect of E6020 in the rMOMP composition was similar irrespective of which of the three preparation methods was utilized.
  • the three adjuvants tested elicited similar levels of antigen-specific total IgG, with both IgGl and IgG2a subclasses, similar in vitro neutralizing capacity and similar cytokine production profiles.
  • This example is related to immunogenic compositions comprising a TLR4 agonist (e.g., E6020) and aluminum hydroxide as a carrier.
  • a TLR4 agonist e.g., E6020
  • aluminum hydroxide e.g., aluminum hydroxide
  • Groups of female CDI mice (10 per group) were immunized intramuscularly on three separate occasions (at about 3 week intervals) with 50 ⁇ 1 of formulations comprising 10 ⁇ g of rMOMP and one of several adjuvants (i.e., ADJ.SQ, ADJ.A, Alum (aluminum hydroxide), and ADJ.B (an adjuvant comprising a TLR4 agonist (E6020) + Alum (aluminum hydroxide))).
  • Immunization doses were prepared by mixing 25 ⁇ of the antigen solution (rMOMP in buffer (50mM Tris pH 8.0 + 0.1% NLS)) with 25 ⁇ 1 of adjuvant.
  • the adjuvant, ADJ.B (comprising E6020 and Alum) was prepared in the following manner:
  • Powder E6020 (EISAI) was diluted in ethanol to reach a concentration of about 12 mg/ml. ⁇ of this solution was then added to 1.9ml of water which was maintained under agitation. The aqueous solution was then filtered and mixed with buffer PBS (10X) (9 volume of E6020 solution for 1 volume of PBS (10X) to get an aqueous solution of E6020 (with some ethanol) at about 0.5mg/ml. To a Peni flask with 120 ⁇ 1 of this aqueous E6020 solution and 930 ⁇ of PBS (IX) was added 450 ⁇ of an aqueous suspension of AIOOH at a concentration of 8 mg/ml. This mixture was homogenized and vortexed for 10 seconds. The prepared adjuvant comprised 2.4mg/ml of Aluminum and 40 ⁇ g/ml of E6020.
  • ADJ.SQ and ADJ.A adjuvants used in this example were prepared substantially as described in Example 6.
  • Example 6 Collection of sera and splenocytes was done substantially as described in Example 6 and measurement of cytokine production and isotyping analysis was also performed substantially as described in that Example. The ability of the elicited antibodies to neutralize C. trachomatis serovar E was assessed by neutralization assay (conducted substantially as described in Example 6). A summary of the ELISA titres, neutralizing titres and cytokine profile by MSD analysis are set out in Tables 9 and 10.
  • This example describes the biochemical and biophysical characterization of the multimeric nature of the recombinant MOMP.
  • Biochemical and biophysical characterization testing was performed on human serovar rMOMP samples that were prepared substantially in accordance with the method set out in Example 4. Tests included CD spectroscopy, intrinsic fluorescence spectroscopy, AUC, SEC- MALS, blue native gel electrophoresis, DSC, FTIR, and mass spectrometry. The data from these tests show that rMOMP samples are folded, and have ⁇ -sheet rich secondary structures. Their solution structures are characterized by the presence of polydisperse oligomers likely consisting of MOMP dimers, trimers, tetramers, higher order oligomers and in some samples, putative monomers.
  • Protein samples were diluted to the appropriate concentration for loading and then combined with sample buffer and Coomassie G-250 additive reagents (Invitrogen). Samples were loaded into wells of a pre-cast 4-16% polyacrylamide gradient gel (NativePAGETM Novex Bis-Tris Gels, Invitrogen) and electrophoresed at 150 V for approximately 2 h. Following electrophoresis, gels were fixed and destained according to the manufacturer's instructions. For Western blot analysis, gels were transferred to PVDF membranes. Samples of rMOMP showed a characteristic ladder pattern on BN-PAGE (see Figures 6A and 6B).
  • the lowest-MW band in the majority of rMOMP samples had a molecular weight of approximately 80,000 corresponding to a putative MOMP dimer.
  • the higher MW bands on the ladder presumably correspond to progressively higher-order oligomers (i.e. trimers, tetramers, pentamers, etc.). This was investigated from a theoretical standpoint by comparing the relative mobilities (Rf-values) of bands from 3 different SerD rMOMP samples with the theoretical MW's of the putative MOMP oligomers.
  • the specificity of the stained bands on BN-PAGE was investigated by means of Western blotting using a SerD MOMP-specific monoclonal antibody.
  • a native MOMP sample which was extracted and purified from the outer membranes of SerD C. trachomatis elementary bodies (EB-MOMP), in accordance to process described previously (2001, Infect. Immun. 69:6240-6247 ) was run as a positive control. All of the ladder bands in the BNG of the 3 SerD rMOMP lots were recognized by the specific mAb in the corresponding Western blot. Therefore, the bands observed in the BNG ladder are MOMP-specific.
  • the rMOMP samples were assessed by Far-UV CD spectroscopy. The samples all showed evidence of ⁇ -sheet rich secondary structure, characterized by a broad spectral minimum around 215 nm. By intrinsic fluorescence spectroscopy, the samples had similar emission spectra, both at 280 nM and 295 nm, suggesting a similar molecular environment for the aromatic side chains of tyrosine and tryptophan.
  • the samples were assessed by size-exclusion chromatography (SEC).
  • SEC elution profiles of the rMOMP samples were consistent with polydisperse MOMP oligomers ( Figures 7, 8). Difference in profiles may reflect differences in the distribution of the various sized oligomeric species.
  • Analysis of the eluting SE-HPLC fractions using multi-angle light scattering (MALS) was also performed and this data (not shown) was similarly consistent with the presence of polydisperse oligomers, whereby high-MW species eluted early in the chromatogram, with lower-MW weight species eluting later.
  • MALS multi-angle light scattering
  • Sedimentation velocity was conducted by AUC.
  • the sedimentation velocity results for the rMOMP samples are consistent with the presence of oligomers.
  • the broadness and overall shape of the AUC spectra was consistent with polydisperse samples consisting of MOMP oligomers of different sizes. This profile is consistent with results from SEC-MALS and BNG experiments.
  • the peak apex sedimentation coefficients (s -values) for the lots were between 8 and 9 Svedvergs.
  • a monomer of rMOMP (-40 kDa) would be expected to have an s -value of approximately 2 Svedbergs. Therefore, rMOMP samples consist of polydisperse oligomers.
  • This example describes the evaluation of human sera from subjects with Chlamydia using rMOMP.
  • Serum samples collected from two different cohorts of Chlamydia-infected subjects were evaluated by ELISA, to assess IgG titers, and using an in-vitro assay to assess neutralization capacity.
  • the first study cohort was comprised of male and female subjects >16 years of age and attending a clinic for Chlamydia treatment.
  • the subjects in this study cohort tested positive in a urogenital Chlamydia screening nucleic acid amplification test (the Gen-Probe Aptima Combo 2 [GP AC2, Gen-Probe, Inc., San Diego, CA]) and were enrolled in a Chlamydia study following treatment.
  • the second study cohort was comprised of female subjects (> 18 years of age) enrolled in a treatment outcome study following a positive test in a urogenital Chlamydia screening test (Ligase Chain Reaction).
  • a cervical Chlamydia culture and a serum sample was collected from each subject during scheduled visits (i.e. , at baseline, day 7, and day 21). Culture-negative genital specimens were subsequently tested by PCR (COBAS AMPLICORTM; Roche Diagnostic Systems, Inc., Branchburg, NJ).
  • Serum levels of total Chlamydia trachomatis IgG were measured using the Chlamydia trachomatis-lgG-EUSA-plus Medac assay (497-PLUS, Medac GmbH, Germany) as per the manufacturer's protocol.
  • the Medac assay uses a synthetic peptide from a MOMP variable domain (an immunodominant region of the protein).
  • Total IgG, IgGl and IgG3 levels were also measured using ELISA assays developed using rMOMP made in accordance to the methods of the invention (SP-IgG, SP-IgG 1 and SP- IgG3, respectively).
  • Lot#sp021 and sp4500 Two lots of rMOMP (lot# sp021 and sp4500), each derived from serovar E, were utilized. Lot#sp021 had been prepared substantially in accordance with the process set out in Example 4, as was Lot#sp4500 apart from a few differences (i.e., the diafiltration buffer used in the refolding procedure was 50 mM Tris, pH 8.0, 0.1% NLS and the inclusion body pellet underwent a NLS wash substantially as described in Example 5, before the purification/refolding process). Protein purity for Lot#sp021 was 91.4% and was 99.7% for Lot#sp4500.
  • 96-well plates were coated with rMOMP at a concentration of O. ⁇ g/mL and incubated overnight at 4°C. The plate was then blocked with blocking buffer (PBS-1% BSA solution) and following incubation, residual blocking buffer was removed. Serum samples predicted with assay diluent were then added and incubated at room temperature. The plate was washed and then incubated with an HRP conjugated goat anti-human IgG (H+L chain, Jackson Laboratories), mouse anti -human IgGl ( ⁇ chain, Southern Biotechnology) or mouse anti-human IgG3 ( ⁇ 3 chain, Southern Biotechnology).
  • HRP conjugated goat anti-human IgG H+L chain, Jackson Laboratories
  • mouse anti -human IgGl ⁇ chain, Southern Biotechnology
  • mouse anti-human IgG3 ⁇ 3 chain, Southern Biotechnology
  • the plate was then developed as per the manufacturer's protocol using TMB substrate (Sigma) and analyzed using the SoftmaxTM plate reader (at absorbance 450nm-540nm). ELISA units were noted in absorbance units (AU/mL); the AU unit value was assessed by comparing the fluorescence of the test sample to an established standard control serum. Results were analysed statistically: correlations between continuous variables were assessed using Spearman's Rank correlation and differences between means were evaluated using the Mann-Whitney U-Test for non-parametric populations. Only those study participants that were positive by the Medac IgG ELISA (26/40 (65%) study participants) were included in the statistical analysis.
  • a similarly diluted EB stock was added to samples and following an incubation period, mixture was transferred to a previously plated monolayer of HELA cells. Plate was centrifuged and sera-EB suspension was removed. Following an incubation period, the cells were fixed with the addition of 100% methanol (Sigma, Canada), then washed with PBS and incubated in 0.1% BSA-PBS buffer with a dilution of antibodies against C. trachomatis MOMP. The antibodies had been derived from rabbit sera raised against 4 peptides to the variable domain of MoPn MOMP. Cells were then washed with PBS and incubated with a Donkey anti-Rabbit HRP conjugated antibody diluted in 5% FBS-PBS with goat serum (Sigma, Canada).
  • the plate was then washed and developed with the metal enhanced DAB substrate kit (Pierce, Canada) and counted using the Zeiss Observer Z l microscope with the AxioVisionTM 4.7.1 software.
  • Neutralization titers which were defined as the dilution of sera able to neutralizing infection by > 50% of control values, ranged from 5 to 320.
  • the assay utilized provided a method of evaluating the effectiveness of serum IgG at preventing infection of HELA cells exposed to Chlamydia trachomatis elementary bodies (EB), and as such, it enabled a determination to be made as to whether the IgG titers in sera corresponded to functional activity against Chlamydia EB's.
  • the levels of total IgG and IgG3 as measured using the rMOMP ELISA assay also correlated positively with neutralization titers which suggest that the rMOMP-specific IgG and IgG3 recognized by the SP-IgG ELISA are able to neutralize serovar E infections in vitro. Indeed, the neutralization capacity of sera was abolished by depleting IgG from sera. Therefore, the rMOMP utilized in the ELISA (and made in accordance to the present invention) was in a substantially native-like form as it was able to detect neutralizing C. trachomatis specific antibodies that had been elicited by a wild-type infection with C. trachmatis.
  • Trp Cys Asp Ala lie Ser Leu Arg Leu Gly Tyr Tyr Gly Asp Phe Val
  • Trp Leu Trp Glu Gly Phe Gly Gly Asp Pro Cys Asp Pro Cys Ala Thr Trp
  • Asp Ala Ser lie Asp Tyr His Glu Trp Gin Ala Ser Leu Ala Leu Ser
  • 325 330 335 lie Ala Val Gly Thr Thr lie Val Asp Ala Asp Lys Tyr Ala Val Thr

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Microbiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • Communicable Diseases (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The present invention provides methods of obtaining a recombinant Chlamydia outer membrane protein (e.g. MOMP) that is expressed as an insoluble aggregated in a heterologous host in a soluble and immunogenic form and to proteins prepared in accordance to these methods. The invention also provides compositions comprising one or more proteins prepared in accordance to the methods of the invention. The proteins obtained in accordance to the methods of the present invention are soluble, immunogenic and in a substantially oligomeric form.

