WO2012016245A2 - Fibronectin cradle molecules and libraries thereof - Google Patents

Fibronectin cradle molecules and libraries thereof Download PDF

Info

Publication number
WO2012016245A2
WO2012016245A2 PCT/US2011/046160 US2011046160W WO2012016245A2 WO 2012016245 A2 WO2012016245 A2 WO 2012016245A2 US 2011046160 W US2011046160 W US 2011046160W WO 2012016245 A2 WO2012016245 A2 WO 2012016245A2
Authority
WO
WIPO (PCT)
Prior art keywords
cradle
amino acid
loop
fnlll
library
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/046160
Other languages
French (fr)
Other versions
WO2012016245A3 (en
Inventor
Andreas Loew
Brian Edward Vash
Shohei Koide
John Bernard Wojcik
Akiko Koide
Ryan Nicholas Gilbreth
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
University of Chicago
Original Assignee
Novartis AG
University of Chicago
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2805862A priority Critical patent/CA2805862A1/en
Priority to RU2013108962/10A priority patent/RU2013108962A/en
Priority to MX2013001144A priority patent/MX345300B/en
Priority to JP2013523251A priority patent/JP6092773B2/en
Priority to US13/813,409 priority patent/US9512199B2/en
Priority to SG2013006580A priority patent/SG187225A1/en
Priority to EP11746713.4A priority patent/EP2598529A2/en
Priority to AU2011283646A priority patent/AU2011283646B2/en
Application filed by Novartis AG, University of Chicago filed Critical Novartis AG
Priority to CN2011800474318A priority patent/CN103403027A/en
Priority to KR1020137005001A priority patent/KR20130136443A/en
Publication of WO2012016245A2 publication Critical patent/WO2012016245A2/en
Publication of WO2012016245A3 publication Critical patent/WO2012016245A3/en
Priority to IL224220A priority patent/IL224220A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/78Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C40COMBINATORIAL TECHNOLOGY
    • C40BCOMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B40/00Libraries per se, e.g. arrays, mixtures
    • C40B40/04Libraries containing only organic compounds
    • C40B40/10Libraries containing peptides or polypeptides, or derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics

Definitions

  • the present application relates to novel Fibronectin Type III domain (Fnlll) polypeptides and the methods of making and using such Fnlll polypeptides. More specifically, the present invention relates to a library of Fnlll polypeptides using the CD and the FG loops of a number of Fnlll domains (e.g. , Fnlll 07 , Fnlll 10 and Fnlll 14 ) together with the surface exposed residues of the beta-sheet.
  • Fnlll Fibronectin Type III domain
  • scaffold binding proteins are becoming legitimate alternatives to antibodies in their ability to bind specific ligand targets. These scaffold binding proteins share the quality of having a stable framework core that can tolerate multiple substitutions in the ligand binding regions.
  • Some scaffold frameworks have immunoglobulin like protein domain architecture with loops extending from a beta sandwich core.
  • a scaffold framework core can be synthetically engineered and used to form a library comprising different sequence variants. The sequence diversity of such libraries is typically concentrated in the exterior surfaces of the proteins such as loop structures or other exterior surfaces that can serve as ligand binding regions.
  • the fibronectin type III domain (Fnlll) has been established as an effective non- antibody "alternative" scaffold for the generation of novel binding proteins.
  • a member of the immunoglobulin superfamily, Fnlll has three surface exposed loops at one end of the molecule which are analogous to antibody complementarity determining regions (CDRs).
  • CDRs antibody complementarity determining regions
  • Engineering strategies using this scaffold are based on combinatorial libraries created by diversifying both the length and amino acid sequence of these surface loops. From such libraries, Fnlll variants capable of binding to a target of interest can be isolated using various selection methods.
  • the Fnlll scaffold offers many advantages compared to conventional antibodies or fragments thereof because it lacks disulfide bonds, can be readily and highly expressed in bacterial systems, and is relatively small. However, a need exists for improved Fnlll based polypeptides and methods of producing libraries of such polypeptides.
  • the present invention is based on the unexpected discovery that modifications to a beta sheet of a Fnlll polypeptide in addition to modifications to at least one loop region of the Fnlll based polypeptide result in an Fnlll based binding molecule with improved binding ability for a target molecule.
  • the improved binding is a result of increased surface area available for binding to a target molecule by using amino acid residues in the beta sheet to form part of the binding surface and to bind to a target molecule. Modifications to the beta sheets can also be used to distinguish targets.
  • the invention pertains to modifications in the beta strand and loop of all Fnlll molecules, e.g. , Fnlll 07 , Fnlll 10 and Fnlll 14 .
  • the invention pertains to modifications in F and/or C beta strands and modifications in the the FG loop and the CD loop of Fnlll molecules, e.g. , Fnlll 07 , Fnlll 10 and Fnlll 14 .
  • the invention pertains to an Fnlll domain-based cradle polypeptide comprising one or more amino acid substitutions in at least a loop region and at least a non-loop region.
  • the cradle polypeptide may comprise amino acid substitutions in both the beta strands in conjunction with substitutions in the AB loop, the BC loop, the CD loop, the DE loop, and/or the FG loop of Fnlll.
  • the cradle polypeptide may comprise amino acid substitution in beta strand C, beta strand D, beta strand F and/or beta strand G.
  • the cradle polypeptide may comprise one or more amino acid substitutions in two loop regions and/or two non-loop regions, wherein the non-loop regions may be the beta strands C and F, and the loop regions may be the CD and FG loops.
  • the one or more amino acid substitutions may be introduced to the cradle residues in the beta strands.
  • the cradle polypeptide may further comprise an insertion and/or deletion of at least one amino acid in at least one loop and/or non-loop region.
  • the cradle polypeptide may further comprise an insertion and/or deletion of at least one amino acid in two loop regions and/or two non-loop regions, wherein the non- loop regions may be the beta strands C and F, and the loop regions may be the CD and FG loops.
  • the Fnlll domain may be the 1 st , 2 nd , 3 rd , 4*, 5 th , 6*, 7 th , 8*, 9 th , 10 th , 11 th , 12 th , 13 th , 14 th , 15 th or 16 th Fnlll domain of human fibronectin.
  • the one or more amino acid substitutions in the non-loop region may not change the structure of the Fnlll domain scaffold and/or the shape of the loop regions. In some embodiments, the one or more amino acid substitutions in the non-loop region may exclude the non-cradle residues.
  • loop CD may be about 3-11, about 4-9, or 5 residues in length, wherein loop FG may be about 1-10, 5 or 6 residues in length.
  • Position 1 of the FG loop may be a Gly residue
  • position 2 may be a Leu, Val, or lie residue
  • position 3 may be a charged or polar residue
  • position 4 may be a Pro residue
  • position 5 may be a Gly residue
  • position 6 may be a polar residue.
  • positions 3 and/or 5 of the loop may be a Gly residue.
  • the beta strand lengths may be about 6-14, about 8-11, or 9 residues for beta strand C and for beta strand F about 8-13, about 9-11, or 10 residues.
  • the residue at positions 2, 4, and 6 of the C beta strand may be a hydrophobic residue, and positions 1, 3, 5, and 7-9 of the C beta strand amy be altered relative to the wild type sequence, wherein the residue at position 1 of the C beta strand may be selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys, and Arg.
  • the residue at position 3 of the C beta strand may be a hydrophobic residue, or may be selected from the group consisting of He, Val, Arg, Leu, Thr, Glu, Lys, Ser, Gin, and His.
  • Position 5, 7, 8, and 9 of the C beta strand may be selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys, and Arg.
  • the residue at positions 1, 3, 5, and 10 of the F beta strand may be altered relative to the wild type sequence, wherein the residues at positions 1, 3, 5, and 10 of the F beta strand may be individually selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys, and Arg.
  • the residue at positions 2, 4, and 6 of the F beta strand may be a hydrophobic residue.
  • the residue at position 7 of the F beta strand may be a hydrophobic residue, or may be selected from the group consisting of Arg, Tyr, Ala, Thr, and Val.
  • the residue at position 8 of the F beta strand may be selected from the group consisting of Ala, Gly, Ser, Val, and Pro.
  • the residue at position 9 of the F beta strand may be selected from the group consisting of Val, Leu, Glu, Arg, and He.
  • the cradle polypeptide may comprise a substitution that corresponds to a substitution in one or more of the amino acids at positions 30, 31, 33, 35, 37- 39, 40-45, 47, 49, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, and/or 86 of SEQ ID NO: l.
  • the cradle polypeptide may comprise amino acid substitution in one or more of the amino acids at positions 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85 of SEQ ID NO:97.
  • the cradle polypeptide may comprise amino acid substitution in one or more of the amino acids at positions 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81 of SEQ ID NO: 129.
  • the cradle polypeptide may comprise an amino acid sequence set forth in SEQ ID NOs: 468, 469 and 470.
  • the cradle polypeptide may be modified by inserting or deleting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20 or more amino acids, or any range derivable therein, in an Fnlll loop.
  • substitutions in loops AB, CD, and EF may be specifically excluded, either individually or in various combinations.
  • modifications in the bottom loop(s) may be limited to 1, 2, 3, 4, or 5 or fewer substitutions, insertions, and/ or deletions.
  • the amino acid substitutions may contribute to the binding specificity of the cradle polypeptide.
  • a chimeric cradle polypeptide comprising one or more amino acid substitutions in at least a loop region and at least a non-loop region, wherein part of the cradle polypeptide is replaced by a non-FnIII domain polypeptide that enhances the binding affinity of the cradle polypeptide for a target molecule.
  • the chimeric cradle polypeptide may comprise all or part of a complementarity determining region (CDR) of an antibody or a T-cell receptor, wherein the CDR may be a CDR1, CDR2 or CDR3 of a single domain antibody.
  • the single domain antibody may be a nanobody.
  • the CDR may replace part or all of the AB, BC, CD, DE, EF or FG loop.
  • a multispecific cradle polypeptide comprising multiple copies of one or more monomer cradle polypeptides disclosed herein, wherein the monomer cradle polypeptides may be linked by a linker sequence.
  • the linker sequence may be selected from the group consisting of GGGGSGGGGS (SEQ ID NO: 471), GSGSGSGSGS (SEQ ID NO: 472), PSTSTST (SEQ ID NO: 473) and EIDKPSQ (SEQ ID NO: [0016]
  • the present invention provides a cradle library comprising a plurality of cradle polypeptides having amino acid substitutions in both the beta strands in conjunction with substitutions in the AB loop, the BC loop, the CD loop, the DE loop, and/or the FG loop of Fnlll.
  • the cradle polypeptides may comprise one or more amino acid substitutions corresponding to amino acid positions 30, 41, 42, 43, 44, 45, 76, 77, 78, 79, 80, 81, 82, 83, 84 and/or 85 of SEQ ID NO: l.
  • the cradle polypeptides may further comprise one or more amino acid substitutions corresponding to amino acid positions 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 32, 34, 35, 36, 37, 38, 39, 40, 46, 48, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 74, 75, 86, 87, 88, 89, 90, 91, 92, 93 and/or 94 of SEQ ID NO: l.
  • the cradle polypeptides may be at least 50%, 60%, 70%, 80%, or 90% identical to SEQ ID NO: l. In some embodiments the cradle polypeptides may further comprise an insertion of at least 1, 2, or about 2-25 amino acids in at least one loop region. In some embodiments the cradle polypeptides may comprise a deletion of at least 1, 2 or about 2-10 amino acids in at least one loop region. In some embodiments the cradle polypeptides may comprise a deletion of at least 2 amino acids in two loop regions. In some embodiments the cradle polypeptides may comprise at least 1 amino acid insertion and 1 amino acid deletion in at least one loop region.
  • the cradle polypeptides may comprise an insertion and deletion of at least 1 amino acid in the same loop region.
  • the cradle library may be preselected to bind a target molecule.
  • the cradle polypeptides may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 79, 86 and 468- 470.
  • the cradle library may contain 10, 100, 1000, 10 4 , 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10", 10 12 , 10 13 , 10 14 , 10 15 or more different polypeptide variants, including all values and ranges there between.
  • the amino acid sequence of the Fnlll domain from which the library is generated is derived from the wild type amino acid sequences of the 1 st , 2 nd , 3 rd , 4 ⁇ , 5 ⁇ , 6 ⁇ , 7 ⁇ , 8*, 9 th , 10*, 11 th , 12 th , 13 th , 14*, 15* or 16* Fnlll domain of human fibronectin.
  • the cradle polypeptide sequences may be a a loop FG comprising 5 or 6 residues, a loop CD comprising 3 to 11 residues, a beta strand C comprising 6 to 14 residues, a beta F comprising 8 to 13 residues, or a combination of the loops and strands.
  • polynucleotides encoding one or more cradle polypeptide described herein.
  • the polynucleotide may be an expression cassette or an expression construct.
  • the expression construct may be capable of expressing the encoded polypeptide in a host cell, such as a prokaryotic or eukaryotic cell line or strain.
  • the expression construct may be functional in one or more polypeptide expression systems known in the art.
  • the expression construct may be functional in bacteria, yeast, insect cells, mammalian cells or the like.
  • a method of producing a cradle polypeptide by: a) expressing a polynucleotide encoding a cradle polypeptide disclosed herein in a host cell; and b) isolating and/or purifying the expressed cradle polypeptide.
  • the method may include the engineering of various amino acids substitutions, deletions, and/or insertions described herein.
  • a method of forming a cradle library of Fnlll domain polypeptides useful in screening for the presence of one or more polypeptides having a selected binding or enzymatic activity comprises: (i) aligning loops FG and CD, and preferably beta strands C and F amino acid sequences in a collection of native Fnlll domain polypeptides, (ii) segregating the aligned loop and beta strand sequences according to length, (iii) for a selected loop, beta strand, and length from step (ii), performing positional amino acid frequency analysis to determine the frequencies of amino acids at each position, (iv) for each loop, beta strand, and length analyzed in step (iii), identifying at each position a conserved or selected semi-conserved consensus amino acid and other natural- variant amino acids, (v) for at least one selected loop, beta strand, and length, forming: (1) a library of mutagenesis sequences expressed by
  • the cradle library may include cradle polypeptides which may comprise: (a) regions A, AB, B, C, CD, D, E, EF, F, and G having wildtype amino acid sequences of a selected native Fnlll polypeptide, and (b) loop regions FG, CD, and/or beta strands C and F, having selected lengths, wherein at least one selected loop and/or beta strand region of a selected length contains a library of mutagenesis sequences expressed by a library of coding sequences that encode, at each loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has an occurrence frequency equal to or less than a selected threshold frequency of at least 50%, a single common target amino acid and any co-produced amino acids.
  • the cradle polypeptides may comprise: (a) regions A, AB, B, C, CD, D, E, EF, F, and G having wildtype amino acid sequences of a selected native Fnlll polypeptide, and (b) loop regions FG, CD, and non-loop regions C and F having selected lengths, where at least one selected loop and/or beta strand region of a selected length contains a library of natural- variant combinatorial sequences expressed by a library of coding sequences that encode at each position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has a frequency of occurrence equal to or less than a selected threshold frequency of at least 50%, other natural variant amino acids, including semi- conserved amino acids and variable amino acids whose occurrence rate is above a selected minimum threshold occurrence at that position, or their chemical equivalents.
  • the cradle library may have a given threshold of 100%, unless the amino acid position contains only one dominant and one variant amino acid, and the dominant and variant amino acids are chemically similar amino acids, in which case the given threshold may be 90%.
  • the cradle library may contain all natural variants or their chemical equivalents having at least some reasonable occurrence frequency, e.g. , 10%, in the in the selected loop, beta strand, and position.
  • the cradle library may have at least one or more loops FG and CD and/or beta-strands C and F which comprise beneficial mutations identified by screening a natural-variant combinatorial library containing amino acid variants in the loops, beta strands, or combinations thereof.
  • one or more members of the library may be then isolated from other members of the library and analyzed.
  • the cradle library may be pre- selected to bind a target and those preselected members are then further diversified in selected amino acid position to generate a targeted cradle library that is subsequently screened for a particular characteristic or property.
  • a method of of identifying a cradle polypeptide having a desired binding affinity to a target molecule comprising: a) reacting a cradle library of Fnlll domain polypeptides disclosed herein with the target molecule, and b) screening the cradle library of Fnlll domain polypeptides to select those having a desired binding affinity to the target molecule.
  • one or more cradle polypeptides may be selected that have a particular property, such as binding specificity and/or binding affinity to a target.
  • the amino acid or nucleic acid sequence of one or more of the selected library members may be determined using conventional methods.
  • the sequence of the selected Fnlll polypeptide(s) may then be used to produce a second cradle library that introduces further substitution of the selected sequences.
  • the second cradle library may then be screened for Fnlll polypeptides having a particular property. The process can be repeated 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times. Additional iterations may enrich the cradle library as well as potentially include other variants.
  • the method may further comprise conducting a first screen of a cradle library having amino acid substitutions in only Fnlll loops or only Fnlll beta strands and conducting a second screen using substitutions in only Fnlll loops or only Fnlll beta strands.
  • the first screen may use only substitutions in the Fnlll loops and the second screen may use only substitutions in the Fnlll beta-strands.
  • the second screen may use substitutions in both Fnlll loops and beta-strands.
  • the Fnlll amino acid residues varied in the first screen may or may not be varied in the second screen.
  • Also provided herein is a method of detecting a target molecule which comprises contacting a sample containing the target with an Fnlll binding domain that specifically binds the target. Further provided herein is a method of producing an Fnlll variant comprising: (a) expressing a polypeptide comprising an amino acid sequence; and (b) isolating and/or purifying the expressed variant Fnlll domain from a host cell expressing the variant Fnlll.
  • a cradle polypeptide selected using the method of identifying a cradle polypeptide having a desired binding affinity to a target molecule disclosed herein.
  • the cradle polypeptide may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs:4-78, 80-85, 87-96, 98, 99, 101-128, 130- 141, 143, 145-147, 149-159, 161-199, 201-238 and 240-277.
  • the present invention provides a kit comprising a plurality of cradle polypeptides as described herein. Also provided herein is a kit comprising a plurality of polynucleotides encoding the Fnlll cradle polypeptides as disclosed herein. Further provided herein is a kit comprising a cradle library and/or the polynucleotides encoding the cradle library as disclosed herein.
  • Figure 1 is a schematic diagram illustrating the method for constructing Fnlll cradle libraries using computer assisted genetic database biomining and delineation of beta-scaffold and loop structures.
  • Figure 2A shows the structure and sequence of the wild type Fnlll 10 (SEQ ID NO: 1). Loops CD and FG along with the specific residues of beta strands C and F are shown in black in the structure and boldface black in the sequence.
  • Figure 2B shows the binding surface formed by the Cradle. Loops CD and FG are black, sheet C is light gray, and sheet F is dark gray.
  • Figure 3 A shows the placement of the cradle residues on the ribbon diagrams of the Fnlll domains.
  • the structure for the Fnlll 07 domain is from RCSB code 1FNF
  • the structure for the Fnlll 10 domain is from 1FNA
  • the structure for the Fnlll 14 domain is from 1FNH.
  • Figure 3B is a ball and stick representation of the location of the cradle on the Fnlll 10 molecule, where cradle residues are black and other residues are white.
  • Figures 4A-D show the length distribution calculated from mammalian Fnlll domains found in the PFAM family PF00041.
  • Figure 4 A Sheet C
  • Figure 4B Loop CD
  • Figure 4C Sheet F
  • Figure 4D Loop FG.
  • Figures 5A-H show the positional amino acid distribution found in the structural elements of the Cradle. The conservation of the top 5 amino acids for each position in each Cradle is shown.
  • Figure 5A Sheet C, length 9;
  • Figure 5B Sheet C, length 10;
  • Figure 5C Loop CD, length 4;
  • Figure 5D Loop CD, length 5;
  • Figure 5E Loop CD, length 6;
  • Figure 5F Sheet F, length 10;
  • Figure 5G Loop FG, length 5;
  • Figure 5H Loop FG, length 6.
  • Figures 6A-F show the binding surface comparison of the Fnlll 10 Cradle, the Fnlll 10 Top Side and the Fnlll 10 Bottom Side binding sites.
  • Figure 6A Cradle shown in white on a ribbon diagram of Fnlll 10 ;
  • Fi gure 6B Surface representation of the Cradle;
  • Figure 6C Top Side shown in white on a ribbon diagram of FnIII 10 ;
  • Fi gure 6D Surface representation of the Top Side;
  • Figure 6E Bottom Side shown in white on a ribbon diagram of FnIII 10 ;
  • Fi gure 6F Surface representation of the Bottom Side.
  • Figures 7A-B show the conservation of amino acid type in sheets C and F of Fnlll 10 and indicates which residues are varied in the Cradle molecule and which ones were left as wild type.
  • Figure 7A Ribbon diagram of FnIII 10 with the amino acids in sheets C and F numbered 1 - 19. The Ca for each amino acid is shown as a sphere and the C is shown as a stick to indicate the direction of the amino acid R group. Varied amino acids are colored gray and unvaried are colored white.
  • Figure 7B Table showing the amino acid type conservation for each position in sheets C and F.
  • Figure 8 is the amino acid distribution in the varied residues of the Cradle and CDR- H3 domains known to bind antigens.
  • Figures 9A-F describe the design of the Cradle library on Fnlll 07 , Fnlll 10 , and Fnlll 14 .
  • Fi gure 9A Length distribution of loop CD
  • Figure 9B Length distribution of loop FG
  • Figure 9C Amino acid distribution in the sheets and loops.
  • Figure 9D Alignment of cradle residues for Fnlll 07 , Fnlll 10 and Fnlll 14 (SEQ ID NOs: 468-470). Beta sheets are shown as white residues on a black background and loops are shown as black text.
  • Cradle residues are shown in bold with X representing the amino acid distribution for the beta sheets and Y
  • Figure 9E Alignment of Fnlll 07 , Fnlll 10 and Fnlll 14 (SEQ ID NOs:97, 100, 129) illustrating the cradle residues in beta sheets C and F and loops CD and FG. Beta sheets are shown as white residues on a black background and loops are shown as black text with Cradle residues shown in bold.
  • Figure 9F Shown are the Fnlll structural element residue ranges and Fnlll cradle residues ranges.
  • Figures lOA-C show a shared epitope for a monobody and a SIM peptide and conservation of the SIM binding site in SUMO proteins.
  • Figure 10A The structures of the ySMB-1 monobody bound to ySUMO (left) and a SIM peptide bound to hSUMO-115 (PDB ID 1Z5S) (right) are shown. Because there are no structures of natural SIM peptides in complex with ySUMO, the structure of a SIM peptide bound to hSUMO-1 is shown for comparison.
  • FIG. 10B An alignment of SIM binding site/ySMB-1 epitope residues in ySUMO, and two human homologs, hSUMO-1 and hSUMO-2 are shown (top left) (SEQ ID NOs:297-299). Residues are ranked according to their conservation score: residues identical in all 3 SUMO proteins (i), similar with a conservation score of 9 (ii), and similar with a conservation score of 8 (iii). Conservation scores were calculated using methods outlined by Livingstone and Barton, Comput. Appl. Biosci. (1993) 9:745-756 using the Jalview program (Clamp, et al. ,
  • Figures 11A-C illustrate the design of a SUMO-targeted cradle library.
  • Figure 11 A Shown is the structure of the ySMB-l/ySUMO interface. The ySUMO structure is shown as a surface with epitope residues shown as sticks.
  • Figure 11B Shown is a sequence alignment (top) of ySMB-1 epitope residues in ySUMO and equivalent residues in hSUMO-1 and hSUMO-2 (SEQ ID NOs:297-299). Below, the residues of ySMB-1 varied in the SUMO- targeted library are listed. Interactions between ySMB-1 residues and ySUMO residues in the ySMB-l/ySUMO structure are indicated by lines.
  • Figure 11C Shown is a cartoon of the ySMB-1 structure with the positions varied in the SUMO-targeted library indicated.
  • Figures 12A-C illustrate the selection and characterization of monobodies from the SUMO-targeted library.
  • Figure 12 A ySUMO (left) and hSUMO-1 (right) are shown with the ySMB-1 paratope structure modeled as if binding to each target.
  • Monobody residue positions are shown as spheres corresponding to Ca atoms of indicated residue numbers.
  • FG loop residues (75, 76, 78, 79, 80, 81, 82, 83, 84, and 85) and scaffold residues (31, 33, and 73) are indicated.
  • a table is shown listing the amino acid diversities introduced at monobody positions in the SUMO-targeted library. Wildtype residues at each position are indicated in brackets.
  • Figure 12B Shown are the amino acid sequences of monobodies recovered against ySUMO and hSUMO-1 as well as representative SPR binding traces (SEQ ID NOs:303-318). Estimated dissociation constants from SPR are given for all clones.
  • Figure 12C Shown are the sequence logo representations of 40 ySUMO monobodies and 44 hSUMO- 1 monobodies. The wild-type sequence of ySMB-1 is shown above (SEQ ID NO:303). In this depiction, the relative height of individual letters reflects how frequently that amino acid is recovered at that position, the letters stacked at a given position are ordered from more frequently occurring to less frequently occurring, and the overall height of an individual stack reflects the overall level of sequence conservation at that position. Figures generated using WebLogo (Crooks, et al , Genome Res. (2004) 14:1188-1190; Schneider and Stephens, Nucleic Acids Res. (1990) 18:6097-6100).
  • Figure 13 shows the rationale for scaffold residue preferences in ySUMO and hSUMO-1 monobodies. Contacts made by scaffold residues in the ySMB-l/ySUMO complex (left) and in a modeled ySMB-l/hSUMO-1 complex (right) are shown. A potential steric and electrostatic clash between R33 of the monobody scaffold and K25 of hSUMO-1 is circled.
  • Figures 14A-D show the specificity in ySUMO and hSUMO-1 binding monobodies.
  • Figure 14A Amino Acid Sequences of Two Nearly Identical ySUMO and hSUMO-1
  • Monobodies are shown (SEQ ID NOs:303, 319-320). Monobody A was recovered as a hSUMOl binder, and monobody B as a ySUMO binder.
  • Figure 14B Phage ELISA data is shown for binding of Monobody A and B to ySUMO and hSUMO-1. Both ySUMO and hSUMO-1 were produced as GST fusion proteins. Binding to GST is shown as a negative control.
  • Figure 14C Phage ELISA data for the binding of 32 hSUMO-1 monobodies to ySUMO, hSUMO-1, and hSUMO-2 is shown. All SUMO proteins were produced as GST fusions. Binding to GST is shown as a negative control.
  • Figure 14D Sequence alignments of monobodies specific for hSUMO-1 and cross-reacting with ySUMO are shown in sequence logo format (see Figure 13 legend for explanation of sequence logos).
  • the wild-type ySMB-1 sequence is shown above. Clone numbers 1, 3, 4, 5, 6, 8, 9, 12, 13, 17, 18, 20, 21, 23, 31 and 32 in Figure 25C were classified as cross-reactive. The remaining 16 clones were classified as specific.
  • Figures 15A-C show the representative binding data for monobodies generated from the cradle libraries. Phage ELISA signals of selected clones are shown.
  • Figures 15 A, B and C show clones selected from the BL1 library with hSUMOl, human ubiquitin and AblSH2 as a target, respectively.
  • ELISA wells were coated with the cognate target.
  • the left bars show data in the absence of a soluble target (which serves as a competitor), and the middle bars show data in the presence of a soluble competitor (100 nM for hSUMOl and 200nM for the others).
  • the right bars show binding to wells containing no target (negative control).
  • Figures 16A-E show the sequences and properties of ySUMO-binding monobodies.
  • Figure 16 A yeast SUMO (ySUMO) structure shaded by conservation score among ySUMO and hSUMO isoforms (Livingstone and Barton, supra, 1993).
  • Figure 16B Schematic of the Fnlll scaffold with beta strands A-G labeled and surface loops (BC loop, DE loop, and FG loop) diversified in monobody libraries.
  • Figure 16C Amino acid sequences of variable loops of ySUMO-binding monobodies with K d values from SPR (SEQ ID NOs:321-329).
  • Figure 16D SPR traces for ySMB-1 and ySMB-2 binding to ySUMO with kinetic parameters calculated from a bet fit (solid line) of the raw data (dashed line) to a 1: 1 binding model.
  • Figure 16E Epitopes of ySMB-1 and ySMB-2 mapped from NMR chemical shift perturbation shown on the ySUMO structure.
  • Figure 17 shows the sequences and affinities of ySUMO-binding monobodies (SEQ ID NOs:321-415). Amino acid sequences of the variable loops of all ySUMO-binding monobodies recovered in our laboratory. If available, K ⁇ j values from SPR are given.
  • Monobodies originated from one of three libraries: a binary Tyr/Ser library in which loop lengths and sequences were varied using a combination of 50% Y and 50% S (Koide, A., et al , Proc. Natl. Acad. Sci. USA (2007) 104:6632-6637), a "YSX” library which used a combination of 40% Y, 20% S, 10% G, and 5% each of R, L, H, D, N, A (Olsen, et al.
  • Figure 18 shows the epitope mapping ELISA of ySUMO-binding monobodies. Binding of 34 phage-displayed ySUMO-binding monobodies measured by ELISA in the presence and absence of 1 ⁇ ySMB-1 competitor. Clone numbers correspond to those of the format ySMB-X in Figure 28.
  • Figures 19A-B show the specificity of ySUMO-binding monobodies.
  • Figure 19 A Binding of eight ySUMO-binding monobodies to ySUMO, hSUMOl and hSUM02 assayed using phage ELISA. Clone numbers are of the format ySMB-X in Figures 27C and 28.
  • Figure 19B Equilibrium SPR measurements of ySMB-1 (left column) and ySMB-9 (right column) binding to ySUMO, hSUMOl and hSUM02. Equilibrium responses at multiple concentrations (left panels) were fit with a simple 1 : 1 binding model (right panels).
  • Figures 20A-C show the crystal structure of the monobody ySMB-l/ySUMO complex.
  • Figure 20A Top: ySUMO and ySMB-1 are shown with monobody paratope residues shown as sticks; FG loop residues and scaffold residues are indicated.
  • ySUMO is shown in the same orientation as in Figure 16E.
  • Bottom An alternative view with the monobody paratope depicted as a surface.
  • Figure 20B Close-up of the ySMB-l/ySUMO interface.
  • ySUMO surface/sticks
  • Monobody paratope residues are shown as in (A).
  • Figure 20C Left and Middle: comparison of the binding modes of ySMB-1 to ySUMO and the SIM of RanBP2 to hSUMOl. Both form intermolecular beta sheets with their SUMO targets (expanded box). Right: Overlay of the RanBP2 SIM and SIM mimicking monobody residues with the ySUMO surface shown.
  • Figures 21A-B show the ySMB-l/ySUMO interface analysis.
  • Figure 21 A Buried surface area contributed by each residue in the ySMB-1 paratope.
  • Figure 21B Percent of total ySMB-1 and ySUMO buried surface area contributed by each amino acid type.
  • Figures 22A-F show the hSUMOl -binding monobodies from the SUMO-targeted library.
  • Figure 22A Design of the SUMO-targeted cradle library.
  • Left ySMB-1 paratope residues (backbone sticks/spheres) are shown with FG loop and scaffold residues indicated.
  • ySUMO (surface) is shown with ySMB-1 epitope residues as sticks.
  • ySUMO residues F37, K38, K40, T43, L48, and R55 are completely conserved, H23, 135, 139, R47 and A51 are conservative substitution and N25, E34, F36, E50, and K54 are non-conservative substitution, according to conservation between ySUMO and hSUMOs.
  • the residue types at each position in hSUMOl and hSUM02/3 are shown in parentheses.
  • Right Amino acid diversity used in the SUMO-targeted library.
  • the wild-type ySMB-1 residue is in brackets.
  • Figure 22B Amino acid sequences of hSUMOl -binding monobodies from the SUMO-targeted library. K ⁇ j values from SPR are also shown.