Description

EXPRESSION, PURIFICATION AND REFOLDING OF RECOMBINANT CHLAMYDIA PROTEINS, COMPOSITIONS AND RELATED METHODS
CROSS-REFERENCE TO RELATED APPLICATIONS
The present application claims priority to U.S. Serial No. 61/413,663, filed November 15, 2010, and U.S. Serial No. 61/452,319, filed March 14, 201 1, which are incorporated by reference herein in their entireties.
FIELD OF THE INVENTION
The present invention relates generally to recombinant protein purification and more particularly, to methods of purifying and folding recombinantly expressed proteins. BACKGROUND OF THE INVENTION
Chlamydiale bacteria are obligate intracellular pathogens of eukaryotic cells. Four chlamydial species are currently known— C. trachomatis, C. pneumoniae, C. pecorum and C. psittaci— and genomic sequences for each of these are publicly available ((1999) Nature Genetics 21 :385-389; (2000) Nucleic Acids Res 28: 1397-1406; (2000) Nucleic Acids Res 28:2311-2314; ( 1998) Science 282:754-759).
C. trachomatis organisms are dimorphic, and alternate between 1) infectious "elementary bodies" (EBs) which are endocytosed by mucosal cells into vesicular inclusions; and 2) metabolically active, intracellular "reticulate bodies" (RBs). RBs replicate and redifferentiate into EBs before being released to infect neighbouring cells.
Treatment of EBs with n-lauroyl sarcosine produces "chlamydial OM complexes"
(COMCs) containing three relatively detergent-resistant, cysteine-rich proteins: the Major Outer Membrane Protein (MOMP), encoded by ompA, and OmcB and OmcA, encoded by omp2 and omp3, respectively (BMC Microbiology 2005, 5 :5, and references therein). There are a number of other Chlamydial outer membrane proteins such as for example, PorB, PmpB, PmpC, PmpD, PmpG, and PmpH.
MOMP is expressed in both EBs and RBs and is situated on the outer membrane where it functions as a porin. It constitutes about 60% of the membrane protein of the infectious EB. Structural and functional analysis has shown that native MOMP exists as an oligomer; the native conformation of C. trachomatis MOMP is a trimer with monomers that have a β-barrel, β-sheet secondary structure. In EB, MOMP forms trimers twith disulfide bridges within and between its individual monomers (~ 40 kDa) and also between trimers (J. Bacterid. 189:6222-6235, 2007).
There are at least 19 different C. trachomatis serovars capable of infecting humans {i.e., A to K, Ba, Da, la, Ja, LI to L3 and L2a) and these serovars have been typed based on serological differentiation of the antigenic epitopes on MOMP. The MOMPs encoded by each of these 19 different serovars share five well-conserved regions and four variable sequence segments or domains (termed VS or VD 1 to VD 4). The subspecies and serovar specific antigenic epitopes or determinants are located on the variable domains. Based on amino acid homology, the serovars have been subdivided into the following serogroups or classes: B class (B, Ba, D, Da, E, LI, L2 and L2a), C class (A, C, H, I, la, J, K and L3), and intermediate class (F and G). Infection with any C. trachomatis serovar may result in disease: serovars A, B, Ba and C cause trachoma; serovars L1-L3 are the agents of lymphogranuloma venereum; serovars D-K cause sexually transmitted infections; and serovars G, I and D have been associated with cervical cancer.
Chlamydial infection itself causes disease, and failure to clear the infection results in persistent immune stimulation which may lead to chronic infection with severe consequences (e.g., sterility and blindness). The precise immune correlates of protection remain to be determined, but cell-mediated immune responses and antibody mediated immune responses are each involved; the bacterium is an intracellular parasite, and as such, it can typically evade antibody-mediated immune responses, but antibodies to the C. trachomatis MOMP protein neutralize EB infectivity and B-cell-deficient mice are unable to prevent re-infection (which suggests a functional role for B cells in adaptive immunity) (Morrison et al, 2005). While antibiotics may clear an infection, in many cases women are asymptomatic and therefore, are unlikely to seek treatment.
In view of these asymptomatic infections and the serious nature of the disease, there is a need for a suitable vaccine. Vaccines may be useful: (a) as a prophylactic vaccine by immunizing against chlamydial infection or against Chlamydia-induced disease; and/or (b) as a therapeutic vaccine by eradicating an established chronic chlamydial infection.
A number of the outer membrane proteins (OMPs) of the various chlamydial species have been considered as possible vaccine candidate antigens including MOMP but the study of these proteins however has been hampered by the difficulty in producing them in a purified, soluble recombinant form with the appropriate quaternary structure. A MOMP protein (either recombinantly expressed or extracted directly from the bacteria) needs to assume some degree of its native conformation such that it presents the conformational epitopes required to induce a therapeutically effective immune response. For example, in a study using EB-MOMP extracted from C. trachomatis mouse pneumonitis (MoPn) (a natural pathogen of mice) under conditions to maintain its native trimeric conformation, this trimeric native-like form of EB-MOMP was able to induce in mice a protective response as effective as that elicited by live organisms against a genital challenge (Infect. Immun. 73 : 8153-8160, 2005).
The recombinant expression of MOMP in heterologous bacterial expression systems is commonly associated with the production of improperly folded recombinant proteins in insoluble aggregates, referred to as inclusion bodies. Solubilizing these aggregates and then refolding the proteins into their native conformation is problematic and often leads to low recovery.
MOMP is a detergent resistant, cysteine-rich protein, and as such, recombinantly expressed MOMP (rMOMP) can aggregate when oxidized or interact with, and form extensive disulfide bonds with other cysteine-rich proteins making it prone to misfolding and aggregation and difficult to purify and refold (Mol Microbiol 1992, 6: 1087-1094; BMC Microbiology 2005, 5:5). Recombinant MOMP has been expressed in E. coli using full-length ompA genes that include the signal sequence to target the translated protein to the outer membrane but this approach too has proven problematic as the protein tends to misfold and aggregate (Manning et al. 1993). Others have cloned MOMP into plasmids with an in-frame histidine-tag such that the recombinantly expressed protein is his-tagged either at its N or C terminus and as such, purifiable using Ni-NTA chromatography (Coler et al. 2009). Such his-tagged recombinant protein preparations are not suitable however for use as commercial vaccines (e.g., due to the potential elicitation of an anti-his-tag response) and are not suitable for the large scale manufacturing required for commercial vaccines.
Therefore, a need still exists for methods that produce a soluble recombinant MOMP in a sufficiently native -like form and on a scale large enough to be commercially viable. SUMMARY OF THE INVENTION
The present invention generally relates to methods for preparing soluble and immunogenic recombinant Chlamydial membrane outer membrane (MOMP) proteins. More particularly, the present invention relates to methods for obtaining recombinant Chlamydial MOMP that is expressed as an insoluble aggregate in a heterologous host, in a soluble and immunogenic form. The methods of the present invention are generally accomplished by:
(a) isolating the insoluble aggregated protein; (b) admixing the insoluble aggregated protein from step(a) in an aqueous solution comprising a denaturing agent to denature the insoluble aggregated protein;
(c) purifying the denatured protein from step (b) by subjecting the mixture of step (b) to at least one chromatographic purification in the presence of denaturing agent and collecting eluted solution of purified denatured protein;
(d) admixing the purified denatured protein solution from step (c) with a reducing agent and at least one small molecule additive to enhance protein folding and/or suppress protein aggregation;
(e) reducing concentration of denaturing agent and reducing agent to levels sufficient to allow the protein to renature into soluble and substantially oligomeric forms; and
(f) isolating the substantially oligomeric forms.
Immunogenic compositions and methods for eliciting an immune response against Chlamydia infections (such as e.g., C. trachomatis) are also described. Preferred examples include immunogenic compositions comprising immunogenic recombinant MOMP proteins, methods for their production and their use. In further embodiments of the present invention, the recombinant MOMP proteins can be from any one of the known 19 different human serovars of C. trachomatis or any of the known serovars of C. pneumoniae.
In a further aspect of the invention, methods of immunizing a subject against disease caused by infection with a strain of Chlamydia are provided, which comprises administering to the subject an effective amount of a Chlamydia protein made in accordance to the methods described herein.
The invention provides several advantages. For example, the recombinant MOMP proteins obtained by the methods of the present invention are immunogenic and administration of these proteins (e.g. , in the compositions of the present invention) to a subject elicits an immune response and/or an immunoprotective response against infections by Chlamaydia (e.g., C. trachomatis). The methods of the present invention can be used to obtain soluble recombinant MOMP in substantially oligomeric forms. In addition, the methods of the present invention can be used to obtain recombinant MOMP suitable for use in the preparation of immunogenic compositions (e.g., vaccines).
Other features and advantages of the invention will be apparent from the following
Detailed Description, the Drawings and the Claims. BRIEF DESCRIPTION OF THE DRAWINGS
The present invention will be further understood from the following description with reference to the drawings, in which:
Figure 1 shows a schematic representation of one embodiment of the purification, refolding process for recombinant proteins;
Figure 2 shows a representative SDS PAGE gel of rMOMP protein samples obtained after the various steps of the purification and refolding method;
Figures 3 shows a representative Blue Native PAGE gel analysis of rMOMP (serovar E, C.
trachomatis) protein samples prepared in accordance to an embodiment of the invention: two pilot scale samples (left, A,B) and three lab scale samples (right, C-H). Pilot scale lot was approximately 10 fold larger than lab scale. The actual yields of the lots were as follows: pilot lot JR3182: 1.59 g, lab scale JR3081 : 180 mg, JR3095: 121.9 mg, JR3097: 101.4 mg.
Figure 4 shows a representative SDS-PAGE gel of rMOMP (serovar E, C. trachomatis) protein samples prepared in accordance to an embodiment of the invention demonstrating the quaternary structure of the rMOMP protein at various steps (i.e., samples of the solubilized IBs, the purified denatured MOMP (Q pool), the folded protein, and the final product)
Figure 5 shows representative SDS-PAGE gels comparing two protein samples purified in accordance to an alternative embodiment. While the same starting material was used to prepare the samples run in the left panel gel and those run in the right panel gel, each panel of samples underwent a different purification process. In both gels, lanes are loaded in triplicate with 4 μg of protein. Improved purity is evident in the samples of the right panel.
Figures 6A, 6B, 6C show representative BN-PAGE gel analysis of rMOMP protein samples prepared in accordance to an embodiment of the invention.
Figure 7 shows representative SE-HPLC chromatograms for SerE rMOMP lots.
Figure 8 shows representative SE-HPLC chromatograms for SerF, la, and J rMOMP lots.
Figure 9 (A and B) shows a representative graphical comparison of elicited IgG titers as assessed using two different ELISA assays (the commercially available Medac™ assay and an ELISA developed using rMOMP made in accordance to the invention).
Figure 10 (A and B) shows a representative graphical correlation between sera IgG titers (as measured by IgG ELISA) and sera neutralization capacity. A strong positive correlation was evident between IgG levels measured by the sp-IgG ELISA and neutralization titres in all participants (Figure 10A). The correlation was still evident when the 4 most visually obvious outliers were removed from the analysis (Figure 10B).
Figure 11 (A and B) shows a representative graphical correlation between sera IgG3 titers and neutralization capacity. A strong positive correlation was evident between IgG3 levels (as measured by the SP-IgG3 ELISA) and neutralization titers in all participants (Figure 1 1 A), even when the most visually obvious outliers were excluded (Figure 1 IB).
DETAILED DESCRIPTION OF THE INVENTION
The present invention provides novel methods of obtaining a recombinant Chlamydial MOMP proteins that have been recombinantly expressed in a host as an insoluble aggregate, in a soluble, immunogenic and substantially oligomeric form. Also provided are novel methods of purifying and/or refolding chlamydial outer membrane proteins that have been recombinantly expressed in a host cell as an insoluble aggregate. The present invention further provides novel recombinant proteins, particularly recombinant proteins obtained by these novel methods and immunogenic compositions comprising these proteins. These compositions are useful for eliciting an immune response (e.g., a neutralizing immune response) against a Chlamydia infection and/or for treating and/or preventing Chlamydial infections.
The methods for preparing such proteins are generally accomplished by: a) isolating the insoluble aggregated protein (e.g., by isolating inclusion body fractions enriched in MOMP protein); b) admixing the insoluble aggregated protein in an aqueous solution comprising a denaturing agent to denature (i.e., solubilize) the insoluble aggregated protein to provide a solution containing denatured MOMP protein; c) purifying the denatured MOMP protein by subjecting the mixture of step (b) to at least one chromatographic purification in the presence of denaturing agent and collecting eluted solution of purified denatured protein; d) renaturing (refolding) the purified denatured MOMP protein by admixing a reducing agent and at least one small molecule additive (and in preferred examples of the invention, using n-lauroyl sarcosine and in other preferred examples of the invention, using DTT, 1-arginine and n-lauroyl sarcosine) and then reducing the concentration of both the denaturing and reducing agents to levels sufficient to allow the protein to renature into soluble and substantially oligomeric forms. DEFINITIONS
The following includes definitions of selected terms that may be used throughout the disclosure. The definitions include various examples and/or forms of components that fall within the scope of a term and that may be used for implementation. The examples are not intended to be limiting. Both singular and plural forms of the terms fall within the definitions.
"Adjuvant", as used herein, refers to agents or substances that modulate the immunogenicity of an antigen. "Modulate the immunogenicity" includes enhancing the magnitude, duration and/or specificity or type of an immune response stimulated by an antigen.
A "heterologous host", as used herein, refers to a host cell (e.g. , prokaryotic, eukaryotic) that is transfected with a construct encoding a target protein not normally found in said host.
As used herein, "immunogenicity" refers to the ability of a substance to induce an immune response when administered to a subject (e.g., a cellular immunogen-specific immune response and/or a humoral antibody response). As used herein and defined in the art, "antigenicity" is the ability of an antibody to recognize and bind to a protein (e.g., an antigen).
An "immunoprotective response", as used herein, is meant to encompass humoral and/or cellular immune responses that are sufficient to: 1) inhibit or prevent infection by a microbial organism, particularly a pathogenic microbial organism; and/or 2) prevent onset of disease, reduce the risk of onset of disease, or reduce the severity of disease symptoms caused by infection by a microbial organism, particularly a pathogenic microbial organism.
As used herein, "inclusion bodies" are insoluble protein aggregates. The terms "insoluble aggregates" and "inclusion bodies" are used herein interchangeably.
"Isolated", as used herein, is meant to describe a compound of interest that is in an environment different from that in which the compound naturally occurs. "Isolated" is meant to include compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.
Oligomeric proteins contain a number of polypetide chains or subunits (e.g., monomer units). Dimers, trimers and tetramers are examples of oligomers.
As used herein, the term "substantially purified" refers to a compound that is removed from its natural environment and is at least 60% free, preferably 75% free, more preferably 80% free and most preferably 90% free from other components with which it is naturally associated. The "% purity" of a compound (e.g., protein sample) refers to % by which the compound is free from detectable quantities of contaminants. Preferably a protein made in accordance to the method described herein is greater than 80% pure. Purity may be assessed using sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and scanning densitometry as described herein.
As used herein, the term "subject", is meant any mammalian subject, particularly humans. Other subjects may include cattle, sheep (e.g. in detection of sheep at risk of abortion due to chlamydial infection), dogs, cats (e.g. in detection of cats having eye and/or respiratory infections), birds (e.g. chickens or other poultry), pigs, rabbits, rats, mice, horses, and so on. Of particular interest are subjects having or susceptible to Chlamydia infection, particularly to infection by C. trachomatis, C. psittaci and/or C. pneumoniae.
As used herein, the term "effective amount" or "therapeutically effective amount" means a dosage sufficient to provide for treatment for the disease state being treated or to otherwise provide the desired effect (e.g. induction of an effective immune response or reduction of bacterial load). The precise dosage will vary according to a variety of factors such as subject- dependent variables (e.g., age, immune system health, etc), the disease (e.g., the species of the infecting pathogen), and the treatment being effected. In the case of an intracellular pathogen infection, an "effective amount" is that amount necessary to substantially improve the likelihood of treating the infection, in particular that amount which improves the likelihood of successfully preventing infection or eliminating infection when it has occurred.
As used herein, non-reducing conditions for gel electrophoresis such as blue native polyacrylamide gel electrophoresis (BN-PAGE) means the preparation of samples without boiling and without the addition of reducing agents such as diothiothreitol (DTT) or 2-mercaptoethanol or beta-mercaptoethanol (BME).
"Treatment" or "treating" as used herein means any therapeutic intervention in a subject, usually a mammalian subject, generally a human subject, including: (i) prevention, that is, causing the clinical symptoms not to develop, e.g. preventing infection and/or preventing progression to a harmful state; (ii) inhibition, that is, arresting the development or further development clinical, symptoms, e.g. mitigating or completely inhibiting an active (ongoing) infection so that bacterial load is decreased to the degree that it is no longer seriously harmful, which decrease can include complete elimination of an infectious dose of Chlamydial bacteria from the subject; and/or (iii) relief, that is, causing the regression of clinical symptoms, e.g., causing a relief of fever, inflammation, and/or other symptoms and pathologies caused by an infection. A polypeptide used with the invention may comprise an amino acid sequence that:
is identical (i.e. 100% identical) to a sequence disclosed in the sequence listing;
shares sequence identity (e.g. 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) with a sequence disclosed in the sequence listing;
has 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 (or more) single amino acid alterations (deletions, insertions, substitutions), which may be at separate locations or may be contiguous, as compared to the reference sequence; and
when aligned with a particular sequence from the sequence listing using a pair-wise alignment algorithm, such as the Needleman-Wunsch global alignment algorithm, using default parameters (e.g. with Gap opening penalty = 10.0, and with Gap extension penalty =0.5, using the EBLOSUM62 scoring matrix). This algorithm is implemented in the needle tool in the EMBOSS package.
Variants of MOMP polypeptides may comprise an amino acid sequence having 80% or more sequence identity (e.g. 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to the serovar sequences disclosed herein (e.g. SEQ IDs 3, 8, 11, 13, 15, and 17) or any other know or existing in the art.
Immunogenic compositions of the invention may be useful as vaccines. Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat infection), but will typically be prophylactic.
The term "vaccine", as used herein, refers to a pharmaceutically acceptable formulation of at least one antigen. Such pharmaceutical acceptable formulations of an antigen may also include for example, adjuvants, excipients, diluents, and/or other similar substances that enhance the activity, stability, and/or other properties of a formulation or administration.
Methods of Purifying and Refolding
In one aspect, the present invention provides a method of obtaining an outer membrane protein (e.g., rMOMP) that is recombinantly expressed as an insoluble aggregate in a heterologous host, in a soluble and immunogenic form.
The isolation, purification and refolding of recombinantly expressed MOMP proteins into a form having a degree of fidelity to the native oligomeric form, is desirable.
Recombinant proteins (such as for example, rMOMP) often form aggregates or inclusion bodies when over expressed in heterologous expression systems usually in an insoluble form. This usually occurs because the expressed protein is not correctly folded. In order to obtain proteins in a correctly refolded form, various steps are required (e.g., disruption of the host cells, isolation of the inclusion bodies, and then dissolving (i.e., denaturing) them in a chaotropic agent). The denatured protein is then transferred to an environment that favours a return to its native conformation; during the process the protein undergoes a transition through various semi- stable intermediates, any of which can lead to aggregation as opposed to the desired native conformation.
The present invention provides an efficient method for purifying and refolding a recombinant Chlamydia outer membrane protein from a denatured state, which overcomes the shortcomings of current methods.
In these methods a suitable heterologous host cell (e.g., E. coli) is transfected with a construct encoding the target protein (e.g., MOMP of any serovar of a species of Chlamydia). Suitable host cells can be prokaryotic or eukaryotic. Examples of suitable hosts cells that can be used to express recombinant proteins include bacteria, yeast, insect and mammalian cells. Bacteria cells are particularly useful, especially E. coli. Methods of expressing a heterologous protein in a host cell are well known in the art and examples are provided herein.
The present invention encompasses a wide variety of recombinant proteins. These proteins include outer membrane proteins (such as for example, MOMP, OmcA, OmcB and PorB) of each Chlamydial species (C. trachomatis, C. pneumonaie, C. pecorum, C. psittaci). The present methods also can enhance the expression recovery and purification of these recombinant outer membrane proteins.
MOMP expressed recombinantly typically is produced intracellularly in an insoluble aggregated form (i.e., as inclusion bodies). The cells expressing the target protein in an insoluble aggregated form are collected and lysed, to isolate the insoluble aggregates. Cell lysis can occur prior to, or coincident with, the solubilization procedures described below. Cell lysis can be accomplished by, for example, mechanical sheer such as a French pressure cell, enzymatic digestion, sonification, homogenization, glass bead vortexing, detergent treatment, organic solvents, freeze thaw, grinding with alumina or sand, treatment with a denaturing agent as defined below, and the like.
The insoluble aggregated material (inclusion bodies) can be separated from soluble proteins by various methods such as centrifugation, filtration (including ultrafiltration), precipitation or settling. Generally, the inclusion bodies are separated from cell debris using low- speed centrifugation after cell lysis as they are denser than most of the cellular components. These recovered inclusion bodies may be contaminated with E. coli cell wall and outer membrane components. The later may largely be removed by selective extraction with detergents and low concentration of either urea or guanidine-HCl to produce wash pellets. Alternatively, the application of mild detergents to cell lyates will promote dissolution of most cellular structures, while leaving the inclusion bodies intact, which can then be collected by low speed centrifugation.
Next, the insoluble aggregated material is solubilized (i.e., rendered soluble, denatured or monomelic) by exposing the insoluble aggregated material (or whole cells without prior lysis) to a denaturing agent. Useful denaturing agents include chaptropic reagents such as urea, guanidine (guanidine hydrochloride), agents such as arginine, and sodium thiocyanate, extremes in pH (dilute acids or bases), detergents (e.g., SDS, N-lauroyl sarcosine), salts (e.g., chlorides, nitrates, thiocyanates, cetylmethylammonium salts, tricholoroacetates), chemical derivatization (e.g., sulfitolysis, reaction with citraconic anhydride), solvents (e.g., 2-amino-2-methyl-l-propanol or other alcohols, DMSO, DMF). In preferred examples, the denaturing agent is guanidine and/or urea. Useful concentrations of either guanidine or urea are 1-8M with 6-8M being preferred concentrations. Chelating agents such as EDTA may be used in this step to prevent metal catalyzed air oxidation of cysteines during the removal of chaptrotic reagents (such as for e.g., guanidine, urea).
Preferably, a disulfide reducing agent is also used in conjunction with the denaturing agent. Useful disulfide reducing agents include thiol compounds such as diothiothreitol (DTT) or beta-mercaptoethanol. These compounds can be used in the range of 1-100 mM with - 10 mM being a typical concentration.
In one example, inclusion bodies are solubilized in guanidine (e.g., 6M). Prior to purification, the guaninidine is exchanged with urea (e.g., 8M urea) for example, by tangenitial flow filtration. In a further example, inclusion bodies are recovered by centrifugation and the inclusion body pellet is solubilized in 8M urea (at about pH 12.5). Preferably, the solubilization solution also includes a reducing agent such as for example, DTT (e.g., lOmM).
In one embodiment, isolated inclusion bodies are solubilized by adding (20-40 mL/g) in 8M Urea, pH 12.5 and incubating mixture for about 30 minutes. Following incubation, DTT (lOmM) is added and the pH of the solution is reduced to about pH 6 with citrate/phosphate buffer. The solubilization supernatant is then diluted with Urea (e.g., 8M with lOmM DTT) to reach a conductivity of preferably about 2.0-2.5 mS/cm. The resulting supernatant is then filtered. Following solubilization, the soluble and denatured protein is recovered and isolated from other proteins in the soluble fraction (mixture). Such recovery and purification methods are known or readily determined by those skilled in the art, including for example, centrifugation, filtration, dialysis, chromatography, including size exclusion, ion-exchange, hydrophobic interaction and affinity chromatography procedures and the like. The denatured protein solution subjected to at least one chromatographic purification (such as for example, ion-exchange, hydrophobic interaction and affinity chromatography). Preferably the solution is subjected to at least one anion exchange chromatography. In preferred examples, the solution is subjected first to cation exchange chromatography (to capture impurities) and then to anion exchange chromatography. With anion exchange chromatography, the column is preferably washed with a solution comprising Urea and a salt (e.g., 8M Urea, 15 mM NaCl) and the rMOMP protein may be eluted from the column using a solution of Urea with a higher salt concentration (e.g., (8M Urea, 30-90 mM NaCl). Throughout the purification process the solubilized protein is maintained in a denatured state (for example, by ensuring the constant presence of urea).
The next step in the process is to refold the solubilized and purified protein to obtain the desired conformation. In the achieved refolded conformation, the protein is soluble, immunogenic and in form that is similar to the native oligomeric form. In the achieved refolded conformation, the protein is capable of eliciting neutralizing antibodies to the corresponding species (and/or serovar) of Chlamydia from which it was derived. In preferred examples, the protein is in a substantially oligomeric form which preferably includes at least a trimeric form and preferably includes less than 6% of the monomeric form. Preferably, less than 5% is in the monomelic form.
The purification of a denatured protein before subjecting it to refolding conditions is unconventional; chromatographic approaches for purification are generally not well suited to protein mixtures containing the high levels of strong denaturants (e.g., 8 M urea or 6 M guanidine hydrochloride) required to solubilize inclusion body preparations.
The aqueous solution of purified protein is mixed with a reducing agent (e.g., DTT, DTE, or 2-mercaptoethanol) and at least one small molecule additive. Refolding is achieved by reducing the concentrations of the denaturing agent and the reducing agent to levels sufficient to allow the protein to re-nature into a soluble, conformationally native-like form (i.e., oligomeric). This can be achieved by dialysis, dilution, gel filtration, precipitation of the protein or by immobilization on a resin followed by buffer washes. In preferred examples, concentrations are reduced using at least one tangential flow filtration. Conditions for this step are chosen to allow for regeneration of the protein's native disulfide bond(s) and therefore consider the redox environment. A reducing agent such as DTT, DTE, or 2-mercaptoethanol is used to reduce disulfide bonds to the sulfhydral state when the protein is denatured, ensuring complete unfolding. Re-establishment of these disulfide bonds, which confers appropriate secondary structure, occurs when the buffer environment is allowed to promote oxidation, when the protein is newly and correctly re-folded. Alternatively, this can be accomplished through the addition of an oxidizing agent and a reducing agent, to catalyze a disulfide exchange reaction. Preferably, a reagent or combination of reagents are chosen that result in native disulfide bond formation (e.g., oxygen, cysteine/oxygen, cysteine/cystine, cysteine/cystamine, cysteamine/cystamine, reduced glutathione/oxidized glutathione, and the like).
Small molecule additives (also known as chemical chaperones) may be added to guide the protein towards the correct conformation. Examples of small molecule additives for use in the disclosed methods, include those which enhance protein folding and/or suppress protein aggregation. Examples of small molecule additives for use in the disclosed methods include 1- arginine, N-lauroyl sarcosine, sucrose and ammonium sulfate. Preferred small molecule additives are 1-arginine and N-lauroyl sarcosine.
The purified protein is refolded by removing or reducing the concentration of the denaturant and any excess reducing agent. Preferably, the concentration of the denaturant (e.g„ Urea or guanidine hydrochloride) is reduced over a few minutes, to provide a stable, folded protein. There are intermediate folding states of the protein, from which insoluble misfolded aggregates can form and these intermediate folding states are sensitive to concentration as they follow second order kinetics. Reducing the concentration of the denaturant (and reducing agent if applicable) in a minimal amount of time reduces the opportunity for mis-folding.
In the preferred practice of the present invention, as exemplified herein, the refolding process involves a diafiltration of a volume of purified denatured recombinant protein (e.g., rMOMP) in urea (e.g., 8M) mixed with equal volumes of arginine (e.g., 1M - 3M) and NLS (e.g., 2-30% v/v) and DTT (e.g., 10 mM). Preferred embodiments of the present invention are depicted in Figure 1 and are described in the examples herein.
The recombinant proteins obtained according to these methods can be further processed if desired. For example, residual contaminates can be removed. The isolated rMOMP protein is preferably in a buffered solution having a pH of 7.0 to 8.5, and preferably 7.5 to 8.5. The protein solution preferably has a residual concentration of NLS of 0.5% (w/v) or less, of DTT of 24 μg/ml or less, and of urea of 10 mg/ml or less.
The purified recombinant MOMP proteins obtained by the methods of the present invention are identifiable via their known physical, chemical, immunological or biological properties (e.g., by means of SDS-PAGE, BN-PAGE, isoelectric focusing, specific monoclonal antibodies, and immunological parameters such as, antibody ELISA, neutralizing antibody titres, cytokine levels, lymphoproliferative responses.
The yield of rMOMP obtained by the methods of the present invention is 75-95% or higher.
The protein preparations produced by the present methods can be used for a variety of in vitro and in vivo applications. The proteins and their derivatives of the present invention can be used for research, diagnostic, prophylactic or therapeutic purposes. In vitro uses include, for example the use of the protein for screening, detecting and/or purifying other proteins.
Compositions. Formulations and Administration
The present invention provides immunogenic compositions useful for treating and/or preventing Chlamydial infections. In another aspect, the present invention provides methods of inducing anti-chlamydial immunity by administering the immunogenic compositions provided, either alone or in a prime boost protocol. An anti-chlamydial immune response can be defined as a reduction in bacterial load in the immunized host upon challenge with live Chlamydia, and/or the stimulation of protective levels of IFN-γ in the host cells (immunoprotective response).
The data presented herein and described in detail below demonstrates that immunization with compositions comprising recombinantly expressed outer membrane proteins (e.g., rMOMP) made in accordance to the methods described herein elicits both cellular and humoral immune responses.
Compositions (e.g., vaccine compositions) of the present invention may be administered in the presence or absence of an adjuvant. Adjuvants generally are substances that can enhance the immunogenicity of antigens. Adjuvants may play a role in both acquired and innate immunity (e.g., toll-like receptors) and may function in a variety of ways, not all of which are understood. Preferably the antigen induces a Thl biased response or a balanced Thl/Th2 response.
Many substances, both natural and synthetic, have been shown to function as adjuvants.
For example, adjuvants may include, but are not limited to, mineral salts, squalene mixtures, muramyl peptide, saponin derivatives, mycobacterium cell wall preparations, certain emulsions, monophosphoryl lipid A, mycolic acid derivatives, nonionic block copolymer surfactants, Quil A, cholera toxin B subunit, polyphosphazene and derivatives, immunostimulating complexes (ISCOMs), cytokine adjuvants, MF59 adjuvant, lipid adjuvants, mucosal adjuvants, certain bacterial exotoxins and other components, certain oligonucleotides, PLG, and others. These adjuvants may be used in the compositions and methods described herein.
In preferred examples, the composition comprises at least one Chlamydial MOMP protein (produced in accordance to the methods of the invention), and an adjuvant, characterized in that the adjuvant comprises at least:
- an oil-in-water emulsion comprising at least squalene, an aqueous solvent, a polyoxyethylene alkyl ether hydrophilic nonionic surfactant, a hydrophobic nonionic surfactant, wherein said oil-in-water emulsion is obtainable by a phase inversion temperature process and wherein 90% of the population by volume of the oil drops has a size less than 200 nm, and optionally less than 150 nm; and
- a TLR agonist (e.g., TLR4 agonist such as for example, the product E6020 having CAS Number 287180-63-6).
Such an adjuvant is described in WO2007006939 (Vaccine Composition Comprising a Thermoinversable Emulsion) which is incorporated herein in its entirety. The product E6020 is described in US2007/0082875 (which is incorporated herein by reference in its entirety).
In certain embodiments, the immunogenic composition includes at least one Chlamydia outer membrane protein made in accordance to the methods described herein with or without an adjuvant. For example, the immunogenic composition may include MOMP from at least one serovar of a Chlamydia species (e.g. , C. trachomatis) and preferably, it includes MOMP from at least two or at least three or more serovars of a Chlamydia species. Preferably, the immunogenic composition prevents infection in a subject by inducing functional antibodies and appropriate CD4 and CD8 T-cell responses. Ideally, the composition elicits appropriate functional antibodies and IFN-γ producing CD4 T-cells (analogous to a Thl type response in mice).
The immunogenic compositions of the present invention are preferably in liquid form, but they may be lyophilized (as per standard methods) or foam dried (as described in WO2009012601, Antigen-Adjuvant Compositions and Methods). A composition according to one embodiment of the invention is in a liquid form. An immunization dose may be formulated in a volume of between 0.5 and 1.0 ml. Liquid formulations may be in any form suitable for administration including for example, a solution, or suspension.
The pH of the formulation (and composition) is preferably between about 6.4 and about 9. More preferably, the pH is about 7.4. The pH may be maintained by the use of a buffer.
The pharmaceutical formulations of the immunogenic compositions of the present invention may also optionally include one or more excipients (e.g., diluents, buffers, preservatives, detergents and/or immunostimulants) which are well known in the art. Suitable excipients are compatible with the antigen and with the adjuvant as is known in the art. Examples of detergents include a Tween (polysorbate) such as Tween 80.
The immunogenic compositions of the invention find use in methods of preventing or treating a disease, disorder condition or symptoms associated with Chlamydia. The terms disease disorder and condition will be used interchangeably herein. Specifically the prophylactic and therapeutic methods comprise administration of a therapeutically effective amount of a pharmaceutical composition to a subject. In particular embodiments, methods for preventing or treating Chlamydia are provided.
As used herein, preventing a disease or disorder is intended to mean administration of a therapeutically effective amount of a pharmaceutical composition of the invention to a subject in order to protect the subject from the development of the particular disease or disorder associated with Chlamydia.
By treating a disease or disorder is intended administration of a therapeutically effective amount of a pharmaceutical composition of the invention to a subject that is afflicted with a disease caused by Chlamydia or that has been exposed to Chlamydia where the purpose is to cure, heal alleviate relive alter remedy ameliorate improve or affect the condition or the symptoms of the disease.
A therapeutically effective amount refers to an amount that provides a therapeutic effect for a given condition and administration regimen. A therapeutically effective amount can be determined by the ordinary skilled medical worker based on patient characteristics (e.g., age, weight, gender, condition, complications other diseases). The therapeutically effective amount will be further influenced by the route of administration of the composition.
For prophylactic uses, one skilled in the art can readily determine the appropriate dose, frequency of dosing and route of administration. Factors in making such determinations include, without limitation, the nature of the protein to be administered, the condition to be treated, potential patient compliance, the age and weight of the patient and the like. The immunogenic preparations and vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective (i.e., protective against Chlamydial infection). The quantity to be administered is subject dependent, including for example the capacity of the individual's immune system to synthesize antibodies to the composition and produce a cell -mediated immune response. Suitable dosage ranges are readily determinable by one skilled in the art and may be of the order of about 1 μg to about lmg of the soluble, immunogenic recombinant protein (e.g., rMOMP). Suitable regimes for initial administration and booster doses are also variable but may include an initial administration followed by subsequent administration. The dosage may also depend on the route of administration and will vary according to the size of the subject. The invention also provides compositions including antigenic material of several pathogens (combined vaccines). Such combined vaccines contain for example material from various pathogens or from various strains of the same pathogen, or from combinations of various pathogens.
In another aspect, the present invention provides methods of inducing anti-chlamydial immunity by administering the immunogenic compositions provided, either alone or in a prime boost protocol. An anti-chlamydial immune response can be defined as a reduction in bacterial load in the immunized host upon challenge with live chlamydia, and/or administration of protective levels of IFN-γ in the host cells.