  • FIG. 22E Binding of hSlMB-22 and ySMB-ST6 to ySUMO and hSUMOl measured by phage ELISA.
  • Figure 22F Contacts made by scaffold residues in the ySMB- 1/ySUMO complex (left) and in a modeled ySMB-l/hSUMO-1 complex (right). Monobody (sticks) and SUMO residues (surface/sticks) are indicated.
  • the ySMB-l/hSUMOl complex was modeled by superposition of the ySUMO portion of the ySMB-1 complex with the hSUMOl structure.
  • Figure 23 shows the ySUMO-binding monobodies isolated from the SUMO-targeted library. Shown are the amino acid sequences of monobodies recovered against ySUMO from the SUMO-targeted library with K d values from SPR (SEQ ID NOs:303, 428-432) and representative SPR traces.
  • Figure 24 shows the epitope mapping ELISA of hSUMOl -binding monobodies. Binding of sixteen phage-displayed hSUMOl -binding monobodies to hSUMOl measured by ELISA in the presence or absence of ⁇ hSlMB-4 competitor. Clone numbers correspond to those of the format hSlMB-X in Figures 22B and 26.
  • Figures 25A-B shows the specificity of hSUMO-1 -binding monobodies.
  • Figure 25 A Binding curves derived from phage ELISA of six hSUMOl -binding monobodies binding to ySUMO, hSUMOl and hSUM02. Data for additional monobodies are shown in Figure 26 ⁇ . Serial dilutions of phage containing culture supernatant (titer ⁇ 10 8 ) were used. Absorbance values were scaled to 1 cm path- length.
  • Figure 25B Equilibrium SPR measurements of hSlMB-4 binding to ySUMO, hSUMOl and hSUM02. Equilibrium responses at multiple concentrations (left panels) were fit to a simple 1 :1 binding model (right panels).
  • Figures 26A-B show the selectivity of hSUMOl -binding monobodies.
  • Figure 26A Binding curves derived from phage ELISA of 10 hSUMO-binding monbodies binding to ySUMO, hSUMOl and hSUM02. Data for six additional monobodies are shown.
  • Figure 26B The amino acid sequences of 16 hSUMOl -binding monobodies are shown (SEQ ID NOs:433- 448) and grouped according to their specificity factor for hSUMOl over ySUMO. The specificity factor is the ratio of apparent affinity measured for hSUMOl to that for ySUMO in the titration phage ELISA experiment shown in Figure 25A and Figure 26A.
  • Figures 27A-C show the effects of hSUMOl -specific monobodies on SUMO/SIM interactions and SUMOylation.
  • Figure 27A Left: Schematic of SIM-containing RanBP2's interaction with SUMOylated RanGAP (modified with hSUMOl). Right: Binding of RanBP2 to SUMOl-RanGAP in the presence of monobody hSlMB-4 in ELISA.
  • Figure 27B Schematic of the El- and E2-dependent steps in the SUMOylation cascade. Covalently linked intermediates are formed sequentially between SUMO and El (SAE1/2) and E2 (Ubc9).
  • Figure 27C SDS-PAGE of SUMOylation reactions carried out in the presence of hSlMB-4 (lanes 3-5) and hSlMB-5 (lanes 6-8). Lanes 1 and 2 are negative controls with ySMB-1 and without a monobody, respectively. All reactions contained SAE1/2, Ubc9 and both hSUMOl and hSUM03 as substrates. Bands corresponding to the SAE2-SUMO and Ubc9-SUMO covalent intermediates for each isoform are indicated. His 6 -tagged SUM03 (H6-SUM03) was used to distinguish hSUMOl from hSUM03 on the gel.
  • Figure 28 shows the proposed mechanism for monobody inhibition of hSUMOl conjugation.
  • the trajectory of a long loop of SAE1 that is disordered in the crystal structure is illustrated by a dashed line.
  • Figures 29A-B show the monobody effects on deSUMOylation.
  • Figure 29A shows the monobody effects on deSUMOylation.
  • FIG. 29B Schematic of the deSUMOylation assay in which a YFP-hSUMOl-ECFP fusion protein is cleaved by SENPl at the hSUMOl C-terminal di-glycine sequence.
  • Figure 29B SDS-PAGE analysis of deSUMOylation reactions carried out in the presence of hSMB-4 (lanes 6-8) or hSlMB-5 (lanes 9-11). Controls are also shown without SENPl or a monobody (lane 1) or with SENPl cleavage carried out in the presence of the ySUMO specific ySMB-1 (lanes 2-5). Bands corresponding to the YFP-hSUMOl-ECFP fusion and the YFP-hSUMOl and ECFP cleavage products are indicated as well as the band corresponding to the monobodies.
  • Figures 30A-E shows monobody library design.
  • Figure 30A A comparison of the VHH scaffold (left) and the Fnlll scaffold (right). The two beta sheet regions are colored in cyan and blue, respectively. The CDR regions of the VHH and the corresponding loops in Fnlll are colored and labeled. The beta strands of Fnlll are labeled with A-G.
  • Figure 30B The structure of a monobody bound to its target, maltose-binding protein (Gilbreth, R. N., et al , J Mol Biol (2008) 381:407-418). The monobody is depicted in the same manner as in A. Only a portion of maltose-binding protein is shown as a surface model.
  • Figure 30C The structure of a monobody bound to the Abl SH2 domain depicted as in B (Wojcik, et al. , supra, 2010).
  • Figure 30D The locations of diversified residues in the cradle library shown as spheres on the Fnlll structure.
  • Figure 30E The locations of diversified residues in the cradle library.
  • FIG. 3 ID SPR sensorgrams for target binding of representative monobodies.
  • the thin lines show the best global fit of the 1 : 1 binding model.
  • the insets show dose-dependence analysis of the sensorgrams and the best fit of the 1 : 1 binding model.
  • Figures 32A-D show the crystal structures of monobodies originating from the two libraries. The structures are shown with the monobodies in similar orientations.
  • Figure 32A The structure of the SH13 monobody bound to the Abl SH2 domain depicted as in Figure 30C.
  • Figure 32B NMR-based epitope mapping of the SH13/Abl SH2 complex. The spheres show residues of Abl SH2 whose amide resonances were strongly affected (shift of > 1.5 peak width), weakly affected (shift of 0.5-1.5 peak width) and minimally affected (shift of ⁇ 0.5 peak width) by monobody binding, respectively.
  • Figure 32C The crystal structures of the ySMB-l/ySUMO complex (left) and ySMB-9/hSUMOl complex (right).
  • Figure 32D The two monobodies bound to equivalent epitopes on the targets using distinct modes.
  • the left panel shows a comparison of the two crystal structures shown in C with ySUMO and hSUMOl superimposed.
  • the right panel shows ySUMO and hSUMOl in equivalent orientations with the epitopes for the indicated monobodies.
  • Figure 33 shows mutations of residues in the C-strand abolished target binding.
  • Residues 30, 31 and 33 of monobody GS5 were mutated back to their respective wild-type amino acids.
  • the mean fluorescence intensities of yeast cells displaying the GS5 monobody (filled circles) and the mutant (open circles) are plotted as a function of the concentration of the target, GFP.
  • fibronectin type III domain refers to a domain (region) from a wild-type fibronectin from any organism.
  • the Fnlll domain is selected from the group consisting of Fnlll 01 , Fnlll 02 , Fnlll 03 , Fnlll 04 , Fnlll 05 , Fnlll 06 , Fnlll 07 , Fnlll 08 , Fnlll 09 , Fnlll 10 , Fnlll 11 , Fnlll 12 , Fnlll 13 , Fnlll 14 , Fnlll 15 , and Fnlll 16 and the like.
  • the Fnlll domain is selected from the group consisting of Fnlll 07 , Fnlll 10 , and Fnlll . In another embodiment, the Fnlll domain is Fnlll . In another embodiment, the Fnlll domain is Fnlll 10 . In another embodiment, the Fnlll domain is Fnlll 14 .
  • Fnlll domain variant or “variant Fnlll domain” refers to a polypeptide region in which modifications have been made to the wildtype Fnlll domain. Modifications include one or more amino acid substitutions, deletions, and/or insertions are present as compared to the amino acid sequence of a wildtype Fnlll domain.
  • the Fnlll variant or Fnlll variant domain has an alteration with respect to specifically the human tenth domain of the Fnlll domain sequence (SEQ ID NO: l).
  • the Fnlll variant or Fnlll variant domain has an alteration with respect to specifically the human seventh domain of the Fnlll domain sequence (SEQ ID NO: 97).
  • the Fnlll variant or Fnlll variant domain has an alteration with respect to specifically the human fourteenth domain of the Fnlll domain sequence (SEQ ID NO: 129).
  • substitutional variant includes the replacement of one or more amino acids in a peptide sequence with a conservative or non-conservative amino acid(s).
  • the Fnlll domain variant has increased binding properties compared to the wildtype Fnlll domain relative to a particular target.
  • the Fnlll domain variant has an increased surface area available for binding to a target moelcule compared with the wild type Fnlll domain.
  • Fnlll domain polypeptide refers to a polypeptide that includes at least one Fnlll domain.
  • a "variant Fnlll domain polypeptide” or “Fnlll domain-based polypeptide” refers to a polypeptide that includes at least one Fnlll domain variant. It is contemplated that such polypeptides are capable of specifically binding a target polypeptide or protein.
  • Fnlll domain-based molecule refers to a molecule having an amino acid sequence of an Fnlll domain or Fnlll variant domain.
  • a " ⁇ sheet” or "beta sheet” is a form of regular secondary structure in proteins. Beta sheets consist of beta strands connected laterally by at least two or three backbone hydrogen bonds, forming a generally twisted, pleated sheet.
  • a "beta strand” or “ ⁇ strand” is a stretch of polypeptide chain typically 3 to 10 amino acids long with backbone in an almost fully extended conformation.
  • the term beta strand A also referred to as sheet A, refers to the amino acids preceding the AB loop.
  • beta strand B also referred to as sheet B, refers to the amino acids connecting the AB and BC loops.
  • beta strand C also referred to as sheet C or ⁇
  • beta strand D also referred to as sheet D or ⁇ 2
  • beta strand E also referred to as sheet E
  • beta strand F also referred to as sheet F or ⁇ 3
  • beta strand F also referred to as sheet F or ⁇ 3
  • beta strand G also referred to as sheet G or ⁇ 4, refers to the amino acids after the FG loop, e.g. , amino acid position 85-94 of SEQ ID NO: l.
  • a loop is a less ordered, flexible stretch of amino acids (as compared to alpha helices and beta sheets) that typically connect other structural elements of a protein.
  • the loops are designated by the beta-strands they connect, for example the loop connecting beta-strand A and beta-strand B is the AB loop.
  • BC loop refers to the amino acids corresponding to amino acids 22 to 30 of SEQ ID NO: l.
  • CD loop refers to the amino acids corresponding to amino acids 39 to 45 of SEQ ID NO: l.
  • DE loop refers to the amino acids corresponding to amino acids 51 to 55 of SEQ ID NO: l.
  • FG loop refers to the amino acids corresponding to amino acids 76 to 87 of SEQ ID NO: l.
  • non-loop region refers to parts of the polypeptide sequence that do not form a loop, which include, but are not limited to, the beta sheets and beta strands. In the context of Fnlll, the non-loop regions include beta strands A, B, C, D, E, F and G.
  • the term "library” refers to a collection (e.g. , to a plurality) of polypeptides having different amino acid sequences and different protein binding properties.
  • a variant Fnlll domain library comprising polypeptides having different variations of the Fnlll domain.
  • the library is an actual physical library of polypeptides or nucleic acids encoding the polypeptides.
  • a database that comprises information about a library that has been generated or a theoretical library that can be generated. This information may be a compound database comprising descriptions or structures of a plurality of potential variant Fnlll domains.
  • the term "specifically binds" or “specific binding” refers to the measurable and reproducible ability of an Fnlll domain variant to bind another molecule (such as a target), that is determinative of the presence of the target molecule in the presence of a heterogeneous population of molecules including biological molecules.
  • an Fnlll domain variant that specifically or preferentially binds to a target is a polypeptide that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to most or all other molecules.
  • Specific binding does not necessarily require (although it can include) exclusive binding.
  • Target refers to a peptide, antigen or epitope that specifically binds to an Fnlll-based binding molecule or monobody described herein.
  • Targets include, but are not limited to, epitopes present on proteins, peptides, carbohydrates, and/or lipids.
  • non-natural amino acid residue refers to an amino acid residue that is not present in the naturally occurring Fnlll domain in a mammal, such as a human.
  • affinity tag is used interchangeably herein, and usually refer to a molecule or domain of a molecule that is specifically recognized by an antibody or other binding partner. The term also refers to the binding partner complex as well. Thus, for example, biotin and a biotin/avidin complex are both regarded as an affinity tag. In addition to epitopes recognized in epitope/antibody interactions, affinity tags also comprise "epitopes" recognized by other binding molecules (e.g.
  • ligands bound by receptors ligands bound by receptors
  • ligands bound by other ligands to form heterodimers or homodimers His6 bound by Ni-NTA, biotin bound by avidin, streptavidin, or anti-biotin antibodies, and the like.
  • conjugate in the context of an Fnlll domain variant refers to a chemical linkage between the Fnlll domain variant and a non-FnIII domain variant. It is specifically contemplated that this excludes a regular peptide bond found between amino acid residues under physiologic conditions in some embodiments of the invention.
  • the term "cradle molecule” or "Fnlll-based cradle molecule” refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand and at least one loop region, wherein the loop region is a top loop region selected from the group consisting of BC, DE, and FG.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand and at least one loop region, wherein the loop region is a bottom loop region selected from the group consisting of AB, CD, and EF.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand and at least one top loop region selected from the group consisting of BC, DE, and FG and at least one bottom loop region selected from the group consisting of AB, CD, and EF. It is understood that not all three loops from the top or bottom region need to be used for binding the target molecule.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand and the top FG loop region and the bottom CD loop region.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand selected from the group consisting of sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G and at least one loop region, wherein the loop region is a top loop region selected from the group consisting of BC, DE, and FG.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand selected from the group consisting of sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G and at least one loop region, wherein the loop region is a bottom loop region selected from the group consisting of AB, CD, and EF.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand selected from the group consisting of sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G and at least one loop region, wherein the loop region is a bottom loop region selected from the group consisting of AB, CD, and EF.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand selected from the group consisting of sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G and at least one top loop region selected from the group consisting of BC, DE, and FG and at least one bottom loop region selected from the group consisting of AB, CD, and EF.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in beta strand C and the top FG loop region and the bottom CD loop region.
  • the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in beta strand F and the top FG loop region and the bottom CD loop region.
  • two or more cradle molecules are linked together. Such molecules are referred to herein as "multispecific cradle molecules”.
  • the cradle molecules can be linked together (e.g. , in a pearl-like fashion) to form a multispecific cradle molecules that comprises, for example, at least two cradle molecules that are linked together.
  • this multispecific cradle molecule binds to different target regions of a same target molecule (e.g. , Target A).
  • Target A a target molecule
  • one cradle molecule of the multispecific cradle molecule can bind to a first target region of Target A and another cradle molecule of the multispecific cradle molecule can bind to a second target region of Target A. This can be used to increase avidity of the multispecific cradle molecule for the target molecule.
  • the multispecific cradle molecule binds to multiple target molecules.
  • one cradle molecule of the multispecific cradle molecule can bind to Target A and another cradle molecule of the multispecific cradle molecule can bind to Target B (e.g. , a half life extender).
  • the multispecific cradle molecule comprises at least two cradle molecules that bind to different target regions of Target A and at least two cradle molecules that bind to different target regions of Target B.
  • any number of cradle molecules can be linked in this fashion to create a multispecific cradle molecule that are able to bind to different target regions of the same target molecule or different target molecules.
  • the C-terminal region of one cradle molecule is linked to the N-terminal region of another cradle molecule.
  • CDR complementarity determining region
  • non-FnIII moiety refers to a biological or chemical entity that imparts additional functionality to a molecule to which it is attached.
  • the non-FnIII moiety is a polypeptide, e.g. , human serum albumin (HSA), or a chemical entity, e.g. , polyethylene gycol (PEG) which increases the half-life of the Fnlll-based binding molecule in vivo.
  • HSA human serum albumin
  • PEG polyethylene gycol
  • cradle library refers to an Fnlll polypeptide library in which amino acid diversity in at least one beta strand and at least one top loop selected from the group consisting of BC, DE, and FG and/or at least one bottom loop selected from the group consisting of AB, CD, and EF loop regions is determined by or reflects the amino acid variants present in a collection of known Fnlll sequences.
  • N+/- libraries refers to a more sophisticated or fine tuned library in which the most frequent amino acids surrounding an fixed amino acid are determined in the library design.
  • N+/- libraries are conducted with variations in beta strands, (e.g. , sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G, in particular sheet C and F), bottom loops, AB, CD, and EF, the top loops, BC, DE, FG, or any combination of the beta strands (e.g. , sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G, in particular sheet C and F) and top and bottom loops.
  • beta strands e.g. , sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G, in particular sheet C and F
  • N is the most predominant amino acid at a particular position and amino acids upstream or downstream are designated +N or -N, respectively.
  • N+3 is an amino acid 3 positions upstream of N
  • N-3 is an amino acid 3 positions downstream of N in a 3D structure of Fnlll.
  • N+2 and N+l are amino acids at positions 2 and 1 upstream of N, respectively, while N-2 and N-l are amino acids at positions 2 and 1 downstream of N, respectively.
  • N-2 and N-l are amino acids at positions 2 and 1 downstream of N, respectively.
  • the term "conserved amino acid residue” or "fixed amino acid” refers to an amino acid residue determined to occur with a frequency that is high, typically at least 50% or more (e.g. , at about 60%, 70%, 80%, 90%, 95%, or 100%), for a given residue position.
  • a frequency that is high typically at least 50% or more (e.g. , at about 60%, 70%, 80%, 90%, 95%, or 100%)
  • a given residue is determined to occur at such a high frequency, i. e. , above a threshold of about 50%, it may be determined to be conserved and thus represented in the libraries of the invention as a "fixed” or “constant” residue, at least for that amino acid residue position in the loop region being analyzed.
  • residues refers to amino acid residues determined to occur with a frequency that is high, for 2 to 3 residues for a given residue position.
  • 2-3 residues, preferably 2 residues, that together, are represented at a frequency of about 40% of the time or higher (e.g. , 50%, 60%, 70%, 80%, 90% or higher)
  • the residues are determined to be semi-conserved and thus represented in the libraries of the invention as a "semi-fixed" at least for that amino acid residue position in the loop region being analyzed.
  • an appropriate level of nucleic acid mutagenesis/variability is introduced for a semi- conserved amino acid (codon) position such that the 2 to 3 residues are properly represented.
  • each of the 2 to 3 residues can be said to be “semi-fixed” for this position.
  • a "selected semi-conserved amino acid residue” is a selected one of the 2 or more semi-conserved amino acid residues, typically, but not necessarily, the residue having the highest occurrence frequency at that position.
  • variable amino acid residue refers to amino acid residues determined to occur with a lower frequency (less than 20%) for a given residue position. When many residues appear at a given position, the residue position is determined to be variable and thus represented in the libraries of the invention as variable at least for that amino acid residue position in the loop region being analyzed. Typically, an appropriate level of nucleic acid
  • variable amino acid (codon) position such that an accurate spectrum of residues is properly represented.
  • a lower threshold frequency of occurrence of variable amino acids may be, for example, 5-10% or lower. Below this threshold, variable amino acids may be omitted from the natural-variant amino acids at that position.
  • natural-variant amino acids includes conserved, semi-conserved, and variable amino acid residues observed, in accordance with their occurrence frequencies, at a given position in a selected loop of a selected length.
  • the natural-variant amino acids may be substituted by chemically equivalent amino acids, and may exclude variable amino acid residues below a selected occurrence frequency, e.g. , 5-10%, or amino acid residues that are chemically equivalent to other natural-variant amino acids.
  • library of mutagenesis sequences refers to a library of sequences within a selected Fnlll loop and loop length which is expressed by a library of coding sequences that encode, at each loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has an occurrence frequency equal to or less than a selected threshold frequency of at least 50%, a single common target amino acid and any co-produced amino acids.
  • the library of sequences within a given loop will contain the target amino acid at all combinations of one to all positions within the loop at which the consensus amino acid has an occurrence frequency equal to or less than the given threshold frequency. If this threshold frequency is set at 100%, each position in the loop will be contain the target amino acid in at least one library member.
  • the "library mutagenesis sequences” can be generated from the Tables and Figures disclosed herein using commercial vendors such as Geneart, or DNA2.0.
  • library of natural-variant combinatorial sequences refers to a library of sequences within a selected Fnlll beta strand and Fnlll loop which is expressed by a library of coding sequences that encode at each loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has a frequency of occurrence equal to or less than a selected threshold frequency of at least 50%, other natural variant amino acids, including semi-conserved amino acids and variable amino acids whose occurrence rate is above a selected minimum threshold occurrence at that position, or their chemical equivalents.
  • the library of natural variant combinatorial sequences will contain the consensus amino acid at that position plus other amino acid variants identified as having at least some minimum frequency at that position, e.g. , at least 5-10% frequency, or chemically equivalent amino acids.
  • natural variants may be substituted or dropped if the coding sequence for that amino acid produces a significant number of co-produced amino acids, via codon degeneracy.
  • the term "variability profile" or "VP" refers to the cataloguing of amino acids and their respective frequency rates of occurrence present at a particular beta strand or loop position. The beta strand and loop positions are derived from an aligned fibronectin dataset.
  • Fibronectin Type III (Fnlll) polypeptides refer to a group of proteins composed of momomeric subunits having Fnlll structure or motif made up of seven beta strands with six connecting loops (three at the top and three at the bottom). Beta strands A, B, and E form one half beta sandwich and beta strands C, D, F, and G form the other half, and having molecular weights of about 94 amino acids and molecular weights of about 10 Kda.
  • the overall fold of the Fnlll domain is closely related to that of the immunoglobulin domains, and the three loops near the N-terminus of Fnlll, named BC, DE, and FG can be considered structurally analogous to the antibody variable heavy (VH) domain complementarity-determining regions, CDR1, CDR2, and CDR3, respectively.
  • VH variable heavy
  • the top and bottom loops of Fnlll have typically been thought to confer structural stability rather than being used for binding targets. However, the methods of the invention demonstrate that the top and bottom loops, as well as the beta sheets, can indeed be used for binding targets.
  • Libraries of Fnlll binding molecules can also be generated that use the top loops, the bottom loops or any combination of the top and bottom loops and the surface exposed residues of the beta-sheets for binding.
  • the Fnlll polypeptide is Fnlll 10 with the following amino acid sequence:
  • the Fnlll polypeptide is Fnlll 07 with the following amino acid sequence: Pro Leu Ser Pro Pro Thr Asn Leu His Leu Glu Ala Asn Pro Asp Thr Gly Val Leu Thr Val Ser Trp Glu Arg Ser Thr Thr Pro Asp lie Thr Gly Tyr Arg He Thr Thr Thr Pro Thr Asn Gly Gin Gin Gly Asn Ser Leu Glu Glu Val Val His Ala Asp Gin Ser Ser Cys Thr Phe Asp Asn Leu Ser Pro Gly Leu Glu Tyr Asn Val Ser Val Tyr Thr Val Lys Asp Asp Lys Glu Ser Val Pro He Ser Asp Thr He lie Pro (SEQ ID NO: 97)
  • the Fnlll polypeptide or scaffold is Fnlll 14 with the following amino acid sequence:
  • the present invention pertains to methods and compositions for generating Fnlll cradle molecules and libraries containing the same.
  • the cradle molecules included in the methods set forth herein are variants in that they comprise a wild type Fnlll domain that has been altered by substitution, insertion and/or deletion of one or more amino acid.
  • the cradle molecules set forth herein may demonstrate a selective and/or specific binding affinity for particular target molecules or portions thereof.
  • the cradle molecule is a fusion polypeptide that includes a variant Fnlll domain linked at the N- or C-terminus to a second peptide or polypeptide.
  • the cradle molecule comprises a linker interposed between the variant Fnlll domain and the second peptide or polypeptide sequence. Linkers are discussed in greater detail in the specification below.
  • the cradle molecules set forth herein may comprise a sequence of any number of additional amino acid residues at either the N-terminus or C-terminus of the amino acid sequence that includes the variant Fnlll domain.
  • the cradle molecule may include the addition of an antibody epitope or other tag, to facilitate identification, targeting, and/or purification of the polypeptide.
  • 6xHis and GST glutthione S transferase
  • 6xHis and GST glutthione S transferase
  • Other amino acid sequences that may be included in the cradle molecule include functional domains, such as active sites from enzymes such as a hydrolase, glycosylation domains, cellular targeting signals or transmembrane regions.
  • the cradle molecule may further include one or more additional tissue-targeting moieties.
  • Cradle molecules may possess deletions and/or substitutions of amino acids relative to the native sequence. Sequences with amino acid substitutions are contemplated, as are sequences with a deletion, and sequences with a deletion and a substitution. In some embodiments, these cradle molecules may further include insertions or added amino acids.
  • substitutional or replacement variants typically contain the exchange of one amino acid for another at one or more sites within the protein and may be designed to modulate one or more properties of the cradle molecule, particularly to increase its efficacy or specificity.
  • substitutions of this kind may or may not be conservative substitutions.
  • Conservative substitution is when one amino acid is replaced with one of similar shape and charge. Being that the libraries of variant Fnlll domains serves to provide a diversity of amino acid sequences and binding selectivity conservative substitutions are not required.
  • conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine.
  • the cradle molecules may possess an insertion of one or more residues.
  • the variant Fnlll domain may be structurally equivalent to the native counterparts.
  • the variant Fnlll domain forms the appropriate structure and conformation for binding targets, proteins, or peptide segments.
  • the hydropathic index of amino acids may be considered.
  • the importance of the hydropathic amino acid index in conferring interactive function on a protein is generally understood in the art (Kyte and Doolittle, J Mol Biol. (1982) 157(1): 105- 32). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
  • hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 + 1); glutamate (+3.0 + 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5 + 1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (- 1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4).
  • an amino acid can be substituted for another having a similar hydrophilicity value and still produce a biologically equivalent and immunologically equivalent protein.
  • substitution of amino acids whose hydrophilicity values are within +2 is preferred, those that are within +1 are particularly preferred, and those within +0.5 are even more particularly preferred.
  • amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. However, in some aspects a non-conservative substitution is contemplated. In some embodiments a random substitution is also contemplated. Exemplary substitutions that take into consideration the various foregoing characteristics are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
  • Fnlll polypeptides can be modified by inserting or deleting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20 or more amino acids, or any range derivable therein, in an Fnlll loop or beta strand. Variants of the loop region are discussed in U.S. Patent No. 6,673,901 and U.S. Patent
  • the one or more amino acid substitution in beta strand C may be one or more amino acid substitution corresponding to position 30, 31, 32, 33, 34, 35, 36, 37, 38 and/or 39 of SEQ ID NO: 1.
  • the amino acid substitution in beta strand C may correspond to position 31, 33, 35, 37, 38 and/or 39 of SEQ ID NO: l.
  • the amino acid substitution in beta strand C may correspond to position 31 and/or 33 of SEQ ID NO: l.
  • the one or more amino acid substitution in CD loop may be one or more amino acid substitution corresponding to position 40, 41, 42, 43, 44 and/or 45 of SEQ ID NO: l.
  • the one or more amino acid substitution in beta strand D may be one or more amino acid substitution corresponding to position 44, 45, 46, 47, 48, 49, 50 or 51 of SEQ ID NO: l. In some embodiments, the amino acid substitution in beta strand D may correspond to position 44, 45, 47, or 49 of SEQ ID NO: l.
  • the one or more amino acid substitution in beta strand F may be one or more amino acid substitution corresponding to position 67, 68, 69, 70, 71, 72, 73, 74, 75 and/or 76 of SEQ ID NO: 1.
  • the amino acid substitution in beta strand F may correspond to position 67, 69, 71, 73 and/or 76 of SEQ ID NO: l.
  • the amino acid substitution in beta strand F may correspond to position 71, 73, 75 and/or 76 of SEQ ID NO: l.
  • the one or more amino acid substitution in FG loop may be one or more amino acid substitution corresponding to position 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86 of SEQ ID NO: 1.
  • the one or more amino acid substitution in beta strand G may be one or more amino acid substitution corresponding to position 85, 86, 87, 88, 89, 90, 91, 92, 93, or 94 of SEQ ID NO: l.
  • the amino acid substitution in beta strand G may correspond to position 84 or 85 of SEQ ID NO: 1.
  • the cradle molecules can include amino acid substitutions correspond to one or more amino acid substitutions at position 31, 33, 47, 49, 73, and/or 75 of SEQ ID NO: l.
  • the cradle molecule may further comprise an amino acid substitution corresponding to amino acid position 30 of SEQ ID NO:l.
  • the cradle molecule may comprise one or more amino acid substitution corresponding to amino acid position 41, 42, 43, 44, or 45 of SEQ ID NO: 1.
  • the cradle molecule can further comprise one or more amino acid substitution corresponding to amino acid position 76, 77, 78, 79, 80, 81, 82, 83, 84, or 85 of SEQ ID NO: l.
  • the substitution may be in at least one beta strand.
  • the cradle molecule can comprise 1, 2, 3, 4 or more insertions and/or deletions of amino acids corresponding to amino acids of SEQ ID NO: l. Insertions can include, but are not limited to stretches of poly-serine, poly-alanine, poly- valine, poly-threonine, or polymers of any other of the 20 amino acids, that is subsequently mutagenized or diversified for generating a combinatorial cradle molecule library. Diversification of these inserted residues can include alteration to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 of the other natural amino acids.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more contiguous amino acids are inserted into one or more of the beta strands (e.g., C and/or F) or AB, BC, CD, DE, EF, FG loops of an Fnlll domain cradle molecule.
  • the cradle molecule can comprise an insertion, a deletion, or both an insertion and a deletion.
  • the insertion and deletion need not be located at the same position and may be located at sites distal or proximal to each other.
  • the insertion and/or deletion can be in a loop or beta strands of the Fnlll domain polypeptide.
  • At least one loop region of Fnlll may comprise an insertion of at least 2 amino acids. In some embodiments, at least one region of Fnlll may comprise an insertion of 2 to 25 amino acids in at least one loop region. In some embodiments at least 2, 3, or more loop regions comprise an insertion. In some embodiments, the cradle molecule has at least one loop region of Fnlll may comprise a deletion of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids, including all values and ranges there between. In some embodiments, at least 2, 3, or 4 loop or beta strands, portions, or regions comprise a deletion of at least 1 amino acid.
  • the cradle molecule may comprise at least one insertion and one deletion in at least one loop and at least one beta strand. In some embodiments, the cradle molecule may comprise an insertion and a deletion in the same loop or beta strand region. In some
  • the cradle molecule may comprise at least one insertion or deletion in at least one beta strand. In some embodiments, the cradle molecule may comprise at least one insertion or deletion in at least one beta strand and at least one loop region.
  • the Fnlll domain may be the 1 st , 2 nd , 3 rd , 4 th , 5 ⁇ , 6 ⁇ , 7 ⁇ , 8 ⁇ , 9*, 10*, 11*, 12*, 13*, 14*, 15* or 16* Fnlll domain of human fibronectin.
  • the Fnlll domain may be the 7*, 10* or 14* Fnlll domain of human fibronectin.
  • the Fnlll variants in other organisms are also contemplated based on their alignment with human Fnlll.
  • the one or more amino acid substitution in beta strand C may be one or more amino acid substitution corresponding to position 33, 35, 37, 39, 40 and/or 41 of SEQ ID NO: 97.
  • the one or more amino acid substitution in CD loop may be one or more amino acid substitution corresponding to position 42, 43, 44, 45, 46, 47 and/or 48 of SEQ ID NO: 97.
  • the amino acid substitution in beta strand F may correspond to position 70, 72, 74, 76 and/or 79 of SEQ ID NO:97.