Immunogenic compositions may be presented in a kit form comprising the immunogenic composition and an adjuvant or a reconstitution solution comprising one or more pharmaceutically acceptable diluents to facilitate reconstitution of the composition for administration to a mammal using conventional or other devices. Such a kit would optionally include the device for administration of the liquid form of the composition (e.g. hypodermic syringe, microneedle array) and/or instructions for use.
The present disclosure also provides methods of eliciting an immune response in a subject by administering the immunogenic compositions, or formulations thereof, to subjects. This may be achieved by the administration of a pharmaceutically acceptable formulation of the compositions to the subject to effect exposure of the immunogenic polypeptide and/or adjuvant to the immune system of the subject. The administrations may occur once or may occur multiple times. In one example, the one or more administrations may occur as part of a so-called "prime- boost" protocol. Compositions of the invention can be administered by an appropriate route such as for example, percutaneous (e.g. , intramuscular, intravenous, intraperitoneal or subcutaneous), transdermal, or mucosal (e.g. , intranasal), in amounts and in regimes determined to be appropriate by those skilled in the art. Exposure of the subject to the compositions disclosed herein may result in establishment of a temporary or permanent immune response in the subject. The immune response may protect the subject from subsequent exposure to the antigen, often by subsequent exposure to an infectious agent from which the antigen was derived. Therapeutic effects may also be possible.
The composition may be administered in dosage unit formulations containing conventional pharmaceutically acceptable carriers and vehicles. The term "pharmaceutically acceptable carrier" as used herein refers to one or more formulation materials suitable for accomplishing or enhancing the delivery of a protein or polypeptide as a pharmaceutical composition. In certain embodiments, a pharmaceutical composition is a composition comprising a therapeutically effective amount of a polypeptide or protein. The terms "effective amount" and "therapeutically effective amount" each refer to the amount of a polypeptide or protein used to induce or enhance an effective immune response. It is preferred that compositions of the present invention provide for the induction or enhancement of an immune response in a host which protects the host from the development of an infection or allows the host to eliminate an existing infection from the body.
The compositions and vaccines disclosed herein may also be incorporated into various delivery systems. In one example, the compositions may be applied to a "microneedle array" or "microneedle patch" delivery system for administration. These microneedle arrays or patches generally comprise a plurality of needle-like projections attached to a backing material and coated with a dried form of a vaccine. When applied to the skin of a subject, the needle-like projections pierce the skin and achieve delivery of the vaccine, effecting immunization of the subject.
While the compositions of the invention can be administered as the sole active pharmaceutical agent, they can also be used in combination with one or more other compositions or agents (i.e. , other chlamydial antigens, co-stimulatory molecules, adjuvants). When administered as a combination, the individual components can be formulated as separate compositions administered at the same time or different times, or the components can be combined as a single composition.
All references cited within this disclosure are hereby incorporated by reference in their entirety. Examples
The above disclosure generally describes the present invention. A more complete understanding can be obtained by reference to the following specific Examples. These Examples are described solely for purposes of illustration and are not intended to limit the scope of the invention. Changes in form and substitution of equivalents are contemplated as circumstances may suggest or render expedient. Although specific terms have been employed herein, such terms are intended in a descriptive sense and not for purposes of limitations.
Methods of molecular genetics, protein biochemistry, immunology and fermentation technology used, but not explicitly described in this disclosure and these Examples, are amply reported in the scientific literatures and are well within the ability of those skilled in the art.
Example 1A. Recombinant Cloning of Mouse MOMP Protein (MoPn)
This Example describes the cloning of the MOMP gene (and MOMP gene fragments) from the C. trachomatis mouse pneumonitis strain (MoPn), a natural murine pathogen.
MOMP DNA sequence (full-length but lacking the signal peptide) was amplified from genomic DNA of Chlamydia MoPn with primers containing Ndel and Xhol sites (SEQ ID NOs. 1 and 2) . The resulting PCR product was digested with Ndel and Xhol and ligated into Ndel and Xhol digested and dephosphorylated pET24b(+). The ligation mixture was transformed into chemically competent E. Coli DH5a and positive clones were selected by plating on Luria agar containing 5C^g/ml kanamycin. Single colonies were cultured overnight in Luria Broth containing 5C^g/ml kanamycin and plasmid DNA was isolated using a QIAprep Spin Miniprep Kit. Ndel/ Xhol digests were performed to determine which clones had the correct fragment. Clone pKNE38 had the correct size fragment and an aliquot was sent for DNA sequence analysis, confirming the correct MOMP DNA sequence (and the predicted amino acid sequence of inserted coding sequence is set out as SEQ ID NO:3). Plasmid DNA from pKNE38 was transformed into chemically competent E. Coli BL21(DE3) cells using heat shock. Protein expression was assessed by culturing a single colony and inducing expression with 1 mM IPTG. Glycerol stocks were made from the overnight culture of this material for subsequent use. SDS-PAGE and Western analysis were used to identify protein expressed.
Sequence of Primers (5 '→ 3')
Primer No.1 A: GAA TCA GTC ACA TAT GCT GCC TGT GGG GAA TCC TGC (SEQ ID NO: 1)
Primer No. IB : CTG CAG TCA CTC GAG TCA TTA GAA ACG GAA CTG AGC ATT TAC (SEQ ID NO:2) Predicted Amino Acid Sequence of Inserted Coding Sequence (SEQ ID NO:3)
1 MLPVGNPAEP SLMIDGILWE GFGGDPCDPC TTWCDAISLR LGYYGDFVFD
51 RVLKTDVNKQ FEMGAAPTGD ADLTTAPTPA SRENPAYGKH MQDAEMFTNA
101 AYMALNIWDR FDVFCTLGAT SGYLKGNSAA FNLVGLFGRD ETAVAADDIP
151 NVSLSQAVVE LYTDTAFAWS VGARAALWEC GCATLGASFQ YAQSKPKVEE
201 LNVLCNAAEF TINKPKGYVG QEFPLNIKAG TVSATDTKDA SIDYHEWQAS
251 LALSYRLNMF TPYIGVKWSR ASFDADTIRI AQPKLETSIL KMTTWNPTIS
301 GSGIDVDTKI TDTLQIVSLQ LNKMKSRKSC GLAIGTTIVD ADKYAVTVET
351 RLIDERAAHV NAQFRF
Example IB. Recombinant Cloning of MOMP from human afflicting serovars of C.
trachomatis
This Example describes the cloning of MOMP from C. trachomatis serovars that afflict humans. The rMOMP cloned as described below were used in various studies, as described in the examples that follow.
MOMP Serovar D
The nucleotide sequence of full-length MOMP (but lacking signal sequence) was amplified from genomic DNA of C. trachomatis serovar D strain UW-3/Cx , and the resulting PCR product was digested and ligated into pET24b(+). The ligation mixture was transformed into chemically competent E. Coli DH5a and positive clones were selected and single colonies were cultured overnight. Plasmid DNA was isolated using a QIAprep Spin Miniprep Kit. A single clone was selected and DNA sequence analysis, confirmed the presence of the correct MOMP DNA sequence (SEQ ID NO: 9). The predicted amino acid sequence of the insert is SEQ ID NO: 8. Plasmid DNA from the clone was transformed into chemically competent E. Coli BL21(DE3) cells and MOMP protein expression was induced with ImM IPTG, confirmed by SDS-PAGE and Western analysis (and was considered sufficient for downstream protein purification).
MOMP was cloned in a substantially similar manner from serovars E, F, J and la. Corresponding DNA and amino acid sequences for cloned serovar E, F, J and la rMOMP proteins are set out below. For serovars J and la, Primer Nos. 2A and 2B were utilizing for cloning. The primers utilized for cloning of MOMP from serovars E and F are provided below. Sequencing of cloned proteins from all serovars was done using the T7 and 7294. BB primers.
Sequence of Primers used for sequencing (5 ' 3 ')
T7: TAA TAC GAC TCA CTA TAG GG (SEQ ID NO: 4)
7294.BB: TAT GCT AGT TAT TGC TCA GCG GTG (SEQ ID NO: 5) Sequence of Primers used for Cloning (5 '→ 3 ')
Primer No.2A: GCA TGA CAT ATG CCT GTG GGG AAT CCT GC
(SEQ ID NO: 6)
Primer No. 2B: CGA TCG GGA TCC TTA GAA GCG GAA TTG TGC ATT TAC (SEQ ID NO:7)
Predicted Amino Acid Sequence of Inserted Coding Sequence (SEQ ID NO: 8)
1 MPVGNPAEPS LMIDGILWEG FGGDPCDPCA TWCDAISMRV GYYGDFVFDR
51 VLKTDVNKEF QMGAKPTTDT GNSAAPSTLT ARENPAYGRH MQDAEMFTNA
101 ACMALNIWDR FDVFCTLGAT SGYLKGNSAS FNLVGLFGDN ENQKTVKAES
151 VPNMSFDQSV VELYTDTTFA WSVGARAALW ECGCATLGAS FQYAQSKPKV
201 EELNVLCNAA EFTINKPKGY VGKEFPLDLT AGTDAATGTK DASIDYHEWQ
251 ASLALSYRLN MFTPYIGVKW SRASFDADTI RIAQPKSATA IFDTTTLNPT
301 IAGAGDVKTG AEGQLGDTMQ IVSLQLNKMK SRKSCGIAVG TTIVDADKYA
351 VTVETRLIDE RAAHVNAQFR F
MOMP Serovar E
atgcctgtggggaatcctgctgaaccaagccttatgatcgacggaattctgtgggaaggtttcggcggagat ccttgcgatccttgcaccacttggtgtgacgctatcagcatgcgtatgggttactatggtgactttgttttc gaccgtgttttgaaaacagatgtgaataaagaattccaaatgggtgacaagcctacaagtactacaggcaat gctacagctccaaccactcttacagcaagagagaatcctgcttacggccgacatatgcaggatgctgagatg tttacaaatgccgcttgcatggcattgaatatttgggatcgctttgatgtattctgtacactaggagcctct agcggataccttaaaggaaactctgcttctttcaatttagttggattgtttggagataatgaaaatcaaagc acggtcaaaacgaattctgtaccaaatatgagcttagatcaatctgttgttgaactttacacagatactgcc ttctcttggagcgtgggcgctcgagcagctttgtgggagtgcggatgtgcgactttaggggcttctttccaa tacgctcaatctaaacctaaagtcgaagaattaaacgttctctgtaacgcagctgagtttactatcaataag cctaaaggatatgtagggcaagaattccctcttgcactcatagcaggaactgatgcagcgacgggcactaaa gatgcctctattgattaccatgagtggcaagcaagtttagctctctcttacagattgaatatgttcactccc tacattggagttaaatggtctcgagcaagttttgatgccgatacgattcgtatagcccagccaaaatcagct acagctatctttgatactaccacgcttaacccaactattgctggagctggcgatgtgaaagctagcgcagag ggtcagctcggagataccatgcaaatcgtctccttgcaattgaacaagatgaaatctagaaaatcttgcggt attgcagtaggaacgactattgtagatgcagacaaatacgcagttacagttgagactcgcttgatcgatgag agagctgctcacgtaaatgcacaattccgcttctaa (SEQ ID NO: 10)
MPVGNPAEPS LMIDGILWEG FGGDPCDPCT TWCDAISMRM GYYGDFVFDR VLKTDVNKEF QMGDKPTSTT GNATAPTTLT ARENPAYGRH MQDAEMFTNA ACMALNIWDR FDVFCTLGAS SGYLKGNSAS FNLVGLFGDN ENQSTVKTNS VPNMSLDQSV VELYTDTAFS WSVGARAALW ECGCATLGAS FQYAQSKPKV EELNVLCNAA EFTINKPKGY VGQEFPLALI AGTDAATGTK DASIDYHEWQ ASLALSYRLN MFTPYIGVKW SRASFDADTI RIAQPKSATA IFDTTTLNPT IAGAGDVKAS AEGQLGDTMQ IVSLQLNKMK SRKSCGIAVG TTIVDADKYA VTVETRLIDE RAAHVNAQFR F (SEQ ID NO: 11)
Sequence of Primers used for Cloning (5 '→ 3 ')
9494. JL: CCTGTGGGGAATCCTGCTGAA (SEQ ID NO: 18)
9502. JL: TTTGGGTCGACCTATTAGAAGCGGAATTGTGCATTTACGTGA ( SEQ ID NO: 19)
MOMP Serovar F
atgcctgtggggaatcctgctgaaccaagccttatgatcgacggaattctgtgggaaggtttcggcggagat ccttgcgatccttgcaccacttggtgtgacgctatcagcatgcgtatgggttactatggtgactttgttttc gaccgtgttttgaaaacagatgtgaataaagagtttgaaatgggcgaggctttagccggagcttctgggaat acgacctctactctttcaaaattggtagaacgaacgaaccctgcatatggcaagcatatgcaagacgcagag atgtttaccaatgccgcttgcatgacattgaatatttgggatcgttttgatgtattctgtacattaggagcc accagtggatatcttaaaggaaattcagcatctttcaacttagttgggttattcggcgatggtgtaaacgcc acgaaacctgctgcagatagtattcctaacgtgcagttaaatcagtctgtggtggaactgtatacagatact acttttgcttggagtgttggagctcgtgcagctttgtgggaatgtggatgtgcaactttaggagcttctttc caatatgctcaatctaaacctaaaatcgaagaattaaacgttctctgtaacgcagcagagtttactattaat aaacctaaagggtatgtaggtaaggagtttcctcttgatcttacagcaggaacagatgcagcgacgggcact aaagatgcctctattgattaccatgagtggcaagcaagtttatctctttcttacagactcaatatgttcact ccctacattggagttaaatggtctcgtgcaagctttgattctgatacaattcgtatagcccagccgaggttg gtaacacctgttgtagatattacaacccttaacccaactattgcaggatgcggcagtgtagctggagctaac acggaaggacagatatctgatacaatgcaaatcgtctccttgcaattgaacaagatgaaatctagaaaatct tgcggtattgcagtaggaacaactattgtggatgcagacaaatacgcagttacagttgagactcgcttgatc gatgagagagctgctcacgtaaatgcacaattccgcttctaa (SEQ ID NO: 12)
MPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTD KEFEMGEALAGASGN TTSTLSKLVERTNPAYGKHMQDAEMFTNAACMTLNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDG A TKPAADSIPNVQLNQSWELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKIEELNVLCNAAEFTIN KPKGYVGKEFPLDLTAGTDAATGTKDASIDYHEWQASLSLSYRLNMFTPYIGVKWSRASFDSDTIRIAQPRL VTPWDITTLNPTIAGCGSVAGANTEGQISDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLI DERAAH AQFRF (SEQ ID NO: 13)
Sequence of Primers used for Cloning (5 '→ 3 ')
9494.JL: CCTGTGGGGAATCCTGCTGAA (SEQ ID NO: 20)
MOMP-RK: GGGGTACCCTATTAGAAGCGGAATTGTGCATTTACGTGA (SEQ ID NO: 21)
MOMP Serovar J
atgcctgtggggaatcctgctgaaccaagccttatgatcgacggaattctgtgggaaggtttcggtggagat ccttgcgatccttgcaccacttggtgtgacgctatcagcatgcgtatgggttactatggtgactttgttttc gaccgtgttttgaaaacagatgtgaataaagaatttcagatgggagcggcgcctactaccagcgatgtagca ggcttacaaaacgatccaacaacaaatgttgctcgtccaaatcccgcttatggcaaacacatgcaagatgct gaaatgtttacgaacgctgcttacatggcattaaatatctgggatcgttttgatgtattttgtacattggga gcaactaccggttatttaaaaggaaactccgcttccttcaacttagttggattattcggaacaaaaacacaa gcttctagctttaatacagcgaatctttttcctaacactgctttgaatcaagctgtggttgagctttataca gacactacctttgcttggagcgtaggtgctcgtgcagctctctgggaatgtgggtgtgcaacgttaggagct tctttccaatatgctcaatctaaacctaaagtagaagagttaaatgttctttgtaatgcatccgaatttact attaataagccgaaaggatatgttggggcggaatttccacttgatattaccgcaggaacagaagctgcgaca gggactaaggatgcctctattgactaccatgagtggcaagcaagtttagccctttcttacagattaaatatg ttcactccttacattggagttaaatggtctagagtaagttttgatgccgacacgatccgtatcgctcagcct aaattggctgaagcaatcttggatgtcactactctaaacccgaccatcgctggtaaaggaactgtggtcgct tccggaagcgaaaacgacctggctgatacaatgcaaatcgtttccttgcagttgaacaagatgaaatctaga aaatcttgcggtattgcagtaggaacgactattgtagatgcagacaaatacgcagttacagttgagactcgc ttgatcgatgagagagcagctcacgtaaatgcacaattccgcttctaa (SEQ ID NO: 14)
MPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTD KEFQMGAAPTTSDVA GLQNDPTTNVARPNPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLKGNSASFNLVGLFGTKTQ ASSFNTANLFPNTALNQAWELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFT INKPKGYVGAEFPLDITAGTEAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQP KLAEAILDVTTLNPTIAGKGTWASGSENDLADTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETR LIDERAAHWAQFRF (SEQ ID NO: 15)
MOMP Serovar la
atgcctgtggggaatcctgctgaaccaagccttatgatcgacggaattctgtgggaaggtttcggcggagat ccttgcgatccttgcaccacttggtgtgacgctatcagcatgcgtatgggttactacggagactttgttttc gaccgtgttttgaaaacagatgtgaataaagaatttcagatgggagcggcgcctactaccaaggatatagca ggcttagaaaacgatccaacaacaaatgttgctcgtccaaatcccgcttatggcaaacacatgcaagatgct gaaatgtttacgaacgctgcttacatggcattaaatatctgggatcgttttgatgtattttgtacattggga gcaactaccggttatttaaaaggaaactccgcttccttcaacttagttggattattcggaacaaaaacacaa tcttctaactttaatacagcgaagcttattcctaacgctgctttgaatcaagctgtggttgagctttataca gacactacctttgcttggagcgtaggtgctcgtgcagctctctgggaatgtgggtgtgcaacgttaggagct tctttccaatatgctcaatctaaacctaaagtagaagagttaaatgttctttgtaatgcatccgaatttact attaataagccgaaaggatatgttggggcggaatttccacttgatattaccgcaggaacagaagctgcgaca gggactaaggatgcctctattgactaccatgagtggcaagcaagtttagccctgtcttacagattaaatatg ttcactccttacattggagttaaatggtctagagtaagttttgatgccgacacgatccgtatcgctcagcct aaattggctgaagcaatcttggatgtcactactctaaacccgaccatcgctggtaaaggaactgtggtcgct tccggaagcgataacgacctggctgatacaatgcaaatcgtttccttgcagttgaacaagatgaaatctaga aaatcttgcggtattgcagtaggaacgactattgtagatgcagacaaatacgcagttacagttgagactcgc ttgatcgatgagagagcagctcacgtaaatgcacaattccgcttctaa (SEQ ID NO: 16)
MPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTD KEFQMGAAPTTKDIA GLENDPTTNVARPNPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLKGNSASFNLVGLFGTKTQ SSNFNTAKLIPNAALNQAWELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFT INKPKGYVGAEFPLDITAGTEAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQP KLAEAILDVTTLNPTIAGKGTWASGSDNDLADTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETR LIDERAAH AQFRF (SEQ ID NO: 17)
EXAMPLE 2
This example illustrates one embodiment of the process for purification and refolding of recombinant MOMP for immunization.
MOMP protein derived from the mouse pneumonitis strain (MoPn) and two human serovars (serovars D and E) of C. trachomatis were each independently expressed in E. coli, grown in fermenters, and subjected to a purification and folding procedure. A schematic diagram of the method is set out in Figure 1 and is described further below. This embodiment of the purification and refolding process of the present invention uses, for illustrative purposes, MOMP cloned from serovar D of C. trachomatis .
Briefly, E. coli cells expressing recombinant serovar D of C. trachomatis MOMP (cloned in substantial accordance with the teaching of Example IB) were grown in a shake flask at 37°C overnight, after which the culture is used to inoculate a 20L fermenter with an initial OD of 0.5. The fermentation was carried out under the following conditions: 37 °C, pH 6.8, 30% dissolved oxygen, 700-1200 rpm agitation. Fermentation was carried out in a fed-batch mode using a pH- stat method. Glucose was fed into the fermenter to maintain a glucose concentration between 0 to 2 g/L. The culture was induced with ImM IPTG, and then grown for 4-6 hours. The final fermenter OD reached approximately 30-40.
Primary Recovery step (Preparation of Inclusion Body Fraction): The fermenter broth was harvested and concentrated using 0.2 μηι tangential flow filtration (TFF) unit. Cell disruption was performed at 13000 psi using a homogenizer. Typically, a centrifugation step was followed by homogenization to remove most impurities and to reduce viscosity of the homogenate. Alternatively, lysozyme was added to the thawed broth following centrifugation. The inclusion bodies (IBs; sedimentable detergent insoluble MOMP of a purity of about 50 %) were then washed with buffer containing Triton X-100.
Purification step:
The IB pellets were solubilized in 6M guanidine hydrochloride (a charged denaturant) and following solubilization, this denaturant was exchanged with 8M urea (a non-charged denaturant) using tangential flow filtration (TFF). The urea solution was applied to a chromatography column containing a Q-type anion exchange material column (Q Ceramic HyperD® 20 Chromatography Sorbent, Pall Corporation). In this chromatography step, the running, washing, and elution buffers used also contained about 8 M urea at a pH of about 8.5 (pH range 7.5 to 9.0) to maintain the protein denatured and soluble throughout the purification procedure. The recombinant MOMP protein was eluted from the column with 50-90 mM sodium chloride. The purity of the resulting protein was evaluated by SDS-PAGE (see Figure 2). Protein gel densitometry following Coomassie staining indicated a purity of approximately 90% or greater.
Folding step:
A TFF approach was used to exchange buffer solutions in the rMOMP sample. Briefly, the pooled eluate from the chromatography step was mixed with equal volumes of about 10% v/v of the detergent sodium N-lauroyl sarcosine (NLS) (range for NLS is about 6 to 10% v/v), and 1 M 1-arginine; DTT was added to a final concentration of 10 mM. This mixture was then subjected to TFF diafiltration using a 10 kDa MWCO membrane filter, in which the replacement
(diafiltration) buffer was about 10 mM Tris-HCl pH 8, 0.06% NLS. Filtration continued until approximately 10 sample volumes of the diafiltration buffer passed through the filter. The retentate, designated TFF1, optionally underwent a second TFF procedure with diafiltration buffer of 50 mM Tris-HCl, pH 8.0, resulting in a fraction designated TFF2.
Samples of the rMOMP protein were taken throughout the process at various stages and were assessed by SDS-PAGE. A representative SDS-PAGE get is set out in Figure 2.
The above-described purification and folding method was also applied to rMOMP derived from MoPn and to rMOMP derived from C. trachomatis serovar E, with similar results. This method may also be applied to rMOMP derived from the other C. trachomatis serovars (e.g. F, la, and J) and from serovars of C. pneumoniae.
The rMOMP derived from MoPn demonstrated immunological protection in at least one animal study using a mouse protection model, and recognition of at least one conformational epitope by a monoclonal antibody that specifically recognizes native MOMP.
These data indicate that the method resulted in a purified yet denatured target protein and that renaturation (and a return to aqueous solubility) was achieved by the subsequent protein folding process. The diafiltration of a volume of purified denatured rMOMP in urea (8M) mixed with equal volumes of small molecule additives such as for example, arginine (1M) and NLS (30% v/v) can be used to refold the denatured protein.
EXAMPLE 3
This example describes an alternative process for preparing rMOMP from C. trachomatis serovars D, E, F, J and la using Urea and pH shock (as a denaturing agent rather than guanidine hydrochloride) and a reduced concentration of NLS.
A number of lab scale lots of rMOMP from C. trachomatis serovars D (3 lots), E (3 lots), J (2 lots) and la (1 lot) were prepared. First, rMOMP was cloned from each of serovar in substantial accordance with the teaching set out in Example IB. IB fractions/pellets were prepared in substantial accordance with the teaching set out in Example 2 and were then subjected to the purification and folding process described further below.
Purification: The IB fraction/pellet was mixed at a ratio of 20 mL/g wet weight with a solubilization buffer containing about 25 mM KCl, 25 mM NaOH, 8 M urea at a pH of approximately 12.5. The pH of the mixture was adjusted following re-suspension of the pellet to about 12.5. Following incubation at room temperature, the mixture was subjected to centrifugation (10397 g, 4°C). The supernatant, containing solubilized rMOMP, was mixed with an equal volume of buffer (50 mM Tris-HCl pH 7.0 and 8M urea), and the pH was adjusted with 6 N HC1 to pH 8.5. DTT was added to achieve a concentration of 10 mM. Conductivity was reduced to 2.0-2.5 mS by dilution with a buffer of 50 mM Tris-HCL (pH 8.5), 8 M urea, 1 mM EDTA and the solution was then filtered. Chromatographic operations were carried out using an AKTA Explorer 100 (G.E. Healthcare) chromatography unit with a column packed with Pall BioSepra Q Ceramic HyperD F anion exchange sorbent.
Following column equilibration (using an equilibration buffer of 50 mM Tris-HCl, pH 8.5; 8 M urea; 1 mM EDTA), 120-240 mL of the solubilized rMOMP mixture was loaded onto the column. Following collection of the flow-through and chase fractions, a wash step of 3-5 CV ensued with the equilibration buffer (to which had been added 20-40 mM NaCl). Elution was performed with equilibration buffer (containing 40-90 mM NaCl), and fractions were collected. The concentration of sodium chloride (NaCl) in the wash and elution buffers was adjusted for each serovar based on empirical experimentation; suitable NaCl concentrations in wash buffer ranged from 20-40 mM NaCl, and in elution buffers ranged from of NaCl in suitable wash buffers ranged from 40-90 mM NaCl.
In subsequent studies, to increase the purity of the resultant rMOMP protein an additional purification step using CEX chromotography in the flow-through mode was added upstream of the AEX step. The CEX step was conducted at a pH of 5.5-6 after which the solution pH was adjusted to 8.5 for the AEX step. However, since the CEX step is conducted at a pH of approximately 5.5 which is close to the pi of rMOMP (~ 4.8), a second pH shock step may be added before the AEX step to help avoid the development of soluble aggregates.
Refolding procedure: The refolding procedure involved the reduction of rMOMP 's disulfide bonds with DTT (e.g., by adding about lOmM DTT), the addition of the small molecule additive 1-arginine, (e.g. about 333 mM), and the addition of the small molecule additive (and detergent) n-lauroyl sarcosine (NLS), (e.g. about 2% NLS). The mixture was then subjected to diafiltration, which is briefly described below.
1. Following the addition of the arginine and NLS solutions, the mixture was concentrated by TFF (using TFF filtration apparatus, Sartocon 2Plus unit with Sartorius
Hydrosart cassettes) until it reached the original rMOMP sample volume (i.e., approximately a threefold reduction).
2. TFF was operated in the diafiltration mode for approximately five volumes of Tris buffer.
3. The mixture was diluted 1 :3 with Tris buffer, and subjected to a further
(approximately) 5 volumes of diafiltration with Tris buffer, while maintaining the diluted volume. 4. The mixture was concentrated (approximately) threefold by TFF recovered from the TFF device, and EDTA was added to achieve a concentration of 1 mM.
Protein concentration was estimated by micro BCA assay. Endotoxin was assessed (Endo safe; Charles River Labs) and NLS content was estimated spectrophotometrically using a wavelength of 210 nm. SDS-PAGE gel protein analysis with scanning densitometry was used to assess for protein purity, and protein conformation was assessed by Blue Native PAGE (representative gels are provided in Figures 3,6A,B,C).
The procedure described above was executed in a similar manner for all five MOMP serovars, with satisfactory results. The display of characteristic ladder patterns was evident with BN-P AGE gels. Residual NLS content following folding was in the range 0.175-0.30 %. The reduction of NLS concentration in the final product was significant as earlier studies in mouse models indicated that the concentration of residual NLS in the final product is preferably < 0.5%.
The purity of the final protein product was assessed by SDS-PAGE with scanning densitometry. Table 3 presents a summary of the purity (percent of total protein) and yield (expressed as mg bulk rMOMP product per gram wet weight of IB) obtained in preparing lots. In the case of serovars D and E, the mean of three lots is provided.
Table 3
Purity and Yield results for rMOMP from 4 C. trachomatis serovars
Figure imgf000029_0001
In all cases a characteristic ladder pattern on blue native PAGE gels was noted; as such, oligomeric forms of rMOMP were present in sample.
These data indicate that outer membrane proteins (e.g. , MOMP) may be prepared in accordance to the process described (i.e., using pH shock). More particularly, these data indicate that reducing the NLS concentration in the refolding process to a final concentration of 2% does not adversely effect the refolding process and results in a final protein product with a reduced concentration of residual NLS (e.g., <0.5). EXAMPLE 4
This example describes a process utilized for preparing pilot scale lots of rMOMP from C.
trachomatis serovar E for immunization.
Preceding examples have related to lab scale lot processes. Such processes are at a scale sufficient to provide a protein preparation sufficient for characterization and animal studies and typically, start with 6-12 g of MOMP IB material. For pilot scale lots, the MOMP production process is sufficiently scaled up such that 50% of the product of a 20 L fermenter run can be processed in one series of unit operations.
C. trachomatis Serovar E rMOMP was cloned in substantial accordance to the procedure set out in Example IB. An inclusion body fraction of the protein was prepared substantially in accordance with the procedure set out in Example 2 except that fermentation was conducted using a 20L fermenter.
Purification: The IB fraction/pellet was mixed in a solubilization buffer (of 25 mM KCl, 25 mM NaOH and 8 M urea at pH 12.5) at a ratio of approximately 20 mL/g wet weight of IB pellet. The mass of Ser E MOMP IB pellet used was about 118.5 g. The pH was adjusted with NaOH following re-suspension of the pellet to about 12.5, and the mixture was incubated at room temperature with gentle agitation for 40 min. Following incubation, the mixture was subjected to centrifugation (10397 g, 20 min, 4°C). The supernatant, containing solubilized rMOMP, was mixed with an equal volume of buffer containing 50 mM Tris-HCl pH 7.0, and 8M urea, and the pH was adjusted with 6 N HC1 to pH 8.5. DTT was added to the solution to achieve a concentration of 10 mM. The conductivity of the solution was checked with a conductivity meter, and was reduced to 2.0-2.5 mS by dilution with 50 mM Tris-HCL pH 8.5, 8 M urea, 1 mM EDTA. The solution was filtered through a dead end 0.22 um filter; the final volume was 5.5 L.
Chromatographic operations were carried out using an AKTA Pilot (G.E. Healthcare) chromatography unit with a column (BPG100, G.E. Healthcare) packed with Pall BioSepra Q Ceramic HyperD F anion exchange sorbant. The column was washed, regenerated, and equilibrated as previously described at the lab scale (as described in Example 3). The flow rate for all operations, unless noted otherwise, was 160 mL/min. Following column equilibration (using an equilibration buffer of 50 mM Tris-HCl, pH 8.5; 8 M urea; 1 mM EDTA), 5 L of the starting material was loaded onto the column. The chase volume (with equilibration buffer) was about 4 CV, and this was followed by a wash step at about 5 CV with equilibration buffer to which was added NaCl to 25 mM. A suitable range of NaCl concentration in wash buffer is 20 mM - 40 mM and a preferred concentration is 20 mM NaCl. Elution was performed with 4.5 CVs equilibration buffer containing 75 mM NaCl. A suitable range of NaCl concentration in elution buffer is 40 mM - 90 mM and a preferred concentration is 40 mM NaCl.
In subsequent studies, to increase the purity of the resultant rMOMP protein an additional purification step using CEX chromotography in the flow-through mode was added upstream of the AEX chromatographic step. The CEX step was conducted at a pH of 5.5-6 after which the solution pH was adjusted to 8.5 for the AEX step. However, since the CEX step is conducted at a pH of approximately 5.5 which is close to the pi of rMOMP (~ 4.8), a second pH shock step before the AEX step may also be included to avoid the development of soluble aggregates.
Prior to diafiltration, 3.9 g DTT was added to the purified rMOMP pool, resulting in a concentration of 10 mM. To this was added 2.5 L of 1 M 1-arginine, followed by 2.5 L 6% v/v NLS; each of these solutions having been prepared in a buffer containing 50 mM Tris-HCl, pH 8. The rMOMP-arginine-NLS mixture was then mixed at room temperature.
MOMP folding procedure: The purified rMOMP was treated with DTT, arginine, and NLS, followed by a two part TFF operation which induces folding and reduces residual NLS detergent. The refolding procedure involved the reduction of rMOMP's disulfide bonds with DTT (e.g., about lOmM DTT), the addition of the molecular chaperone, 1-arginine, (e.g. about 333 mM), and the addition of the detergent n-lauroyl sarcosine (NLS), (e.g. about 2% NLS).
The MOMP-arginine-NLS mixture (7.5L) was then subjected to the two-part TFF operation, substantially as described in Example 3. Volume reduced 3 fold to 2.5L with filtrations. Diafiltration ensued for 7 volumes, using a diafiltration buffer consisting of 50 mM Tris-HCL pH 8. The solution was then diluted 1 :3 (to 7.5L) with 50 mM Tris-HCL pH 8, then another 7 volume diafiltration step with the diafiltration buffer containing 0.1% v/v NLS. Following the second diafiltration, the material was concentrated to 1.2L and EDTA (ImM) was added.
The TFF operations had a total elapsed time of ~ 2.5 h, similar to the target time established for lab scale (2-4 h). Previous investigations found that prolonged TFF folding, originally adopted to reduce shear forces and provide a gentler environment, was in fact deleterious to the folding attempt, in which the development of aggregated protein as indicated by BN-PAGE gel analysis occurred. The folding process was considered successful if the resulting protein product was soluble in aqueous buffers at > lmg/mL, and the characteristic ladder pattern in BN-PAGE gels was evident. The presence of discrete bands of MOMP protein over a range of molecular weights is indicative of multimeric units (somewhat analogous to the putative trimeric state found with the native protein). Figure 3 illustrates BN-PAGE gel patterns with the pilot scale lot and three lots of lab scale Ser E rMOMP protein. Patterns are similar, with the presence of a ladder consisting of at least four bands of similar apparent molecular weight. Additionally, there is little evidence of monomelic rMOMP, normally seen just below the 66 kDa marker (not shown).
The purity of the final protein product was assessed by scanning densitometry of SDS- PAGE gels. Figure 4 shows an image of an SDS-P AGE purity gel for the pilot Ser E lot. Protein purity was assessed as approximately 88% by scanning densitometry, with a low molecular weight band accounting for 6% of the total protein. The percentage assessed may be an underestimate of MOMP purity as putative MOMP related bands (fragments, complexes) on the gel were not identified.
The concentration of residual components was assessed and considered well within appropriate limits: endotoxin content was 0.005 EU^g protein, and residual NLS was 0.49% (i.e., approximately 0.24% at 1 mg/mL).
MOMP Serovar F
Similar results were obtained when a pilot scale lot of Serovar F rMOMP was prepared in substantial accordance to the process used for Serovar E rMOMP: total yield of purified/folded MOMP was 6.15 g; 89.8-90.5 % protein purity; 0.007 EU^g endotoxin content; 0.31% v/v residual NLS.
These data indicate that the purification and folding process is adaptable for use as a large scale process to manufacture recombinant protein in commercially significant amounts. EXAMPLE 5
This example illustrates the evaluation of the effects of process modifications on protein purity.
C. trachomatis rMOMP was cloned from serovar E in substantial accordance with the teaching set out in Example IB. IB fraction/pellet of the recombinant protein was prepared in substantial accordance with the teaching set out in Example 2. A wash buffer was prepared consisting of 50 mM Tris-HCl pH 8.0, 2 M Urea, 0.5% v/v/ NLS. Thawed IB material was mixed with NLS buffer at 20 mL per IB gram for approximately 30 minutes. The IB mixture was divided equally into centrifuge bottles and then centrifuged. The supernatant was decanted and the pellet (with the target protein) was retained and was subjected to a purification and folding process in substantial accordance to the teaching in Example 3. Protein concentration was estimated by BCA assay and purity was assessed by SDS- PAGE with scanning densitometry. A number of lab scale lots were similarly prepared using an IB fraction wash buffer with either 0.5% NLS or 0.5% Triton X-100, and 2 or 4 M urea.
The effect of NaCl concentration in the purification process on protein purity was also evaluated. An IB fraction prepared in substantial accordance with the teaching of Example 2 was divided into multiple samples. One sample of the IB fraction was subjected to a purification and folding process in substantial accordance to the method described in Example 3. A second sample of the IB fraction was first washed (in substantial accordance to the method described above in this Example) and was then subjected to substantially the same purification and folding process as was the first sample of the IB fraction except that the NaCl concentration in the wash buffer and the elution buffer was increased from 15 mM to 20 mM and 30 mM to 40 mM, respectively.
Protein concentration and purity of the resulting purified and folded protein product from each of samples 1 and 2 was estimated by BCA assay and SDS-PAGE with scanning densitometry, respectively. The resulting SDS-PAGE gels are illustrated in Figure 5. The left panel illustrates a gel with samples (run in three lanes) from the first preparation and the right panel illustrates a gel with three lanes loaded with samples from the second preparation. In both gels, lanes are loaded in triplicate with 4 μg of protein. With the first preparation, the purity of the resulting material was approximately 75% whereas with the second preparation, protein purity was approximately 98%. A number of lab scale and pilot scale lots have been prepared using the additional IB buffer wash and increased NaCl concentration and similar increases in protein purity have been noted (with an average increase in protein purity was about 10%, and providing protein with a purity as high as 100%).
These data indicate that the washing the IB pellet with a suitable buffer before subjecting it to the purification and folding process increases protein purity without adversely affecting protein yield. Subjecting the IB fraction/pellet to an NLS buffer wash before the purification process and increasing the concentration of NaCl in the wash buffer and the elution buffer of the purification process increases protein purity (without adversely affecting protein yield, folding, and solubility). These results were surprising since repeated washing of IB fractions in buffers of various urea stringencies (concentrations) had previously resulted in decreased yield.
EXAMPLE 6
This example describes the evaluation of the immunogenicity of the rMOMP (purified and refolded in accordance to the process of the present invention) in an animal model.
Recombinant MOMP derived from C. trachomatis serovar E was prepared in substantial accordance with the teaching of Example 4. Each dose of immunization contained 5C^g of rMOMP protein and adjuvant [i.e., ADJ.A, ADJ.SQ, aluminum hydroxide (Alhydrogel), Montanide/CpG] in a volume of 50μ1. Blood samples were taken periodically following immunization in order to conduct a number of tests, including detection of anti-Chlamydia antibodies by ELISA, quantification of total IgG and Thl/Th2 sub-typing.
Groups of female BALB/c mice (15 per group) (Charles River) were immunized intramuscularly three times, at approximately 3 week intervals with 50μ1 of the applicable composition (as noted in Table 4). The mice were approximately 7-8 weeks of age at the time of the 1st immunization. As a control, 4 groups were administered compositions of adjuvanted Ovalbumin. Pre-bleed samples were obtained approximately 4 days before the first immunization.
Table 4: Vaccine component and volume to inoculate per mouse
Figure imgf000034_0001
Formulations were freshly prepared before each immunization. Antigens, buffers and adjuvants were stored at 4°C. First, antigen (i.e. , Ovalbumin or rMOMP) 15 μg/dose was diluted in buffer 50 mM Tris, pH 8.0, 0.1% NLS (30μ1Λ1θ8ε). To this mixture the applicable adjuvant was added, plus buffer when necessary to obtain an immunization dose of 50μ1.
Aluminum adjuvant used is the one called Alhydrogel which is aluminum oxyhydroxyde or AIOOH, at a concentration of 9.9 mg/ml. The final quantity of aluminum in the immunization doses is 50μg/dose
Adjuvant A (AD J. A) was prepared as follows: In a 1st container, the following ingredients were mixed, under agitation and at 40°C: 39.37g of Phosphate Buffer, (Eurobio); 4.68g of mannitol, (Roquette); 4.822g of EumulginTM B l, (Cognis); and 20.3 mg of E6020 (Eisai). This aqueous phase had a weight of 48.91g. In a 2nd container, 30.48g of squalene were mixed with 4.52g of Montane TM80 under agitation at ambient temperature. This oily phase had a weight of 35g.
When both phases were homogeneous, 29.1 lg of the oily phase was incorporated into the aqueous phase. The mixture was then gently agitated, and put in an oily bath at 80-90°C, under still gentle agitation (300rpm). When the mixture reached 75°C, the emulsion was taken out of the oily bath and put on ice, while agitation was maintained at about 250 rpm. When the temperature of the mixture returned to ambient temperature, a homogeneous thermoreversible oil- in-water emulsion was obtained, in which more than 90% of the population by volume of the oil droplets had a size < 200nm and in which the composition by weight was as follows: 32.5% of squalene, 6.18% of ceteareth-12 (EumulginTMB l), 4.82% of sorbitan monooleate (MontaneTM80), 6% of mannitol, 0.026% of E6020 and 50.5% of PBS. This stock solution was then diluted at 1/5 with phosphate buffer (IX) to obtain an emulsion having 6.5% squalene.
About 5 minutes to 1 hour in advance of the applicable immunization, antigen samples ( 10 μg of antigen suspended in 25 μΐ buffer) was gently mixed with 25 μΐ of adjuvant. Volume of composition inoculated was 50 μΐ.
The second Adjuvant, ADJ.SQ, was prepared from a stock solution prepared as ADJ.A's with the exception that no E6020 was included. As such, the stock solution of ADJ.SQ was diluted at 1/6.5 with PBS to get an emulsion comprising 5% squalene.
As the concentration of squalene and surfactants were higher in ADJ.A than in ADJ.SQ, the preparation of the formulations utilized for the immunizations were different for both adjuvants to obtain the same final concentration of 2.5% squalene in the immunization doses (although, inadvertently, for the 1st immunization, the final concentration of squalene in the ADJ.SQ group was 2%). One mouse from group B was found dead 4 days before the 3r immunization (and was bled out). Sera was collected from immunized animals about 2 weeks post-immunization and was pooled for each group to assess antibody response by ELISA.
Mice were euthanized and their spleens removed aseptically. Single cell suspensions were prepared. Splenocytes from mice belonging to the same group were pooled and were pelleted by centrifugation. Erythrocytes in the suspension were lysed. The cell suspension was transferred to another tube and centrifuged to pellet the cells. Process was repeated to ensure that most of the erythrocytes were lysed. The cell pellet was resuspended, cells were counted and plated. Cells were stimulated with Ovalbumin, rMOMP, UV-inactivated C. trachomatis MoPn EB MOMP, or PMA.
Isotyping analysis of the antibody profile generated was done using ELISA based reagents. Induction of Thl/Th2 responses was analyzed by quantifying the antigen-specific IgG2a (Thl) and IgGl (Th2) antibody response and by measuring levels of cytokines (e.g., IFN-γ (Thl), interleukin-10 (Th2) in antigen-stimulated splenocyte culture (i.e. , by assaying in vitro cytokine production by splenic T cells).
A summary of the ELISA results and the cytokine profile by MSD analysis are set out in Tables 5 and 6.
Table 5
Figure imgf000036_0001
Table 6 MSD Analysis
INFy IL-10 IL-4 IL-5 IL-2 IL-
12(p70)
OVA+ADJ.A 845.5 2890.1 295.0 3472.5 1656.6 99.7
OVA+ADJ.SQ 323.1 244.4 70.2 1475.7 1116.7 49.7
OVA+Alum (AIOOH) 816.0 267.8 79.8 194.1 1729.9 101.6
OVA+CpG Montanide 316.8 95.6 38.7 68.8 1119.3 24.4 rMOMP alone 930.5 9343.5 392.2 8975.5 1000.0 146.6 rMOMP+ADJ.A 14747.1 18601.1 1365.4 13504.6 4231.4 857.0 rMOMP+ ADJ.SQ 1364.1 1113095.5 1189.8 40230.4 830.6 896.6 rMOMP+Alum 1440.9 5222.7 501.9 8194.6 1897.6 301.9 rMOMP+CpG/Montanide 3818.3 6349.9 810.6 266.1 1147.3 258.4
In accordance to the EB-ELISA (antibody) results, the immunogenic composition with unadjuvanted rMOMP was weakly immunogenic and of the IgG classes tested, solely IgGl was detectable. The carrier Aluminum hydroxide was not an effective adjuvant for rMOMP. Adjuvanting rMOMP with the other carrier, ADJ.SQ, elicited strong immune responses (i.e., total IgG) but the response was pre-dominantly a Th2 type, not a Thl/Th2 balanced response (e.g., no detectable IgG2a was elicited). Adjuvanting rMOMP with ADJ.A (an adjuvant comprising E6020) or CpG/Montanide elicited strong immune responses with balanced Thl/Th2 subclasses, at comparable levels. In addition, ADJ.A switched the immune profile induced by un-adjuvanted rMOMP from an IgGl only, to a balanced Thl/Th2 antibody response.