  • the one or more amino acid substitution in FG loop may be one or more amino acid substitution corresponding to position 80, 81, 82, 83, 84 and/or 85 of SEQ ID NO:97.
  • the one or more amino acid substitution in beta strand C may be one or more amino acid substitution corresponding to position 31, 33, 35, 37 and/or 39 of SEQ ID NO: 129.
  • the one or more amino acid substitution in CD loop may be one or more amino acid substitution corresponding to position 40, 41, 42, 43 and/or 44 of SEQ ID NO: 129.
  • the amino acid substitution in beta strand F may correspond to position 66, 68, 70, 72 and/or 75 of SEQ ID NO: 129.
  • the one or more amino acid substitution in FG loop may be one or more amino acid substitution corresponding to position 76, 77, 78, 79, 80 and/or 81 of SEQ ID NO: 129.
  • variants in any one or more of positions that correspond with amino acid position 34, 36, 38, 71, 73, 75, 77 and/or 78 of SEQ ID NO:97, including all ranges there between, can be specifically excluded.
  • variants in any one or more of positions that correspond with amino acid position 332, 34, 36, 38, 67, 69, 71, 73 and/or 74 of SEQ ID NO: 129, including all ranges there between, can be specifically excluded.
  • one or more of the altered or variant amino acids may correspond to position 30, 31, 33, 49, 47, 75, 76, 84, and/or 85 of SEQ ID NO: l.
  • the variant Fnlll domains may comprise an insertion or deletion of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 amino acids in at least one beta strand and at least one loop region of Fnlll.
  • the variant Fnlll domains may comprise an amino acid insertion in loop CD, FG and/or a combination of CD and FG loops and at least one beta strand with a substitution, deletion or addition.
  • the variant Fnlll domains may comprise an amino acid insertion in loop BC, FG and/or a combination of BC and FG loops and at least one beta strand with a substitution, deletion, or addition.
  • the polypeptide may be at least 50%, 60%, 70%, 80%, or 90%, including all values and ranges there between, identical to SEQ ID NOs: 1, 97 and 129.
  • Fnlll cradle molecules may have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions that may include, but are not limited to the following Fnlll residue substitutions (corresponding to SEQ ID NO: l): R30A, R30N, R30D, R30C, R30Q, R30E, R30G, R30H, R30I, R30L, R30K, R30M, R30F, R30P, R30S, R30T, R30W, R30Y, R30V, Y31A, Y31R, Y31N, Y31D, Y31C, Y31Q, Y31E, Y31G, Y31H, Y31I, Y31L, Y31K, Y31M, Y31F, Y31P, Y31S, Y31T, Y31W,
  • substitutions can be introduced before, during, or after introduction of those amino acid substitutions listed above.
  • the other substitutions may include, but is not limited to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 of W22A, W22R, W22N, W22D, W22C, W22Q, W22E, W22G, W22H, W22I, W22L, W22K, W22M, W22F, W22P, W22S, W22T, W22Y, W22V, D23A, D23R, D23N, D23C, D23Q, D23E, D23G, D23H, D23I, D23L, D23K, D23M, D23F, D23P, D23S, D23T, D23W, D23Y, D23V, A24R, A24N, A24D, A24C, A24Q, A24E, A24G, A24H, A24H, A24H, A24E, A24G, A24H, A
  • Fnlll cradle molecules may have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions that may include, but are not limited to the following Fnlll residue substitutions (corresponding to SEQ ID NO:97): G33A, G33N, G33R, G33D, G33C, G33Q, G33E, G33H, G33I, G33L, G33K, G33M, G33F, G33P, G33S, G33T, G33W, G33Y, G33V, R35A, R35N, R35D, R35C, R35Q, R35E, R35G, R35H, R35I, R35L, R35K, R35M, R35F, R35P, R35S, R35T, R35W, R35Y, R35V, T37A, T37R, T37N, T37D,
  • Fnlll cradle molecules may have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions that may include, but are not limited to the following Fnlll residue substitutions (corresponding to SEQ ID NO: 129): G31A, G31N, G31R, G31D, G31C, G31Q, G31E, G31H, G31I, G31L, G31K, G31M, G31F, G31P, G31S, G31T, G31W, G31Y, G31V, Q33A, Q33R, Q33N, Q33D, Q33C, Q33E, Q33G, Q33H, Q33I, Q33L, Q33K, Q33M, Q33F, Q33P, Q33S, Q33T, Q33W, Q33Y, Q33V, D35A, D35R, D35N, D35C,
  • the cradle molecule can further comprise a second Fnlll domain that may or may not have been selected for affinity to a particular target.
  • the second Fnlll domain may or may not contain additional amino acid variations or diversification.
  • the cradle molecule can further comprise a non-FnIII polypeptide that enhances the Fnlll polypeptide binding affinity for a target molecule.
  • the non-FnIII polypeptide may incldue additional variations or diversification that enhances or increases the cradle molecule binding affinity for another target molecule such as a half-life extender, e.g., HSA.
  • the non-FnIII polypeptide can include, but is not limited to domains involved in phospho-tyrosine binding (e.g., SH2, PTB), phospho-serine binding (e.g., UIM, GAT, CUE, BTB/POZ, VHS, UBA, RING, HECT, WW, 14-3- 3, Polo-box), phospho-threonine binding (e.g., FHA, WW, Polo-box), proline-rich region binding (e.g., EVH1 , SH3, GYF), acetylated lysine binding (e.g., Bromo), methylated lysine binding (e.g., Chromo, PHD), apoptosis (e.g., BIR, TRAF, DED, Death, CARD, BH), cytoskeleton modulation (e.g., ADF, GEL, DH, CH, FH2), or other cellular functions (e.g., EH, CC, VHL
  • the invention provides multispecific cradle molecules which comprise two or more individual cradle molecules linked together (e.g. , genetically or chemically).
  • the multispecific cradle molecules comprise at least one cradle molecule that uses at least one beta strand to bind to a target.
  • the multispecific cradle molecule comprises two or more individual cradle molecules linked, in pearl-like fashion, wherein each individual cradle molecule binds to a specific target.
  • targets can be present on the same molecule or on different molecules, such that the different molecules become juxtaposed by the binding of the multispecific cradle molecule.
  • the targets can also be identical, such that the multispecific cradle molecule is able to cluster target molecules, in a similar way to an antibody. Avidity is also increased by binding to the same target molecule with two binding sites on the
  • multispecific cradle molecule capable of independently binding to different regions of the target molecule.
  • a number of individual cradle molecules can be incorporated into the multispecific cradle molecules, for example, at least 2, 3, 4, 5, 6, 7, 8, 9, 10, or more individual cradle molecules.
  • Multispecific cradle molecules can be produced using art recognized methods.
  • cradle molecules may be linked genetically, such that multispecific cradle molecules are expressed as a single polypeptide. This linkage may be direct or conferred by an additional amino acid "linker" sequence. Suitable non-limiting methods and linkers are described, for example, in U.S. Patent Publication No. 20060286603 and Patent Cooperation Treaty
  • Exemplary polypeptide linkers include, but are not limited to, GS linkers, such as GGGGSGGGGS (SEQ ID NO: 471), GSGSGSGSGS (SEQ ID NO: 472), PSTSTST (SEQ ID NO: 473), and EIDKPSQ (SEQ ID NO: 474), and multimers thereof.
  • GS linkers such as GGGGSGGGGS (SEQ ID NO: 471), GSGSGSGSGSGSGS (SEQ ID NO: 472), PSTSTST (SEQ ID NO: 473), and EIDKPSQ (SEQ ID NO: 474), and multimers thereof.
  • the multispecific cradle molecules generated using linker sequences have an improved steric hinderance for binding to target molecules, thus enabling shorter linker sequences to be used to link two or more individual cradle molecules together. Shorter linker sequences cause less immunogenic responses and are less likely to get cleaved.
  • multispecific cradle molecules can be prepared by chemically conjugating the individual cradle molecules using methods known in the art.
  • a variety of coupling or cross-linking agents can be used for covalent conjugation.
  • Examples of cross- linking agents include, e.g.
  • sulfo-SMCC protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5,5'-dithiobis(2-nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N- succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N- maleimidomethyl) cyclohaxane-l-carboxylate (sulfo-SMCC) (see e.g. , Karpovsky et al. (1984) /. Exp. Med. 160: 1686; Liu, MA et al.
  • Preferred conjugating agents are SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, IL). Cysteine residues can be introduced into the Fnlll domain variants at specific positions and then crosslink with reagents to sulfhydryl such as DPDPB or DTME (available from Pierce) to link two individual cradle molecules together to form a multispecific cradle molecule.
  • reagents to sulfhydryl such as DPDPB or DTME (available from Pierce)
  • the present invention features an Fnlll cradle molecule altered compared to the wild-type Fnlll domain to contain all or a portion of a complementarity determining region (CDR) of an antibody or a T-cell receptor.
  • CDR complementarity determining region
  • the CDR regions of any antibody or T-cell receptor variable region, or antigen binding fragments thereof, are suitable for grafting.
  • the CDRs can be obtained from the antibody or T-cell receptor repertoire of any animal including, but not limited to, rodents, primates, camelids or sharks.
  • the CDRs are obtained from CDR1, CDR2 and CDR3 of a single domain antibody, for example a nanobody.
  • CDR1, 2 or 3 of a single domain antibody, such as a nanobody are grafted into any of the AB, BC, CD, DE, EF or FG loops of an Fnlll domain, thereby providing target binding specificity of the original nanobody to the cradle molecule.
  • the CDR is heavy chain CDR3.
  • the CDR is grafted into the FG loop.
  • Engineered libraries of camelid antibodies and antibody fragments are commercially available, for example, from Ablynx, Ghent, Belgium.
  • the antibody repertoire can be from animals challenged with one or more antigens or from naive animals that have not been challenged with antigen.
  • CDRs can be obtained from antibodies, or antigen binding fragments thereof, produced by in vitro or in vivo library screening methods, including, but not limited to, in vitro polysome or ribosome display, phage display or yeast display techniques. This includes antibodies not originally generated by in vitro or in vivo library screening methods but which have subsequently undergone mutagenesis or one or more affinity maturation steps using in vitro or in vivo screening methods.
  • Methods for grafting hypervariable regions or CDRs into Fnlll include, for example, genetic engineering, de novo nucleic acid synthesis or PCR-based gene assembly (see, e.g. , U.S. Patent No. 5,225.539).
  • the above techniques allow for the identification of a suitable loop for selection and presentation of a hypervariable region or CDR, e.g. , the FG loop.
  • additional metrics can be invoked to further improve the fit and presentation of the hypervariable region based on structural modeling of the Fnlll domain and the donor antibody.
  • specific amino acid residues in any of the beta-strands of an Fnlll domain are mutated to allow the CDR loops to adopt a conformation that retains or improves binding to antigen.
  • This procedure can be performed in an analogous way to that CDR grafting into a heterologous antibody framework, using a combination of structural modeling and sequence comparison.
  • the Fnlll domain residues adjacent to a CDR are mutated in a similar manner to that performed by Queen et al. (see U.S. Patent Nos. 6,180,370; 5,693,762; 5,693,761; 5,585,089; 7,022,500).
  • Fnlll domain residues within one Van der Waals radius of CDR residues are mutated in a similar manner to that performed by Winter et al. (see U.S. Patent Nos. 6,548,640; 6,982,321).
  • Fnlll domain residues that are non-adjacent to CDR residues but are predicted, based upon structural modeling of the Fnlll domain and the donor antibody, to modify the conformation of CDR residues are mutated in a similar manner to that performed by Carter et al. or Adair et al (see U.S. Patent Nos. 6,407,213; 6,639,055; 5,859,205; 6,632,927).
  • binding proteins capable of interacting with other proteins with high-affinity and specificity is important in biotechnology, medicine and molecular biology.
  • Such designed binding proteins can be used in numerous applications. They can be used to bind a target protein, label a protein of interest for detection and visualization, to purify a target protein from a complex mixture or to functionally perturb a target by blocking a functional site.
  • Combinatorial methods are effective platforms for the production of novel binding proteins.
  • large libraries of protein variants are created by introducing a large amount of sequence diversity and sometimes structural diversity into a contiguous surface in a protein scaffold.
  • the central idea in combinatorial approaches is to create a sufficiently diverse repertoire of candidate binding surfaces that vary in shape and chemical character. Variants capable of binding a target of interest can then be isolated using various selection methods.
  • phage display libraries are generally limited to approximately 10 10 members. Considering a small binding surface consisting of 15 positions in a protein scaffold, if all 15 positions are varied to all 20 amino acids, this gives 20 15 or 3 x 10 19 theoretical sequence combinations. Thus, only a very small percentage of the possible binding site configurations would actually be sampled in the library. Since discovery of a binding surface suitable for a given target is already likely to be a rare event, the sampling limitations of combinatorial methods make isolation of functional binding proteins a difficult and unlikely task.
  • Another type of strategy for combating the sampling problem in combinatorial methods involves focusing the sequence and structural properties of the binding site library toward those likely to be useful for binding to a target-type of interest. These strategies are based on structural information (both primary and tertiary) of existing binding molecules. This approach has been explored in synthetic antibodies with the creation of peptide-targeted and small molecule hapten targeted libraries (Cobaugh, et ah , J. Mol. Biol. (2008) 378:622-633; Persson, et ah , J. Mol. Biol. (2006) 357:607-620).
  • CDR complementarity determining region
  • an Fnlll domain is used as a basis for generating a combinatorial library of protein binding domains.
  • the present invention provides a library of Fnlll cradle molecules that use the CD and the FG loops of Fnlll domains together with the surface exposed residues of the beta- strands.
  • the proposed library referred to as the "cradle library” herein, will increase the surface area available for binding over the traditional previously disclosed top and bottom side libraries.
  • loops FG and CD are highly variable in natural occurring fibronectins and can be randomized without restrictions both in composition and loop length. This will enable a highly diverse library without generating instable molecules which should overcome some of the restrictions in the traditional libraries previously disclosed.
  • surface exposed beta sheet residues will also be randomized to generate a large cradle-like surface to be available for binding to target proteins.
  • the library size can be controlled so that they can be readily screened using, for example, high throughput methods to obtain new therapeutics.
  • the Fnlll cradle library with bottom and top side loop regions and the surface exposed residues of the beta-sheets can be screened using positive physical clone selection by FACS, phage panning or selective ligand retention. These in vitro screens bypass the standard and tedious methodology inherent in generating an antibody hybridoma library and supernatant screening.
  • the Fnlll cradle library with the bottom and top loop regions (CD and FG, respectively) and the surface exposed residues of the beta-sheets has the potential to recognize any target as the constituent amino acids in the target binding loop are created by in vitro diversity techniques. This produces the significant advantages of the library controlling diversity size and the capacity to recognize self antigens. Still further, the Fnlll cradle library with the bottom and top side loop regions (CD and FG) and the surface exposed residues of the beta-sheets can be propagated and re-screened to discover additional fibronectin binding domains against other desired targets.
  • a combinatorial library is a collection of diverse compounds generated by either chemical synthesis or biological synthesis by combining a number of chemical "building blocks.”
  • a linear combinatorial chemical library such as a polypeptide (e.g., mutein or variant) library is formed by combining a set of chemical building blocks called amino acids in every possible way for a given compound length. Millions of compounds can be synthesized through such combinatorial mixing of chemical building blocks. For example, one commentator has observed that the systematic, combinatorial mixing of 100 interchangeable chemical building blocks results in the theoretical synthesis of 100 million tetrameric compounds or 10 billion pentameric compounds (Gallop, et ah , J. Med. Chem. (1994)
  • Embodiments of the invention are directed to a combinatorial library of Fnlll domains.
  • polypeptides of the library include variations of amino acid sequence in one or more of the beta strands of the Fnlll domains.
  • the library includes variations of amino acid sequences in one or more loops of the Fnlll domains.
  • the library includes variation in both loops and beta strands of the Fnlll domain. Libraries can be generated using (i) a directed approach; and (ii) a random approach, both of which are illustrated in the Examples.
  • the present invention pertains to a mutagenesis cradle library of Fnlll domain polypeptides useful in screening for the presence of one or more polypeptides having a selected binding or enzymatic activity.
  • the library polypeptides include (a) regions A, AB, B, BC, C, CD, D, E, EF, F, FG, and G having wildtype amino acid sequences of a selected native Fnlll domain polypeptide or polypeptides, (b) beta- strands C and F and loop regions CD and FG having one or more selected lengths.
  • At least one selected beta-strand or loop region of a selected length contains a library of sequences encoded by a library of coding sequences that encode, at each beta-strand or loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has a occurrence frequency equal to or less than a selected threshold frequency of at least 50%, a single common target amino acid and any co- produced amino acids (amino acids produced by the coding sequences at a given position as a result of codon degeneracy).
  • the variability profile is used to define a sequence of fixed and "variable" positions, i.e. , positions at which a target amino acid can be introduced.
  • the number of fixed positions will depend on the selected threshold frequency for the consensus amino acid at each position.
  • beta-strand and loop sequences are selected, a library of coding-sequence oligonucleotides encoding all of the identified sequences is constructed, making codon substitutions as shown that are effective to preserve the existing consensus amino acid, but also encode the selected target amino acid, and any other co-product amino acids encoded by degenerate codons.
  • the library of coding sequences for the beta strands and loops is added to the framework sequences, to construct the library of coding sequences for the polypeptide libraries.
  • the library of polypeptides may be encoded by an expression library format that includes a ribosome display library, a polysome display library, a phage display library, a bacterial expression library, or a yeast display library.
  • the libraries may be used in a method of identifying a polypeptide having a desired binding affinity, in which the natural- variant combinatorial library are screened to select for an Fnlll domain having a desired binding affinity.
  • the same methodology can be used to generate Fnlll libraries using any combination of beta sheets and top and bottom loop regions.
  • the cradle library polypeptides include (a) regions A, AB, B,
  • BC, C, CD, D, DE, E, EF, F, FG and G having wildtype amino acid sequences of a selected native Fnlll polypeptide or polypeptides, and (b) beta-strands C and F and loop regions CD and
  • At least one selected beta strand or loop region of a selected length contains a library of natural-variant combinatorial sequences expressed by a library of coding sequences that encode at each loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has a frequency of occurrence equal to or less than a selected threshold frequency of at least 50%, other natural variant amino acids, including semi-conserved amino acids and variable amino acids whose occurrence rate is above a selected minimum threshold occurrence at that position, or their chemical equivalents.
  • the variability profile is used to define a sequence of fixed and "variable" positions, i.e. , positions at which amino acid variations can be introduced.
  • the number of fixed positions will depend on the selected threshold frequency for the consensus amino acid at each position. If, for example, the selected frequency threshold was set at about 60%, the conserved or semi-conserved residues and natural- variant substitutions would not be made at these positions.
  • the threshold frequency is set at 100%, all positions would be considered open to variation, recognizing that a single amino acid with a frequency of 100% at a loop position would not be substituted, and a position that had one very dominant amino acid, e.g. , with a frequency of 90%, might be substituted only if the low- frequency variant(s) were chemically dissimilar to the dominant amino acid.
  • the amino acid substitutions at each variable position can be selected.
  • the number of variations that are selected will depend on the number of variable substitution positions in the loop/sheet and the average number of variations per substituted loop/sheet position.
  • natural- variant substitutions are introduced into a single loop only, many more variations per position can be accommodated.
  • the particular natural variant amino acids that are selected for each position will generally include the amino acids having the highest frequencies, while limited the number of co-produced amino acids, and secondarily, preserving chemical diversity at each site.
  • a library of coding-sequence oligonucleotides encoding all of the identified natural-variant sequences is constructed, making codon substitutions that are effective to preserve the existing consensus amino acid, and encode the selected variant amino acids, including variants encoded by degenerate codons.
  • the library of coding sequences for the natural-variants loops/sheets is added to the framework sequences, to construct the library of coding sequences for the natural-variant polypeptide libraries.
  • the coding library includes coding sequences for a pair of AB/CD, AB/EF, CD/EF or CD/FG loops, where each loop in the pair has one selected length.
  • the coding library includes coding sequences for any combination of all five loops, AB, BC, CD, EF and FG.
  • the coding library includes coding sequences for the C and F sheets.
  • the coding library includes coding sequences for any combination of all beta sheets.
  • N+/- libraries are constructed with variations in bottom loops, AB, CD, and EF, the top loops, BC, DE, FG, or any combination of top and bottom loops, and any combination of the beta strands (e.g. , C and/or F).
  • N+/- libraries N is the most predominant amino acid at a particular position and amino acids upstream or downstream are designated +N or -N, respectively.
  • N+3 is an amino acid 3 positions upstream of N
  • N-3 is an amino acid 3 positions downstream of N in a 3D structure of Fnlll.
  • N+2 and N+l are amino acids at positions 2 and 1 upstream of N, respectively, while N-2 and N- 1 are amino acids at positions 2 and 1 downstream of N, respectively.
  • N is the most predominantly abundant amino acid to a less abundant amino acid
  • the effect of that modification can be assessed on the abundance of amino acids at 1 , 2, or 3 positions away from N.
  • the frequency and abundance of amino acids surrounding the fixed N position are determined. These differences can be used to generate Fnlll cradle libraries.
  • the consensus sequence in the CD/5 loop is SGGEW (SEQ ID NO:278) at loop positions 1, 2, 3, 4, and 5, with G being the predominant amino acid.
  • the information yielded is an amino acid distribution (N-2, N-1, N, N+1, N+2) of a given position N within a predetermined loop region in the context of a specific amino acid at this position N. This information can then be used to generate a library.
  • the consensus sequence of sheet C is GYIVEYREK (SEQ ID NO:279) at sheet positions 1, 2, 3, 4, 5, 6, 7, 8 and 9, respectively of the sheet C.
  • N the predominant amino acid
  • the Fnlll cradle molecules in a cradle library may be represented by a sequence set forth in SEQ ID NOs: 468-470. Cradle residues are shown in bold with X representing the amino acid substitution for the beta strands and Y representing the amino acid substitution for the loops with the loop length range given as a subscript. Any substitutions, including natural or engineered amino acids, or other molecules are contemplated. In some embodiments, any of the 19 amino acids other than the native residue can be substituted for the cradle residues. Substitutions may include, but are not limited to conservative substitutions that have little or no effect on the overall net charge, polarity, or hydrophobicity of the protein. Substitutions may also include an insertion and a deletion of one or more amino acids. Fnlll cradle molecules can include alanine substitutions at one or more of amino acid positions.
  • the FG loop may be about 1-10 residues in length. In some embodiments, the FG loop may be about 5 or 6 residues in length. In some embodiments, the FG loop may be five residues in length. In some embodiments, positions 3 and/or 5 of the FG loop are a Gly residue.
  • position 1 of the FG loop is an Ala, Gly, Ser, Asn or Asp residue
  • position 2 of the FG loop is an Ala, Lys, Gly, Val or Gin residue
  • position 3 of the FG loop is a Gly, Leu, Val, Arg or Tyr residue
  • position 4 of the FG loop is an Glu, Leu, Asp, Tyr or Pro residue
  • position 5 of the FG loop is a Gly, Ser, Thr, Asn or His residue.
  • the FG loop may be six amino acids in length.
  • position 1 of the FG loop is a Gly residue
  • position 2 of the FG loop is a Leu, Val or He residue
  • position 3 of the FG loop is a charged or polar residue
  • position 4 of the FG loop is a Pro residue
  • position 5 of the FG loop is a Gly residue
  • position 6 of the FG loop is a polar residue.
  • position 1 of the FG loop is a Gly, Glu, Asp, Ser or Ala residue
  • position 2 of the FG loop is an Ala, Gly, Tyr, Val or Asn residue
  • position 3 of the FG loop is a Gly, Gin, Lys, Arg or Glu residue
  • position 4 of the FG loop is an Arg, Glu, Val, He or Leu residue
  • position 5 of the FG loop is a Ser, Gly, Val, Thr or Leu residue
  • position 6 of the FG loop is a Glu, Gly, Lys, Ser or Pro residue.
  • the CD loop may be about 3-11 residues in length. In some embodiments, the CD loop may be about 4-9 residues in length. In some embodiments, the CD loop may be four residues in length. In some embodiments, position 1 of the CD loop is a Asp, Gly, Glu, Ser or Asn residue, position 2 of the CD loop is a Gly, Ala, Asp, Asn or Glu residue, position 3 of the CD loop is a Gin, Glu, Arg, Gly or Thr residue, position 4 of the CD loop is a Pro, Thr, Glu, Ser or Gin residue. In some embodiments, the CD loop may be five amino acids in length.
  • position 1 of the CD loop is a Ser, Asp, Gly, Glu or Thr residue
  • position 2 of the CD loop is a Gly, Ser, Arg, Glu or Thr residue
  • position 3 of the CD loop is a Gly, Glu, Arg, Lys or Thr residue
  • position 4 of the CD loop is a Glu, Trp, Ala, Ser or Thr residue
  • position 5 of the CD loop is a Trp, Pro, Leu, Val or Thr residue.
  • the CD loop may be six amino acids in length.
  • position 1 of the CD loop is a Gly, Asn, Asp, Glu or Lys/Ser residue
  • position 2 of the CD loop is a Gly, Ser, Lys, Thr or Ala residue
  • position 3 of the CD loop is a Glu, Pro, Asp, Thr or Asn residue
  • position 4 of the CD loop is a Gly, Glu, Leu, Arg or Ser residue
  • position 5 of the CD loop is a Trp, Glu, Asp, Pro or Arg residue
  • position 6 of the CD loop is a Glu, Val, Thr, Pro or Ala residue.
  • the beta strand C may be about 6-14 residues in length. In some embodiments, the beta strand C may be about 8-11 residues in length. In some embodiments, the beta strand C may be 9 residues in length. In some embodiments, positions 2, 4 and 6 of the beta strand C are a hydrophobic residue. In some embodiments, positions 1, 3, 5 and 7-9 of the beta strand C are altered relative to the wild type sequence. In some
  • position 1 of the beta strand C is selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
  • position 3 of the beta strand C is a hydrophobic residue.
  • position 3 of the beta strand C is selected from the group consisting of He, Val, Arg, Leu, Thr, Glu, Lys, Ser, Gin and His.
  • positions 5 and 7-9 of the beta strand C are selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
  • the beta strand F may be about 8-13 residues in length. In some embodiments, the beta strand F may be about 9-11 residues in length. In some embodiments, the beta strand F may be 10 residues in length. In some embodiments, positions 1, 3, 5 and 10 of the beta strand F are altered relative to the wild type sequence. In some embodiments, positions 1, 3, 5 and 10 of the beta strand F are selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg. In some embodiments, positions 2, 4 and 6 of the beta strand F are a hydrophobic residue. In some embodiments, position 7 of the beta strand F is a hydrophobic residue.
  • position 7 of the beta strand F is selected from the group consisting of Arg, Tyr, Ala, Thr and Val.
  • position 8 of the beta strand F is selected from the group consisting of Ala, Gly, Ser, Val and Pro.
  • position 9 of the beta strand F is selected from the group consisting of Val, Leu, Glu, Arg and lie.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 30 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 31 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 30, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 33 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 30, 31, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 35 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 30, 31, 33, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 37 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 38 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 39 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 40 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 41 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 42 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 43 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 44 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 45 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 47 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 49 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 50 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 67 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 69 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 71 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 73 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 75 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 76 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 77 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 78 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 79 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 80, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 80 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 81 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 82 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 81, 82, 83, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 83 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 84, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 84 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 85 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 85 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84 and/or 86.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 86 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 33 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 35 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 37 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 39 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 40 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 41 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 42 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 43 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 44 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 45 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 46 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 47 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 48 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 70 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 72 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 74 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 76, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 76 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 79, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 79 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 80, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 80 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 81, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 81 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 82, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 82 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 83, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 83 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 84 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 84 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83 and/or 85.
  • the cradle library may comprise a variation in an amino acid corresponding to amino acid 85 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83 and/or 84.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 31 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 31 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 33 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 35 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 37 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 39 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 40 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 41 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 42 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 43 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 44 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 66 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 68 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 70 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 72, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 72 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 75, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 75 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 76, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 76 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 77, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 77 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 78, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 78 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 79, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 79 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 80 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 80 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79 and/or 81.
  • the cradle library comprises a variation in an amino acid corresponding to amino acid 81 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79 and/or 80.
  • a cradle library of Fnlll domain variants based on sequence information obtained through, e.g. , bioinformatics and/or structural analysis.
  • the first step in building a fibronectin library of the invention is selecting sequences that meet certain predetermined criteria. PFAM, ProSite and similar databases were searched for sequences containing Fnlll domains ( Figure 1). These electronic databases contain catalogued expressed fibronectin and fibronectin-like protein sequences and can be queried for those Fnlll domains and similar sequences (e.g. , using the BLAST search algorithm). The Fnlll domain sequences can then be grouped to predefined criteria such as domain subclasses, sequence similarity or originating organism(s).
  • Fnlll domains based on the criteria of the invention dictates both the loop sizes and the initial amino acid sequence diversity to be introduced.
  • bioinformatics led design the loop regions are flexible for insertion into multiple Fnlll domains.
  • specific targeted loop substitutions overall scaffold stability is maximized while concurrently, non- immunogenic substitutions are minimized.
  • the library can be size tailored so that the overall diversity can be readily screened in different systems. Furthermore, the
  • Fnlll domain sequences are then delineated whereupon the intervening beta strand and loop regions and constituent amino acids are then identified. This then determines the length of the existing loops and beta strands, the amino acid profiles for each loop length and beta strand length, hence the physical size and amino acid diversity that can be accommodated within these frameworks.
  • sequences within each loop and beta strand are aligned, and the aligned sequences are then split into groups according to loop length and beta strand length.
  • the distributions of beta strands lengths for sheets A-G and loop lengths for AB, BC, CD, EF and FG loops were identified (see, e.g. , Figure 4).
  • the most common beta strand lengths and loop sizes are selected.
  • the selected loop lengths are CD/4, CD/5, CD/6, FG/5 and FG/6
  • the selected beta strand lengths are 9 residues for beta strand C and 10 residues for beta strand F.
  • each beta strand For each beta strand, one can determine the preferred loop acceptor sites based on both comparative structural and sequence analysis. For example, one can use the structural overlay comparison of the overall loop and beta strand scaffolds between the Fnlll 07 , Fnlll 10 , Fnlll 14 or any of the other known Fnlll domains. In identifying precise loop positions, the above step greatly minimizes necessary diversity loop mutations that would not result in functional ligand binding specificity.
  • a positional amino acid frequency analysis is performed at each loop position, to determine the frequency of occurrence, in a set of native Fnlll domains.
  • This method may include a frequency analysis and the generation of the corresponding variability profiles (VP) of existing loop sequences (see Example 6).
  • the outward facing amino acids of sheets C and F were analyzed to determine the frequency of occurrence, in a set of native Fnlll domains ( Figure 7B). Amino acids 1, 3, 5, 7-9 in beta strand C and amino acids 1, 3, 5, 7, and 10 in beta strand F are intended for use in the cradle library. High frequency (e.g. , >50 ) positions are considered conserved or fixed.
  • Moderately high frequency or "semi-conserved” amino acids or (when 2 or 3 are combined account for >40 ) are chosen as "wildtype" at other positions. These wildtype amino acids are then systematically altered using, mutagenesis, e.g. , walk-through mutagenesis, to generate the cradle library.
  • mutagenesis e.g. , walk-through mutagenesis
  • variable positions are those where typically, no one amino acid accounts for more than 20% of the represented set.
  • a variability profile analysis of the Fnlll domain databases allows identification of loop/beta strand amino acid residue positions that fall within three categories, e.g. , 1) positions that should be conserved or "fixed,” 2) semi-conserved, and/or 3) variable positions that are suitable for diversity generation.
  • a variability profile analysis is performed and a threshold frequency is used to identify the most favorable sequences to be used in designating the overall loop/sheet diversity.
  • the conserved or a selected semi-conserved sequence (typically the most frequent amino acid in the semi-conserved residues) is considered the "wild type” or "consensus” residue in the loop sequence.