The capacity of the sera from immunized mice to neutralize C. trachomatis serovar E was assessed with an in vitro neutralization assay against serovar E EBs. The in vitro neutralization assay was performed substantially as follows: The assay utilized 96 well round bottom plates. Dilutions of each serum sample were prepared using PBS and 5% baby rabbit complement (Sigma). Into each dilution sample well, 1500 IFU/50 μΐ of EBs from C. trachomatis (diluted in PBS + 5% baby rabbit complement just prior to use), was added and the mixtures were incubated at 37°C for 45 minutes with gentle rocking. A 96 well plate containing a HeLa cell monolayer (of HeLa cells seeded at 5 x 104 cells/well, about 24 hours earlier) was prepared and 50μ1 of each dilution sample was transferred to sample wells in the HeLa cell monolayer plate. The plate was centrifuged for 60 minutes at room temperature at 1800 rpm. DMEM with L-glutamine and sodium pyruvate (Invitrogen) supplemented with 1 μg/ml cyclohexamide, 10% FBS, gentamicin was added to each sample well and plates were incubated at 35°C with 5% C02 for 44-48 hours. As controls, dilutions of EBs alone and dilutions of PBS + 5% baby rabbit complement sera alone were also prepared and added to specific wells of the HeLa cell plate.
Inclusion bodies were stained and the 50% neutralization titre was determined by calculating the value of percent neutralization for each of the sample dilutions by applying the formula, (IFU prebleed - IFU bleed)/IFU prebleed x 100. Alternatively, the value could be determined by taking the average of the control samples with EBs alone in place of prebleed IFU. For each sample, the 50% neutralization titre was the lowest dilution with a value greater or equal to 50% (e.g., if a 1 :400 dilution had 71% neutralization and a 1 : 800 had 34% neutralization, the 50% neutralization titre of that sample was 400). A summary of the results obtained are set out in Table 5.
These data show that neutralizing antibodies were detected in the group immunized with compositions comprising rMOMP and ADJ.A (comprising E6020). Although strong antibody responses (of predominantly IgGl subclass) were stimulated in mice immunized with compositions comprising rMOMP and ADJ.SQ, the sera from these mice had no detectable neutralizing capacity. Of the compositions administered, those including rMOMP adjuvanted with ADJ.A or CpG/Montanide stimulated neutralizing antibodies to serovar E.
EXAMPLE 7
Immunogenic compositions comprising rMOMP (2 different doses) adjuvanted with Adjuvant No. l (ADJ.A) with varying concentrations of a TLR4 agonist (E6020), were evaluated in an animal model.
Recombinant MOMP derived from C. trachomatis serovar E was prepared in substantial accordance with the teaching of Example 4. Groups of female CDI mice (6 to 12 per group) (Charles River) were immunized intramuscularly on three separate occasions (at about 3 week intervals) with 50μ1 of the applicable composition (as noted in Table 7). Two doses of antigen (rMOMP) were used, 10μg and 25μg. E6020 were tested at 3 doses, 0.25μg, 0^g and ^g. A group of mice was also tested with one carrier alone, this being the group with ADJ.SQ considered as 0μg of E6020. CD l is an outbred strain, in contrast to Balb/C which is an inbred strain. This outbred strain provides a more robust model and is more akin to humans (e.g., more diversified). The mice were approximately 7-8 weeks of age at the time of the 1st immunization. As a negative control, groups E and F were administered compositions of adjuvanted Ovalbumin. Pre-bleed samples were obtained a few days before the first immunization. Table 7: Vaccine component and volume to inoculate per mouse
Figure imgf000039_0001
Formulations were freshly prepared before each immunization. Proteins, buffers and adjuvant were stored at 4°C. Mixtures were prepared by diluting protein (Ovalbumin or rMOMP) in buffer (50mM Tris, pH 8.0, 0.1% NLS), 25μ1Λ1θ8ε and then adding to this mixture the applicable adjuvant. Mixtures including E6020 were vortexed on high for about lmin. Prepared formulations were placed on ice until required.
The adjuvants used in the present example were prepared in the following manner; ADJ.SQ was prepared as previously described in Example 6. ADJ.A was prepared as described in Example 6, and diluted by ADJ.SQ to reach the requisite concentration of E6020. This means that for Groups B, F and H, the ADJ.A used was the same as the one described in Example 6 having 5% squalene and 40 μg/ml of E6020. For Groups C and I, the ADJ.A used is the same as the one used for the preceding group which has been diluted once at ½ with ADJ.SQ to have a concentration of E6020 of 20μg/ml. And for Groups D and J, the ADJ.A used has been diluted once more at ½ by ADJ.SQ to have a concentration of E6020 which is 10μg/ml. One mouse from group F3 was found dead 2 days following the 2nd immunization (and was bled out). Sera was collected from immunized animals about 2 weeks post-immunization and was pooled for each group to assess antibody response by ELISA.
Mice were euthanized and their spleens removed aseptically. Single cell suspensions were prepared. Splenocytes from mice belonging to the same group were pooled. The splenocytes were restimulated in vitro with rMOMP (or as a control, with Ovalbumin, rMOMP, UV-inactivated C. trachomatis MoPn EB-MOMP, or PMA) for 3 days. The culture supernatants were collected and the cytokine production was measured for IFN-γ, IL-4, IL-5, and IL-10 by MSD. Isotyping analysis of the antibody profile generated was done using ELISA based reagents. Induction of Thl/Th2 responses was analyzed by quantifying the antigen-specific IgG2a (Thl) and IgGl (Th2) antibody response and by measuring levels of cytokines (e.g., IFN-γ (Thl), interleukin-10 (Th2) in antigen-stimulated splenocyte culture (i.e. , by assaying in vitro cytokine production by splenic T cells).
The ability of the elicited antibodies to neutralize C. trachomatis serovar E was assessed by neutralization assay which was conducted substantially in accordance to the assay described in Example 6.
A summary of the ELISA titres, neutralizing titres and cytokine profile by MSD analysis are set out in Table 8.
Table 8
Figure imgf000040_0001
Compositions of rMOMP adjuvanted with ADJ.SQ (i.e., lacking the TLR4 agonist, E6020) elicited levels of total IgG (including IgGl and IgG2 subclasses) similar to those elicited with rMOMP adjuvanted with ADJ.A (an adjuvant comprising the TLR4 agonist, E6020), however, the neutralizing capacity of the anti-sera was lower in comparison to anti-sera elicited by compositions comprising rMOMP adjuvanted with ADJ.A. These ADJ.SQ compositions stimulated a Th2-biased immune response (i.e., elicited high levels of Th2 cytokines and low levels of IFN-γ). The addition of a TLR4 agonist (e.g., E6020) shifted the immune response towards a Thl type response.
EXAMPLE 8
Immunogenic compositions comprising rMOMP adjuvanted with ADJ.A produced by one of several different processes.
Groups of female CDI mice (10 per group) (Charles River) were immunized intramuscularly on three separate occasions (at about 3 week intervals) with 50μ1 of formulations comprising either 1 or 10 μg of rMOMP, and having ^g of E6020 with the carrier comprising a squalene emulsion. In that study, the adjuvant was prepared in one of several different ways: either the product E6020 was introduced in the aqueous phase before the emulsification took place, or it was introduced in the oily phase, or even in some cases, it was simply added to the emulsion. The adjuvant effect of E6020 in the rMOMP composition was similar irrespective of which of the three preparation methods was utilized. The three adjuvants tested elicited similar levels of antigen-specific total IgG, with both IgGl and IgG2a subclasses, similar in vitro neutralizing capacity and similar cytokine production profiles.
EXAMPLE 9
This example is related to immunogenic compositions comprising a TLR4 agonist (e.g., E6020) and aluminum hydroxide as a carrier.
Groups of female CDI mice (10 per group) (Charles River) were immunized intramuscularly on three separate occasions (at about 3 week intervals) with 50μ1 of formulations comprising 10 μg of rMOMP and one of several adjuvants (i.e., ADJ.SQ, ADJ.A, Alum (aluminum hydroxide), and ADJ.B (an adjuvant comprising a TLR4 agonist (E6020) + Alum (aluminum hydroxide))). Immunization doses were prepared by mixing 25 μΐ of the antigen solution (rMOMP in buffer (50mM Tris pH 8.0 + 0.1% NLS)) with 25μ1 of adjuvant. The adjuvant, ADJ.B (comprising E6020 and Alum) was prepared in the following manner:
Powder E6020 (EISAI) was diluted in ethanol to reach a concentration of about 12 mg/ml. ΙΟΟμΙ of this solution was then added to 1.9ml of water which was maintained under agitation. The aqueous solution was then filtered and mixed with buffer PBS (10X) (9 volume of E6020 solution for 1 volume of PBS (10X) to get an aqueous solution of E6020 (with some ethanol) at about 0.5mg/ml. To a Peni flask with 120μ1 of this aqueous E6020 solution and 930 μΐ of PBS (IX) was added 450 μΐ of an aqueous suspension of AIOOH at a concentration of 8 mg/ml. This mixture was homogenized and vortexed for 10 seconds. The prepared adjuvant comprised 2.4mg/ml of Aluminum and 40μg/ml of E6020.
The ADJ.SQ and ADJ.A adjuvants used in this example were prepared substantially as described in Example 6.
Collection of sera and splenocytes was done substantially as described in Example 6 and measurement of cytokine production and isotyping analysis was also performed substantially as described in that Example. The ability of the elicited antibodies to neutralize C. trachomatis serovar E was assessed by neutralization assay (conducted substantially as described in Example 6). A summary of the ELISA titres, neutralizing titres and cytokine profile by MSD analysis are set out in Tables 9 and 10.
Table 9
Figure imgf000042_0001
Table 10
These results demonstrated that rMOMP adjuvanted with E6020 irrespective of the carrier system used (i.e., either aluminum or emulsion) induces a Thl/Th2 balanced response whereas a Th2- orientated immune response is induced by rMOMP adjuvanted with the carrier system alone (e.g., Alum).
Figure imgf000043_0001
EXAMPLE 10
This example describes the biochemical and biophysical characterization of the multimeric nature of the recombinant MOMP. Biochemical and biophysical characterization testing was performed on human serovar rMOMP samples that were prepared substantially in accordance with the method set out in Example 4. Tests included CD spectroscopy, intrinsic fluorescence spectroscopy, AUC, SEC- MALS, blue native gel electrophoresis, DSC, FTIR, and mass spectrometry. The data from these tests show that rMOMP samples are folded, and have β-sheet rich secondary structures. Their solution structures are characterized by the presence of polydisperse oligomers likely consisting of MOMP dimers, trimers, tetramers, higher order oligomers and in some samples, putative monomers.
Protein samples were diluted to the appropriate concentration for loading and then combined with sample buffer and Coomassie G-250 additive reagents (Invitrogen). Samples were loaded into wells of a pre-cast 4-16% polyacrylamide gradient gel (NativePAGE™ Novex Bis-Tris Gels, Invitrogen) and electrophoresed at 150 V for approximately 2 h. Following electrophoresis, gels were fixed and destained according to the manufacturer's instructions. For Western blot analysis, gels were transferred to PVDF membranes. Samples of rMOMP showed a characteristic ladder pattern on BN-PAGE (see Figures 6A and 6B). Based on the mobilities of the MW standards, the lowest-MW band in the majority of rMOMP samples had a molecular weight of approximately 80,000 corresponding to a putative MOMP dimer. Similarly, the higher MW bands on the ladder presumably correspond to progressively higher-order oligomers (i.e. trimers, tetramers, pentamers, etc.). This was investigated from a theoretical standpoint by comparing the relative mobilities (Rf-values) of bands from 3 different SerD rMOMP samples with the theoretical MW's of the putative MOMP oligomers. In one of these lots (JR2886) a weak band was observed at the bottom of the ladder with mobility beyond that of the 66-kDa MW marker, and this band was assumed to be a monomer. Weak monomer bands were also observed in SerJ rMOMP lots JR3321 and JR3340 (Figure 6B). Plotting of the measured Rf-values (Figure 6C) against the logarithm of the putative MW's of the putative oligomers (ranging from monomer to heptamer) resulted in an approximately linear correlation, as would be expected for proteins migrating in a polyacrylamide gel suggesting that the ladder bands observed in rMOMP samples correspond to integer multiple oligomers of MOMP (monomer, dimer, trimer, etc.).
The specificity of the stained bands on BN-PAGE was investigated by means of Western blotting using a SerD MOMP-specific monoclonal antibody. A native MOMP sample, which was extracted and purified from the outer membranes of SerD C. trachomatis elementary bodies (EB-MOMP), in accordance to process described previously (2001, Infect. Immun. 69:6240-6247 ) was run as a positive control. All of the ladder bands in the BNG of the 3 SerD rMOMP lots were recognized by the specific mAb in the corresponding Western blot. Therefore, the bands observed in the BNG ladder are MOMP-specific.
The rMOMP samples were assessed by Far-UV CD spectroscopy. The samples all showed evidence of β-sheet rich secondary structure, characterized by a broad spectral minimum around 215 nm. By intrinsic fluorescence spectroscopy, the samples had similar emission spectra, both at 280 nM and 295 nm, suggesting a similar molecular environment for the aromatic side chains of tyrosine and tryptophan.
The samples were assessed by size-exclusion chromatography (SEC). The SEC elution profiles of the rMOMP samples were consistent with polydisperse MOMP oligomers (Figures 7, 8). Difference in profiles may reflect differences in the distribution of the various sized oligomeric species. Analysis of the eluting SE-HPLC fractions using multi-angle light scattering (MALS) was also performed and this data (not shown) was similarly consistent with the presence of polydisperse oligomers, whereby high-MW species eluted early in the chromatogram, with lower-MW weight species eluting later.
Sedimentation velocity was conduced by AUC. The sedimentation velocity results for the rMOMP samples are consistent with the presence of oligomers. The broadness and overall shape of the AUC spectra was consistent with polydisperse samples consisting of MOMP oligomers of different sizes. This profile is consistent with results from SEC-MALS and BNG experiments. The peak apex sedimentation coefficients (s -values) for the lots were between 8 and 9 Svedvergs. A monomer of rMOMP (-40 kDa) would be expected to have an s -value of approximately 2 Svedbergs. Therefore, rMOMP samples consist of polydisperse oligomers. EXAMPLE 11
This example describes the evaluation of human sera from subjects with Chlamydia using rMOMP.
Serum samples collected from two different cohorts of Chlamydia-infected subjects were evaluated by ELISA, to assess IgG titers, and using an in-vitro assay to assess neutralization capacity. The first study cohort was comprised of male and female subjects >16 years of age and attending a clinic for Chlamydia treatment. The subjects in this study cohort tested positive in a urogenital Chlamydia screening nucleic acid amplification test (the Gen-Probe Aptima Combo 2 [GP AC2, Gen-Probe, Inc., San Diego, CA]) and were enrolled in a Chlamydia study following treatment. These subjects underwent urogenital Chlamydia testing by GP AC2 and had serum collected during the baseline visit and as part of a 6-month follow-up visit. The second study cohort was comprised of female subjects (> 18 years of age) enrolled in a treatment outcome study following a positive test in a urogenital Chlamydia screening test (Ligase Chain Reaction). As part of the treatment outcome study, both a cervical Chlamydia culture and a serum sample was collected from each subject during scheduled visits (i.e. , at baseline, day 7, and day 21). Culture-negative genital specimens were subsequently tested by PCR (COBAS AMPLICORTM; Roche Diagnostic Systems, Inc., Branchburg, NJ).
Serum levels of total Chlamydia trachomatis IgG were measured using the Chlamydia trachomatis-lgG-EUSA-plus Medac assay (497-PLUS, Medac GmbH, Germany) as per the manufacturer's protocol. The Medac assay uses a synthetic peptide from a MOMP variable domain (an immunodominant region of the protein). Total IgG, IgGl and IgG3 levels were also measured using ELISA assays developed using rMOMP made in accordance to the methods of the invention (SP-IgG, SP-IgG 1 and SP- IgG3, respectively). Two lots of rMOMP (lot# sp021 and sp4500), each derived from serovar E, were utilized. Lot#sp021 had been prepared substantially in accordance with the process set out in Example 4, as was Lot#sp4500 apart from a few differences (i.e., the diafiltration buffer used in the refolding procedure was 50 mM Tris, pH 8.0, 0.1% NLS and the inclusion body pellet underwent a NLS wash substantially as described in Example 5, before the purification/refolding process). Protein purity for Lot#sp021 was 91.4% and was 99.7% for Lot#sp4500.
Briefly, 96-well plates were coated with rMOMP at a concentration of O. ^g/mL and incubated overnight at 4°C. The plate was then blocked with blocking buffer (PBS-1% BSA solution) and following incubation, residual blocking buffer was removed. Serum samples predicted with assay diluent were then added and incubated at room temperature. The plate was washed and then incubated with an HRP conjugated goat anti-human IgG (H+L chain, Jackson Laboratories), mouse anti -human IgGl (γΐ chain, Southern Biotechnology) or mouse anti-human IgG3 (γ3 chain, Southern Biotechnology). The plate was then developed as per the manufacturer's protocol using TMB substrate (Sigma) and analyzed using the Softmax™ plate reader (at absorbance 450nm-540nm). ELISA units were noted in absorbance units (AU/mL); the AU unit value was assessed by comparing the fluorescence of the test sample to an established standard control serum. Results were analysed statistically: correlations between continuous variables were assessed using Spearman's Rank correlation and differences between means were evaluated using the Mann-Whitney U-Test for non-parametric populations. Only those study participants that were positive by the Medac IgG ELISA (26/40 (65%) study participants) were included in the statistical analysis. Overall, total IgG titers were lower by the Medac IgG assay compared to levels measured by the SP-IgG ELISA (Log10 IgG 1.9 vs. 2.5 respectively, p < 0.0001, Figure 9A), but a strong positive correlation between total IgG levels measured by the Medac ELISA and the SP-IgG ELISA (Figure 9B) was evident. In addition, total IgG levels measured using the medac and SP IgG ELISA' s strongly correlated to SP-IgG3 levels in patient sera. A strong positive correlation was also noted between the total IgG and IgGl levels as measured by the SP-ELISA (r = 0.52, p = 0.005), although no correlation was observed between SP-IgGl levels and Medac IgG levels (r = 0.15, p = 0.46). The neutralization capacity of sera from 26 participants sero-positive for Chlamydia trachomatis (by Medac IgG ELISA) was assessed using an in vitro neutralization assay. The assay was conducted substantially as described in Example 6 but with serum samples diluted in PBS (Invitrogen) containing 5% Guinea pig serum (VWR catalogue # CA80057-496). A similarly diluted EB stock was added to samples and following an incubation period, mixture was transferred to a previously plated monolayer of HELA cells. Plate was centrifuged and sera-EB suspension was removed. Following an incubation period, the cells were fixed with the addition of 100% methanol (Sigma, Canada), then washed with PBS and incubated in 0.1% BSA-PBS buffer with a dilution of antibodies against C. trachomatis MOMP. The antibodies had been derived from rabbit sera raised against 4 peptides to the variable domain of MoPn MOMP. Cells were then washed with PBS and incubated with a Donkey anti-Rabbit HRP conjugated antibody diluted in 5% FBS-PBS with goat serum (Sigma, Canada). The plate was then washed and developed with the metal enhanced DAB substrate kit (Pierce, Canada) and counted using the Zeiss Observer Z l microscope with the AxioVision™ 4.7.1 software. Neutralization titers, which were defined as the dilution of sera able to neutralizing infection by > 50% of control values, ranged from 5 to 320.
The assay utilized provided a method of evaluating the effectiveness of serum IgG at preventing infection of HELA cells exposed to Chlamydia trachomatis elementary bodies (EB), and as such, it enabled a determination to be made as to whether the IgG titers in sera corresponded to functional activity against Chlamydia EB's. A strong positive correlation between SP-IgG levels and neutralization titers in all participants (r =0.47, p = 0.015, Figure 10A) was evident and the correlation was even stronger when 4 of the outliers were removed from the analysis (r=0.59, p=0.004, Figure 10B). In all participants, levels of IgG3, but not IgGl (r = 0.27, p = 0.17), as measured by the SP-ELISA correlated positively with neutralization titers (r = 0.55, p = 0.003, Figure 1 1A). When perceived outliers were excluded from the analysis, a stronger correlation was noted (r = 0.66, p - 0.001, Figure 1 1B). IgG titers as measured by the Medac ELISA kit, did not correlate with neutralization titers (r=0.21, p = 0.30).
These findings show that the ELISA assay utilizing rMOMP made in accordance to the present invention was able to detect Chlamydia trachomatis specific IgG levels in sera from human subjects infected with C. trachomatis . The levels of total IgG detected by this assay correlated strongly with those measured using the commercially available Medac ELISA kit as did the levels of IgG subtypes, including IgGl and IgG3. The levels of total IgG and IgG3 as measured using the rMOMP ELISA assay also correlated positively with neutralization titers which suggest that the rMOMP-specific IgG and IgG3 recognized by the SP-IgG ELISA are able to neutralize serovar E infections in vitro. Indeed, the neutralization capacity of sera was abolished by depleting IgG from sera. Therefore, the rMOMP utilized in the ELISA (and made in accordance to the present invention) was in a substantially native-like form as it was able to detect neutralizing C. trachomatis specific antibodies that had been elicited by a wild-type infection with C. trachmatis.
While example methods, proteins, compositions and other features have been described, it is not the intention of the applicants to restrict or in any way limit the scope of the invention or application. Modifications, alterations and variations will be readily apparent to those of skill in the art. Therefore, the invention is not limited to the specific details, the representative apparatus and examples shown and described.
The contents of all references cited above are incorporated herein by reference. Use of singular forms herein, such as "a" and "the", does not exclude indication of the corresponding plural form, unless the context indicates to the contrary. Thus, for example, if a claim indicates that use of "a" X or Y, it can also be interpreted as covering use of more than one X or Y unless otherwise indicated. To the extent that the term (or) is used in the description or claims (e.g., A or B) it is intended to mean "A or B or both". In circumstances where the intention is to indicate "only A or B but not both" then the term "only A or B but not both" will be employed. Thus, the term "or" herein is used in the inclusive and not the exclusive sense.
Other embodiments are within the following claims.
SEQUENCE LISTING
<110> Sanofi Pasteur Limited
<120> RECOMBINANT CHLAMYDIA PROTEINS, COMPOSITIONS AND RELATED METHODS
<130> APL-10-ll-US-PRO
<140>
<141> 2010-11-15
<160> 21
<170> Patentln version 3.5
<210> 1
<211> 36
<212> DNA
<213> Chlamydia trachomatis
<400> 1
gaatcagtca catatgctgc ctgtggggaa tcctgc 36
<210> 2
<211> 42
<212> DNA
<213> Chlamydia trachomatis
<400> 2
ctgcagtcac tcgagtcatt agaaacggaa ctgagcattt ac 42
<210> 3
<211> 366
<212> PRT
<213> Chlamydia trachomatis
<400> 3
Met Leu Pro Val Gly Asn Pro Ala Glu Pro Ser Leu Met lie Asp Gly
1 5 10 15
lie Leu Trp Glu Gly Phe Gly Gly Asp Pro Cys Asp Pro Cys Thr Thr
20 25 30
Trp Cys Asp Ala lie Ser Leu Arg Leu Gly Tyr Tyr Gly Asp Phe Val
35 40 45 Phe Asp Arg Val Leu Lys Thr Asp Val Asn Lys Gin Phe Glu Met Gly 50 55 60
Ala Ala Pro Thr Gly Asp Ala Asp Leu Thr Thr Ala Pro Thr Pro Ala 65 70 75 80
Ser Arg Glu Asn Pro Ala Tyr Gly Lys His Met Gin Asp Ala Glu Met
85 90 95
Phe Thr Asn Ala Ala Tyr Met Ala Leu Asn He Trp Asp Arg Phe Asp
100 105 110
Val Phe Cys Thr Leu Gly Ala Thr Ser Gly Tyr Leu Lys Gly Asn Ser
115 120 125
Ala Ala Phe Asn Leu Val Gly Leu Phe Gly Arg Asp Glu Thr Ala Val 130 135 140
Ala Ala Asp Asp He Pro Asn Val Ser Leu Ser Gin Ala Val Val Glu 145 150 155 160
Leu Tyr Thr Asp Thr Ala Phe Ala Trp Ser Val Gly Ala Arg Ala Ala
165 170 175
Leu Trp Glu Cys Gly Cys Ala Thr Leu Gly Ala Ser Phe Gin Tyr Ala
180 185 190
Gin Ser Lys Pro Lys Val Glu Glu Leu Asn Val Leu Cys Asn Ala Ala
195 200 205
Glu Phe Thr He Asn Lys Pro Lys Gly Tyr Val Gly Gin Glu Phe Pro 210 215 220
Leu Asn He Lys Ala Gly Thr Val Ser Ala Thr Asp Thr Lys Asp Ala 225 230 235 240
Ser He Asp Tyr His Glu Trp Gin Ala Ser Leu Ala Leu Ser Tyr Arg
245 250 255
Leu Asn Met Phe Thr Pro Tyr He Gly Val Lys Trp Ser Arg Ala Ser
260 265 270
Phe Asp Ala Asp Thr He Arg He Ala Gin Pro Lys Leu Glu Thr Ser
275 280 285
He Leu Lys Met Thr Thr Trp Asn Pro Thr He Ser Gly Ser Gly He 290 295 300
Asp Val Asp Thr Lys He Thr Asp Thr Leu Gin He Val Ser Leu Gin 305 310 315 320
Leu Asn Lys Met Lys Ser Arg Lys Ser Cys Gly Leu Ala He Gly Thr
325 330 335 Thr He Val Asp Ala Asp Lys Tyr Ala Val Thr Val Glu Thr Arg Leu
340 345 350 lie Asp Glu Arg Ala Ala His Val Asn Ala Gin Phe Arg Phe
355 360 365
<210> 4
<211> 20
<212> DNA
<213> Chlamydia trachomatis
<400> 4
taatacgact cactataggg 20
<210> 5
<211> 24
<212> DNA
<213> Chlamydia trachomatis
<400> 5
tatgctagtt attgctcagc ggtg 24 <210> 6
<211> 29
<212> DNA
<213> Chlamydia trachomatis <400> 6
gcatgacata tgcctgtggg gaatcctgc 29
<210> 7
<211> 36
<212> DNA
<213> Chlamydia trachomatis
<400> 7
cgatcgggat ccttagaagc ggaattgtgc atttac 36
<210> 8
<211> 371
<212> PRT <213> Chlamydia trachomatis
<400> 8
Met Pro Val Gly Asn Pro Ala Glu Pro Ser Leu Met lie Asp Gly lie 1 5 10 15
Leu Trp Glu Gly Phe Gly Gly Asp Pro Cys Asp Pro Cys Ala Thr Trp
20 25 30
Cys Asp Ala lie Ser Met Arg Val Gly Tyr Tyr Gly Asp Phe Val Phe
35 40 45
Asp Arg Val Leu Lys Thr Asp Val Asn Lys Glu Phe Gin Met Gly Ala 50 55 60
Lys Pro Thr Thr Asp Thr Gly Asn Ser Ala Ala Pro Ser Thr Leu Thr 65 70 75 80
Ala Arg Glu Asn Pro Ala Tyr Gly Arg His Met Gin Asp Ala Glu Met
85 90 95
Phe Thr Asn Ala Ala Cys Met Ala Leu Asn lie Trp Asp Arg Phe Asp
100 105 110
Val Phe Cys Thr Leu Gly Ala Thr Ser Gly Tyr Leu Lys Gly Asn Ser
115 120 125
Ala Ser Phe Asn Leu Val Gly Leu Phe Gly Asp Asn Glu Asn Gin Lys 130 135 140
Thr Val Lys Ala Glu Ser Val Pro Asn Met Ser Phe Asp Gin Ser Val 145 150 155 160
Val Glu Leu Tyr Thr Asp Thr Thr Phe Ala Trp Ser Val Gly Ala Arg
165 170 175
Ala Ala Leu Trp Glu Cys Gly Cys Ala Thr Leu Gly Ala Ser Phe Gin
180 185 190
Tyr Ala Gin Ser Lys Pro Lys Val Glu Glu Leu Asn Val Leu Cys Asn
195 200 205
Ala Ala Glu Phe Thr lie Asn Lys Pro Lys Gly Tyr Val Gly Lys Glu 210 215 220
Phe Pro Leu Asp Leu Thr Ala Gly Thr Asp Ala Ala Thr Gly Thr Lys 225 230 235 240
Asp Ala Ser lie Asp Tyr His Glu Trp Gin Ala Ser Leu Ala Leu Ser
245 250 255
Tyr Arg Leu Asn Met Phe Thr Pro Tyr lie Gly Val Lys Trp Ser Arg
260 265 270
Ala Ser Phe Asp Ala Asp Thr lie Arg lie Ala Gin Pro Lys Ser Ala 275 280 285
Thr Ala He Phe Asp Thr Thr Thr Leu Asn Pro Thr He Ala Gly Ala
290 295 300
Gly Asp Val Lys Thr Gly Ala Glu Gly Gin Leu Gly Asp Thr Met Gin
305 310 315 320
He Val Ser Leu Gin Leu Asn Lys Met Lys Ser Arg Lys Ser Cys Gly
325 330 335
He Ala Val Gly Thr Thr He Val Asp Ala Asp Lys Tyr Ala Val Thr
340 345 350
Val Glu Thr Arg Leu He Asp Glu Arg Ala Ala His Val Asn Ala Gin
355 360 365
Phe Arg Phe
370 <210> 9
<211> 1116
<212> DNA
<213> Chlamydia trachomatis <400> 9
atgcctgtgg ggaatcctgc tgaaccaagc cttatgatcg acggaattct gtgggaaggt 60 ttcggcggag atccttgcga tccttgcgcc acttggtgtg acgctatcag catgcgtgtt 120 ggttactacg gagactttgt tttcgaccgt gttttgaaaa ctgatgtgaa taaagaattt 180 cagatgggtg ccaagcctac aactgataca ggcaatagtg cagctccatc cactcttaca 240 gcaagagaga atcctgctta cggccgacat atgcaggatg ctgagatgtt tacaaatgcc 300 gcttgcatgg cattgaatat ttgggatcgt tttgatgtat tctgtacatt aggagccacc 360 agtggatatc ttaaaggaaa ctctgcttct ttcaatttag ttggattgtt tggagataat 420 gaaaatcaaa aaacggtcaa agcggagtct gtaccaaata tgagctttga tcaatctgtt 480 gttgagttgt atacagatac tacttttgcg tggagcgtcg gcgctcgcgc agctttgtgg 540 gaatgtggat gtgcaacttt aggagcttca ttccaatatg ctcaatctaa acctaaagta 600 gaagaattaa acgttctctg caatgcagca gagtttacta ttaataaacc taaagggtat 660 gtaggtaagg agtttcctct tgatcttaca gcaggaacag atgctgcgac aggaactaag 720 gatgcctcta ttgattacca tgaatggcaa gcaagtttag ctctctctta cagactgaat 780 atgttcactc cctacattgg agttaaatgg tctcgagcaa gctttgatgc cgatacgatt 840 cgtatagccc agccaaaatc agctacagct atttttgata ctaccacgct taacccaact 900 attgctggag ctggcgatgt gaaaactggc gcagagggtc agctcggaga cacaatgcaa 960 atcgtttcct tgcaattgaa caagatgaaa tctagaaaat cttgcggtat tgcagtagga 1020 acaactattg tggatgcaga caaatacgca gttacagttg agactcgctt gatcgatgag 1080 agagcagctc acgtaaatgc acaattccgc ttctaa 1116
<210> 10
<211> 1116
<212> DNA
<213> Chlamydia trachomatis
<400> 10
atgcctgtgg ggaatcctgc tgaaccaagc cttatgatcg acggaattct gtgggaaggt 60 ttcggcggag atccttgcga tccttgcacc acttggtgtg acgctatcag catgcgtatg 120 ggttactatg gtgactttgt tttcgaccgt gttttgaaaa cagatgtgaa taaagaattc 180 caaatgggtg acaagcctac aagtactaca ggcaatgcta cagctccaac cactcttaca 240 gcaagagaga atcctgctta cggccgacat atgcaggatg ctgagatgtt tacaaatgcc 300 gcttgcatgg cattgaatat ttgggatcgc tttgatgtat tctgtacact aggagcctct 360 agcggatacc ttaaaggaaa ctctgcttct ttcaatttag ttggattgtt tggagataat 420 gaaaatcaaa gcacggtcaa aacgaattct gtaccaaata tgagcttaga tcaatctgtt 480 gttgaacttt acacagatac tgccttctct tggagcgtgg gcgctcgagc agctttgtgg 540 gagtgcggat gtgcgacttt aggggcttct ttccaatacg ctcaatctaa acctaaagtc 600 gaagaattaa acgttctctg taacgcagct gagtttacta tcaataagcc taaaggatat 660 gtagggcaag aattccctct tgcactcata gcaggaactg atgcagcgac gggcactaaa 720 gatgcctcta ttgattacca tgagtggcaa gcaagtttag ctctctctta cagattgaat 780 atgttcactc cctacattgg agttaaatgg tctcgagcaa gttttgatgc cgatacgatt 840 cgtatagccc agccaaaatc agctacagct atctttgata ctaccacgct taacccaact 900 attgctggag ctggcgatgt gaaagctagc gcagagggtc agctcggaga taccatgcaa 960 atcgtctcct tgcaattgaa caagatgaaa tctagaaaat cttgcggtat tgcagtagga 1020 acgactattg tagatgcaga caaatacgca gttacagttg agactcgctt gatcgatgag 1080 agagctgctc acgtaaatgc acaattccgc ttctaa 1116
<210> 11
<211> 371
<212> PRT
<213> Chlamydia trachomatis <400> 11
Met Pro Val Gly Asn Pro Ala Glu Pro Ser Leu Met He Asp Gly He
1 5 10 15
Leu Trp Glu Gly Phe Gly Gly Asp Pro Cys Asp Pro Cys Thr Thr Trp
20 25 30 Cys Asp Ala He Ser Met Arg Met Gly Tyr Tyr Gly Asp Phe Val Phe 35 40 45
Asp Arg Val Leu Lys Thr Asp Val Asn Lys Glu Phe Gin Met Gly Asp
50 55 60
Lys Pro Thr Ser Thr Thr Gly Asn Ala Thr Ala Pro Thr Thr Leu Thr 65 70 75 80
Ala Arg Glu Asn Pro Ala Tyr Gly Arg His Met Gin Asp Ala Glu Met
85 90 95
Phe Thr Asn Ala Ala Cys Met Ala Leu Asn He Trp Asp Arg Phe Asp
100 105 110
Val Phe Cys Thr Leu Gly Ala Ser Ser Gly Tyr Leu Lys Gly Asn Ser
115 120 125
Ala Ser Phe Asn Leu Val Gly Leu Phe Gly Asp Asn Glu Asn Gin Ser 130 135 140
Thr Val Lys Thr Asn Ser Val Pro Asn Met Ser Leu Asp Gin Ser Val 145 150 155 160
Val Glu Leu Tyr Thr Asp Thr Ala Phe Ser Trp Ser Val Gly Ala Arg
165 170 175
Ala Ala Leu Trp Glu Cys Gly Cys Ala Thr Leu Gly Ala Ser Phe Gin
180 185 190
Tyr Ala Gin Ser Lys Pro Lys Val Glu Glu Leu Asn Val Leu Cys Asn
195 200 205
Ala Ala Glu Phe Thr He Asn Lys Pro Lys Gly Tyr Val Gly Gin Glu 210 215 220
Phe Pro Leu Ala Leu He Ala Gly Thr Asp Ala Ala Thr Gly Thr Lys 225 230 235 240
Asp Ala Ser He Asp Tyr His Glu Trp Gin Ala Ser Leu Ala Leu Ser
245 250 255
Tyr Arg Leu Asn Met Phe Thr Pro Tyr He Gly Val Lys Trp Ser Arg
260 265 270
Ala Ser Phe Asp Ala Asp Thr He Arg He Ala Gin Pro Lys Ser Ala
275 280 285
Thr Ala He Phe Asp Thr Thr Thr Leu Asn Pro Thr He Ala Gly Ala 290 295 300
Gly Asp Val Lys Ala Ser Ala Glu Gly Gin Leu Gly Asp Thr Met Gin 305 310 315 320
He Val Ser Leu Gin Leu Asn Lys Met Lys Ser Arg Lys Ser Cys Gly
325 330 335 lie Ala Val Gly Thr Thr lie Val Asp Ala Asp Lys Tyr Ala Val Thr
340 345 350
Val Glu Thr Arg Leu lie Asp Glu Arg Ala Ala His Val Asn Ala Gin
355 360 365
Phe Arg Phe
370
<210> 12
<211> 1122
<212> DNA
<213> Chlamydia trachomatis
<400> 12
atgcctgtgg ggaatcctgc tgaaccaagc cttatgatcg acggaattct gtgggaaggt 60 ttcggcggag atccttgcga tccttgcacc acttggtgtg acgctatcag catgcgtatg 120 ggttactatg gtgactttgt tttcgaccgt gttttgaaaa cagatgtgaa taaagagttt 180 gaaatgggcg aggctttagc cggagcttct gggaatacga cctctactct ttcaaaattg 240 gtagaacgaa cgaaccctgc atatggcaag catatgcaag acgcagagat gtttaccaat 300 gccgcttgca tgacattgaa tatttgggat cgttttgatg tattctgtac attaggagcc 360 accagtggat atcttaaagg aaattcagca tctttcaact tagttgggtt attcggcgat 420 ggtgtaaacg ccacgaaacc tgctgcagat agtattccta acgtgcagtt aaatcagtct 480 gtggtggaac tgtatacaga tactactttt gcttggagtg ttggagctcg tgcagctttg 540 tgggaatgtg gatgtgcaac tttaggagct tctttccaat atgctcaatc taaacctaaa 600 atcgaagaat taaacgttct ctgtaacgca gcagagttta ctattaataa acctaaaggg 660 tatgtaggta aggagtttcc tcttgatctt acagcaggaa cagatgcagc gacgggcact 720 aaagatgcct ctattgatta ccatgagtgg caagcaagtt tatctctttc ttacagactc 780 aatatgttca ctccctacat tggagttaaa tggtctcgtg caagctttga ttctgataca 840 attcgtatag cccagccgag gttggtaaca cctgttgtag atattacaac ccttaaccca 900 actattgcag gatgcggcag tgtagctgga gctaacacgg aaggacagat atctgataca 960 atgcaaatcg tctccttgca attgaacaag atgaaatcta gaaaatcttg cggtattgca 1020 gtaggaacaa ctattgtgga tgcagacaaa tacgcagtta cagttgagac tcgcttgatc 1080 gatgagagag ctgctcacgt aaatgcacaa ttccgcttct aa 1122
<210> 13
<211> 373
<212> PRT
<213> Chlamydia trachomatis <400> .3
Met Pro Val Gly Asn Pro Ala Glu Pro Ser Leu Met He Asp Gly He 1 5 10 15
Leu Trp Glu Gly Phe Gly Gly Asp Pro Cys Asp Pro Cys Thr Thr Trp
20 25 30
Cys Asp Ala He Ser Met Arg Met Gly Tyr Tyr Gly Asp Phe Val Phe
35 40 45
Asp Arg Val Leu Lys Thr Asp Val Asn Lys Glu Phe Glu Met Gly Glu 50 55 60
Ala Leu Ala Gly Ala Ser Gly Asn Thr Thr Ser Thr Leu Ser Lys Leu 65 70 75 80
Val Glu Arg Thr Asn Pro Ala Tyr Gly Lys His Met Gin Asp Ala Glu
85 90 95
Met Phe Thr Asn Ala Ala Cys Met Thr Leu Asn He Trp Asp Arg Phe
100 105 110
Asp Val Phe Cys Thr Leu Gly Ala Thr Ser Gly Tyr Leu Lys Gly Asn
115 120 125
Ser Ala Ser Phe Asn Leu Val Gly Leu Phe Gly Asp Gly Val Asn Ala 130 135 140
Thr Lys Pro Ala Ala Asp Ser He Pro Asn Val Gin Leu Asn Gin Ser 145 150 155 160
Val Val Glu Leu Tyr Thr Asp Thr Thr Phe Ala Trp Ser Val Gly Ala
165 170 175
Arg Ala Ala Leu Trp Glu Cys Gly Cys Ala Thr Leu Gly Ala Ser Phe
180 185 190
Gin Tyr Ala Gin Ser Lys Pro Lys He Glu Glu Leu Asn Val Leu Cys
195 200 205
Asn Ala Ala Glu Phe Thr He Asn Lys Pro Lys Gly Tyr Val Gly Lys 210 215 220
Glu Phe Pro Leu Asp Leu Thr Ala Gly Thr Asp Ala Ala Thr Gly Thr 225 230 235 240
Lys Asp Ala Ser He Asp Tyr His Glu Trp Gin Ala Ser Leu Ser Leu
245 250 255 Ser Tyr Arg Leu Asn Met Phe Thr Pro Tyr He Gly Val Lys Trp Ser
260 265 270
Arg Ala Ser Phe Asp Ser Asp Thr He Arg He Ala Gin Pro Arg Leu
275 280 285
Val Thr Pro Val Val Asp He Thr Thr Leu Asn Pro Thr He Ala Gly 290 295 300
Cys Gly Ser Val Ala Gly Ala Asn Thr Glu Gly Gin He Ser Asp Thr
305 310 315 320
Met Gin He Val Ser Leu Gin Leu Asn Lys Met Lys Ser Arg Lys Ser
325 330 335
Cys Gly He Ala Val Gly Thr Thr He Val Asp Ala Asp Lys Tyr Ala
340 345 350
Val Thr Val Glu Thr Arg Leu He Asp Glu Arg Ala Ala His Val Asn
355 360 365
Ala Gin Phe Arg Phe
370
<210> 14
<211> 1128
<212> DNA
<213> Chlamydia trachomatis
<400> 14
atgcctgtgg ggaatcctgc tgaaccaagc cttatgatcg acggaattct gtgggaaggt 60 ttcggtggag atccttgcga tccttgcacc acttggtgtg acgctatcag catgcgtatg 120 ggttactatg gtgactttgt tttcgaccgt gttttgaaaa cagatgtgaa taaagaattt 180 cagatgggag cggcgcctac taccagcgat gtagcaggct tacaaaacga tccaacaaca 240 aatgttgctc gtccaaatcc cgcttatggc aaacacatgc aagatgctga aatgtttacg 300 aacgctgctt acatggcatt aaatatctgg gatcgttttg atgtattttg tacattggga 360 gcaactaccg gttatttaaa aggaaactcc gcttccttca acttagttgg attattcgga 420 acaaaaacac aagcttctag ctttaataca gcgaatcttt ttcctaacac tgctttgaat 480 caagctgtgg ttgagcttta tacagacact acctttgctt ggagcgtagg tgctcgtgca 540 gctctctggg aatgtgggtg tgcaacgtta ggagcttctt tccaatatgc tcaatctaaa 600 cctaaagtag aagagttaaa tgttctttgt aatgcatccg aatttactat taataagccg 660 aaaggatatg ttggggcgga atttccactt gatattaccg caggaacaga agctgcgaca 720 gggactaagg atgcctctat tgactaccat gagtggcaag caagtttagc cctttcttac 780 agattaaata tgttcactcc ttacattgga gttaaatggt ctagagtaag ttttgatgcc 840 gacacgatcc gtatcgctca gcctaaattg gctgaagcaa tcttggatgt cactactcta 900 aacccgacca tcgctggtaa aggaactgtg gtcgcttccg gaagcgaaaa cgacctggct 960 gatacaatgc aaatcgtttc cttgcagttg aacaagatga aatctagaaa atcttgcggt 1020 attgcagtag gaacgactat tgtagatgca gacaaatacg cagttacagt tgagactcgc 1080 ttgatcgatg agagagcagc tcacgtaaat gcacaattcc gcttctaa 1128 <210> 15
<211> 375
<212> PRT
<213> Chlamydia trachomatis
<400> 15
Met Pro Val Gly Asn Pro Ala Glu Pro Ser Leu Met lie Asp Gly lie 1 5 10 15
Leu Trp Glu Gly Phe Gly Gly Asp Pro Cys Asp Pro Cys Thr Thr Trp
20 25 30
Cys Asp Ala lie Ser Met Arg Met Gly Tyr Tyr Gly Asp Phe Val Phe
35 40 45
Asp Arg Val Leu Lys Thr Asp Val Asn Lys Glu Phe Gin Met Gly Ala 50 55 60
Ala Pro Thr Thr Ser Asp Val Ala Gly Leu Gin Asn Asp Pro Thr Thr 65 70 75 80
Asn Val Ala Arg Pro Asn Pro Ala Tyr Gly Lys His Met Gin Asp Ala
85 90 95
Glu Met Phe Thr Asn Ala Ala Tyr Met Ala Leu Asn lie Trp Asp Arg
100 105 110
Phe Asp Val Phe Cys Thr Leu Gly Ala Thr Thr Gly Tyr Leu Lys Gly
115 120 125
Asn Ser Ala Ser Phe Asn Leu Val Gly Leu Phe Gly Thr Lys Thr Gin 130 135 140
Ala Ser Ser Phe Asn Thr Ala Asn Leu Phe Pro Asn Thr Ala Leu Asn 145 150 155 160
Gin Ala Val Val Glu Leu Tyr Thr Asp Thr Thr Phe Ala Trp Ser Val
165 170 175
Gly Ala Arg Ala Ala Leu Trp Glu Cys Gly Cys Ala Thr Leu Gly Ala
180 185 190
Ser Phe Gin Tyr Ala Gin Ser Lys Pro Lys Val Glu Glu Leu Asn Val
195 200 205
Leu Cys Asn Ala Ser Glu Phe Thr lie Asn Lys Pro Lys Gly Tyr Val 210 215 220
Gly Ala Glu Phe Pro Leu Asp lie Thr Ala Gly Thr Glu Ala Ala Thr 225 230 235 240
Gly Thr Lys Asp Ala Ser lie Asp Tyr His Glu Trp Gin Ala Ser Leu
245 250 255 Ala Leu Ser Tyr Arg Leu Asn Met Phe Thr Pro Tyr He Gly Val Lys
260 265 270
Trp Ser Arg Val Ser Phe Asp Ala Asp Thr He Arg He Ala Gin Pro
275 280 285
Lys Leu Ala Glu Ala He Leu Asp Val Thr Thr Leu Asn Pro Thr He
290 295 300
Ala Gly Lys Gly Thr Val Val Ala Ser Gly Ser Glu Asn Asp Leu Ala
305 310 315 320
Asp Thr Met Gin He Val Ser Leu Gin Leu Asn Lys Met Lys Ser Arg
325 330 335
Lys Ser Cys Gly He Ala Val Gly Thr Thr He Val Asp Ala Asp Lys
340 345 350
Tyr Ala Val Thr Val Glu Thr Arg Leu He Asp Glu Arg Ala Ala His
355 360 365
Val Asn Ala Gin Phe Arg Phe
<210> 16
<211> 1128
<212> DNA
<213> Chlamydia trachomatis
<400> 16
atgcctgtgg ggaatcctgc tgaaccaagc cttatgatcg acggaattct gtgggaaggt 60 ttcggcggag atccttgcga tccttgcacc acttggtgtg acgctatcag catgcgtatg 120 ggttactacg gagactttgt tttcgaccgt gttttgaaaa cagatgtgaa taaagaattt 180 cagatgggag cggcgcctac taccaaggat atagcaggct tagaaaacga tccaacaaca 240 aatgttgctc gtccaaatcc cgcttatggc aaacacatgc aagatgctga aatgtttacg 300 aacgctgctt acatggcatt aaatatctgg gatcgttttg atgtattttg tacattggga 360 gcaactaccg gttatttaaa aggaaactcc gcttccttca acttagttgg attattcgga 420 acaaaaacac aatcttctaa ctttaataca gcgaagctta ttcctaacgc tgctttgaat 480 caagctgtgg ttgagcttta tacagacact acctttgctt ggagcgtagg tgctcgtgca 540 gctctctggg aatgtgggtg tgcaacgtta ggagcttctt tccaatatgc tcaatctaaa 600 cctaaagtag aagagttaaa tgttctttgt aatgcatccg aatttactat taataagccg 660 aaaggatatg ttggggcgga atttccactt gatattaccg caggaacaga agctgcgaca 720 gggactaagg atgcctctat tgactaccat gagtggcaag caagtttagc cctgtcttac 780 agattaaata tgttcactcc ttacattgga gttaaatggt ctagagtaag ttttgatgcc 840 gacacgatcc gtatcgctca gcctaaattg gctgaagcaa tcttggatgt cactactcta 900 aacccgacca tcgctggtaa aggaactgtg gtcgcttccg gaagcgataa cgacctggct 960 gatacaatgc aaatcgtttc cttgcagttg aacaagatga aatctagaaa atcttgcggt 1020 attgcagtag gaacgactat tgtagatgca gacaaatacg cagttacagt tgagactcgc 1080 ttgatcgatg agagagcagc tcacgtaaat gcacaattcc gcttctaa 1128
<210> 17
<211> 375
<212> PRT
<213> Chlamydia trachomatis
<400> 17
Met Pro Val Gly Asn Pro Ala Glu Pro Ser Leu Met He Asp Gly He
1 5 10 15
Leu Trp Glu Gly Phe Gly Gly Asp Pro Cys Asp Pro Cys Thr Thr Trp
20 25 30
Cys Asp Ala He Ser Met Arg Met Gly Tyr Tyr Gly Asp Phe Val Phe
35 40 45
Asp Arg Val Leu Lys Thr Asp Val Asn Lys Glu Phe Gin Met Gly Ala
50 55 60
Ala Pro Thr Thr Lys Asp He Ala Gly Leu Glu Asn Asp Pro Thr Thr
65 70 75 80
Asn Val Ala Arg Pro Asn Pro Ala Tyr Gly Lys His Met Gin Asp Ala
85 90 95
Glu Met Phe Thr Asn Ala Ala Tyr Met Ala Leu Asn He Trp Asp Arg
100 105 110
Phe Asp Val Phe Cys Thr Leu Gly Ala Thr Thr Gly Tyr Leu Lys Gly
115 120 125
Asn Ser Ala Ser Phe Asn Leu Val Gly Leu Phe Gly Thr Lys Thr Gin
130 135 140
Ser Ser Asn Phe Asn Thr Ala Lys Leu He Pro Asn Ala Ala Leu Asn
145 150 155 160
Gin Ala Val Val Glu Leu Tyr Thr Asp Thr Thr Phe Ala Trp Ser Val
165 170 175
Gly Ala Arg Ala Ala Leu Trp Glu Cys Gly Cys Ala Thr Leu Gly Ala
180 185 190
Ser Phe Gin Tyr Ala Gin Ser Lys Pro Lys Val Glu Glu Leu Asn Val
195 200 205
Leu Cys Asn Ala Ser Glu Phe Thr He Asn Lys Pro Lys Gly Tyr Val 210 215 220
Gly Ala Glu Phe Pro Leu Asp He Thr Ala Gly Thr Glu Ala Ala Thr
225 230 235 240
Gly Thr Lys Asp Ala Ser He Asp Tyr His Glu Trp Gin Ala Ser Leu
245 250 255
Ala Leu Ser Tyr Arg Leu Asn Met Phe Thr Pro Tyr He Gly Val Lys
260 265 270
Trp Ser Arg Val Ser Phe Asp Ala Asp Thr He Arg He Ala Gin Pro
275 280 285
Lys Leu Ala Glu Ala He Leu Asp Val Thr Thr Leu Asn Pro Thr He
290 295 300
Ala Gly Lys Gly Thr Val Val Ala Ser Gly Ser Asp Asn Asp Leu Ala
305 310 315 320
Asp Thr Met Gin He Val Ser Leu Gin Leu Asn Lys Met Lys Ser Arg
325 330 335
Lys Ser Cys Gly He Ala Val Gly Thr Thr He Val Asp Ala Asp Lys
340 345 350
Tyr Ala Val Thr Val Glu Thr Arg Leu He Asp Glu Arg Ala Ala His
355 360 365
Val Asn Ala Gin Phe Arg Phe
370 375
<210> 18
<211> 21
<212> DNA
<213> Chlamydia trachomatis
<400> 18
cctgtgggga atcctgctga a 21
<210> 19
<211> 42
<212> DNA
<213> Chlamydia trachomatis <400> 19
tttgggtcga cctattagaa gcggaattgt gcatttacgt ga 42 <210> 20
<211> 21
<212> DNA
<213> Chlamydia trachomatis <400> 20
cctgtgggga atcctgctga a 21
<210> 21
<211> 39
<212> DNA
<213> Chlamydia trachomatis
<400> 21
ggggtaccct attagaagcg gaattgtgca tttacgtga 39