  • This "consensus” or “frequency” approach identifies those particular amino acids under high selective pressure that occurs most frequently at a particular position.
  • residue positions are typically fixed, with diversity being introduced into remaining amino acid positions (taking into account the identified preference for certain amino acids to be present at these positions).
  • the threshold for occurrence frequency at which amino acid variation will be introduced can vary between selected levels as low as 40%, preferably 50% to as high as 100%. At the 100% threshold frequency, mutagenesis of amino acids can be introduced at all positions of the loop, and the only constraints on natural- variant amino acids will be the total number of variants and whether chemical equivalents are available.
  • modified amino acid residues for example, residues outside the traditional 20 amino acids used in most polypeptides, e.g. , homocysteine
  • This is carried out using art recognized techniques which typically introduce stop codons into the polynucleotide where the modified amino acid residue is desired.
  • the technique then provides a modified tRNA linked to the modified amino acid to be incorporated (a so-called suppressor tRNA of, e.g. , the stop codon amber, opal, or ochre) into the polypeptide (see, e.g. , Kohrer, et al. , PNAS (2001) 98: 14310-14315).
  • the Fnlll cradle libraries of the invention and their construction are conducted with the benefit of sequence and structural information such that the potential for generating improved Fnlll cradle moleculesis increased.
  • Structural molecular replacement modeling information can also be used to guide the selection of amino acid diversity to be introduced into the defined beta strand andloop regions.
  • actual results obtained with the Fnlll cradle molecules of the invention can guide the selection (or exclusion), e.g. , affinity maturation, of subsequent Fnlll cradle molecules to be made and screened in an iterative manner.
  • a method for selecting a protein binding domain specific for a target comprises (a) detecting target specific binding of one or more members of a cradle library comprising a plurality of Fnlll domain polypeptides having amino acid substitutions that correspond to at least amino acid position 31, 33, 47, 49, 71, 73, and/or 75 of SEQ ID NO: l ; and (b) selecting the protein binding domain that specifically binds the target.
  • the method may further comprise first preparing the plurality of Fnlll domain polypeptide variants described herein, e.g.
  • Fnlll domains having amino acid substitutions that correspond to at least amino acid position 31, 33, 47, 49, 71, 73, and/or 75 of SEQ ID NO: l.
  • a polypeptide identified as exhibiting a particular characteristic may be isolated.
  • the method may further comprise determining the nucleic acid and/or the amino acid of sequence of the selected protein binding domain.
  • the selected protein binding domain may be synthesized or expressed.
  • in silico modeling is used to eliminate the production of any Fnlll cradle molecules predicted to have poor or undesired structure and/or function. In this way, the number of Fnlll cradle molecules to be produced can be sharply reduced thereby increasing signal-to-noise in subsequent screening assays.
  • the in silico modeling is continually updated with additional modeling information, from any relevant source, e.g. , from gene and protein sequence and three-dimensional databases and/or results from previously tested Fnlll cradle molecules, so that the in silico database becomes more precise in its predictive ability (Figure 1).
  • the in silico database is provided with the assay results, e.g. , binding affinity/avidity of previously tested Fnlll cradle molecules and categorizes the Fnlll cradle molecules, based on the assay criterion or criteria, as responders or nonresponders, e.g. , as Fnlll cradle molecules that bind well or not so well.
  • the affinity maturation of the invention can equate a range of functional responses with particular sequence and structural information and use such information to guide the production of future Fnlll cradle molecules to be tested.
  • the method is especially suitable for screening Fnlll cradle molecules for a particular binding affinity to a target ligand using, e.g. , a BiacoreTM assay.
  • mutagenesis of noncontiguous residues within a loop region or a beta- strand can be desirable if it is known, e.g. , through in silico modeling, that certain residues in the region will not participate in the desired function.
  • the coordinate structure and spatial interrelationship between the defined regions, e.g. , the functional amino acid residues in the defined regions of the Fnlll cradle molecules, e.g. , the diversity that has been introduced, can be considered and modeled.
  • Such modeling criteria include, e.g. , amino acid residue side group chemistry, atom distances, crystallography data, etc. Accordingly, the number of Fnlll cradle molecules to be produced can be intelligently minimized.
  • the computer assisted step comprises, e.g. , mining the NCBI, Genbank, PFAM, and ProSite databases and, optionally, cross-referencing the results against PDB structural database, whereby certain criteria of the invention are determined and used to design the desired loop diversity ( Figure 1).
  • the method is also amenable to being carried out, in part or in whole, by a device, e.g. , a computer driven device.
  • database mining fibronectin domain sequence selection, diversity design, oligonucleotide synthesis, PCR- mediated assembly of the foregoing, and expression and selection of candidate Fnlll cradle molecules that bind a given target can be carried out in part or entirely, by interlaced devices.
  • instructions for carrying out the method, in part or in whole, can be conferred to a medium suitable for use in an electronic device for carrying out the instructions.
  • the methods of the invention are amendable to a high throughput approach comprising software (e.g. , computer-readable instructions) and hardware (e.g. , computers, robotics, and chips).
  • fibronectin and Fnlll sequence classification, identification, and analysis may be found, e.g. , PFAM.
  • PFAM fibronectin and Fnlll sequence classification, identification, and analysis
  • Bioinformatics (2001) 17:282-283; Databases and search and analysis programs include the PFAM database at the Sanger Institute (pfam.sanger.ac.uk); the ExPASy PROSITE database (expasv.ch/prosite/); SBASE web (hydra.icgeb.trieste.it/sbase/); BLAST (located on the World Wide Web at ncbi.nlm.nih.gov/BLAST/); CD-HIT (bioinformatics.ljcrf.edu/cd-hi/); EMBOSS
  • the cradle library of polypeptides may be encoded by an expression library that has the format of a ribosome display library, a polysome display library, a phage display library, a bacterial expression library, or a yeast display library.
  • the Fnlll cradle libraries of the invention are generated for screening by synthesizing individual oligonucleotides that encode the defined region of the polypeptide and have no more than one codon for the predetermined amino acid. This is accomplished by incorporating, at each codon position within the oligonucleotide either the codon required for synthesis of the wild-type polypeptide or a codon for the predetermined amino acid and is referred to as look-through mutagenesis (LTM) (see, e.g. , U.S. Patent Publication No. 20050136428).
  • LTM look-through mutagenesis
  • walk-through mutagenesis can be used (see, e.g. , U.S. Patent Nos. 6,649,340;
  • diversity can be created using the methods available from commercial vendors such as DNA2.0 and Geneart by providing information about the loop lengths of the AB, BC, CD, EF and FG loops, the positional distribution of amino acids at each position of the loop, and the top 7 amino acid abundance at each position of the loop.
  • the mixture of oligonucleotides for generation of the library can be synthesized readily by known methods for DNA synthesis.
  • the preferred method involves use of solid phase beta-cyanoethyl phosphoramidite chemistry (see, e.g. , U.S. Pat. No. 4,725,677).
  • an instrument for automated DNA synthesis can be used containing specified reagent vessels of nucleotides.
  • the polynucleotides may also be synthesized to contain restriction sites or primer hybridization sites to facilitate the introduction or assembly of the polynucleotides representing, e.g. , a defined region, into a larger gene context.
  • the synthesized polynucleotides can be inserted into a larger gene context, e.g. , a single scaffold domain using standard genetic engineering techniques.
  • the polynucleotides can be made to contain flanking recognition sites for restriction enzymes (see, e.g. , U.S. Pat. No. 4,888,286).
  • the recognition sites can be designed to correspond to recognition sites that either exist naturally or are introduced in the gene proximate to the DNA encoding the region.
  • the polynucleotides are ligated into the gene or gene vector by standard techniques.
  • an appropriate vector including, e.g. , phage vectors, plasmids
  • the genes can be introduced into a cell-free extract, phage, prokaryotic cell, or eukaryotic cell suitable for expression of the fibronectin binding domain molecules.
  • a set of degenerate nucleotides can also be directly incorporated in place of one of the polynucleotides.
  • the appropriate complementary strand is synthesized during the extension reaction from a partially complementary polynucleotide from the other strand by enzymatic extension with a polymerase. Incorporation of the degenerate polynucleotides at the stage of synthesis also simplifies cloning where more than one domain or defined region of a gene is mutagenized or engineered to have diversity.
  • the fibronectin binding domain is present on a single stranded plasmid.
  • the gene can be cloned into a phage vector or a vector with a filamentous phage origin of replication that allows propagation of single- stranded molecules with the use of a helper phage.
  • the single-stranded template can be annealed with a set of degenerate polynucleotides representing the desired mutations and elongated and ligated, thus incorporating each analog strand into a population of molecules that can be introduced into an appropriate host (see, e.g. , Sayers, J. R., et al. , Nucleic Acids Res. (1988) 16:791-802). This approach can circumvent multiple cloning steps where multiple domains are selected for mutagenesis.
  • PCR methodology can also be used to incorporate polynucleotides into a gene, for example, loop diversity into beta strand framework regions.
  • the polynucleotides themselves can be used as primers for extension.
  • polynucleotides encoding the mutagenic cassettes corresponding to the defined region (or portion thereof) are complementary to each other, at least in part, and can be extended to form a large gene cassette (e.g., a fibronectin binding domain) using a polymerase, e.g. , using PCR amplification.
  • the size of the library will vary depending upon the loop/sheet length and the amount of sequence diversity which needs to be represented using mutagenesis methods.
  • the library is designed to contain less than 10 15 , 10 14 , 10 13 , 10 12 , 10 11 , 10 10 , 10 9 , 10 8 , 10 7 , and 10 6 fibronectin binding domain.
  • polynucleotide intermediate can be eliminated.
  • the libraries described above may be also attached to a solid support, such as a microchip, and preferably arrayed, using art recognized techniques.
  • the method of this invention is especially useful for modifying candidate fibronectin binding domain molecules by way of affinity maturation. Alterations can be introduced into the loops and/or into the beta strand framework (constant) region of a fibronectin binding domain. Modification of the beta sheets and loop regions can produce fibronectin binding domains with better ligand binding properties, and, if desired, catalytic properties. Modification of the beta strand framework region can also lead to the improvement of chemo-physical properties, such as solubility or stability, which are especially useful, for example, in commercial production, bioavailability, and affinity for the ligand. Typically, the mutagenesis will target the loop region(s) of the fibronectin binding domain, i. e.
  • an identified candidate binding molecule is subjected to affinity maturation to increase the affinity/avidity of the binding molecule to a target ligand.
  • modifications to at least one loop and at least one beta sheet produces an Fnlll cradle molecule with an increased surface area available for binding to a target molecule.
  • modifications to at least one top loop, at least one bottom loop, and at least one beta sheet produces an Fnlll cradle molecule with an increased surface area available for binding to a target molecule.
  • modifications to the FG and CD loops and the C and/or F beta sheet produces an Fnlll cradle molecule with an increased surface area available for binding to a target molecule. In one embodiment, modifications to at least one loop and at least one beta sheet produces an Fnlll cradle molecule that can bind to different target molecules.
  • the practice of the present invention employs, unless otherwise indicated, conventional techniques of chemistry, molecular biology, recombinant DNA technology, PCR technology, immunology (especially, e.g. , antibody technology), expression systems (e.g. , cell- free expression, phage display, ribosome display, and ProfusionTM), and any necessary cell culture that are within the skill of the art and are explained in the literature. See, e.g. ,
  • Fnlll cradle molecules having desired structure and/or activity.
  • Expression of the Fnlll cradle molecules can be carried out using cell-free extracts (e.g. , ribosome display), phage display, prokaryotic cells, or eukaryotic cells (e.g. , yeast display).
  • the polynucleotides are engineered to serve as templates that can be expressed in a cell free extract.
  • Vectors and extracts as described, for example in U.S. Pat. Nos. 5,324,637; 5,492,817; 5,665,563, can be used and many are commercially available.
  • Ribosome display and other cell-free techniques for linking a polynucleotide (i. e. , a genotype) to a polypeptide (i.e. , a phenotype) can be used, e.g. , ProfusionTM (see, e.g. , U.S. Pat.
  • the polynucleotides of the invention can be expressed in a convenient E. coli expression system, such as that described by Pluckthun, Meth. Enzymol. (1989) 178:476- 515; and Skerra, et al. Biotechnology (1991) 9:273-278.
  • the mutant proteins can be expressed for secretion in the medium and/or in the cytoplasm of the bacteria, as described by Better and Horwitz Meth. Enzymol. (1989) 178:476.
  • the Fnlll cradle molecules are attached to the 3' end of a sequence encoding a signal sequence, such as the ompA, phoA or pelB signal sequence (Lei, et al., J.
  • the Fnlll cradle molecule sequences are expressed on the membrane surface of a prokaryote, e.g. , E. coli, using a secretion signal and lipidation moiety as described, e.g. , in U.S. Patent Publication Nos. 20040072740A1 ; 20030100023 Al; and 20030036092A1.
  • the polynucleotides can be expressed in eukaryotic cells such as yeast using, for example, yeast display as described, e.g. , in U.S. Pat. Nos. 6,423,538;
  • the Fnlll cradle molecules of the library are fused to a polypeptide that is expressed and displayed on the surface of the yeast.
  • Fnlll cradle molecules of the invention can also be used, such as mammalian cells, for example myeloma cells (e.g. , NS/0 cells), hybridoma cells, or Chinese hamster ovary (CHO) cells.
  • mammalian cells for example myeloma cells (e.g. , NS/0 cells), hybridoma cells, or Chinese hamster ovary (CHO) cells.
  • myeloma cells e.g. , NS/0 cells
  • hybridoma cells e.g., NS/0 cells
  • Chinese hamster ovary (CHO) cells e.g., Chinese hamster ovary
  • the Fnlll cradle molecules can be produced, for example, as single individual domain or as multimeric chains comprising dimers, trimers, that can be composed of the same domain or of different Fnlll variant domain types (FnIII 03 -FnIII 10 : homodimer; FnIII 10 -FnIII 08 : heterodimer; Fnlll 10 - FnIII 10 n , where n is an integer from 1-20 or
  • Fnlll - Fnlll n where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll 14 - FnIII 14 n , where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll 07 - FnIII 10 n , where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll 10 - FnIII 14 n , where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll 07 - FnIII 14 n , where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll 07 - FnIII 14 n , where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll 07 - Fnlll 10 - FnIII 14 n , where n is an integer from 1-20 or wild type or variant Fnlll domain
  • the screening of the expressed Fnlll cradle molecules can be done by any appropriate means. For example, binding activity can be evaluated by standard immunoassay and/or affinity chromatography. Screening of the Fnlll cradle molecules of the invention for catalytic function, e.g. , proteolytic function can be accomplished using a standard hemoglobin plaque assay as described, for example, in U.S. Pat. No. 5,798,208. Determining the ability of candidate Fnlll cradle molecules to bind therapeutic targets can be assayed in vitro using, e.g.
  • a BiacoreTM instrument which measures binding rates of a Fnlll cradle molecule to a given target or ligand, or using the methods disclosed herein.
  • In vivo assays can be conducted using any of a number of animal models and then subsequently tested, as appropriate, in humans.
  • the Fnlll cradle library is transfected into the recipient bacterial/yeast hosts using standard techniques as described in the Examples.
  • Yeast can readily accommodate library sizes up to 107, with 103-105 copies of each Fnlll fusion protein being displayed on each cell surface.
  • Yeast cells are easily screened and separated using flow cytometry and fluorescence- activated cell sorting (FACS) or magnetic beads.
  • FACS fluorescence- activated cell sorting
  • the yeast eukaryotic secretion system and glycosylation pathways of yeast also allow Fnlll type molecules to be displayed with N and O linked sugars on the cell surface. Details of yeast display are outlined in the Examples section.
  • the yeast display system utilizes the a-agglutinin yeast adhesion receptor to display proteins on the cell surface.
  • the proteins of interest in this case, Fnlll libraries, are expressed as fusion partners with the Aga2 protein.
  • Fnlll libraries are expressed as fusion partners with the Aga2 protein.
  • These fusion proteins are secreted from the cell and become disulfide linked to the Agal protein, which is attached to the yeast cell wall (see Invitrogen, pYDl Yeast Display product literature).
  • the plasmid e.g. , pYDl, prepared from an E.
  • coli host by plasmid purification (Qiagen), is digested with the restriction enzymes, Bam HI and Not I, terminally dephosphorylated with calf intestinal alkaline phosphatase.
  • Ligation of the pYDl and CR products libraries, E. coli (DH5a) transformation and selection on LB-ampicillin (50 mg/ml) plates were performed using standard molecular biology protocols to amplify the libraries before electroporation into yeast cell hosts.
  • Methods for selecting expressed Fnlll library variants having substantially higher affinities for target ligands e.g. , TNF, VEGF, VEGF-R etc, relative to the reference wild type Fnlll domain, can be accomplished as follows.
  • Candidate test ligands e.g. , TNF, VEGF, VEGF-R etc
  • TNF vascular endothelial growth factor
  • VEGF-R vascular endothelial growth factor
  • Those library clones that efficiently bind the labeled antigens are then enriched for by using FACS.
  • This population of yeast cells is then re-grown and subjected to subsequent rounds of selection using increased levels of stringency to isolate a smaller subset of clones that recognize the target with higher specificity and affinity.
  • the libraries are readily amenable to high-throughput formats, using, e.g. , FITC labeled anti-Myc-tag Fnlll binding domain molecules and FACS analysis for quick identification and confirmation.
  • carboxyl terminal tags included which can be utilized to monitor expression levels and/or normalize binding affinity measurements.
  • yeast cells 8xl0 5 cells in 40 ⁇
  • the supernatant is aspirated and the cell pellet is washed with 200 ⁇ of ice cold PBS/BSA buffer (PBS/BSA 0.5% w/v).
  • the cells are re-pelleted and supernatant removed before re-suspending in 100 ⁇ of buffer containing the biotinylated TNFa (200 nM).
  • the cells were left to bind the TNFa at 20°C for 45 minutes after which they were washed twice with PBS/BSA buffer before the addition and incubation with streptavidin-FITC (2 mg/L) for 30 minutes on ice. Another round of washing in buffer was performed before final re- suspension volume of 400 ⁇ in PBS/BSA. The cells were then analyzed on FACScanTM (Becton Dickinson) using CellQuest software as per manufacturer's directions.
  • kinetic selections of the yeast displayed TNF-a fibronectin binding domain libraries involve initial labeling of cells with biotinylated TNF-a ligand followed by time dependent chase in the presence of large excess of un-biotinylated TNF-a ligand.
  • Clones with slower dissociation kinetics can be identified by streptavidin-PE labeling after the chase period and sorted using a high speed FACS sorter. After Aga2-FnIII induction, the cells are incubated with biotinylated TNFa at saturating concentrations (400 nM) for 3 hours at 25°C under shaking.
  • Library screening can be conducted in order to select Fnlll variants that bind to specific ligands or targets. Combinatorial screening can easily produce and screen a large number of variants, which is not feasible with specific mutagenesis ("rational design") approaches.
  • Amino acid variant at various amino acid positions in Fnlll can be generated using a degenerate nucleotide sequence. Fnlll variants with desired binding capabilities can be selected in vitro, recovered and amplified. The amino acid sequence of a selected clone can be identified readily by sequencing the nucleic acid encoding the selected Fnlll.
  • a particular Fnlll cradle molecule has an affinity for a target that is at least 2-fold greater than the affinity of the polypeptide prior to substitutions discussed herein.
  • the affinity is, is at least, or is at most about 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-fold increased compared to another Fnlll cradle molecule.
  • a cradle polypeptide selected using the method of identifying a cradle polypeptide having a desired binding affinity to a target molecule disclosed herein.
  • the cradle polypeptide may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs:4-78, 80-85, 87-96, 98, 99, 101-128, 130- 141, 143, 145-147, 149-159, 161-199, 201-238 and 240-277.
  • Fnlll libraries can also be used to screen for Fnlll proteins that possess functional activity.
  • the study of proteins has revealed that certain amino acids play a crucial role in their structure and function. For example, it appears that only a discrete number of amino acids participate in the functional event of an enzyme.
  • Protein libraries generated by any of the above techniques or other suitable techniques can be screened to identify variants of desired structure or activity.
  • the region studied will be a functional domain of the protein such as a binding domain.
  • the region can be the AB, BC, CD, DE, EF and FG loop binding regions or the beta sheets of Fnlll domain.
  • the screening can be done by any appropriate means.
  • activity can be ascertained by suitable assays for substrate conversion and binding activity can be evaluated by standard immunoassay and/or affinity chromatography.
  • the acid amide Gin and Asn can also form hydrogen bonds, the amido groups functioning as hydrogen donors and the carbonyl groups functioning as acceptors.
  • Gin has one more CH2 group than Asn which renders the polar group more flexible and reduces its interaction with the main chain.
  • Tyr has a very polar hydroxyl group (phenolic OH) that can dissociate at high pH values. Tyr behaves somewhat like a charged side chain; its hydrogen bonds are rather strong.
  • Histidine has a heterocyclic aromatic side chain with a pK value of 6.0. In the physiological pH range, its imidazole ring can be either uncharged or charged, after taking up a hydrogen ion from the solution. Since these two states are readily available, His is quite suitable for catalyzing chemical reactions. It is found in most of the active centers of enzymes.
  • Asp and Glu are negatively charged at physiological pH. Because of their short side chain, the carboxyl group of Asp is rather rigid with respect to the main chain. This may be the reason why the carboxyl group in many catalytic sites is provided by Asp and not by Glu.
  • Charged acids are generally found at the surface of a protein.
  • new Fnlll cradle molecules can be built on the natural "scaffold" of an existing Fnlll polypeptide by mutating only relevant regions by the method of this invention.
  • the method of this invention is suited to the design of de novo improved binding proteins as compared to the isolation of naturally occurring Fnllls.
  • Kits are also contemplated as being made or used in some embodiments of the present invention.
  • a polypeptide or nucleic acid of the present invention can be included in a kit or in a library provided in a kit.
  • a kit can be included in a sealed container.
  • containers include a microtiter plate, a bottle, a metal tube, a laminate tube, a plastic tube, a dispenser, a pressurized container, a barrier container, a package, a compartment, or other types of containers such as injection or blow-molded plastic containers into which the dispersions or compositions or desired bottles, dispensers, or packages are retained.
  • Other examples of containers include glass or plastic vials or bottles.
  • the kit and/or container can include indicia on its surface. The indicia, for example, can be a word, a phrase, an abbreviation, a picture, or a symbol.
  • the containers can dispense or contain a pre-determined amount of a composition of the present invention.
  • the composition can be dispensed as a liquid, a fluid, or a semi-solid.
  • a kit can also include instructions for using the kit and/or compositions. Instructions can include an explanation of how to use and maintain the compositions.
  • a library can be created using a "shaved" template containing polyserine sequence at locations to be diversified (Koide, et al., supra, 2007 and Wojcik, et al. , supra,
  • Phagemid particles can be prepared by growing XLl-Blue cells transfected with the phagemid library in the presence of 0.2 mM IPTG and helper phage (Lo Conte, et ah , J. Mol. Biol. (1999) 285:2177-2198; Fellouse, et al , J. Mol. Biol. (2005) 348: 1153-1162). Phagemid library selection can be performed as follows.
  • a target protein modified with EZ-Link Sulfo-NHS-SS-Biotin (Sulfosuccinimidyl 2(biotinamido)-ethyl-l,3- dithiopropionate; Pierce) is mixed with a sufficient amount of streptavidin-conjugated magnetic beads (Streptavidin MagneSphere ® Pramagnetic Particles; Promega, Z5481/2) in TBS (50 mM Tris HC1 buffer pH 7.5 150 mM NaCl) containing 0.5% Tween20 (TBST).
  • phagemids suspended in 1 ml TBST plus 0.5% BSA is added, and the solution is mixed and incubated for 15 min at room temperature. After washing the beads twice with TBST, the beads suspension containing bound phagemids is added to fresh E. coli culture. Phagemids were amplified as described before (Fellouse, et ah, supra, 2005). In a second round, phagemids are incubated with 0.1 ⁇ target in TBST plus 0.5% BSA, and then captured by streptavidin-conjugated magnetic beads.
  • Phagemids bound to the target protein are eluted from the beads by cleaving the linker within the biotinylation reagent with 100 mM DTT in TBST. The phagemids are washed and recovered as described above. After amplification, the third round of selection is performed using 0.02 ⁇ target.
  • Phage display is an established technique for generating binding members and has been described in detail in many publications such as Kontermann & Dubel (ed.), In: Antibody Engineering: Miniantibodies, 637-647, Springer- Verlag, (2001) and WO92/01047, each of which is incorporated herein by reference in its entirety.
  • the Express- tag in the yeast display vector, pYDl, (Invitrogen) was removed because it cross-reacts with anti-FLAG antibodies (Sigma).
  • the genes for cradle molecules in the phagemid library after three rounds of selection are amplified using PCR and mixed with the modified pYDl cut with EcoRl and Xhol, and yeast EBY100 cells are transformed with this mixture.
  • the transformed yeast cells are grown in the SD-CAA media at 30°C for two days, and then monobody expression is induced by growing the cells in the SG-CAA media at 30°C for 24 h.
  • Sorting of monobody-displaying yeast cells is performed as follows.
  • the yeast cells are incubated with a biotinylated target (50 nM) and mouse anti-V5 antibody (Sigma), then after washing incubated with anti-mouse antibody-FITC conjugate (Sigma) and NeutrAvidin ® -PE conjugate (Invitrogen).
  • the stained cells are sorted based on the FITC and PE intensities. Typically, cells exhibiting the top -1% PE intensity and top 10% FITC intensity are recovered.
  • the nucleic acid encoding any targets are cloned in the appropriate expression vector.
  • genes for monobodies are cloned in the expression vector, pHFT2, which is a derivative of pHFTl (Huang, et ah , supra, 2006) in which the His-6 tag had been replaced with a His- 10 tag. Protein expression and purification can be performed as described previously (Huang, et al. , supra, 2006).
  • An expression vector comprising cDNA encoding an Fnlll polypeptide or a target molecule is introduced into Escherichia coli, yeast, an insect cell, an animal cell or the like for expression to obtain the polypeptide.
  • Polypeptides used in the present invention can be produced, for example, by expressing a DNA encoding it in a host cell using a method described in Molecular Cloning, A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press (1989), Current Protocols in Molecular Biology, John Wiley & Sons (1987- 1997) or the like.
  • a recombinant vector is produced by inserting a cDNA downstream of a promoter in an appropriate expression vector. The vector is then introduced into a host cell suitable for the expression vector.
  • the host cell can be any cell so long as it can express the gene of interest, and includes bacteria ⁇ e.g. , E. coli), an animal cell and the like.
  • Expression vector can replicate autonomously in the host cell to be used or vectors which can be integrated into a chromosome comprising an appropriate promoter at such a position that the DNA encoding the polypeptide can be transcribed.
  • Ribosome display utilizes cell free in vitro coupled transcription/translation machinery to produce protein libraries.
  • the Fnlll library genes are inserted upstream to kappa light immunoglobulin gene that does not have a termination stop codon causing the ribosome to stall, but not release, when it reaches the end of the mRNA. Additionally, the kappa domain spacer serves to physically distance the Fnlll protein from the ribosome complex so that Fnlll binding domain has better accessibility to recognize its cognate ligand.
  • the mRNA library is introduced into either S30 E. coli ribosome extract preparations (Roche) or rabbit reticulate lysate (Promega).
  • the 5' end of the nascent mRNA can bind to ribosomes and undergo translation.
  • the ligand-binding protein remains non-covalently attached to the ribosome along with its mRNA progenitor in a macromolecular complex.
  • the functional Fnlll proteins can then bind to a specific ligand that is either attached to magnetic beads or microtiter well surface. During the enrichment process, non-specific variants are washed away before the specific Fnlll binders are eluted. The bound mRNA is detected by RT-PCR using primers specific to the 5' Fnlll and 3' portion of the kappa gene respectively. The amplified double stranded cDNA is then cloned into an expression vector for sequence analysis and protein production.
  • the reaction mix can contain 0.2 M potassium glutamate, 6.9 mM magnesium acetate, 90 mg/ml protein disulfide isomerase (Fluka), 50 mM Tris acetate (pH 7.5), 0.35 mM each amino acid, 2 mM ATP, 0.5 mM GTP, 1 mM cAMP, 30 mM acetyl phosphate, 0.5 mg/ml E. coli tRNA, 20 mg/ml folinic acid, 1.5% PEG 8000, 40 ml S30 E. coli extract and 10 mg mRNA in a total volume of 110 ml.
  • Translation can be performed at 37° C for 7 min, after which ribosome complexes can be stabilized by 5-fold dilution in ice-cold selection buffer (50 mM Tris acetate (pH 7.5), 150 mM NaCl, 50 mM magnesium acetate, 0.1% Tween 20, 2.5 mg/ml heparin).
  • ice-cold selection buffer 50 mM Tris acetate (pH 7.5), 150 mM NaCl, 50 mM magnesium acetate, 0.1% Tween 20, 2.5 mg/ml heparin).
  • Stabilized ribosome complexes can be incubated with biotinylated hapten (50 nM fluorescein-biotin (Sigma)) or antigen (100 nM IL-13 (Peprotech) biotinylated) as appropriate at 4°C for 1-2 h, followed by capture on streptavidin-coated M280 magnetic beads (Dynal). Beads were then washed to remove non-specifically bound ribosome complexes. For prokaryotic selections, five washes in ice-cold selection buffer can be performed.
  • ribosome complexes bound to magnetic beads can directly be processed into the reverse transcription reaction.
  • selected complexes can be incubated in EB20 [50 mM Tris acetate (pH 7.5), 150 mM NaCl, 20 mM EDTA, 10 mg/ml Saccharomyces cerevisae RNA] for 10 min at 4°C.
  • ribosome complexes can be incubated in PBS20 (PBS, 20 mM EDTA, 10 mg/ml S. cerevisae RNA) for 10 min at 4°C.
  • mRNA can be purified using a commercial kit (High Pure RNA Isolation Kit, Roche).
  • the DNAse I digestion option of the kit was performed; however, this step is not required for eukaryotic samples, as DNAse I digestion was performed during post-selection washes.
  • Reverse transcription can be performed on either 4 ml of purified RNA or 4 ml of immobilized, selected ribosome complexes (i.e. , a bead suspension).
  • reactions contained 50 mM Tris-HCl (pH 8.3), 75 mM KC1, 3 mMMgCl 2 , 10 mMDTT, 1.25 primer, 0.5 mM PCR nucleotide mix (Amersham
  • End-point PCR can be performed to visualize amplification of the full-length construct.
  • a 5 ml sample of each reverse transcription reaction can be amplified with 2.5 UTaq polymerase (Roche) in 20 mM Tris-HCl (pH 8.4), 50 mM KC1, 1 mM MgCl 2 , 5% DMSO, containing 0.25 mM PCR nucleotide mix, 0.25 mM forward primer (T7B or T7KOZ for prokaryotic and or eukaryotic experiments, respectively) and 0.25 mM RT primer.
  • Thermal cycling comprised 94°C for 3 min, then 94°C for 30 s, 50°C for 30 s and 72°C for 1.5 min for 30 cycles, with a final step at 72°C for 5 min.
  • PCR products were visualized by electrophoresis on an ethidium bromide stained agarose gels. The isolated PCR products can then be sub- cloned into a bacterial pBAD expression vector for soluble protein production.
  • Competent E. coli host cells are prepared as per manufacturer's instructions (Invitrogen PBAD expression system). Briefly, 40 ⁇ LMG 194 competent cells and 0.5 ⁇ pBAD Fnlll constructs (approximately 1 ⁇ g DNA) can be incubated together on ice for 15 minutes after which, a one minute 42°C heat shock was applied. The cells are then allowed to recover for 10 minutes at 37°C in SOC media before plating onto LB-Amp plates and 37°C growth overnight. Single colonies are picked the next day for small scale liquid cultures to initially determine optimal L-arabinose induction concentrations for Fnlll production.
  • Cell supernatants from the lysozyme digestions can be collected after centrifugation, and MgS04 can be added to final concentration 40 mM.
  • the FG loop was truncated in PF00041.full and the data from US20090176654(A1) was used instead.
  • the FG loop was defined to include the sequence TGRGDSPASSKPI and the terminal T and I are not defined as part of the FG loop in the cradle.
  • the distribution data for the FG loop from U.S. Patent Publication No. 2009017654(A1) will be amended by subtracting 2 from each loop length in the distribution.
  • the BC loop was calculated for PF00041.full based on the definition in U.S. Patent Publication No. 2009017654(A1) of the DE loop to be the sequence 1 amino acid before the conserved W and up to, but not including, the conserved Y.
  • the BC loop corresponded to columns 125 - 248 in PF00041.full.
  • the BC loops were extracted and the gaps were removed.
  • the length of each loop was determined and range of loop lengths was found to be 1 - 26.
  • the distribution of loop length was determined.
  • the sheet before the CD loop was designated ⁇ (also referred to as sheet C) and included the sequence YYRITYGET (residues 31-39 of SEQ ID NO:280).
  • the CD loop was the sequence GGNSPV (residues 40-45 of SEQ ID NO:280).
  • the sheet directly following the CD loop was ⁇ 2 (also referred to as sheet D) and included the sequence QEFTV (residues 46-50 of SEQ ID NO: 280).
  • the sheet before the FG loop was ⁇ 3 (also referred to as sheet F) and included the sequence DYTITVYAVT (residues 67-76 of SEQ ID NO:280).
  • the FG loop was the sequence GRGDSPASSKP (residues 77-87 of SEQ ID NO:280). ⁇ corresponded to columns 236 - 271.
  • the CD loop was columns 271 - 317.
  • ⁇ 2 was columns 318 - 323.
  • ⁇ 3 was columns 400 - 415.
  • a distinct advantage that the cradle library provides over a top or bottom side library is an increase in surface area of the binding surface on the fibronectin as shown in Figure 6.
  • the top side binding fibronectin library consists of the BC, DE, and FG loops.
  • the bottom side library is the AB, CD, and EF loops.
  • the cradle is the CD and FG loops along with three beta strands.
  • the length variation may indicate that these loops will tolerate more variation than the top or bottom side loops such as the EF loop which has a >90 conservation of loop length 6 as, defined with Fnlll 10 sequence GLKPGV (residues 61-66 of SEQ ID NO:280), along with a >95 sequence conservation of the leucine in position 2.
  • the cradle contains 3 beta strands of the largest beta sheet, it offers more amino acid residues to modify than the top or bottom loops.
  • the top side, bottom side, cradle contain 19 - 23, 12 - 14, and 19 - 24 residues respectively that can be used when loop length variation is not applied.
  • the top and bottom side contain only one loop whose length can be aggressively changed, whereas the cradle contains both of them.
  • a profile was created using the Fnlll domains found in the human fibronectin protein, uniprot FINC_HUMAN or P02751.
  • Fnlll 15 FINC_HUMAN( 1902- 1991) [0346]
  • the fasta sequence for each profile member was derived from the Uniprot entry. The sequences were aligned with Clustal X 2.0.11. The crystal structure of the Fnlll 10 , RCSB entry lfna, was used to highlight secondary structure and define regions on the alignment for later analysis.
  • the sheets on the fibronectin were designated A - G and named from N-terminal to C-terminal in the protein.
  • Loop CD was between sheet C and sheet D.
  • the Fnlll domain alignment was obtained from PFAM and saved as PF00041.full.
  • the alignment from PFAM was truncated at the C-terminal portion of the FG loop and the entire Sheet G.
  • the alignment was in Sweden 1.0 format.
  • the file fn3.in contained 1985 unique mammalian sequences and was loaded into Clustal X as Profile 2. All the sequences in Profile 2 were aligned to Profile 1. Outliers were removed and all the sequences in Profile 2 were aligned to Profile 1. The final alignment for Profile 2 was fn3_final.aln which contained 1750 sequences.
  • the file fn3_final.aln was reformatted so that each protein had 1 line, all amino acids past the C-terminus of Fnlll 10 were trimmed, and a header was added to the top.
  • the file was saved as fibronectins.aln and was the base alignment for further analysis.
  • SWISS_PROT release current for July 15, 2010 was downloaded in fasta format.
  • the release contained 518,415 non redundant sequences for a total 182,829,264 amino acids.
  • the amino acid distribution in the SWISS_PROT release was calculated as a random occurrence reference.
  • H hydrophilic
  • P polar
  • B Basic
  • A Acid
  • C Charged
  • X no preference
  • sheets are in bold, specific amino acids are underlined, subscripts indicate length variations without % and percent occurrence with %.
  • the cradle library was originally defined as sheets C, D, and F with loops CD and FG.
  • Sheet D is on the outside of the fibronectin molecule and unlikely to significantly contribute to binding residues.
  • the definition of the cradle library is refined to be sheets C and F with loops CD and FG, and various combinations thereof.
  • Cradle library mapped onto the human fibronectin sequences (SEQ ID NOs:292, 288, 289, 283, 284, 291, 97, 281, 285, 100, 290, 287, 282, 129, and 286, respectively) is shown below. Cradle residues are shown in bold.
  • the top side library is loops BC, DE, and FG and the bottom library is loops AB, CD, and EF.
  • the AB loop has a length constraint of 3 amino acids with position 1 being Threonine or Serine 67.4% of the time.
  • the BC loop allows for a large variation of loop length with no individual length conserved more than 28.8%.
  • the BC loop does contain a critical Tryptophan residue at position 1 which is conserved at > 92% in all BC lengths and is necessary for proper folding of the fibronectin.
  • position 4 in the BC loop is a Proline with >33% conservation and the N-l position is a hydrophobic residue.
  • the CD loop has a Poisson distribution of length centered at 5 amino acids.
  • the most abundant amino acid in the CD loop is Glycine in position 2 and N-2, and when there is a position 5, it a Tryptophan 30% of the time.
  • the DE loop has a length constraint of 4 amino acids.
  • the EF loop has a length constraint of 6 amino acids with a high amount of sequence conservation.
  • Position 3 Charged or polar amino acid
  • the FG loop length is either 5 (32.6%) or 6 (62.1%) with positions 3 and 5 having a Glycine >43% of the time. The remaining positions have conservation of ⁇ 22% for any given amino acid.
  • the top side library is limited due to length constraint of the DE loop and conserved amino acids in the BC loop.
  • the bottom side library is limited by the 3 amino acid length constraint on the AB loop and the high amount of conservation throughout the EF loop.
  • the amino acid most participating in hydrophobic packing of the fibronectin are BC loop position 1 (W), sheet C position 2 (Y/F), EF loop position 2 (L), and sheet F position 2 (Y).
  • Both the top and bottom side libraries contain loops which have important packing residues which may hinder effective variation.
  • the cradle library loops do not contain structurally necessary amino acids.
  • the cradle library utilizes the outward facing amino acids of sheets C and F to expand the binding surface.
  • the cradle library beta strands C and F are the two longest in the fibronectin molecule and interact extensively to form an anti-parallel beta sheet which may stabilize the protein when changes to the outward facing amino acids are made.
  • Amino acids 1, 3, 5, 7-9 in sheet C and amino acids 1, 3, 5, 7, and 10 in sheet F are intended for use in the cradle library ( Figure 7A).
  • Positions 2, 4, and 6 showed a clear preference for hydrophobic amino acid and are pointing inwards towards the core of the fibronectin.
  • Position 3 had a preference for hydrophobic amino acids, but not as strongly, and is pointing outward toward solvent.
  • the top 10 amino acids by conservation in sheet C, length 9, position 3 were:
  • Figure 7B shows the simplified positional distribution for sheet F length 10.
  • Position 2 4, and 6 showed a clear preference for hydrophobic amino acid and were pointing inwards towards the core of the fibronectin.
  • Position 7 had a preference for hydrophobic amino acids, but not as strongly, and is pointing outward toward solvent.
  • the top 5 amino acids by conservation in sheet F, length 10, position 7 were:
  • Position 1, 3, 5, and 10 showed a clear preference for small flexible or charged/polar amino acid and were pointing outwards towards solvent.
  • Position 9 had a preference for hydrophobic amino acids.
  • the top 5 amino acids by conservation in sheet F, length 10, position 9 were:
  • Position 8 contained a highly conserved Alanine residue with Alanine or Glycine at
  • FnIII14 YTITGLQPGTDYKIYLYTLNDNARS SPWIDAST Shown below is the bottom side library for Fnlll , Fnlll , and Fnlll (SEQ ID NOs:97, 100, 129, respectively).
  • the cradle library consisting of beta strand C, beta strand F, loop CD, and loop FG of the Fnlll domain offers better stability and available binding surface than the directional loop based Top and Bottom Side libraries.
  • Figure 8 shows the amino acid distribution of the residues and amino acid variation compared with the distribution on CDR-H3 domains known to bind antigens.
  • Figure 9C shows the biased amino acid distribution desired for the Cradle residues marked X and Y.
  • Figures 9D-9F show the mapping of the cradle library definition on the sequences of Fnlll 07 , Fnlll 10 , and Fnlll 14 .
  • Figure 9D Alignment of cradle residues for Fnlll 07 , Fnlll 10 and Fnlll 14 .
  • Beta sheets are shown as white residues on a black background and loops are shown as black text.
  • Cradle residues are shown in bold with X representing the amino acid distribution for the beta sheets and Y representing the amino acid distribution for the loops with the loop length range given as a subscript.
  • Figure 9E Alignment of Fnlll 07 , Fnlll 10 and Fnlll 14 illustrating the cradle residues in beta sheets C and F and loops CD and FG. Beta sheets are shown as white residues on a black background and loops are shown as black text with Cradle residues shown in bold.
  • Figure 9F Shown are the Fnlll structural element residue ranges and Fnlll cradle residues ranges. Example 7
  • the Example demonstrates the proof of principle for generating cradle molecules that bind to target molecules using calculated design libraries.
  • targets lysozyme, human Fc, and HSA
  • Fn!II 07 , Fn!II 10 , and Fn!II 14 were created against three targets (lysozyme, human Fc, and HSA) with Fn!II 07 , Fn!II 10 , and Fn!II 14 .
  • Fnlll 10 hits for lysozyme (SEQ ID NOs:100-128, respectively):
  • VSDVPRDLEWAATPTSLL ISWDAPAVTVR-TYYIMYSLWQHYVTNAL—QEFTVPGSKSTATI SGLKPG-VFYGILVYAVSWWS-R-W PISINYRT VSDVPRDLEWAATPTSLLISWDAPAVTVR-SYYIKYSTCSHYVRSGVG-QEFTVPGSKSTATI SGLKPG-VDYMIDVNAVLSEG-RGD PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-GYTT-YS YRDS QEFTVPGSKSTAT ISGLKPGVIYNILVSAVSEWW-K-Y PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-YYEIWYESYFY VLWQEFTVPGSKSTATI SGLKPG-VSYEITVSAVYWH—YAY PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-LYAIMYTAYEYRVMDAKLYQEFTVPG
  • Fnlll 14 hits for lysozyme (SEQ ID NOs:129-141, respectively):
  • Fnlll 07 hit for human Fc SEQ ID NOs: 142-143, respectively.
  • Fnlllrl4 hits for human Fc SEQ ID NOs: 148- 159, respectively:
  • Fnlll 07 hits for HSA (SEQ ID NOs: 160-199, respectively):
  • NVSPPRRARVTDATETTITISWRTKTETITEFFVMAEP YYGEGY- -YIQRTIKPDVRSYTITGLQPGTSYSINLYTLK-RPYL- -YPWIDAST
  • NVSPPRRARVTDATETTITISWRTKTETITAFYVHAVPMLWWNG IQRTIKPDVRSYTITGLQPGTSYTINLETLRMSSHY- -YPWIDAST
  • SUMO a non- limiting model for demonstration of the methods described herein.
  • the following description is given for the purpose of illustrating various embodiments of the invention and is not meant to limit the present invention in any fashion.
  • SUMO is used to represent the general embodiments for the purpose of proof of principle and is not intended to limit the scope of the invention.
  • the described methods and compositions can be used with respect to a plethora of target molecules and are not limited solely to SUMO.
  • SUMOs are structurally similar to ubiquitin and are post-translationally conjugated to other proteins resulting in a variety of functional modulations.
  • SUMO 1-4 there are four SUMO isoforms (SUMO 1-4) (Gareau and Lima, Nature Rev. (2010) 11:861-871).
  • SUMOl and SUM02 share 41% sequence identity (72% similarity) but are functionally distinct ( Figure 10B, bottom) (Saitoh and Hinchey, /. Biolog. Chem. (2000) 275:6252-6258; Vertegaal, et al. , Mol. Cell Proteomics (2006) 5:2298-2310).
  • SUM02 and SUM03 collectively referred to as SUM02/3, share 97% sequence identity and are assumed to be functionally identical (Gareau and Lima, supra, 2010; Johnson, Annual Rev. Biochem. (2004) 73:355-382). SUM04's relevance as a post-translational modification is not clear (Bohren, et al , Protein Express. Purif. (2007) 54:289-294; Owerbach, et al , Biochemical Biophysical Res. Comm. (2005)
  • the peptide inhibitor suffers from two significant shortcomings.
  • Most natural SIM peptides exhibit similarly low affinities and discriminate individual SUMO isoforms by ⁇ 10-fold or less (Kerscher, supra, 2007; Chang, et al. , J. Biological Chem. (2010)
  • Libraries have been designed and constructed in which positions in the beta-strand regions of the Fnlll scaffold, in addition to loop positions, are diversified. Two different libraries are described herein that differ in that positions in the CD loop (residues 41-45) were diversified in Library BLl but not the other, library BL2. The libraries were constructed in the phage display format following procedures that have been published (Wojcik, et al. , supra, 2010) and described herein. The BLl and BL2 libraries were estimated to contain 6xl0 10 and lxlO 10 unique sequences, respectively.
  • Sequences are grouped according to their binding target.
  • x designates a diversified position in the libraries. Because the lengths of the CD and FG loops were varied in the BLl and BL2 libraries, the numbers of "x"s shown for these libraries are for guidance only and they do not accurately reflect the actual numbers of residues.
  • VSSVPTKLEVVAATPTSL LISWDAPAVTVDHYVI TYGETG-SYSSYGQE FAVPGSKSTAT ISGLSPGVDYT ITVYAY ⁇ EFQFEMYMSYS PISINYRT
  • VSSVPTKLEVVAATPTSL LISWDAPAVTVDHYNITYGETG-AFWHYVQAFTVPGSKSTATISGLSPGVDYT ITVYAEW—DQYVVG SPISINYRT
  • VSSVPTKLEVVAATPT SLLISWDAPAVTVDHYYI TYGETG—AYWYSQAFTVPGSKSTATISGLSPGVDYT ITVYA STKFNQY—SPISINYRT
  • VSSVPTKLEVVAATPTSLLISWDASSSSVSHYEITYGETGGNSPV Q EFTVPGSSSTATISGLSPGVDYTITVTAYDSYYDIYIAYSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSYYEITYGETGGNSPV Q EFTVPGSSSTATISGLSPGVDYTITVIAFYSHDDIYISDSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYAITYGETGGNSPV Q EFTVPGSSSTATISGLSPGVDYTITVYAYYSYDDLYVSDSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYAITYGETGGNSPV Q EFTVPGSSSTATISGLSPGVDYTITVFAYYSYDDIYYAYSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYDITYGETGGNSPV Q EFTVPGSSSTATISGLSPGVDYTITVFAY

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Zoology (AREA)
  • Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Apparatus Associated With Microorganisms And Enzymes (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

The here described invention discloses a combination of a top and bottom loop binder library using the CD and the FG loops of a number of Fnlll domains (Fnlll) (e.g., Fnlll7, Fnlll10 and Fnlll14) together with the surface exposed residues of the beta-sheet. The invention also pertains to a method of forming a library of Fnlll domain polypeptides useful in screening for the presence of one or more polypeptides having a selected binding or enzymatic activity.

Description

FIBRONECTIN CRADLE MOLECULES AND LIBRARIES THEREOF
Cross-Reference To Related Applications
[0001] This application is related to U.S. Provisional Patent Application No. 61/369,160 filed on July 30, 2010, U.S. Provisional Patent Application No. 61/369,203 filed on
July 30, 2010, U.S. Provisional Patent Application No. 61/369,222 filed on July 30, 2010, U.S. Provisional Patent Application No. 61/474,632 filed on April 12, 2011, and U.S.
Provisional Patent Application No. 61/474,648 filed on April 12, 2011. Each of the foregoing applications is hereby incorporated by reference in its entirety.
Statement Of Rights To Inventions Made Under Federally Sponsored Research
[0002] Part of this invention was made with government support under contract R01- GM72688 and U54 GM74946 awarded by the National Institutes of Health to the University of Chicago. The government has certain rights in part of the invention.
Reference to Sequence Listing Submitted Via EFS-Web
[0003] The entire content of the following electronic submission of the sequence listing via the USPTO EFS-WEB server, as authorized and set forth in MPEP § 1730 II.B.2(a)(C), is incorporated herein by reference in its entirety for all purposes. The sequence listing is identified on the electronically filed text file as follows:
Figure imgf000002_0001
Technical Field
[0004] The present application relates to novel Fibronectin Type III domain (Fnlll) polypeptides and the methods of making and using such Fnlll polypeptides. More specifically, the present invention relates to a library of Fnlll polypeptides using the CD and the FG loops of a number of Fnlll domains (e.g. , Fnlll07, Fnlll10 and Fnlll14) together with the surface exposed residues of the beta-sheet.
Background Art
[0005] Scaffold based binding proteins are becoming legitimate alternatives to antibodies in their ability to bind specific ligand targets. These scaffold binding proteins share the quality of having a stable framework core that can tolerate multiple substitutions in the ligand binding regions. Some scaffold frameworks have immunoglobulin like protein domain architecture with loops extending from a beta sandwich core. A scaffold framework core can be synthetically engineered and used to form a library comprising different sequence variants. The sequence diversity of such libraries is typically concentrated in the exterior surfaces of the proteins such as loop structures or other exterior surfaces that can serve as ligand binding regions.
[0006] The fibronectin type III domain (Fnlll) has been established as an effective non- antibody "alternative" scaffold for the generation of novel binding proteins. A member of the immunoglobulin superfamily, Fnlll has three surface exposed loops at one end of the molecule which are analogous to antibody complementarity determining regions (CDRs). Engineering strategies using this scaffold are based on combinatorial libraries created by diversifying both the length and amino acid sequence of these surface loops. From such libraries, Fnlll variants capable of binding to a target of interest can be isolated using various selection methods. The Fnlll scaffold offers many advantages compared to conventional antibodies or fragments thereof because it lacks disulfide bonds, can be readily and highly expressed in bacterial systems, and is relatively small. However, a need exists for improved Fnlll based polypeptides and methods of producing libraries of such polypeptides.
Summary of the Invention
[0007] The present invention is based on the unexpected discovery that modifications to a beta sheet of a Fnlll polypeptide in addition to modifications to at least one loop region of the Fnlll based polypeptide result in an Fnlll based binding molecule with improved binding ability for a target molecule. The improved binding is a result of increased surface area available for binding to a target molecule by using amino acid residues in the beta sheet to form part of the binding surface and to bind to a target molecule. Modifications to the beta sheets can also be used to distinguish targets. The invention pertains to modifications in the beta strand and loop of all Fnlll molecules, e.g. , Fnlll07, Fnlll10 and Fnlll14. In particular, the invention pertains to modifications in F and/or C beta strands and modifications in the the FG loop and the CD loop of Fnlll molecules, e.g. , Fnlll07, Fnlll10 and Fnlll14.
[0008] Accordingly, in one aspect, the invention pertains to an Fnlll domain-based cradle polypeptide comprising one or more amino acid substitutions in at least a loop region and at least a non-loop region.
[0009] In some embodiments, the cradle polypeptide may comprise amino acid substitutions in both the beta strands in conjunction with substitutions in the AB loop, the BC loop, the CD loop, the DE loop, and/or the FG loop of Fnlll. In some embodiments the cradle polypeptide may comprise amino acid substitution in beta strand C, beta strand D, beta strand F and/or beta strand G. In some embodiments the cradle polypeptide may comprise one or more amino acid substitutions in two loop regions and/or two non-loop regions, wherein the non-loop regions may be the beta strands C and F, and the loop regions may be the CD and FG loops. In some embodiments the one or more amino acid substitutions may be introduced to the cradle residues in the beta strands. In some embodiments the cradle polypeptide may further comprise an insertion and/or deletion of at least one amino acid in at least one loop and/or non-loop region. In some embodiments the cradle polypeptide may further comprise an insertion and/or deletion of at least one amino acid in two loop regions and/or two non-loop regions, wherein the non- loop regions may be the beta strands C and F, and the loop regions may be the CD and FG loops. In some embodiments the Fnlll domain may be the 1st, 2nd, 3rd, 4*, 5th, 6*, 7th, 8*, 9th, 10th, 11th, 12th, 13th, 14th, 15th or 16th Fnlll domain of human fibronectin. In some embodiments, the one or more amino acid substitutions in the non-loop region may not change the structure of the Fnlll domain scaffold and/or the shape of the loop regions. In some embodiments, the one or more amino acid substitutions in the non-loop region may exclude the non-cradle residues.
[0010] In some embodiments, loop CD may be about 3-11, about 4-9, or 5 residues in length, wherein loop FG may be about 1-10, 5 or 6 residues in length. Position 1 of the FG loop may be a Gly residue, position 2 may be a Leu, Val, or lie residue, position 3 may be a charged or polar residue, position 4 may be a Pro residue, position 5 may be a Gly residue, and position 6 may be a polar residue. In some embodiments, positions 3 and/or 5 of the loop may be a Gly residue.
[0011] In some embodiments, the beta strand lengths may be about 6-14, about 8-11, or 9 residues for beta strand C and for beta strand F about 8-13, about 9-11, or 10 residues. In some embodiments, the residue at positions 2, 4, and 6 of the C beta strand may be a hydrophobic residue, and positions 1, 3, 5, and 7-9 of the C beta strand amy be altered relative to the wild type sequence, wherein the residue at position 1 of the C beta strand may be selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys, and Arg. The residue at position 3 of the C beta strand may be a hydrophobic residue, or may be selected from the group consisting of He, Val, Arg, Leu, Thr, Glu, Lys, Ser, Gin, and His. Position 5, 7, 8, and 9 of the C beta strand may be selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys, and Arg.
[0012] In some embodiments, the residue at positions 1, 3, 5, and 10 of the F beta strand may be altered relative to the wild type sequence, wherein the residues at positions 1, 3, 5, and 10 of the F beta strand may be individually selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys, and Arg. The residue at positions 2, 4, and 6 of the F beta strand may be a hydrophobic residue. The residue at position 7 of the F beta strand may be a hydrophobic residue, or may be selected from the group consisting of Arg, Tyr, Ala, Thr, and Val. The residue at position 8 of the F beta strand may be selected from the group consisting of Ala, Gly, Ser, Val, and Pro. The residue at position 9 of the F beta strand may be selected from the group consisting of Val, Leu, Glu, Arg, and He.
[0013] In some embodiments the cradle polypeptide may comprise a substitution that corresponds to a substitution in one or more of the amino acids at positions 30, 31, 33, 35, 37- 39, 40-45, 47, 49, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, and/or 86 of SEQ ID NO: l. In some embodiments the cradle polypeptide may comprise amino acid substitution in one or more of the amino acids at positions 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85 of SEQ ID NO:97. In some embodiments the cradle polypeptide may comprise amino acid substitution in one or more of the amino acids at positions 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81 of SEQ ID NO: 129. In some embodiments the cradle polypeptide may comprise an amino acid sequence set forth in SEQ ID NOs: 468, 469 and 470. In some embodiments the cradle polypeptide may be modified by inserting or deleting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20 or more amino acids, or any range derivable therein, in an Fnlll loop. In some embodiments, substitutions in loops AB, CD, and EF may be specifically excluded, either individually or in various combinations. In some embodiments modifications in the bottom loop(s) may be limited to 1, 2, 3, 4, or 5 or fewer substitutions, insertions, and/ or deletions. In some embodiments the amino acid substitutions may contribute to the binding specificity of the cradle polypeptide.
[0014] Also provided herein is a chimeric cradle polypeptide comprising one or more amino acid substitutions in at least a loop region and at least a non-loop region, wherein part of the cradle polypeptide is replaced by a non-FnIII domain polypeptide that enhances the binding affinity of the cradle polypeptide for a target molecule. In some embodiments the chimeric cradle polypeptide may comprise all or part of a complementarity determining region (CDR) of an antibody or a T-cell receptor, wherein the CDR may be a CDR1, CDR2 or CDR3 of a single domain antibody. In some embodiments the single domain antibody may be a nanobody. In some embodiments the CDR may replace part or all of the AB, BC, CD, DE, EF or FG loop.
[0015] Further provided herein is a multispecific cradle polypeptide comprising multiple copies of one or more monomer cradle polypeptides disclosed herein, wherein the monomer cradle polypeptides may be linked by a linker sequence. In some embodiments the linker sequence may be selected from the group consisting of GGGGSGGGGS (SEQ ID NO: 471), GSGSGSGSGS (SEQ ID NO: 472), PSTSTST (SEQ ID NO: 473) and EIDKPSQ (SEQ ID NO: [0016] In another aspect, the present invention provides a cradle library comprising a plurality of cradle polypeptides having amino acid substitutions in both the beta strands in conjunction with substitutions in the AB loop, the BC loop, the CD loop, the DE loop, and/or the FG loop of Fnlll. In some embodiments the cradle polypeptides may comprise one or more amino acid substitutions corresponding to amino acid positions 30, 41, 42, 43, 44, 45, 76, 77, 78, 79, 80, 81, 82, 83, 84 and/or 85 of SEQ ID NO: l. In some embodiments the cradle polypeptides may further comprise one or more amino acid substitutions corresponding to amino acid positions 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 32, 34, 35, 36, 37, 38, 39, 40, 46, 48, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 74, 75, 86, 87, 88, 89, 90, 91, 92, 93 and/or 94 of SEQ ID NO: l. In some embodiments the cradle polypeptides may be at least 50%, 60%, 70%, 80%, or 90% identical to SEQ ID NO: l. In some embodiments the cradle polypeptides may further comprise an insertion of at least 1, 2, or about 2-25 amino acids in at least one loop region. In some embodiments the cradle polypeptides may comprise a deletion of at least 1, 2 or about 2-10 amino acids in at least one loop region. In some embodiments the cradle polypeptides may comprise a deletion of at least 2 amino acids in two loop regions. In some embodiments the cradle polypeptides may comprise at least 1 amino acid insertion and 1 amino acid deletion in at least one loop region. In some embodiments the cradle polypeptides may comprise an insertion and deletion of at least 1 amino acid in the same loop region. In some embodiments the cradle library may be preselected to bind a target molecule. In some embodiments the cradle polypeptides may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 79, 86 and 468- 470. In some embodiments the cradle library may contain 10, 100, 1000, 104, 105, 106, 107, 108, 109, 1010, 10", 1012, 1013, 1014, 1015 or more different polypeptide variants, including all values and ranges there between. In some embodiments, the amino acid sequence of the Fnlll domain from which the library is generated is derived from the wild type amino acid sequences of the 1st, 2nd, 3rd, 4Λ, 5Λ, 6Λ, 7Λ, 8*, 9th, 10*, 11th, 12th, 13th, 14*, 15* or 16* Fnlll domain of human fibronectin. In some embodiments, the cradle polypeptide sequences may be a a loop FG comprising 5 or 6 residues, a loop CD comprising 3 to 11 residues, a beta strand C comprising 6 to 14 residues, a beta F comprising 8 to 13 residues, or a combination of the loops and strands.
[0017] Further provided herein are polynucleotides encoding one or more cradle polypeptide described herein. In some embodiments the polynucleotide may be an expression cassette or an expression construct. In some embodiments the expression construct may be capable of expressing the encoded polypeptide in a host cell, such as a prokaryotic or eukaryotic cell line or strain. In some embodiments the expression construct may be functional in one or more polypeptide expression systems known in the art. In some embodiments the expression construct may be functional in bacteria, yeast, insect cells, mammalian cells or the like.
[0018] Further provided herein is a method of producing a cradle polypeptide by: a) expressing a polynucleotide encoding a cradle polypeptide disclosed herein in a host cell; and b) isolating and/or purifying the expressed cradle polypeptide. In some embodiments the method may include the engineering of various amino acids substitutions, deletions, and/or insertions described herein.
[0019] In a further aspect, provided herein is a method of forming a cradle library of Fnlll domain polypeptides useful in screening for the presence of one or more polypeptides having a selected binding or enzymatic activity, which comprises: (i) aligning loops FG and CD, and preferably beta strands C and F amino acid sequences in a collection of native Fnlll domain polypeptides, (ii) segregating the aligned loop and beta strand sequences according to length, (iii) for a selected loop, beta strand, and length from step (ii), performing positional amino acid frequency analysis to determine the frequencies of amino acids at each position, (iv) for each loop, beta strand, and length analyzed in step (iii), identifying at each position a conserved or selected semi-conserved consensus amino acid and other natural- variant amino acids, (v) for at least one selected loop, beta strand, and length, forming: (1) a library of mutagenesis sequences expressed by a library of coding sequences that encode, at each loop position, the consensus amino acid, and if the consensus amino acid has a occurrence frequency equal to or less than a selected threshold frequency of at least 50%, a single common target amino acid and any co- produced amino acids, or (2) a library of natural-variant combinatorial sequences expressed by a library of coding sequences that encode at each position, a consensus amino acid and, if the consensus amino acid has a frequency of occurrence equal to or less than a selected threshold frequency of at least 50%, other natural variant amino acids, including semi-conserved amino acids and variable amino acids whose occurrence rate is above a selected minimum threshold occurrence at that position, or their chemical equivalents, (vi) incorporating the library of coding sequences into framework Fnlll coding sequences to form an Fnlll expression library, and (vi) expressing the Fnlll polypeptides of the expression library.
[0020] In some embodiments, the cradle library may include cradle polypeptides which may comprise: (a) regions A, AB, B, C, CD, D, E, EF, F, and G having wildtype amino acid sequences of a selected native Fnlll polypeptide, and (b) loop regions FG, CD, and/or beta strands C and F, having selected lengths, wherein at least one selected loop and/or beta strand region of a selected length contains a library of mutagenesis sequences expressed by a library of coding sequences that encode, at each loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has an occurrence frequency equal to or less than a selected threshold frequency of at least 50%, a single common target amino acid and any co-produced amino acids.
[0021] In some embodiments, the cradle polypeptides may comprise: (a) regions A, AB, B, C, CD, D, E, EF, F, and G having wildtype amino acid sequences of a selected native Fnlll polypeptide, and (b) loop regions FG, CD, and non-loop regions C and F having selected lengths, where at least one selected loop and/or beta strand region of a selected length contains a library of natural- variant combinatorial sequences expressed by a library of coding sequences that encode at each position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has a frequency of occurrence equal to or less than a selected threshold frequency of at least 50%, other natural variant amino acids, including semi- conserved amino acids and variable amino acids whose occurrence rate is above a selected minimum threshold occurrence at that position, or their chemical equivalents.
[0022] In some embodiments, the cradle library may have a given threshold of 100%, unless the amino acid position contains only one dominant and one variant amino acid, and the dominant and variant amino acids are chemically similar amino acids, in which case the given threshold may be 90%. In some embodiments, the cradle library may contain all natural variants or their chemical equivalents having at least some reasonable occurrence frequency, e.g. , 10%, in the in the selected loop, beta strand, and position.