Claims

CLAIMS What we claim is:
1. A method of obtaining a recombinant Chlamydial major outer membrane protein
(MO MP) that is expressed as an insoluble aggregate in a heterologous host, in a soluble and immunogenic form comprising the steps of:
(a) isolating the insoluble aggregated protein;
(b) admixing the insoluble aggregated protein from step(a) in an aqueous solution comprising a denaturing agent to denature the insoluble aggregated protein;
(c) purifying the denatured protein from step (b) by subjecting the mixture of step (b) to at least one chromatographic purification in the presence of denaturing agent and collecting eluted solution of purified denatured protein;
(d) admixing the purified denatured protein solution from step (c) with a reducing agent and at least one small molecule additive to enhance protein folding and/or suppress protein aggregation;
(e) reducing concentration of denaturing agent and reducing agent to levels sufficient to allow the protein to renature into soluble and substantially oligomeric form; and
(f) isolating the oligomeric form.
2. The method of claim 1, wherein the renatured, soluble protein from step (f) exhibits a ladder pattern when analyzed by polyacrylamide gel electrophoresis conducted in non- reducing conditions.
3. The method of claim 1, wherein step (e) comprises subjecting the mixture of step (d) to at least two diafiltrations.
4. The method of claim 1 wherein the reducing agent is dithiothreitol (DTT).
5. The method of claim 1, wherein the isolated protein is greater than 80% pure.
6. The method of claim 1, wherein the denaturing agent is selected from the group
consisting of urea and guanidine hydrochloride.
7. The method of claim 1 wherein the small molecule additive of step (d) is selected from the group consisting of: 1-arginine, N-lauroyl sarcosine, sucrose, and ammonium sulfate.
8. The method of claim 1, wherein the small molecule additive of step (d) is selected from the group consisting of 1-arginine and N-lauroyl sarcosine.
9. The method of claim 8, wherein 1-arginine and N-lauroyl sarcosine are each added in step (d).
10. The method of claim 1, wherein the insoluble aggregated protein is isolated by lysing the heterlogous host cell in which the protein was recombinantly expressed by chemical, enzymatic or physical means.
11. The method of claim 1, wherein the at least one chromatographic purification of step (d) is selected from the group consisting of: cation exchange chromatography, anion exchange chromatography and hydrophobic interaction chromatography.
12. The method of claim 11, wherein step (c) comprises purifying the denatured protein from step (b) by cation exchange chromatography and further purifying the denatured protein by anion exchange chromatography.
13. The method of claim 12, wherein the cation exchange chromatography is performed to collect solution of purified protein and the solution is then subjected to a pH shock treatment before being subjected to the anion exchange chromatography.
14. The method of claim 1, wherein less than 5% of the resulting renatured protein is in the monomelic form.
15. The method of claim 1, wherein the oligomeric form includes at least a trimeric form.
16. The method of claim 1, wherein the isolated protein is in a buffered solution having a pH of 7.5 to 8.5.
17. The method of claim 1, wherein the isolated protein is in a buffered solution having a residual concentration of NLS of 0.5% (w/v) or less.
18. The method of claim 1, wherein the reducing agent is DTT and the isolated protein is in a buffered solution having a residual concentration of DTT of 24 μg/ml or less.
19. The method of claim 1, wherein the denaturing agent is urea and the isolated protein is in a buffered solution having a residual concentration of urea of 10 mg/ml or less.
20. A soluble and immunogenic recombinant Chlamydial MOMP produced in accordance with the method of any one of claims 1 to 19 wherein the protein elicits a neutralizing antibody titre of at least 50% when administered to a subject.
21. A soluble recombinant Chlamydial MOMP produced in accordance with the method of any one of claims 1 to 19 wherein the protein elicits a neutralizing antibody titre of at least 90% when administered to a subject.
22. A soluble recombinant Chlamydial MOMP produced in accordance with the method of any one of claims 1 to 19 wherein the protein is derived from a serovar of C. trachomatis or C. pneumoniae.
23. The soluble recombinant Chlamydial MOMP of claim 22 wherein the protein is derived from a serovar of C. trachomatis.
24. The soluble recombinant MOMP protein of claim 22 wherein the protein has a amino acid sequence with at least 80% sequence identity to SEQ ID NO:3.
25. The soluble MOMP protein of claim 22 wherein the protein has a amino acid sequence with at least 80% sequence identity to SEQ ID NO:8.
26. The soluble MOMP protein of claim 22 wherein the protein has a amino acid sequence with at least 80% sequence identity to SEQ ID NO: 11.
27. The soluble MOMP protein of claim 22 wherein the protein has a amino acid sequence with at least 80% sequence identity to SEQ ID NO: 13.
28. The soluble MOMP protein of claim 22 wherein the protein has a amino acid sequence with at least 80% sequence identity to SEQ ID NO: 15.
29. The soluble MOMP protein of claim 22 wherein the protein has a amino acid sequence with at least 80% sequence identity to SEQ ID NO: 17.
30. A composition comprising the soluble recombinant Chlamydial MOMP of any one of claims 21 to 29 and a pharmaceutically acceptable carrier.
31. The composition of claim 30 further comprising an adjuvant.
32. The composition of claim 31 wherein the adjuvant comprises a TLR-4 agonist.
33. The composition of claim 32, wherein the TLR-4 agonist is E6020.
34. The composition of claim 31 wherein the adjuvant comprises an oil-in-water emulsion.
35. The composition of claim 32 or 33 wherein the adjuvant further comprises an oil-in-water emulsion.
36. The composition of claim 32 or 33 wherein the adjuvant further comprises an aluminum compound.
37. The composition of claim 36 wherein the aluminum compound is aluminum hydroxide.
38. A composition according to any one of claims 30 to 37, wherein the soluble recombinant Chlamydial MOMP is derived from a serovar of C. trachomatis.
39. A composition according to claim 38, wherein the composition comprises at least two or more soluble recombinant Chlamydial MOMP proteins each derived from a different serovar of C. trachomatis .
40. Use of the soluble recombinant MOMP of any one of claims 20 to 29 in the manufacture of a vaccine composition for the treatment or prevention of infection by the C.
trachomatis serovar from which the MOMP was derived.
41. A method of inducing an immune response to C. trachomatis in a subject, the method comprising administering to the subject an effective amount of the composition of any one of claims 30 to 39.
42. A method of immunizing a subject against a disease caused by a C. trachomatis infection comprising administering to the subject an effective amount of the soluble MOMP of any one of claims 20 to 29.
PCT/CA2011/050704 2010-11-15 2011-11-15 Expression, purification and refolding of recombinant chlamydia proteins, compositions and related methods Ceased WO2012065262A1 (en)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US41366310P 2010-11-15 2010-11-15
US61/413,663 2010-11-15
US201161452319P 2011-03-14 2011-03-14
US61/452,319 2011-03-14

Publications (1)

Publication Number Publication Date
WO2012065262A1 true WO2012065262A1 (en) 2012-05-24

Family

ID=46083456

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CA2011/050704 Ceased WO2012065262A1 (en) 2010-11-15 2011-11-15 Expression, purification and refolding of recombinant chlamydia proteins, compositions and related methods

Country Status (1)

Country Link
WO (1) WO2012065262A1 (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112062820A (en) * 2020-08-24 2020-12-11 黑龙江八一农垦大学 Renaturation and purification method of colibacillus recombinant outer membrane protein A inclusion body protein
CN112210019A (en) * 2020-10-15 2021-01-12 广东省科学院生物工程研究所 Purification method of transmembrane region of membrane protein containing single transmembrane region
CN113480622A (en) * 2021-08-05 2021-10-08 江苏坤力生物制药有限责任公司 Method for preparing and purifying recombinant pneumolysin
US20220378892A1 (en) * 2014-11-21 2022-12-01 Merck Sharp & Dohme Llc Recombinant expression of chlamydia momp antigen
US12263213B2 (en) 2023-03-02 2025-04-01 Sanofi Pasteur Compositions for use in treatment of Chlamydia

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
CALDWELL, H. D. ET AL.: "Purification and partial characterization of the major outer membrane protein of Chlamydia trachomatis", INFECTION AND IMMUNITY, vol. 31, no. 3, March 1981 (1981-03-01), pages 1161 - 1176 *
CHEN, J. ET AL.: "Cooperative effects of urea and L-arginine on protein folding", PROTEIN EXPRESSION AND PURIFICATION, vol. 66, no. 1, 20 February 2009 (2009-02-20), pages 82 - 90 *
MANNING, D. S. ET AL.: "Expression of the major outer membrane protein of Chlamydia trachomatis in Escherichia coli", INFECTION AND IMMUNITY, vol. 61, no. 10, October 1993 (1993-10-01), pages 4093 - 4098 *
PAL, S. ET AL.: "Vaccination with the Chlamydia trachomatis major outer membrane protein can elicit an immune response as protective as that resulting from inoculation with live bacteria", INFECTION AND IMMUNITY, vol. 73, no. 12, December 2005 (2005-12-01), pages 8153 - 8160 *
WAN, L. ET AL.: "Expression, purification, and refolding of a novel immunotoxin containing humanized single-chain fragment variable antibody against CTLA4 and the N-terminal fragment of human perforin", PROTEIN EXPRESSION AND PURIFICATION, vol. 48, no. 2, 9 March 2006 (2006-03-09), pages 307 - 313 *
WARNER, L. R. ET AL.: "Expression, purification, and refolding of recombinant collagen alphal(XI) amino terminal domain splice variants", PROTEIN EXPRESSION AND PURIFICATION, vol. 52, no. 2, April 2007 (2007-04-01), pages 403 - 409 *
WEN, Q. ET AL.: "Expression, purification, and refolding of recombinant fusion protein hIL-2/mGM-CSF", BIOMEDICAL AND ENVIRONMENTAL SCIENCES, vol. 21, no. 6, December 2008 (2008-12-01), pages 509 - 513 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20220378892A1 (en) * 2014-11-21 2022-12-01 Merck Sharp & Dohme Llc Recombinant expression of chlamydia momp antigen
CN112062820A (en) * 2020-08-24 2020-12-11 黑龙江八一农垦大学 Renaturation and purification method of colibacillus recombinant outer membrane protein A inclusion body protein
CN112062820B (en) * 2020-08-24 2023-05-26 黑龙江八一农垦大学 Renaturation purification method of E.coli recombinant outer membrane protein A inclusion body protein
CN112210019A (en) * 2020-10-15 2021-01-12 广东省科学院生物工程研究所 Purification method of transmembrane region of membrane protein containing single transmembrane region
CN113480622A (en) * 2021-08-05 2021-10-08 江苏坤力生物制药有限责任公司 Method for preparing and purifying recombinant pneumolysin
US12263213B2 (en) 2023-03-02 2025-04-01 Sanofi Pasteur Compositions for use in treatment of Chlamydia

Similar Documents

Publication Publication Date Title
Sun et al. Protection against an intranasal challenge by vaccines formulated with native and recombinant preparations of the Chlamydia trachomatis major outer membrane protein
EP2890394B1 (en) Stabilised proteins for immunising against staphylococcus aureus
Tifrea et al. Increased immunoaccessibility of MOMP epitopes in a vaccine formulated with amphipols may account for the very robust protection elicited against a vaginal challenge with Chlamydia muridarum
RU2723046C2 (en) Chlamydia sp vaccines
Tifrea et al. Amphipols stabilize the Chlamydia major outer membrane protein and enhance its protective ability as a vaccine
WO2012065262A1 (en) Expression, purification and refolding of recombinant chlamydia proteins, compositions and related methods
US20160367655A1 (en) Immunogenic Compositions
Chionh et al. Heat shock protein complex vaccination induces protection against Helicobacter pylori without exogenous adjuvant
US20150202277A1 (en) Stabilised proteins for immunising against staphylococcus aureus
dos Anjos Leal et al. Mycoplasma hyopneumoniae and Mycoplasma flocculare differential domains from orthologous surface proteins induce distinct cellular immune responses in mice
Gao et al. Interleukin-2 shows high adjuvanticity for an inactivated vaccine against duck Tembusu virus disease
Cheng et al. Assessment of the role in protection and pathogenesis of the Chlamydia muridarum V-type ATP synthase subunit A (AtpA)(TC0582)
US9987346B2 (en) Methods and compositions for vaccinating a subject for a sexually transmitted pathogen
US20150203543A1 (en) Stabilised proteins for immunising against staphylococcus aureus
US20220378892A1 (en) Recombinant expression of chlamydia momp antigen
Rose et al. Unusual Self-Assembly of the Recombinant Chlamydia trachomatis Major Outer Membrane Protein–Based Fusion Antigen CTH522 Into Protein Nanoparticles
US20150191513A1 (en) Stabilised proteins for immunising against staphylococcus aureus
US9913889B2 (en) Immunogenic TP0751 fragments
US20210292398A1 (en) Streptococcal toxic shock syndrome
Chanda et al. Bridging Gaps in Antibody Responses and Animal Welfare: Assessing Blood Collection Methods and Vaginal Immunity in Mice Immunized with Intranasal Gonococcal Vaccines
as an Adjuvant et al. Immunization with the

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11841710

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 11841710

Country of ref document: EP

Kind code of ref document: A1