[0023] In some embodiments, the cradle library may have at least one or more loops FG and CD and/or beta-strands C and F which comprise beneficial mutations identified by screening a natural-variant combinatorial library containing amino acid variants in the loops, beta strands, or combinations thereof. In some embodiments, one or more members of the library may be then isolated from other members of the library and analyzed. In some embodiments, the cradle library may be pre- selected to bind a target and those preselected members are then further diversified in selected amino acid position to generate a targeted cradle library that is subsequently screened for a particular characteristic or property.
[0024] Further provided herein is a method of of identifying a cradle polypeptide having a desired binding affinity to a target molecule, comprising: a) reacting a cradle library of Fnlll domain polypeptides disclosed herein with the target molecule, and b) screening the cradle library of Fnlll domain polypeptides to select those having a desired binding affinity to the target molecule. In some embodiments, after conducting the binding assay(s) one or more cradle polypeptides may be selected that have a particular property, such as binding specificity and/or binding affinity to a target. In some embodiments, the amino acid or nucleic acid sequence of one or more of the selected library members may be determined using conventional methods. The sequence of the selected Fnlll polypeptide(s) may then be used to produce a second cradle library that introduces further substitution of the selected sequences. The second cradle library may then be screened for Fnlll polypeptides having a particular property. The process can be repeated 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times. Additional iterations may enrich the cradle library as well as potentially include other variants.
[0025] In some embodiments, the method may further comprise conducting a first screen of a cradle library having amino acid substitutions in only Fnlll loops or only Fnlll beta strands and conducting a second screen using substitutions in only Fnlll loops or only Fnlll beta strands. In some embodiments, the first screen may use only substitutions in the Fnlll loops and the second screen may use only substitutions in the Fnlll beta-strands. In some embodiments, the second screen may use substitutions in both Fnlll loops and beta-strands. In some embodiments, the Fnlll amino acid residues varied in the first screen may or may not be varied in the second screen.
[0026] Also provided herein is a method of detecting a target molecule which comprises contacting a sample containing the target with an Fnlll binding domain that specifically binds the target. Further provided herein is a method of producing an Fnlll variant comprising: (a) expressing a polypeptide comprising an amino acid sequence; and (b) isolating and/or purifying the expressed variant Fnlll domain from a host cell expressing the variant Fnlll.
[0027] Further provided herein is a cradle polypeptide selected using the method of identifying a cradle polypeptide having a desired binding affinity to a target molecule disclosed herein. In some embodiments, the cradle polypeptide may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs:4-78, 80-85, 87-96, 98, 99, 101-128, 130- 141, 143, 145-147, 149-159, 161-199, 201-238 and 240-277.
[0028] In still a further aspect, the present invention provides a kit comprising a plurality of cradle polypeptides as described herein. Also provided herein is a kit comprising a plurality of polynucleotides encoding the Fnlll cradle polypeptides as disclosed herein. Further provided herein is a kit comprising a cradle library and/or the polynucleotides encoding the cradle library as disclosed herein.
Brief Description of the Drawings
[0029] Figure 1 is a schematic diagram illustrating the method for constructing Fnlll cradle libraries using computer assisted genetic database biomining and delineation of beta-scaffold and loop structures.
[0030] Figure 2A shows the structure and sequence of the wild type Fnlll10 (SEQ ID NO: 1). Loops CD and FG along with the specific residues of beta strands C and F are shown in black in the structure and boldface black in the sequence. [0031] Figure 2B shows the binding surface formed by the Cradle. Loops CD and FG are black, sheet C is light gray, and sheet F is dark gray.
[0032] Figure 3 A shows the placement of the cradle residues on the ribbon diagrams of the Fnlll domains. The structure for the Fnlll07 domain is from RCSB code 1FNF, the structure for the Fnlll10 domain is from 1FNA, and the structure for the Fnlll14 domain is from 1FNH.
[0033] Figure 3B is a ball and stick representation of the location of the cradle on the Fnlll10 molecule, where cradle residues are black and other residues are white.
[0034] Figures 4A-D show the length distribution calculated from mammalian Fnlll domains found in the PFAM family PF00041. Figure 4 A: Sheet C; Figure 4B: Loop CD; Figure 4C: Sheet F; Figure 4D: Loop FG.
[0035] Figures 5A-H show the positional amino acid distribution found in the structural elements of the Cradle. The conservation of the top 5 amino acids for each position in each Cradle is shown. Figure 5A: Sheet C, length 9; Figure 5B: Sheet C, length 10; Figure 5C: Loop CD, length 4; Figure 5D: Loop CD, length 5; Figure 5E: Loop CD, length 6; Figure 5F: Sheet F, length 10; Figure 5G: Loop FG, length 5; Figure 5H: Loop FG, length 6.
[0036] Figures 6A-F show the binding surface comparison of the Fnlll10 Cradle, the Fnlll10 Top Side and the Fnlll10 Bottom Side binding sites. Figure 6A: Cradle shown in white on a ribbon diagram of Fnlll10; Fi gure 6B: Surface representation of the Cradle; Figure 6C: Top Side shown in white on a ribbon diagram of FnIII10; Fi gure 6D: Surface representation of the Top Side; Figure 6E: Bottom Side shown in white on a ribbon diagram of FnIII10; Fi gure 6F: Surface representation of the Bottom Side.
[0037] Figures 7A-B show the conservation of amino acid type in sheets C and F of Fnlll10 and indicates which residues are varied in the Cradle molecule and which ones were left as wild type. Figure 7A: Ribbon diagram of FnIII10 with the amino acids in sheets C and F numbered 1 - 19. The Ca for each amino acid is shown as a sphere and the C is shown as a stick to indicate the direction of the amino acid R group. Varied amino acids are colored gray and unvaried are colored white. Figure 7B: Table showing the amino acid type conservation for each position in sheets C and F.
[0038] Figure 8 is the amino acid distribution in the varied residues of the Cradle and CDR- H3 domains known to bind antigens.
[0039] Figures 9A-F describe the design of the Cradle library on Fnlll07, Fnlll10, and Fnlll14. Fi gure 9A: Length distribution of loop CD; Figure 9B: Length distribution of loop FG; Figure 9C: Amino acid distribution in the sheets and loops. Figure 9D: Alignment of cradle residues for Fnlll07, Fnlll10 and Fnlll14 (SEQ ID NOs: 468-470). Beta sheets are shown as white residues on a black background and loops are shown as black text. Cradle residues are shown in bold with X representing the amino acid distribution for the beta sheets and Y
representing the amino acid distribution for the loops with the loop length range given as a subscript.
Figure 9E: Alignment of Fnlll07, Fnlll10 and Fnlll14 (SEQ ID NOs:97, 100, 129) illustrating the cradle residues in beta sheets C and F and loops CD and FG. Beta sheets are shown as white residues on a black background and loops are shown as black text with Cradle residues shown in bold. Figure 9F: Shown are the Fnlll structural element residue ranges and Fnlll cradle residues ranges.
[0040] Figures lOA-C show a shared epitope for a monobody and a SIM peptide and conservation of the SIM binding site in SUMO proteins. Figure 10A: The structures of the ySMB-1 monobody bound to ySUMO (left) and a SIM peptide bound to hSUMO-115 (PDB ID 1Z5S) (right) are shown. Because there are no structures of natural SIM peptides in complex with ySUMO, the structure of a SIM peptide bound to hSUMO-1 is shown for comparison. Figure 10B: An alignment of SIM binding site/ySMB-1 epitope residues in ySUMO, and two human homologs, hSUMO-1 and hSUMO-2 are shown (top left) (SEQ ID NOs:297-299). Residues are ranked according to their conservation score: residues identical in all 3 SUMO proteins (i), similar with a conservation score of 9 (ii), and similar with a conservation score of 8 (iii). Conservation scores were calculated using methods outlined by Livingstone and Barton, Comput. Appl. Biosci. (1993) 9:745-756 using the Jalview program (Clamp, et al. ,
Bioinformatics (2004) 20:426-427). These scores reflect conservation of chemical and structural properties of side chains. The structure of ySUMO is shown (top right). Figure IOC: A full sequence alignment of ySUMO, hSUMO-1 and hSUMO-2 is shown (SEQ ID
NOs:300-302).
[0041] Figures 11A-C illustrate the design of a SUMO-targeted cradle library. Figure 11 A: Shown is the structure of the ySMB-l/ySUMO interface. The ySUMO structure is shown as a surface with epitope residues shown as sticks. Figure 11B: Shown is a sequence alignment (top) of ySMB-1 epitope residues in ySUMO and equivalent residues in hSUMO-1 and hSUMO-2 (SEQ ID NOs:297-299). Below, the residues of ySMB-1 varied in the SUMO- targeted library are listed. Interactions between ySMB-1 residues and ySUMO residues in the ySMB-l/ySUMO structure are indicated by lines. Below each ySMB-1 residue, the amino acids allowed at that position in the SUMO-targeted library are listed along with the degenerate codon used to introduce them in parentheses. Figure 11C: Shown is a cartoon of the ySMB-1 structure with the positions varied in the SUMO-targeted library indicated.
[0042] Figures 12A-C illustrate the selection and characterization of monobodies from the SUMO-targeted library. Figure 12 A: ySUMO (left) and hSUMO-1 (right) are shown with the ySMB-1 paratope structure modeled as if binding to each target. Monobody residue positions are shown as spheres corresponding to Ca atoms of indicated residue numbers. FG loop residues (75, 76, 78, 79, 80, 81, 82, 83, 84, and 85) and scaffold residues (31, 33, and 73) are indicated. In the center, a table is shown listing the amino acid diversities introduced at monobody positions in the SUMO-targeted library. Wildtype residues at each position are indicated in brackets. Figure 12B: Shown are the amino acid sequences of monobodies recovered against ySUMO and hSUMO-1 as well as representative SPR binding traces (SEQ ID NOs:303-318). Estimated dissociation constants from SPR are given for all clones. Figure 12C: Shown are the sequence logo representations of 40 ySUMO monobodies and 44 hSUMO- 1 monobodies. The wild-type sequence of ySMB-1 is shown above (SEQ ID NO:303). In this depiction, the relative height of individual letters reflects how frequently that amino acid is recovered at that position, the letters stacked at a given position are ordered from more frequently occurring to less frequently occurring, and the overall height of an individual stack reflects the overall level of sequence conservation at that position. Figures generated using WebLogo (Crooks, et al , Genome Res. (2004) 14:1188-1190; Schneider and Stephens, Nucleic Acids Res. (1990) 18:6097-6100).
[0043] Figure 13 shows the rationale for scaffold residue preferences in ySUMO and hSUMO-1 monobodies. Contacts made by scaffold residues in the ySMB-l/ySUMO complex (left) and in a modeled ySMB-l/hSUMO-1 complex (right) are shown. A potential steric and electrostatic clash between R33 of the monobody scaffold and K25 of hSUMO-1 is circled.
[0044] Figures 14A-D show the specificity in ySUMO and hSUMO-1 binding monobodies. Figure 14A: Amino Acid Sequences of Two Nearly Identical ySUMO and hSUMO-1
Monobodies are shown (SEQ ID NOs:303, 319-320). Monobody A was recovered as a hSUMOl binder, and monobody B as a ySUMO binder. Figure 14B: Phage ELISA data is shown for binding of Monobody A and B to ySUMO and hSUMO-1. Both ySUMO and hSUMO-1 were produced as GST fusion proteins. Binding to GST is shown as a negative control. Figure 14C:Phage ELISA data for the binding of 32 hSUMO-1 monobodies to ySUMO, hSUMO-1, and hSUMO-2 is shown. All SUMO proteins were produced as GST fusions. Binding to GST is shown as a negative control. Figure 14D: Sequence alignments of monobodies specific for hSUMO-1 and cross-reacting with ySUMO are shown in sequence logo format (see Figure 13 legend for explanation of sequence logos). The wild-type ySMB-1 sequence is shown above. Clone numbers 1, 3, 4, 5, 6, 8, 9, 12, 13, 17, 18, 20, 21, 23, 31 and 32 in Figure 25C were classified as cross-reactive. The remaining 16 clones were classified as specific. [0045] Figures 15A-C show the representative binding data for monobodies generated from the cradle libraries. Phage ELISA signals of selected clones are shown. Figures 15 A, B and C show clones selected from the BL1 library with hSUMOl, human ubiquitin and AblSH2 as a target, respectively. ELISA wells were coated with the cognate target. The left bars show data in the absence of a soluble target (which serves as a competitor), and the middle bars show data in the presence of a soluble competitor (100 nM for hSUMOl and 200nM for the others). The right bars show binding to wells containing no target (negative control).
[0046] Figures 16A-E show the sequences and properties of ySUMO-binding monobodies. Figure 16 A: yeast SUMO (ySUMO) structure shaded by conservation score among ySUMO and hSUMO isoforms (Livingstone and Barton, supra, 1993). Figure 16B: Schematic of the Fnlll scaffold with beta strands A-G labeled and surface loops (BC loop, DE loop, and FG loop) diversified in monobody libraries. Figure 16C: Amino acid sequences of variable loops of ySUMO-binding monobodies with Kd values from SPR (SEQ ID NOs:321-329). Figure 16D: SPR traces for ySMB-1 and ySMB-2 binding to ySUMO with kinetic parameters calculated from a bet fit (solid line) of the raw data (dashed line) to a 1: 1 binding model. Figure 16E: Epitopes of ySMB-1 and ySMB-2 mapped from NMR chemical shift perturbation shown on the ySUMO structure.
[0047] Figure 17 shows the sequences and affinities of ySUMO-binding monobodies (SEQ ID NOs:321-415). Amino acid sequences of the variable loops of all ySUMO-binding monobodies recovered in our laboratory. If available, K<j values from SPR are given.
Monobodies originated from one of three libraries: a binary Tyr/Ser library in which loop lengths and sequences were varied using a combination of 50% Y and 50% S (Koide, A., et al , Proc. Natl. Acad. Sci. USA (2007) 104:6632-6637), a "YSX" library which used a combination of 40% Y, 20% S, 10% G, and 5% each of R, L, H, D, N, A (Olsen, et al. , Nature (2010) 463:906-912), or a "YSGW" library which used a combination of 30% Y, 15% S, 10% G, 5% each of W, F and R, and 2.5% each of all other amino acids except cysteine in the BC and FG loops and 50% Gly, 25% Tyr and 25% Ser at position 52, and a 50/50 mixture of Tyr and Ser at positions 53-55 in the DE loop (Wojcik, et al. , supra, 2010).
[0048] Figure 18 shows the epitope mapping ELISA of ySUMO-binding monobodies. Binding of 34 phage-displayed ySUMO-binding monobodies measured by ELISA in the presence and absence of 1 μΜ ySMB-1 competitor. Clone numbers correspond to those of the format ySMB-X in Figure 28.
[0049] Figures 19A-B show the specificity of ySUMO-binding monobodies. Figure 19 A: Binding of eight ySUMO-binding monobodies to ySUMO, hSUMOl and hSUM02 assayed using phage ELISA. Clone numbers are of the format ySMB-X in Figures 27C and 28. Figure 19B: Equilibrium SPR measurements of ySMB-1 (left column) and ySMB-9 (right column) binding to ySUMO, hSUMOl and hSUM02. Equilibrium responses at multiple concentrations (left panels) were fit with a simple 1 : 1 binding model (right panels).
[0050] Figures 20A-C show the crystal structure of the monobody ySMB-l/ySUMO complex. Figure 20A: Top: ySUMO and ySMB-1 are shown with monobody paratope residues shown as sticks; FG loop residues and scaffold residues are indicated. ySUMO is shown in the same orientation as in Figure 16E. Bottom: An alternative view with the monobody paratope depicted as a surface. Figure 20B: Close-up of the ySMB-l/ySUMO interface. ySUMO (surface/sticks) is shown with residues comprising the hydrophobic center of the epitope and the charged/polar rim. Monobody paratope residues are shown as in (A). Figure 20C: Left and Middle: comparison of the binding modes of ySMB-1 to ySUMO and the SIM of RanBP2 to hSUMOl. Both form intermolecular beta sheets with their SUMO targets (expanded box). Right: Overlay of the RanBP2 SIM and SIM mimicking monobody residues with the ySUMO surface shown.
[0051] Figures 21A-B show the ySMB-l/ySUMO interface analysis. Figure 21 A: Buried surface area contributed by each residue in the ySMB-1 paratope. Figure 21B: Percent of total ySMB-1 and ySUMO buried surface area contributed by each amino acid type.
[0052] Figures 22A-F show the hSUMOl -binding monobodies from the SUMO-targeted library. Figure 22A: Design of the SUMO-targeted cradle library. Left: ySMB-1 paratope residues (backbone sticks/spheres) are shown with FG loop and scaffold residues indicated. ySUMO (surface) is shown with ySMB-1 epitope residues as sticks. ySUMO residues F37, K38, K40, T43, L48, and R55 are completely conserved, H23, 135, 139, R47 and A51 are conservative substitution and N25, E34, F36, E50, and K54 are non-conservative substitution, according to conservation between ySUMO and hSUMOs. The residue types at each position in hSUMOl and hSUM02/3 are shown in parentheses. Right: Amino acid diversity used in the SUMO-targeted library. The wild-type ySMB-1 residue is in brackets. Figure 22B: Amino acid sequences of hSUMOl -binding monobodies from the SUMO-targeted library. K<j values from SPR are also shown. Representative SPR traces are shown. At bottom, sequences of an additional hSUMOl binding monobody (hSlMB-22) and a very similar ySUMO binding monobody (ySMB-ST6) recovered from the SUMO targeted library are shown (SEQ ID NOs:303, 416-427). Figure 22C: Epitope of hSlMB-4 mapped from chemical shift perturbation shown on the hSUMOl structure. Data are represented using the same scheme as in Figure 16E. Figure 22D: (SEQ ID NO:303) Sequence conservation of ySUMO- and hSUMOl -binding monobodies shown as sequence logos (Schneider and Stephens, supra, 1990; Crooks, et ah , supra, 2004). The height of individual letters reflects how frequently that amino acid was recovered at that position, the letters stacked at a position are ordered from most to least frequently occurring and the overall height of a stack reflects the overall conservation level at that position. Figure 22E: Binding of hSlMB-22 and ySMB-ST6 to ySUMO and hSUMOl measured by phage ELISA. Figure 22F: Contacts made by scaffold residues in the ySMB- 1/ySUMO complex (left) and in a modeled ySMB-l/hSUMO-1 complex (right). Monobody (sticks) and SUMO residues (surface/sticks) are indicated. The ySMB-l/hSUMOl complex was modeled by superposition of the ySUMO portion of the ySMB-1 complex with the hSUMOl structure.
[0053] Figure 23 shows the ySUMO-binding monobodies isolated from the SUMO-targeted library. Shown are the amino acid sequences of monobodies recovered against ySUMO from the SUMO-targeted library with Kd values from SPR (SEQ ID NOs:303, 428-432) and representative SPR traces.
[0054] Figure 24 shows the epitope mapping ELISA of hSUMOl -binding monobodies. Binding of sixteen phage-displayed hSUMOl -binding monobodies to hSUMOl measured by ELISA in the presence or absence of ΙμΜ hSlMB-4 competitor. Clone numbers correspond to those of the format hSlMB-X in Figures 22B and 26.
[0055] Figures 25A-B shows the specificity of hSUMO-1 -binding monobodies. Figure 25 A: Binding curves derived from phage ELISA of six hSUMOl -binding monobodies binding to ySUMO, hSUMOl and hSUM02. Data for additional monobodies are shown in Figure 26Λ. Serial dilutions of phage containing culture supernatant (titer ~ 108) were used. Absorbance values were scaled to 1 cm path- length. Figure 25B : Equilibrium SPR measurements of hSlMB-4 binding to ySUMO, hSUMOl and hSUM02. Equilibrium responses at multiple concentrations (left panels) were fit to a simple 1 :1 binding model (right panels).
[0056] Figures 26A-B show the selectivity of hSUMOl -binding monobodies. Figure 26A: Binding curves derived from phage ELISA of 10 hSUMO-binding monbodies binding to ySUMO, hSUMOl and hSUM02. Data for six additional monobodies are shown. Figure 26B: The amino acid sequences of 16 hSUMOl -binding monobodies are shown (SEQ ID NOs:433- 448) and grouped according to their specificity factor for hSUMOl over ySUMO. The specificity factor is the ratio of apparent affinity measured for hSUMOl to that for ySUMO in the titration phage ELISA experiment shown in Figure 25A and Figure 26A.
[0057] Figures 27A-C show the effects of hSUMOl -specific monobodies on SUMO/SIM interactions and SUMOylation. Figure 27A: Left: Schematic of SIM-containing RanBP2's interaction with SUMOylated RanGAP (modified with hSUMOl). Right: Binding of RanBP2 to SUMOl-RanGAP in the presence of monobody hSlMB-4 in ELISA. Figure 27B: Schematic of the El- and E2-dependent steps in the SUMOylation cascade. Covalently linked intermediates are formed sequentially between SUMO and El (SAE1/2) and E2 (Ubc9). Figure 27C: SDS-PAGE of SUMOylation reactions carried out in the presence of hSlMB-4 (lanes 3-5) and hSlMB-5 (lanes 6-8). Lanes 1 and 2 are negative controls with ySMB-1 and without a monobody, respectively. All reactions contained SAE1/2, Ubc9 and both hSUMOl and hSUM03 as substrates. Bands corresponding to the SAE2-SUMO and Ubc9-SUMO covalent intermediates for each isoform are indicated. His6-tagged SUM03 (H6-SUM03) was used to distinguish hSUMOl from hSUM03 on the gel.
[0058] Figure 28 shows the proposed mechanism for monobody inhibition of hSUMOl conjugation. A modeled structure of a ySMB-l-like monobody bound to an El -hSUMOl complex (PDB ID 3KYD (Olsen, et al. , supra, 2010). The trajectory of a long loop of SAE1 that is disordered in the crystal structure is illustrated by a dashed line.
[0059] Figures 29A-B show the monobody effects on deSUMOylation. Figure 29A:
Schematic of the deSUMOylation assay in which a YFP-hSUMOl-ECFP fusion protein is cleaved by SENPl at the hSUMOl C-terminal di-glycine sequence. Figure 29B: SDS-PAGE analysis of deSUMOylation reactions carried out in the presence of hSMB-4 (lanes 6-8) or hSlMB-5 (lanes 9-11). Controls are also shown without SENPl or a monobody (lane 1) or with SENPl cleavage carried out in the presence of the ySUMO specific ySMB-1 (lanes 2-5). Bands corresponding to the YFP-hSUMOl-ECFP fusion and the YFP-hSUMOl and ECFP cleavage products are indicated as well as the band corresponding to the monobodies.
[0060] Figures 30A-E shows monobody library design. Figure 30A: A comparison of the VHH scaffold (left) and the Fnlll scaffold (right). The two beta sheet regions are colored in cyan and blue, respectively. The CDR regions of the VHH and the corresponding loops in Fnlll are colored and labeled. The beta strands of Fnlll are labeled with A-G. Figure 30B: The structure of a monobody bound to its target, maltose-binding protein (Gilbreth, R. N., et al , J Mol Biol (2008) 381:407-418). The monobody is depicted in the same manner as in A. Only a portion of maltose-binding protein is shown as a surface model. Figure 30C: The structure of a monobody bound to the Abl SH2 domain depicted as in B (Wojcik, et al. , supra, 2010). Figure 30D: The locations of diversified residues in the cradle library shown as spheres on the Fnlll structure. Figure 30E: The locations of diversified residues in the cradle library.
[0061] Figures 31A-D show monobody library designs and generated clones. Amino acid sequences of monobodies generated from the new cradle library (Figure 31 A) (SEQ ID
NOs:449-457) and the "loop only" library (Figure 3 IB) (SEQ ID NOs:458-467). "X" denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp and 2.5% each of all the other amino acids except for Cys; "B", a mixture of Gly, Ser and Tyr; "J", a mixture of Ser and Tyr; "O", a mixture of Asn, Asp, His, lie, Leu, Phe, Tyr and Val; "U", a mixture of His, Leu, Phe and Tyr; "Z", a mixture of Ala, Glu, Lys and Thr. Figure 31C: Binding measurements by yeast surface display of representative monobodies. The mean fluorescence intensities of yeast cells displaying a monobody are plotted as a function of the concentration of the target as indicated in panel A. Figure 3 ID: SPR sensorgrams for target binding of representative monobodies. The thin lines show the best global fit of the 1 : 1 binding model. The insets show dose-dependence analysis of the sensorgrams and the best fit of the 1 : 1 binding model.
[0062] Figures 32A-D show the crystal structures of monobodies originating from the two libraries. The structures are shown with the monobodies in similar orientations. Figure 32A: The structure of the SH13 monobody bound to the Abl SH2 domain depicted as in Figure 30C. Figure 32B: NMR-based epitope mapping of the SH13/Abl SH2 complex. The spheres show residues of Abl SH2 whose amide resonances were strongly affected (shift of > 1.5 peak width), weakly affected (shift of 0.5-1.5 peak width) and minimally affected (shift of <0.5 peak width) by monobody binding, respectively. Figure 32C: The crystal structures of the ySMB-l/ySUMO complex (left) and ySMB-9/hSUMOl complex (right). Figure 32D: The two monobodies bound to equivalent epitopes on the targets using distinct modes. The left panel shows a comparison of the two crystal structures shown in C with ySUMO and hSUMOl superimposed. The right panel shows ySUMO and hSUMOl in equivalent orientations with the epitopes for the indicated monobodies.
[0063] Figure 33 shows mutations of residues in the C-strand abolished target binding. Residues 30, 31 and 33 of monobody GS5 (see Figure 31A for its sequence) were mutated back to their respective wild-type amino acids. The mean fluorescence intensities of yeast cells displaying the GS5 monobody (filled circles) and the mutant (open circles) are plotted as a function of the concentration of the target, GFP.
Detailed Description of the Invention I. Definitions
[0064] The terms below have the following meanings unless indicated otherwise in the specification:
[0065] The term "fibronectin type III domain" or "Fnlll domain" refers to a domain (region) from a wild-type fibronectin from any organism. In one specific embodiment, the Fnlll domain is selected from the group consisting of Fnlll01, Fnlll02, Fnlll03, Fnlll04, Fnlll05, Fnlll06, Fnlll07, Fnlll08, Fnlll09, Fnlll10, Fnlll11, Fnlll12, Fnlll13, Fnlll14, Fnlll15, and Fnlll16 and the like. In another embodiment, the Fnlll domain is selected from the group consisting of Fnlll07, Fnlll10, and Fnlll . In another embodiment, the Fnlll domain is Fnlll . In another embodiment, the Fnlll domain is Fnlll10. In another embodiment, the Fnlll domain is Fnlll14.
[0066] The term "Fnlll domain variant" or "variant Fnlll domain" refers to a polypeptide region in which modifications have been made to the wildtype Fnlll domain. Modifications include one or more amino acid substitutions, deletions, and/or insertions are present as compared to the amino acid sequence of a wildtype Fnlll domain. In one embodiment, the Fnlll variant or Fnlll variant domain has an alteration with respect to specifically the human tenth domain of the Fnlll domain sequence (SEQ ID NO: l). In one embodiment, the Fnlll variant or Fnlll variant domain has an alteration with respect to specifically the human seventh domain of the Fnlll domain sequence (SEQ ID NO: 97). In one embodiment, the Fnlll variant or Fnlll variant domain has an alteration with respect to specifically the human fourteenth domain of the Fnlll domain sequence (SEQ ID NO: 129). The term "substitutional variant" includes the replacement of one or more amino acids in a peptide sequence with a conservative or non-conservative amino acid(s). In some embodiments, the Fnlll domain variant has increased binding properties compared to the wildtype Fnlll domain relative to a particular target. In some embodiments, the the Fnlll domain variant has an increased surface area available for binding to a target moelcule compared with the wild type Fnlll domain.
[0067] The term "Fnlll domain polypeptide" refers to a polypeptide that includes at least one Fnlll domain. A "variant Fnlll domain polypeptide" or "Fnlll domain-based polypeptide" refers to a polypeptide that includes at least one Fnlll domain variant. It is contemplated that such polypeptides are capable of specifically binding a target polypeptide or protein. "Fnlll domain-based molecule" refers to a molecule having an amino acid sequence of an Fnlll domain or Fnlll variant domain.
[0068] A "β sheet" or "beta sheet" is a form of regular secondary structure in proteins. Beta sheets consist of beta strands connected laterally by at least two or three backbone hydrogen bonds, forming a generally twisted, pleated sheet. A "beta strand" or "β strand" is a stretch of polypeptide chain typically 3 to 10 amino acids long with backbone in an almost fully extended conformation. The term beta strand A, also referred to as sheet A, refers to the amino acids preceding the AB loop. The term beta strand B, also referred to as sheet B, refers to the amino acids connecting the AB and BC loops. The term beta strand C, also referred to as sheet C or βΐ, refers to the amino acids connecting the BC and CD loops, e.g. , amino acid position 31-39 of SEQ ID NO: 1. The term beta strand D, also referred to as sheet D or β2, refers to the amino acids connecting the CD and DE loops, e.g. , amino acid position 44-51 of SEQ ID NO: l. The term beta strand E, also referred to as sheet E, refers to the amino acids connecting the DE and EF loops. The term beta strand F, also referred to as sheet F or β3, refers to the amino acids connecting the EF and FG loops, e.g. , amino acid position 67-75 of SEQ ID NO: l. The term beta strand G, also referred to as sheet G or β4, refers to the amino acids after the FG loop, e.g. , amino acid position 85-94 of SEQ ID NO: l.
[0069] A loop is a less ordered, flexible stretch of amino acids (as compared to alpha helices and beta sheets) that typically connect other structural elements of a protein. In the context of Fnlll, the loops are designated by the beta-strands they connect, for example the loop connecting beta-strand A and beta-strand B is the AB loop. The term BC loop refers to the amino acids corresponding to amino acids 22 to 30 of SEQ ID NO: l. The term CD loop refers to the amino acids corresponding to amino acids 39 to 45 of SEQ ID NO: l. The term DE loop refers to the amino acids corresponding to amino acids 51 to 55 of SEQ ID NO: l. The term FG loop refers to the amino acids corresponding to amino acids 76 to 87 of SEQ ID NO: l. The term "non-loop region" refers to parts of the polypeptide sequence that do not form a loop, which include, but are not limited to, the beta sheets and beta strands. In the context of Fnlll, the non-loop regions include beta strands A, B, C, D, E, F and G.
[0070] The term "library" refers to a collection (e.g. , to a plurality) of polypeptides having different amino acid sequences and different protein binding properties. In some embodiments there is a variant Fnlll domain library comprising polypeptides having different variations of the Fnlll domain. Unless otherwise noted, the library is an actual physical library of polypeptides or nucleic acids encoding the polypeptides. In further embodiments, there is a database that comprises information about a library that has been generated or a theoretical library that can be generated. This information may be a compound database comprising descriptions or structures of a plurality of potential variant Fnlll domains.
[0071] The term "specifically binds" or "specific binding" refers to the measurable and reproducible ability of an Fnlll domain variant to bind another molecule (such as a target), that is determinative of the presence of the target molecule in the presence of a heterogeneous population of molecules including biological molecules. For example, an Fnlll domain variant that specifically or preferentially binds to a target is a polypeptide that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to most or all other molecules. "Specific binding" does not necessarily require (although it can include) exclusive binding.
[0072] An polypeptide that specifically binds to a target with an affinity of at least 1 x 10~6 M at room temperature under physiological salt and pH conditions, as measured by surface plasmon resonance. An example of such a measurement is provided in the Example section. [0073] The term "target" refers to a peptide, antigen or epitope that specifically binds to an Fnlll-based binding molecule or monobody described herein. Targets include, but are not limited to, epitopes present on proteins, peptides, carbohydrates, and/or lipids.
[0074] The term "non-natural amino acid residue" refers to an amino acid residue that is not present in the naturally occurring Fnlll domain in a mammal, such as a human.
[0075] The terms "tag", "epitope tag" or "affinity tag" are used interchangeably herein, and usually refer to a molecule or domain of a molecule that is specifically recognized by an antibody or other binding partner. The term also refers to the binding partner complex as well. Thus, for example, biotin and a biotin/avidin complex are both regarded as an affinity tag. In addition to epitopes recognized in epitope/antibody interactions, affinity tags also comprise "epitopes" recognized by other binding molecules (e.g. , ligands bound by receptors), ligands bound by other ligands to form heterodimers or homodimers, His6 bound by Ni-NTA, biotin bound by avidin, streptavidin, or anti-biotin antibodies, and the like.
[0076] The term "conjugate" in the context of an Fnlll domain variant refers to a chemical linkage between the Fnlll domain variant and a non-FnIII domain variant. It is specifically contemplated that this excludes a regular peptide bond found between amino acid residues under physiologic conditions in some embodiments of the invention.
[0077] The terms "inhibiting," "reducing," or "preventing," or any variation of these terms, when used in the claims and/or the specification includes any measurable decrease or complete inhibition to achieve a desired result.
[0078] As used herein the term "cradle molecule" or "Fnlll-based cradle molecule" refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand and at least one loop region, wherein the loop region is a top loop region selected from the group consisting of BC, DE, and FG. In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand and at least one loop region, wherein the loop region is a bottom loop region selected from the group consisting of AB, CD, and EF. In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand and at least one top loop region selected from the group consisting of BC, DE, and FG and at least one bottom loop region selected from the group consisting of AB, CD, and EF. It is understood that not all three loops from the top or bottom region need to be used for binding the target molecule. In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand and the top FG loop region and the bottom CD loop region. [0079] In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand selected from the group consisting of sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G and at least one loop region, wherein the loop region is a top loop region selected from the group consisting of BC, DE, and FG. In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand selected from the group consisting of sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G and at least one loop region, wherein the loop region is a bottom loop region selected from the group consisting of AB, CD, and EF. In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand selected from the group consisting of sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G and at least one loop region, wherein the loop region is a bottom loop region selected from the group consisting of AB, CD, and EF. In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in at least one beta strand selected from the group consisting of sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G and at least one top loop region selected from the group consisting of BC, DE, and FG and at least one bottom loop region selected from the group consisting of AB, CD, and EF. In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in beta strand C and the top FG loop region and the bottom CD loop region. In one embodiment, the cradle molecule refers to an Fnlll domain that has been altered to contain one or more modifications in beta strand F and the top FG loop region and the bottom CD loop region.
[0080] In a further embodiment, two or more cradle molecules are linked together. Such molecules are referred to herein as "multispecific cradle molecules".
[0081] The cradle molecules can be linked together (e.g. , in a pearl-like fashion) to form a multispecific cradle molecules that comprises, for example, at least two cradle molecules that are linked together. In some embodiments, this multispecific cradle molecule binds to different target regions of a same target molecule (e.g. , Target A). For example, one cradle molecule of the multispecific cradle molecule can bind to a first target region of Target A and another cradle molecule of the multispecific cradle molecule can bind to a second target region of Target A. This can be used to increase avidity of the multispecific cradle molecule for the target molecule. In another embodiment, the multispecific cradle molecule binds to multiple target molecules. For example, one cradle molecule of the multispecific cradle molecule can bind to Target A and another cradle molecule of the multispecific cradle molecule can bind to Target B (e.g. , a half life extender). In yet another embodiment, the multispecific cradle molecule comprises at least two cradle molecules that bind to different target regions of Target A and at least two cradle molecules that bind to different target regions of Target B. The skilled artisan will appreciate that any number of cradle molecules can be linked in this fashion to create a multispecific cradle molecule that are able to bind to different target regions of the same target molecule or different target molecules. In one embodiment, the C-terminal region of one cradle molecule is linked to the N-terminal region of another cradle molecule.
[0082] The term "complementarity determining region (CDR)" refers to a hypervariable loop from an antibody variable domain or from a T-cell receptor. The position of CDRs within a antibody variable region have been defined (see, e.g., Kabat, E.A., et al. Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, 1991 ; MacCallum et al, J. Mol. Biol. 262, 732-745, 1996; Al- Lazikani et al , J. Mol. Biol. 273,927-948, 1997, Lefranc et al , Dev. Comp. Immunol. 27(1):55- 77, 2003; Honegger and Pluckthun, J. Mol. Biol. 309(3):657-70, 2001 ; and Chothia, C. et al , J. Mol. Biol. 196:901-917, 1987, which are incorporated herein by reference).
[0083] The term "non-FnIII moiety" refers to a biological or chemical entity that imparts additional functionality to a molecule to which it is attached. In a particular embodiment, the non-FnIII moiety is a polypeptide, e.g. , human serum albumin (HSA), or a chemical entity, e.g. , polyethylene gycol (PEG) which increases the half-life of the Fnlll-based binding molecule in vivo.
[0084] The term "cradle library" refers to an Fnlll polypeptide library in which amino acid diversity in at least one beta strand and at least one top loop selected from the group consisting of BC, DE, and FG and/or at least one bottom loop selected from the group consisting of AB, CD, and EF loop regions is determined by or reflects the amino acid variants present in a collection of known Fnlll sequences.
[0085] The term "universal N+- binding library" or "N+/- libraries" refers to a more sophisticated or fine tuned library in which the most frequent amino acids surrounding an fixed amino acid are determined in the library design. These N+/- libraries are conducted with variations in beta strands, (e.g. , sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G, in particular sheet C and F), bottom loops, AB, CD, and EF, the top loops, BC, DE, FG, or any combination of the beta strands (e.g. , sheet A, sheet B, sheet C, sheet D, sheet E, sheet F and sheet G, in particular sheet C and F) and top and bottom loops. For "N+/- libraries," N is the most predominant amino acid at a particular position and amino acids upstream or downstream are designated +N or -N, respectively. For example, N+3 is an amino acid 3 positions upstream of N, while N-3 is an amino acid 3 positions downstream of N in a 3D structure of Fnlll.
Likewise, N+2 and N+l are amino acids at positions 2 and 1 upstream of N, respectively, while N-2 and N-l are amino acids at positions 2 and 1 downstream of N, respectively. By altering N from the most predominantly abundant amino acid to a less abundant amino acid, the effect of that modification can be assessed on the abundance of amino acids at 1, 2, or 3 positions away from N. In designing such a library, the frequency and abundance of amino acids surrounding the fixed N position are determined. These differences can be used to generate universal fibronectin bottom-side binding domain libraries, top-side binding domain libraries, or a combination of both bottom-side and top-side binding domain libraries.
[0086] The term "conserved amino acid residue" or "fixed amino acid" refers to an amino acid residue determined to occur with a frequency that is high, typically at least 50% or more (e.g. , at about 60%, 70%, 80%, 90%, 95%, or 100%), for a given residue position. When a given residue is determined to occur at such a high frequency, i. e. , above a threshold of about 50%, it may be determined to be conserved and thus represented in the libraries of the invention as a "fixed" or "constant" residue, at least for that amino acid residue position in the loop region being analyzed.
[0087] The term "semi-conserved amino acid residue" refers to amino acid residues determined to occur with a frequency that is high, for 2 to 3 residues for a given residue position. When 2-3 residues, preferably 2 residues, that together, are represented at a frequency of about 40% of the time or higher (e.g. , 50%, 60%, 70%, 80%, 90% or higher), the residues are determined to be semi-conserved and thus represented in the libraries of the invention as a "semi-fixed" at least for that amino acid residue position in the loop region being analyzed. Typically, an appropriate level of nucleic acid mutagenesis/variability is introduced for a semi- conserved amino acid (codon) position such that the 2 to 3 residues are properly represented. Thus, each of the 2 to 3 residues can be said to be "semi-fixed" for this position. A "selected semi-conserved amino acid residue" is a selected one of the 2 or more semi-conserved amino acid residues, typically, but not necessarily, the residue having the highest occurrence frequency at that position.
[0088] The term "variable amino acid residue" refers to amino acid residues determined to occur with a lower frequency (less than 20%) for a given residue position. When many residues appear at a given position, the residue position is determined to be variable and thus represented in the libraries of the invention as variable at least for that amino acid residue position in the loop region being analyzed. Typically, an appropriate level of nucleic acid
mutagenesis/variability is introduced for a variable amino acid (codon) position such that an accurate spectrum of residues is properly represented. Of course, it is understood that, if desired, the consequences or variability of any amino acid residue position, i. e. , conserved, semi-conserved, or variable, can be represented, explored or altered using, as appropriate, any of the mutagenesis methods disclosed herein. A lower threshold frequency of occurrence of variable amino acids may be, for example, 5-10% or lower. Below this threshold, variable amino acids may be omitted from the natural-variant amino acids at that position.
[0089] The term "natural-variant amino acids" includes conserved, semi-conserved, and variable amino acid residues observed, in accordance with their occurrence frequencies, at a given position in a selected loop of a selected length. The natural-variant amino acids may be substituted by chemically equivalent amino acids, and may exclude variable amino acid residues below a selected occurrence frequency, e.g. , 5-10%, or amino acid residues that are chemically equivalent to other natural-variant amino acids.
[0090] The term "library of mutagenesis sequences" refers to a library of sequences within a selected Fnlll loop and loop length which is expressed by a library of coding sequences that encode, at each loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has an occurrence frequency equal to or less than a selected threshold frequency of at least 50%, a single common target amino acid and any co-produced amino acids. Thus, for each of target amino acid, the library of sequences within a given loop will contain the target amino acid at all combinations of one to all positions within the loop at which the consensus amino acid has an occurrence frequency equal to or less than the given threshold frequency. If this threshold frequency is set at 100%, each position in the loop will be contain the target amino acid in at least one library member. The "library mutagenesis sequences" can be generated from the Tables and Figures disclosed herein using commercial vendors such as Geneart, or DNA2.0.
[0091] The term "library of natural-variant combinatorial sequences" refers to a library of sequences within a selected Fnlll beta strand and Fnlll loop which is expressed by a library of coding sequences that encode at each loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has a frequency of occurrence equal to or less than a selected threshold frequency of at least 50%, other natural variant amino acids, including semi-conserved amino acids and variable amino acids whose occurrence rate is above a selected minimum threshold occurrence at that position, or their chemical equivalents. Thus, for each amino acid position in a selected beta strand or loop, the library of natural variant combinatorial sequences will contain the consensus amino acid at that position plus other amino acid variants identified as having at least some minimum frequency at that position, e.g. , at least 5-10% frequency, or chemically equivalent amino acids. In addition, natural variants may be substituted or dropped if the coding sequence for that amino acid produces a significant number of co-produced amino acids, via codon degeneracy. [0092] The term "variability profile" or "VP" refers to the cataloguing of amino acids and their respective frequency rates of occurrence present at a particular beta strand or loop position. The beta strand and loop positions are derived from an aligned fibronectin dataset.
[0093] Other objects, features and advantages of the present invention will become apparent from the following detailed description. It should be understood, however, that the detailed description and the specific examples, while indicating specific embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from this detailed description.
II. Fnlll Polypeptides
[0094] Fibronectin Type III (Fnlll) polypeptides refer to a group of proteins composed of momomeric subunits having Fnlll structure or motif made up of seven beta strands with six connecting loops (three at the top and three at the bottom). Beta strands A, B, and E form one half beta sandwich and beta strands C, D, F, and G form the other half, and having molecular weights of about 94 amino acids and molecular weights of about 10 Kda. The overall fold of the Fnlll domain is closely related to that of the immunoglobulin domains, and the three loops near the N-terminus of Fnlll, named BC, DE, and FG can be considered structurally analogous to the antibody variable heavy (VH) domain complementarity-determining regions, CDR1, CDR2, and CDR3, respectively. The top and bottom loops of Fnlll have typically been thought to confer structural stability rather than being used for binding targets. However, the methods of the invention demonstrate that the top and bottom loops, as well as the beta sheets, can indeed be used for binding targets. Libraries of Fnlll binding molecules can also be generated that use the top loops, the bottom loops or any combination of the top and bottom loops and the surface exposed residues of the beta-sheets for binding.
[0095] In one embodiment, the Fnlll polypeptide is Fnlll10 with the following amino acid sequence:
Val Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr Pro Thr Ser Leu Leu lie Ser Trp Asp Ala Pro Ala Val Thr Val Arg Tyr Tyr Arg lie Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gin Glu Phe Thr Val Pro Gly Ser Lys Ser Thr Ala Thr He Ser Gly Leu Lys Pro Gly Val Asp Tyr Thr lie Thr Val Tyr Ala Val Thr Gly Arg Gly Asp Ser Pro Ala Ser Ser Lys Pro He Ser He Asn Tyr Arg Thr (SEQ ID NO: 1).
[0096] In another embodiment, the Fnlll polypeptide is Fnlll07 with the following amino acid sequence: Pro Leu Ser Pro Pro Thr Asn Leu His Leu Glu Ala Asn Pro Asp Thr Gly Val Leu Thr Val Ser Trp Glu Arg Ser Thr Thr Pro Asp lie Thr Gly Tyr Arg He Thr Thr Thr Pro Thr Asn Gly Gin Gin Gly Asn Ser Leu Glu Glu Val Val His Ala Asp Gin Ser Ser Cys Thr Phe Asp Asn Leu Ser Pro Gly Leu Glu Tyr Asn Val Ser Val Tyr Thr Val Lys Asp Asp Lys Glu Ser Val Pro He Ser Asp Thr He lie Pro (SEQ ID NO: 97)
[0097] In another embodiment, the Fnlll polypeptide or scaffold is Fnlll14 with the following amino acid sequence:
Asn Val Ser Pro Pro Arg Arg Ala Arg Val Thr Asp Ala Thr Glu Thr Thr He Thr lie Ser Trp Arg Thr Lys Thr Glu Thr lie Thr Gly Phe Gin Val Asp Ala Val Pro Ala Asn Gly Gin Thr Pro He Gin Arg Thr lie Lys Pro Asp Val Arg Ser Tyr Thr lie Thr Gly Leu Gin Pro Gly Thr Asp Tyr Lys He Tyr Leu Tyr Thr Leu Asn Asp Asn Ala Arg Ser Ser Pro Val Val He Asp Ala Ser Thr (SEQ ID NO: 129)
III. Fnlll Cradle Molecules
[0098] The present invention pertains to methods and compositions for generating Fnlll cradle molecules and libraries containing the same.
[0099] The cradle molecules included in the methods set forth herein are variants in that they comprise a wild type Fnlll domain that has been altered by substitution, insertion and/or deletion of one or more amino acid. The cradle molecules set forth herein may demonstrate a selective and/or specific binding affinity for particular target molecules or portions thereof.
[0100] In some embodiments, the cradle molecule is a fusion polypeptide that includes a variant Fnlll domain linked at the N- or C-terminus to a second peptide or polypeptide. In other embodiments, the cradle molecule comprises a linker interposed between the variant Fnlll domain and the second peptide or polypeptide sequence. Linkers are discussed in greater detail in the specification below.
[0101] Furthermore, the cradle molecules set forth herein may comprise a sequence of any number of additional amino acid residues at either the N-terminus or C-terminus of the amino acid sequence that includes the variant Fnlll domain. For example, there may be an amino acid sequence of about 3 to about 1,000 or more amino acid residues at either the N-terminus, the C- terminus, or both the N-terminus and C-terminus of the amino acid sequence that includes the variant Fnlll domain.
[0102] The cradle molecule may include the addition of an antibody epitope or other tag, to facilitate identification, targeting, and/or purification of the polypeptide. The use of 6xHis and GST (glutathione S transferase) as tags is well known. Inclusion of a cleavage site at or near the fusion junction will facilitate removal of the extraneous cradle molecule after purification. Other amino acid sequences that may be included in the cradle molecule include functional domains, such as active sites from enzymes such as a hydrolase, glycosylation domains, cellular targeting signals or transmembrane regions. The cradle molecule may further include one or more additional tissue-targeting moieties.
[0103] Cradle molecules may possess deletions and/or substitutions of amino acids relative to the native sequence. Sequences with amino acid substitutions are contemplated, as are sequences with a deletion, and sequences with a deletion and a substitution. In some embodiments, these cradle molecules may further include insertions or added amino acids.
[0104] Substitutional or replacement variants typically contain the exchange of one amino acid for another at one or more sites within the protein and may be designed to modulate one or more properties of the cradle molecule, particularly to increase its efficacy or specificity.
Substitutions of this kind may or may not be conservative substitutions. Conservative substitution is when one amino acid is replaced with one of similar shape and charge. Being that the libraries of variant Fnlll domains serves to provide a diversity of amino acid sequences and binding selectivity conservative substitutions are not required. However, if used, conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine. Changes other than those discussed above are generally considered not to be conservative substitutions. It is specifically contemplated that one or more of the conservative substitutions above may be included as embodiments. In other embodiments, such substitutions are specifically excluded. Furthermore, in additional embodiments, substitutions that are not conservative are employed in the variants.
[0105] In addition to a deletion or substitution, the cradle molecules may possess an insertion of one or more residues.
[0106] The variant Fnlll domain may be structurally equivalent to the native counterparts. For example, the variant Fnlll domain forms the appropriate structure and conformation for binding targets, proteins, or peptide segments.
[0107] The following is a discussion based upon changing of the amino acids of a cradle molecule to create a library of cradle molecules or a second-generation cradle molecule. For example, certain amino acids may be substituted for other amino acids in a cradle molecule without appreciable loss of function, such as ability to interact with a target peptide sequence. Since it is the interactive capacity and nature of a cradle molecule that defines that cradle molecule's functional activity, certain amino acid substitutions can be made in a cradle molecule sequence and nevertheless produce a cradle molecule with like properties.
[0108] In making such changes, the hydropathic index of amino acids may be considered. The importance of the hydropathic amino acid index in conferring interactive function on a protein is generally understood in the art (Kyte and Doolittle, J Mol Biol. (1982) 157(1): 105- 32). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
[0109] It also is understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity. U.S. Patent No. 4,554,101, incorporated herein by reference, states that the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein. As detailed in U.S. Patent No. 4,554,101, the following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 + 1); glutamate (+3.0 + 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5 + 1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (- 1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4).
[0110] It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still produce a biologically equivalent and immunologically equivalent protein. In such changes, the substitution of amino acids whose hydrophilicity values are within +2 is preferred, those that are within +1 are particularly preferred, and those within +0.5 are even more particularly preferred.
[0111] As outlined above, amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. However, in some aspects a non-conservative substitution is contemplated. In some embodiments a random substitution is also contemplated. Exemplary substitutions that take into consideration the various foregoing characteristics are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
[0112] Fnlll polypeptides can be modified by inserting or deleting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20 or more amino acids, or any range derivable therein, in an Fnlll loop or beta strand. Variants of the loop region are discussed in U.S. Patent No. 6,673,901 and U.S. Patent
Publication No. 20110038866, which are hereby incorporated by reference. [0113] In some embodiments the one or more amino acid substitution in beta strand C may be one or more amino acid substitution corresponding to position 30, 31, 32, 33, 34, 35, 36, 37, 38 and/or 39 of SEQ ID NO: 1. In some embodiments, the amino acid substitution in beta strand C may correspond to position 31, 33, 35, 37, 38 and/or 39 of SEQ ID NO: l. In some embodiments, the amino acid substitution in beta strand C may correspond to position 31 and/or 33 of SEQ ID NO: l.
[0114] In some embodiments the one or more amino acid substitution in CD loop may be one or more amino acid substitution corresponding to position 40, 41, 42, 43, 44 and/or 45 of SEQ ID NO: l.
[0115] In some embodiments, the one or more amino acid substitution in beta strand D may be one or more amino acid substitution corresponding to position 44, 45, 46, 47, 48, 49, 50 or 51 of SEQ ID NO: l. In some embodiments, the amino acid substitution in beta strand D may correspond to position 44, 45, 47, or 49 of SEQ ID NO: l.
[0116] In still a further aspect, the one or more amino acid substitution in beta strand F may be one or more amino acid substitution corresponding to position 67, 68, 69, 70, 71, 72, 73, 74, 75 and/or 76 of SEQ ID NO: 1. In some embodiments, the amino acid substitution in beta strand F may correspond to position 67, 69, 71, 73 and/or 76 of SEQ ID NO: l. In some embodiments, the amino acid substitution in beta strand F may correspond to position 71, 73, 75 and/or 76 of SEQ ID NO: l.
[0117] In some embodiments the one or more amino acid substitution in FG loop may be one or more amino acid substitution corresponding to position 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86 of SEQ ID NO: 1.
[0118] In some embodiments, the one or more amino acid substitution in beta strand G may be one or more amino acid substitution corresponding to position 85, 86, 87, 88, 89, 90, 91, 92, 93, or 94 of SEQ ID NO: l. In some embodiments, the amino acid substitution in beta strand G may correspond to position 84 or 85 of SEQ ID NO: 1.
[0119] The cradle molecules can include amino acid substitutions correspond to one or more amino acid substitutions at position 31, 33, 47, 49, 73, and/or 75 of SEQ ID NO: l. In some embodiments, the cradle molecule may further comprise an amino acid substitution corresponding to amino acid position 30 of SEQ ID NO:l. In some embodiments, the cradle molecule may comprise one or more amino acid substitution corresponding to amino acid position 41, 42, 43, 44, or 45 of SEQ ID NO: 1. The cradle molecule can further comprise one or more amino acid substitution corresponding to amino acid position 76, 77, 78, 79, 80, 81, 82, 83, 84, or 85 of SEQ ID NO: l. In one embodiment, the substitution may be in at least one beta strand. [0120] In some embodiments, the cradle molecule can comprise 1, 2, 3, 4 or more insertions and/or deletions of amino acids corresponding to amino acids of SEQ ID NO: l. Insertions can include, but are not limited to stretches of poly-serine, poly-alanine, poly- valine, poly-threonine, or polymers of any other of the 20 amino acids, that is subsequently mutagenized or diversified for generating a combinatorial cradle molecule library. Diversification of these inserted residues can include alteration to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 of the other natural amino acids. In some embodiments 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more contiguous amino acids are inserted into one or more of the beta strands (e.g., C and/or F) or AB, BC, CD, DE, EF, FG loops of an Fnlll domain cradle molecule. In some embodiments, the cradle molecule can comprise an insertion, a deletion, or both an insertion and a deletion. The insertion and deletion need not be located at the same position and may be located at sites distal or proximal to each other. The insertion and/or deletion can be in a loop or beta strands of the Fnlll domain polypeptide. In some embodiments, at least one loop region of Fnlll may comprise an insertion of at least 2 amino acids. In some embodiments, at least one region of Fnlll may comprise an insertion of 2 to 25 amino acids in at least one loop region. In some embodiments at least 2, 3, or more loop regions comprise an insertion. In some embodiments, the cradle molecule has at least one loop region of Fnlll may comprise a deletion of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids, including all values and ranges there between. In some embodiments, at least 2, 3, or 4 loop or beta strands, portions, or regions comprise a deletion of at least 1 amino acid. In some embodiments, the cradle molecule may comprise at least one insertion and one deletion in at least one loop and at least one beta strand. In some embodiments, the cradle molecule may comprise an insertion and a deletion in the same loop or beta strand region. In some
embodiments, the cradle molecule may comprise at least one insertion or deletion in at least one beta strand. In some embodiments, the cradle molecule may comprise at least one insertion or deletion in at least one beta strand and at least one loop region.
[0121] In some embodiments, variants in any one or more of positions that correspond with amino acid position 15, 16, 17, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 38, 39, 40, 41, 42, 43, 44, 45, 51, 52, 53, 54, 55, 56, 60, 61, 62, 63, 64, 65, 66, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 93, 95, and/or 96, including all ranges there between, can be specifically included in the claimed embodiments. In other embodiments, variants in any one or more of positions that correspond with amino acid position 15, 16, 17, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 38, 39, 40, 41, 42, 43, 44, 45, 51, 52, 53, 54, 55, 56, 60, 61, 62, 63, 64, 65, 66, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 93, 95, and/or 96, including all ranges there between, can be specifically excluded. In other embodiments, variants in any one or more of positions that correspond with amino acid position 32, 34, 36, 68, 70, 72, 74, and/or 75, including all ranges there between, can be specifically excluded. It will be understood that these recited positions are based on the sequence of the tenth domain in human Fnlll (SEQ ID NO: l). In some embodiments, the Fnlll domain may be the 1st, 2nd, 3rd, 4th, 5Λ, 6Λ, 7Λ, 8Λ, 9*, 10*, 11*, 12*, 13*, 14*, 15* or 16* Fnlll domain of human fibronectin. In some embodiments, the Fnlll domain may be the 7*, 10* or 14* Fnlll domain of human fibronectin. In some embodiments, the Fnlll variants in other organisms are also contemplated based on their alignment with human Fnlll.
[0122] In some embodiments the one or more amino acid substitution in beta strand C may be one or more amino acid substitution corresponding to position 33, 35, 37, 39, 40 and/or 41 of SEQ ID NO: 97. In some embodiments the one or more amino acid substitution in CD loop may be one or more amino acid substitution corresponding to position 42, 43, 44, 45, 46, 47 and/or 48 of SEQ ID NO: 97. In some embodiments, the amino acid substitution in beta strand F may correspond to position 70, 72, 74, 76 and/or 79 of SEQ ID NO:97. In some embodiments the one or more amino acid substitution in FG loop may be one or more amino acid substitution corresponding to position 80, 81, 82, 83, 84 and/or 85 of SEQ ID NO:97.
[0123] In some embodiments the one or more amino acid substitution in beta strand C may be one or more amino acid substitution corresponding to position 31, 33, 35, 37 and/or 39 of SEQ ID NO: 129. In some embodiments the one or more amino acid substitution in CD loop may be one or more amino acid substitution corresponding to position 40, 41, 42, 43 and/or 44 of SEQ ID NO: 129. In some embodiments, the amino acid substitution in beta strand F may correspond to position 66, 68, 70, 72 and/or 75 of SEQ ID NO: 129. In some embodiments the one or more amino acid substitution in FG loop may be one or more amino acid substitution corresponding to position 76, 77, 78, 79, 80 and/or 81 of SEQ ID NO: 129.
[0124] In other embodiments, variants in any one or more of positions that correspond with amino acid position 34, 36, 38, 71, 73, 75, 77 and/or 78 of SEQ ID NO:97, including all ranges there between, can be specifically excluded. In other embodiments, variants in any one or more of positions that correspond with amino acid position 332, 34, 36, 38, 67, 69, 71, 73 and/or 74 of SEQ ID NO: 129, including all ranges there between, can be specifically excluded.
[0125] In some embodiments one or more of the altered or variant amino acids may correspond to position 30, 31, 33, 49, 47, 75, 76, 84, and/or 85 of SEQ ID NO: l. In some embodiments, the variant Fnlll domains may comprise an insertion or deletion of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 amino acids in at least one beta strand and at least one loop region of Fnlll. In some embodiments, the variant Fnlll domains may comprise an amino acid insertion in loop CD, FG and/or a combination of CD and FG loops and at least one beta strand with a substitution, deletion or addition. In some embodiments, the variant Fnlll domains may comprise an amino acid insertion in loop BC, FG and/or a combination of BC and FG loops and at least one beta strand with a substitution, deletion, or addition. In some embodiments, the polypeptide may be at least 50%, 60%, 70%, 80%, or 90%, including all values and ranges there between, identical to SEQ ID NOs: 1, 97 and 129.
[0126] In some embodiments, Fnlll cradle molecules may have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions that may include, but are not limited to the following Fnlll residue substitutions (corresponding to SEQ ID NO: l): R30A, R30N, R30D, R30C, R30Q, R30E, R30G, R30H, R30I, R30L, R30K, R30M, R30F, R30P, R30S, R30T, R30W, R30Y, R30V, Y31A, Y31R, Y31N, Y31D, Y31C, Y31Q, Y31E, Y31G, Y31H, Y31I, Y31L, Y31K, Y31M, Y31F, Y31P, Y31S, Y31T, Y31W, Y31V, R33A, R33N, R33D, R33C, R33Q, R33E, R33G, R33H, R33I, R33L, R33K, R33M, R33F, R33P, R33S, R33T, R33W, R33Y, R33V, T35A, T35R, T35N, T35D, T35C, T35Q, T35E, T35G, T35H, T35I, T35L, T35K, T35M, T35F, T35P, T35S, T35W, T35Y, T35V, G37A, G37N, G37R, G37D, G37C, G37Q, G37E, G37H, G37I, G37L, G37K, G37M, G37F, G37P, G37S, G37T, G37W, G37Y, G37V, E38A, E38N, E38R, E38D, E38C, E38Q, E38G, E38H, E38I, E38L, E38K, E38M, E38F, E38P, E38S, E38T, E38W, E38Y, E38V, T39A, T39N, T39R, T39D, T39C, T39Q, T39E, T39G, T39H, T39I, T39L, T39K, T39M, T39F, T39P, T39S, T39W, T39Y, T39V, G40A, G40N, G40R, G40D, G40C, G40Q, G40E, G40H, G40I, G40L, G40K, G40M, G40F, G40P, G40S, G40T, G40W, G40Y, G40V, G41A, G41R, G41N, G41D, G41C, G41Q, G41E, G41H, G41I, G41L, G41K, G41M, G41F, G41P, G41S, G41T, G41W, G41Y, G41V, N42A, N42R, N42D, N42C, N42Q, N42E, N42G, N42H, N42I, N42L, N42K, N42M, N42F, N42P, N42S, N42T, N42W, N42Y, N42V, S43A, S43R, S43N, S43D, S43C, S43Q, S43E, S43G, S43H, S43I, S43L, S43K, S43M, S43F, S43P, S43T, S43W, S43Y, S43V, P44A, P44R, P44N, P44D, P44C, P44Q, P44E, P44G, P44H, P44I, P44L, P44K, P44M, P44F, P44S, P44T, P44W, P44Y, P44V, V45A, V45R, V45N, V45D, V45C, V45Q, V45E, V45G, V45H, V45I, V45L, V45K, V45M, V45F, V45P, V45S, V45T, V45W, V45Y, E47A, E47R, E47N, E47D, E47C, E47Q, E47G, E47H, E47I, E47L, E47K, E47M, E47F, E47P, E47S, E47T, E47W, E47Y, E47V, T49A, T49R, T49N, T49D, T49C, T49Q, T49E, T49G, T49H, T49I, T49L, T49K, T49M, T49F, T49P, T49S, T49W, T49Y, T49V, V50A, V50R, V50N, V50D, V50C, V50Q, V50E, V50G, V50H, V50I, V50L, V50K, V50M, V50F, V50P, V50S, V50T, V50W, V50Y, D67A, D67R, D67N, D67C, D67Q, D67E, D67G, D67H, D67I, D67L, D67K, D67M, D67F, D67P, D67S, D67T, D67W, D67Y, D67V, T69A, T69R, T69N, T69D, T69C, T69Q, T69E, T69G, T69H, T69I, T69L, T69K, T69M, T69F, T69P, T69S, T69W, T69Y, T69V, T71A, T71R, T71N, T71D, T71C, T71Q, T71E, T71G, T71H, T71I, T71L, T71K, T71M, T71F, T71P, T71S, T71W, T71Y, T71V, Y73A, Y73R, Y73N, Y73D, Y73C, Y73Q, Y73E, Y73G, Y73H, Y73I, Y73L, Y73K, Y73M, Y73F, Y73P, Y73S, Y73T, Y73W, Y73V, V75A, V75R, V75N, V75D, V75C, V75Q, V75E, V75G, V75H, V75I, V75L, V75K, V75M, V75F, V75P, V75S, V75T, V75W, V75Y, T76A, T76R, T76N, T76D, T76C, T76Q, T76E, T76G, T76H, T76I, T76L, T76K, T76M, T76F, T76P, T76S, T76W, T76Y, T76V, G77A, G77R, G77N, G77D, G77C, G77Q, G77E, G77H, G77I, G77L, G77K, G77M, G77F, G77P, G77S, G77T, G77W, G77Y, G77V, R78A, R78N, R78D, R78C, R78Q, R78E, R78G, R78H, R78I, R78L, R78K, R78M, R78F, R78P, R78S, R78T, R78W, R78Y, R78V, G79A, G79R, G79N, G79D, G79C, G79Q, G79E, G79H, G79I, G79L, G79K, G79M, G79F, G79P, G79S, G79T, G79W, G79Y, G79V, D80A, D80R, D80N, D80C, D80Q, D80E, D80G, D80H, D80I, D80L, D80K, D80M, D80F, D80P, D80S, D80T, D80W, D80Y, D80V, S81A, S81R, S81N, S81D, S81C, S81Q, S81E, S81G, S81H, S81I, S81L, S81K, S81M, S81F, S81P, S81T, S81W, S81Y, S81V, P82A, P82R, P82N, P82D, P82C, P82Q, P82E, P82G, P82H, P82I, P82L, P82K, P82M, P82F, P82S, P82T, P82W, P82Y, P82V, A83R, A83N, A83D, A83C, A83Q, A83E, A83G, A83H, A83I, A83L, A83K, A83M, A83F, A83P, A83S, A83T, A83W, A83Y, A83V, S84A, S84R, S84N, S84D, S84C, S84Q, S84E, S84G, S84H, S84I, S84L, S84K, S84M, S84F, S84P, S84T, S84W, S84Y, S84V, S85A, S85R, S85N, S85D, S85C, S85Q, S85E, S85G, S85H, S85I, S85L, S85K, S85M, S85F, S85P, S85T, S85W, S85Y, S85V, K86A, K86R, K86N, K86D, K86C, K86Q, K86E, K86G, K86H, K86I, K86L, K86M, K86F, K86P, K86S, K86T, K86W, K86Y, and K86V.
[0127] In still further embodiments other amino acid substitutions can be introduced before, during, or after introduction of those amino acid substitutions listed above. The other substitutions (corresponding to SEQ ID NO: l) may include, but is not limited to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 of W22A, W22R, W22N, W22D, W22C, W22Q, W22E, W22G, W22H, W22I, W22L, W22K, W22M, W22F, W22P, W22S, W22T, W22Y, W22V, D23A, D23R, D23N, D23C, D23Q, D23E, D23G, D23H, D23I, D23L, D23K, D23M, D23F, D23P, D23S, D23T, D23W, D23Y, D23V, A24R, A24N, A24D, A24C, A24Q, A24E, A24G, A24H, A24I, A24L, A24K, A24M, A24F, A24P, A24S, A24T, A24W, A24Y, A24V, P25A, P25R, P25N, P25D, P25C, P25Q, P25E, P25G, P25H, P25I, P25L, P25K, P25M, P25F, P25S, P25T, P25W, P25Y, P25V, A26R, A26N, A26D, A26C, A26Q, A26E, A26G, A26H, A26I, A26L, A26K, A26M, A26F, A26P, A26S, A26T, A26W, A26Y, A26V, V27A, V27R, V27N, V27D, V27C, V27Q, V27E, V27G, V27H, V27I, V27L, V27K, V27M, V27F, V27P, V27S, V27T, V27W, V27Y, T28A, T28R, T28N, T28D, T28C, T28Q, T28E, T28G, T28H, T28I, T28L, T28K, T28M, T28F, T28P, T28S, T28W, T28Y, T28V, V29A, V29R, V29N, V29D, V29C, V29Q, V29E, V29G, V29H, V29I, V29L, V29K, V29M, V29F, V29P, V29S, V29T, V29W, V29Y, G52A, G52R, G52N, G52D, G52C, G52Q, G52E, G52H, G52I, G52L, G52K, G52M, G52F, G52P, G52S, G52T, G52W, G52Y, G52V, S53A, S53R, S53N, S53D, S53C, S53Q, S53E, S53G, S53H, S53I, S53L, S53K, S53M, S53F, S53P, S53T, S53W, S53Y, S53V, K54A, K54R, K54N, K54D, K54C, K54Q, K54E, K54G, K54H, K54I, K54L, K54M, K54F, K54P, K54S, K54T, K54W, K54Y, K54V, S55A, S55R, S55N, S55D, S55C, S55Q, S55E, S55G, S55H, S55I, S55L, S55K, S55M, S55F, S55P, S55T, S55W, S55Y, or S55V.
[0128] In some embodiments, Fnlll cradle molecules may have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions that may include, but are not limited to the following Fnlll residue substitutions (corresponding to SEQ ID NO:97): G33A, G33N, G33R, G33D, G33C, G33Q, G33E, G33H, G33I, G33L, G33K, G33M, G33F, G33P, G33S, G33T, G33W, G33Y, G33V, R35A, R35N, R35D, R35C, R35Q, R35E, R35G, R35H, R35I, R35L, R35K, R35M, R35F, R35P, R35S, R35T, R35W, R35Y, R35V, T37A, T37R, T37N, T37D, T37C, T37Q, T37E, T37G, T37H, T37I, T37L, T37K, T37M, T37F, T37P, T37S, T37W, T37Y, T37V, T39A, T39N, T39R, T39D, T39C, T39Q, T39E, T39G, T39H, T39I, T39L, T39K, T39M, T39F, T39P, T39S, T39W, T39Y, T39V, P40A, P40R, P40N, P40D, P40C, P40Q, P40E, P40G, P40H, P40I, P40L, P40K, P40M, P40F, P40S, P40T, P40W, P40Y, P40V, T41A, T41R, T41N, T41D, T41C, T41Q, T41E, T41G, T41H, T41I, T41L, T41K, T41M, T41F, T41P, T41S, T41W, T41Y, T41V, N42A, N42R, N42D, N42C, N42Q, N42E, N42G, N42H, N42I, N42L, N42K, N42M, N42F, N42P, N42S, N42T, N42W, N42Y, N42V, G43A, G43N, G43R, G43D, G43C, G43Q, G43E, G43H, G43I, G43L, G43K, G43M, G43F, G43P, G43S, G43T, G43W, G43Y, G43V, Q44A, Q44R, Q44N, Q44D, Q44C, Q44E, Q44G, Q44H, Q44I, Q44L, Q44K, Q44M, Q44F, Q44P, Q44S, Q44T, Q44W, Q44Y, Q44V, Q45A, Q45R, Q45N, Q45D, Q45C, Q45E, Q45G, Q45H, Q45I, Q45L, Q45K, Q45M, Q45F, Q45P, Q45S, Q45T, Q45W, Q45Y, Q45V, G46A, G46R, G46N, G46D, G46C, G46Q, G46E, G46H, G46I, G46L, G46K, G46M, G46F, G46P, G46S, G46T, G46W, G46Y, G46V, N47A, N47R, N47D, N47C, N47Q, N47E, N47G, N47H, N47I, N47L, N47K, N47M, N47F, N47P, N47S, N47T, N47W, N47Y, N47V, S48A, S48R, S48N, S48D, S48C, S48Q, S48E, S48G, S48H, S48I, S48L, S48K, S48M, S48F, S48P, S48T, S48W, S48Y, S48V, E70A, E70R, E70N, E70D, E70C, E70Q, E70G, E70H, E70I, E70L, E70K, E70M, E70F, E70P, E70S, E70T, E70W, E70Y, E70V, N72A, N72R, N72D, N72C, N72Q, N72E, N72G, N72H, N72I, N72L, N72K, N72M, N72F, N72P, N72S, N72T, N72W, N72Y, N72V, S74A, S74R, S74N, S74D, S74C, S74Q, S74E, S74G, S74H, S74I, S74L, S74K, S74M, S74F, S74P, S74T, S74W, S74Y, S74V, Y76A, Y76R, Y76N, Y76D, Y76C, Y76Q, Y76E, Y76G, Y76H, Y76I, Y76L, Y76K, Y76M, Y76F, Y76P, Y76S, Y76T, Y76W, Y76V, K79A, K79R, K79N, K79D, K79C, K79Q, K79E, K79G, K79H, K79I, K79L, K79M, K79F, K79P, K79S, K79T, K79W, K79Y, K79V, D80A, D80R, D80N, D80C, D80Q, D80E, D80G, D80H, D80I, D80L, D80K, D80M, D80F, D80P, D80S, D80T, D80W, D80Y, D80V, D81A, D81R, D81N, D81C, D81Q, D81E, D81G, D81H, D81I, D81L, D81K, D81M, D81F, D81P, D81S, D81T, D81W, D81Y, D81V, K82A, K82R, K82N, K82D, K82C, K82Q, K82E, K82G, K82H, K82I, K82L, K82M, K82F, K82P, K82S, K82T, K82W, K82Y, K82V, E83A, E83R, E83N, E83D, E83C, E83Q, E83G, E83H, E83I, E83L, E83K, E83M, E83F, E83P, E83S, E83T, E83W, E83Y, E83V, S84A, S84R, S84N, S84D, S84C, S84Q, S84E, S84G, S84H, S84I, S84L, S84K, S84M, S84F, S84P, S84T, S84W, S84Y, S84V, V85A, V85R, V85N, V85D, V85C, V85Q, V85E, V85G, V85H, V85I, V85L, V85K, V85M, V85F, V85P, V85S, V85T, V85W, and V85Y.
[0129] In some embodiments, Fnlll cradle molecules may have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions that may include, but are not limited to the following Fnlll residue substitutions (corresponding to SEQ ID NO: 129): G31A, G31N, G31R, G31D, G31C, G31Q, G31E, G31H, G31I, G31L, G31K, G31M, G31F, G31P, G31S, G31T, G31W, G31Y, G31V, Q33A, Q33R, Q33N, Q33D, Q33C, Q33E, Q33G, Q33H, Q33I, Q33L, Q33K, Q33M, Q33F, Q33P, Q33S, Q33T, Q33W, Q33Y, Q33V, D35A, D35R, D35N, D35C, D35Q, D35E, D35G, D35H, D35I, D35L, D35K, D35M, D35F, D35P, D35S, D35T, D35W, D35Y, D35V, V37A, V37R, V37N, V37D, V37C, V37Q, V37E, V37G, V37H, V37I, V37L, V37K, V37M, V37F, V37P, V37S, V37T, V37W, V37Y, A39N, A39R, A39D, A39C, A39Q, A39E, A39G, A39H, A39I, A39L, A39K, A39M, A39F, A39P, A39S, A39T, A39W, A39Y, A39V, N40A, N40R, N40D, N40C, N40Q, N40E, N40G, N40H, N40I, N40L, N40K, N40M, N40F, N40P, N40S, N40T, N40W, N40Y, N40V, G41A, G41R, G41N, G41D, G41C, G41Q, G41E, G41H, G41I, G41L, G41K, G41M, G41F, G41P, G41S, G41T, G41W, G41Y, G41V, Q42A, Q42R, Q42N, Q42D, Q42C, Q42E, Q42G, Q42H, Q42I, Q42L, Q42K, Q42M, Q42F, Q42P, Q42S, Q42T, Q42W, Q42Y, Q42V, T43A, T43R, T43N, T43D, T43C, T43Q, T43E, T43G, T43H, T43I, T43L, T43K, T43M, T43F, T43P, T43S, T43W, T43Y, T43V, P44A, P44R, P44N, P44D, P44C, P44Q, P44E, P44G, P44H, P44I, P44L, P44K, P44M, P44F, P44S, P44T, P44W, P44Y, P44V, D66A, D66R, D66N, D66C, D66Q, D66E, D66G, D66H, D66I, D66L, D66K, D66M, D66F, D66P, D66S, D66T, D66W, D66Y, D66V, K68A, K68R, K68N, K68D, K68C, K68Q, K68E, K68G, K68H, K68I, K68L, K68M, K68F, K68P, K68S, K68T, K68W, K68Y, K68V, Y70A, Y70R, Y70N, Y70D, Y70C, Y70Q, Y70E, Y70G, Y70H, Y70I, Y70L, Y70K, Y70M, Y70F, Y70P, Y70S, Y70T, Y70W, Y70V, Y72A, Y72R, Y72N, Y72D, Y72C, Y72Q, Y72E, Y72G, Y72H, Y72I, Y72L, Y72K, Y72M, Y72F, Y72P, Y72S, Y72T, Y72W, Y72V, N75A, N75R, N75D, N75C, N75Q, N75E, N75G, N75H, N75I, N75L, N75K, N75M, N75F, N75P, N75S, N75T, N75W, N75Y, N75V, D76A, D76R, D76N, D76C, D76Q, D76E, D76G, D76H, D76I, D76L, D76K, D76M, D76F, D76P, D76S, D76T, D76W, D76Y, D76V, N77A, N77R, N77D, N77C, N77Q, N77E, N77G, N77H, N77I, N77L, N77K, N77M, N77F, N77P, N77S, N77T, N77W, N77Y, N77V, A78R, A78N, A78D, A78C, A78Q, A78E, A78G, A78H, A78I, A78L, A78K, A78M, A78F, A78P, A78S, A78T, A78W, A78Y, A78V, R79A, R79N, R79D, R79C, R79Q, R79E, R79G, R79H, R79I, R79L, R79K, R79M, R79F, R79P, R79S, R79T, R79W, R79Y, R79V, S80A, S80R, S80N, S80D, S80C, S80Q, S80E, S80G, S80H, S80I, S80L, S80K, S80M, S80F, S80P, S80T, S80W, S80Y, S80V, S81A, S81R, S81N, S81D, S81C, S81Q, S81E, S81G, S81H, S81I, S81L, S81K, S81M, S81F, S81P, S81T, S81W, S81Y, and S81V.
[0130] The cradle molecule can further comprise a second Fnlll domain that may or may not have been selected for affinity to a particular target. The second Fnlll domain may or may not contain additional amino acid variations or diversification. In other aspects, the cradle molecule can further comprise a non-FnIII polypeptide that enhances the Fnlll polypeptide binding affinity for a target molecule. The non-FnIII polypeptide may incldue additional variations or diversification that enhances or increases the cradle molecule binding affinity for another target molecule such as a half-life extender, e.g., HSA. The non-FnIII polypeptide can include, but is not limited to domains involved in phospho-tyrosine binding (e.g., SH2, PTB), phospho-serine binding (e.g., UIM, GAT, CUE, BTB/POZ, VHS, UBA, RING, HECT, WW, 14-3- 3, Polo-box), phospho-threonine binding (e.g., FHA, WW, Polo-box), proline-rich region binding (e.g., EVH1 , SH3, GYF), acetylated lysine binding (e.g., Bromo), methylated lysine binding (e.g., Chromo, PHD), apoptosis (e.g., BIR, TRAF, DED, Death, CARD, BH), cytoskeleton modulation (e.g., ADF, GEL, DH, CH, FH2), or other cellular functions (e.g., EH, CC, VHL, TUDOR, PUF Repeat, PAS, MH1 , LRR1 IQ, HEAT, GRIP, TUBBY, SNARE, TPR, TIR, START, SOCS Box, SAM, RGS, PDZ, PB 1 , LEVI, F-BOX, ENTH, EF-Hand, SHADOW, ARM, ANK).
Multispecific Fnlll Domain Cradle Molecules
[0131] In another aspect, the invention provides multispecific cradle molecules which comprise two or more individual cradle molecules linked together (e.g. , genetically or chemically). The multispecific cradle molecules comprise at least one cradle molecule that uses at least one beta strand to bind to a target.
[0132] In one embodiment, the multispecific cradle molecule comprises two or more individual cradle molecules linked, in pearl-like fashion, wherein each individual cradle molecule binds to a specific target. Such targets can be present on the same molecule or on different molecules, such that the different molecules become juxtaposed by the binding of the multispecific cradle molecule. The targets can also be identical, such that the multispecific cradle molecule is able to cluster target molecules, in a similar way to an antibody. Avidity is also increased by binding to the same target molecule with two binding sites on the
multispecific cradle molecule capable of independently binding to different regions of the target molecule.
[0133] A number of individual cradle molecules can be incorporated into the multispecific cradle molecules, for example, at least 2, 3, 4, 5, 6, 7, 8, 9, 10, or more individual cradle molecules.
[0134] Multispecific cradle molecules can be produced using art recognized methods. For example, cradle molecules may be linked genetically, such that multispecific cradle molecules are expressed as a single polypeptide. This linkage may be direct or conferred by an additional amino acid "linker" sequence. Suitable non-limiting methods and linkers are described, for example, in U.S. Patent Publication No. 20060286603 and Patent Cooperation Treaty
Publication No. WO04041862A2. Exemplary polypeptide linkers include, but are not limited to, GS linkers, such as GGGGSGGGGS (SEQ ID NO: 471), GSGSGSGSGS (SEQ ID NO: 472), PSTSTST (SEQ ID NO: 473), and EIDKPSQ (SEQ ID NO: 474), and multimers thereof.
[0135] The multispecific cradle molecules generated using linker sequences have an improved steric hinderance for binding to target molecules, thus enabling shorter linker sequences to be used to link two or more individual cradle molecules together. Shorter linker sequences cause less immunogenic responses and are less likely to get cleaved.
[0136] Alternatively, multispecific cradle molecules can be prepared by chemically conjugating the individual cradle molecules using methods known in the art. A variety of coupling or cross-linking agents can be used for covalent conjugation. Examples of cross- linking agents include, e.g. , protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5,5'-dithiobis(2-nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N- succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N- maleimidomethyl) cyclohaxane-l-carboxylate (sulfo-SMCC) (see e.g. , Karpovsky et al. (1984) /. Exp. Med. 160: 1686; Liu, MA et al. (1985) Proc. Natl. Acad. Sci. U.S.A 82:8648). Other methods include those described in Paulus (1985) Behring Ins. Mitt. No. 78: 118-132; Brennan et al. (1985) Science 229:81-83, and Glennie et al. (1987) /. Immunol. 139: 2367-2375.
Preferred conjugating agents are SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, IL). Cysteine residues can be introduced into the Fnlll domain variants at specific positions and then crosslink with reagents to sulfhydryl such as DPDPB or DTME (available from Pierce) to link two individual cradle molecules together to form a multispecific cradle molecule. Methods for Grafting CDRs onto Fn!II Cradle Molecules
[0137] In one aspect, the present invention features an Fnlll cradle molecule altered compared to the wild-type Fnlll domain to contain all or a portion of a complementarity determining region (CDR) of an antibody or a T-cell receptor.
[0138] The CDR regions of any antibody or T-cell receptor variable region, or antigen binding fragments thereof, are suitable for grafting. The CDRs can be obtained from the antibody or T-cell receptor repertoire of any animal including, but not limited to, rodents, primates, camelids or sharks. In a one embodiment, the CDRs are obtained from CDR1, CDR2 and CDR3 of a single domain antibody, for example a nanobody. In a more specific embodiment, CDR1, 2 or 3 of a single domain antibody, such as a nanobody, are grafted into any of the AB, BC, CD, DE, EF or FG loops of an Fnlll domain, thereby providing target binding specificity of the original nanobody to the cradle molecule. In one embodiment, the CDR is heavy chain CDR3. In one embodiment, the CDR is grafted into the FG loop.
Engineered libraries of camelid antibodies and antibody fragments are commercially available, for example, from Ablynx, Ghent, Belgium. The antibody repertoire can be from animals challenged with one or more antigens or from naive animals that have not been challenged with antigen. Additionally or alternatively, CDRs can be obtained from antibodies, or antigen binding fragments thereof, produced by in vitro or in vivo library screening methods, including, but not limited to, in vitro polysome or ribosome display, phage display or yeast display techniques. This includes antibodies not originally generated by in vitro or in vivo library screening methods but which have subsequently undergone mutagenesis or one or more affinity maturation steps using in vitro or in vivo screening methods. Example of such in vitro or in vivo library screening methods or affinity maturation methods are described, for example, in U.S. Patent Nos. 7,195,880; 6,951,725; 7,078,197; 7,022,479; 5,922,545; 5,830,721; 5,605,793, 5,830,650; 6,194,550; 6,699,658; 7,063,943; 5866344 and Patent Cooperation Treaty
Publication No. WO06023144.
[0139] Methods to identify antibody CDRs are well known in the art (see Kabat et al. , U.S. Dept. of Health and Human Services, "Sequences of Proteins of Immunological Interest" (1983); Chothia et al , (1987) /. Mol. Biol. 196:901-917; MacCallum et al , (1996) /. Mol. Biol. 262:732-745). The nucleic acid encoding a particular antibody can be isolated and sequenced, and the CDR sequences deduced by inspection of the encoded protein with regard to the established antibody sequence nomenclature. Methods for grafting hypervariable regions or CDRs into Fnlll include, for example, genetic engineering, de novo nucleic acid synthesis or PCR-based gene assembly (see, e.g. , U.S. Patent No. 5,225.539). [0140] The above techniques allow for the identification of a suitable loop for selection and presentation of a hypervariable region or CDR, e.g. , the FG loop. However, additional metrics can be invoked to further improve the fit and presentation of the hypervariable region based on structural modeling of the Fnlll domain and the donor antibody.
[0141] In one aspect, specific amino acid residues in any of the beta-strands of an Fnlll domain are mutated to allow the CDR loops to adopt a conformation that retains or improves binding to antigen. This procedure can be performed in an analogous way to that CDR grafting into a heterologous antibody framework, using a combination of structural modeling and sequence comparison. In one embodiment, the Fnlll domain residues adjacent to a CDR are mutated in a similar manner to that performed by Queen et al. (see U.S. Patent Nos. 6,180,370; 5,693,762; 5,693,761; 5,585,089; 7,022,500). In another embodiment, Fnlll domain residues within one Van der Waals radius of CDR residues are mutated in a similar manner to that performed by Winter et al. (see U.S. Patent Nos. 6,548,640; 6,982,321). In another embodiment, Fnlll domain residues that are non-adjacent to CDR residues but are predicted, based upon structural modeling of the Fnlll domain and the donor antibody, to modify the conformation of CDR residues are mutated in a similar manner to that performed by Carter et al. or Adair et al (see U.S. Patent Nos. 6,407,213; 6,639,055; 5,859,205; 6,632,927).
IV. Fnlll Cradle Libraries
[0142] The ability to generate novel binding proteins capable of interacting with other proteins with high-affinity and specificity is important in biotechnology, medicine and molecular biology. Such designed binding proteins can be used in numerous applications. They can be used to bind a target protein, label a protein of interest for detection and visualization, to purify a target protein from a complex mixture or to functionally perturb a target by blocking a functional site.
[0143] Combinatorial methods are effective platforms for the production of novel binding proteins. In these methods, large libraries of protein variants are created by introducing a large amount of sequence diversity and sometimes structural diversity into a contiguous surface in a protein scaffold. The central idea in combinatorial approaches is to create a sufficiently diverse repertoire of candidate binding surfaces that vary in shape and chemical character. Variants capable of binding a target of interest can then be isolated using various selection methods.
[0144] Though powerful, a significant limitation of combinatorial systems is their limited sampling capacity. For instance, phage display libraries are generally limited to approximately 1010 members. Considering a small binding surface consisting of 15 positions in a protein scaffold, if all 15 positions are varied to all 20 amino acids, this gives 2015 or 3 x 1019 theoretical sequence combinations. Thus, only a very small percentage of the possible binding site configurations would actually be sampled in the library. Since discovery of a binding surface suitable for a given target is already likely to be a rare event, the sampling limitations of combinatorial methods make isolation of functional binding proteins a difficult and unlikely task.
[0145] Several strategies have been explored for combating the sampling problem in combinatorial libraries. The most widely used approach is to couple simple library selection with so-called affinity maturation strategies. Usually, these strategies involve introduction of additional sequence diversity into the protein population at various stages during the selection process to effectively increase sampling capacity. The idea in such approaches is to first recover hits from an under-sampled library, then introduce point mutations to gradually optimize these clones for increased affinity. These approaches have been used successfully in a variety of systems. However, in most cases, the introduced mutations are random in terms of their positions and amino acid types. Thus, while this strategy has proven effective, the likelihood of accumulating productive mutations is very low. As a result, such methods often require several rounds of additional selection for affinity maturation after initial hits are recovered and effective binders are not always produced.
[0146] Another type of strategy for combating the sampling problem in combinatorial methods involves focusing the sequence and structural properties of the binding site library toward those likely to be useful for binding to a target-type of interest. These strategies are based on structural information (both primary and tertiary) of existing binding molecules. This approach has been explored in synthetic antibodies with the creation of peptide-targeted and small molecule hapten targeted libraries (Cobaugh, et ah , J. Mol. Biol. (2008) 378:622-633; Persson, et ah , J. Mol. Biol. (2006) 357:607-620). In each of these examples, antibody complementarity determining region (CDR) lengths were chosen that are frequently observed in peptide- or small molecule -binding antibodies. These structural features are pre-encoded in the antibody binding site, and then sequence diversity is introduced in this context using amino acid types frequently observed in antibodies recognizing the target-type of interest. In this way, a proven useful architecture is simply "reprogrammed" to recognize another molecule with similar characteristics.
[0147] In embodiments discussed herein, an Fnlll domain is used as a basis for generating a combinatorial library of protein binding domains.
[0148] Artificial antibody scaffolds that bind specific ligands are becoming legitimate alternatives to antibodies generated using traditional techniques, in part because antibodies can be difficult and expensive to produce. The limitations of antibodies have spurred the development of alternative binding proteins based on immunoglobulin like folds or other protein topologies. These non-antibody scaffold share the general quality of having a structurally stable framework core that is tolerant to multiple substitutions in other parts of the protein.
[0149] The present invention provides a library of Fnlll cradle molecules that use the CD and the FG loops of Fnlll domains together with the surface exposed residues of the beta- strands. The proposed library, referred to as the "cradle library" herein, will increase the surface area available for binding over the traditional previously disclosed top and bottom side libraries. Furthermore, loops FG and CD are highly variable in natural occurring fibronectins and can be randomized without restrictions both in composition and loop length. This will enable a highly diverse library without generating instable molecules which should overcome some of the restrictions in the traditional libraries previously disclosed. Additionally, surface exposed beta sheet residues will also be randomized to generate a large cradle-like surface to be available for binding to target proteins.
[0150] By creating artificial diversity, the library size can be controlled so that they can be readily screened using, for example, high throughput methods to obtain new therapeutics. The Fnlll cradle library with bottom and top side loop regions and the surface exposed residues of the beta-sheets can be screened using positive physical clone selection by FACS, phage panning or selective ligand retention. These in vitro screens bypass the standard and tedious methodology inherent in generating an antibody hybridoma library and supernatant screening.
[0151] Furthermore, the Fnlll cradle library with the bottom and top loop regions (CD and FG, respectively) and the surface exposed residues of the beta-sheets has the potential to recognize any target as the constituent amino acids in the target binding loop are created by in vitro diversity techniques. This produces the significant advantages of the library controlling diversity size and the capacity to recognize self antigens. Still further, the Fnlll cradle library with the bottom and top side loop regions (CD and FG) and the surface exposed residues of the beta-sheets can be propagated and re-screened to discover additional fibronectin binding domains against other desired targets.
[0152] A combinatorial library is a collection of diverse compounds generated by either chemical synthesis or biological synthesis by combining a number of chemical "building blocks." For example, a linear combinatorial chemical library such as a polypeptide (e.g., mutein or variant) library is formed by combining a set of chemical building blocks called amino acids in every possible way for a given compound length. Millions of compounds can be synthesized through such combinatorial mixing of chemical building blocks. For example, one commentator has observed that the systematic, combinatorial mixing of 100 interchangeable chemical building blocks results in the theoretical synthesis of 100 million tetrameric compounds or 10 billion pentameric compounds (Gallop, et ah , J. Med. Chem. (1994)
37: 1233-1250).
[0153] Embodiments of the invention are directed to a combinatorial library of Fnlll domains. In some embodiments, polypeptides of the library include variations of amino acid sequence in one or more of the beta strands of the Fnlll domains. In some embodiments, the library includes variations of amino acid sequences in one or more loops of the Fnlll domains. In some embodiments, the library includes variation in both loops and beta strands of the Fnlll domain. Libraries can be generated using (i) a directed approach; and (ii) a random approach, both of which are illustrated in the Examples.
Universal Mutagenesis Cradle Libraries
[0154] The present invention pertains to a mutagenesis cradle library of Fnlll domain polypeptides useful in screening for the presence of one or more polypeptides having a selected binding or enzymatic activity. The library polypeptides include (a) regions A, AB, B, BC, C, CD, D, E, EF, F, FG, and G having wildtype amino acid sequences of a selected native Fnlll domain polypeptide or polypeptides, (b) beta- strands C and F and loop regions CD and FG having one or more selected lengths. At least one selected beta-strand or loop region of a selected length contains a library of sequences encoded by a library of coding sequences that encode, at each beta-strand or loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has a occurrence frequency equal to or less than a selected threshold frequency of at least 50%, a single common target amino acid and any co- produced amino acids (amino acids produced by the coding sequences at a given position as a result of codon degeneracy).
[0155] In constructing a library within a given loop/strand of a given loop/strand length, the variability profile is used to define a sequence of fixed and "variable" positions, i.e. , positions at which a target amino acid can be introduced. The number of fixed positions will depend on the selected threshold frequency for the consensus amino acid at each position.
[0156] Once the beta-strand and loop sequences are selected, a library of coding-sequence oligonucleotides encoding all of the identified sequences is constructed, making codon substitutions as shown that are effective to preserve the existing consensus amino acid, but also encode the selected target amino acid, and any other co-product amino acids encoded by degenerate codons.
[0157] The library of coding sequences for the beta strands and loops is added to the framework sequences, to construct the library of coding sequences for the polypeptide libraries. The library of polypeptides may be encoded by an expression library format that includes a ribosome display library, a polysome display library, a phage display library, a bacterial expression library, or a yeast display library.
[0158] The libraries may be used in a method of identifying a polypeptide having a desired binding affinity, in which the natural- variant combinatorial library are screened to select for an Fnlll domain having a desired binding affinity. The same methodology can be used to generate Fnlll libraries using any combination of beta sheets and top and bottom loop regions.
Natural-Variant Combinatorial Cradle Library
[0159] Further provided is a natural-variant combinatorial cradle library of Fnlll polypeptides useful in screening for the presence of one or more polypeptides having a selected binding or enzymatic activity. The cradle library polypeptides include (a) regions A, AB, B,
BC, C, CD, D, DE, E, EF, F, FG and G having wildtype amino acid sequences of a selected native Fnlll polypeptide or polypeptides, and (b) beta-strands C and F and loop regions CD and
FG having selected lengths. At least one selected beta strand or loop region of a selected length contains a library of natural-variant combinatorial sequences expressed by a library of coding sequences that encode at each loop position, a conserved or selected semi-conserved consensus amino acid and, if the consensus amino acid has a frequency of occurrence equal to or less than a selected threshold frequency of at least 50%, other natural variant amino acids, including semi-conserved amino acids and variable amino acids whose occurrence rate is above a selected minimum threshold occurrence at that position, or their chemical equivalents.
[0160] In constructing a natural-variant combinatorial cradle library for a given loop/sheet and loop/sheet length, the variability profile is used to define a sequence of fixed and "variable" positions, i.e. , positions at which amino acid variations can be introduced. In the cradle libraries, the number of fixed positions will depend on the selected threshold frequency for the consensus amino acid at each position. If, for example, the selected frequency threshold was set at about 60%, the conserved or semi-conserved residues and natural- variant substitutions would not be made at these positions. Conversely, if the threshold frequency is set at 100%, all positions would be considered open to variation, recognizing that a single amino acid with a frequency of 100% at a loop position would not be substituted, and a position that had one very dominant amino acid, e.g. , with a frequency of 90%, might be substituted only if the low- frequency variant(s) were chemically dissimilar to the dominant amino acid.
[0161] From the amino acid profile for a given loop/sheet and loop/sheet length, and knowing which of the positions will be held fixed and which will be admit variations, the amino acid substitutions at each variable position can be selected. In general, the number of variations that are selected (including co-produced amino acids) will depend on the number of variable substitution positions in the loop/sheet and the average number of variations per substituted loop/sheet position. Of course, if natural- variant substitutions are introduced into a single loop only, many more variations per position can be accommodated.
[0162] The particular natural variant amino acids that are selected for each position will generally include the amino acids having the highest frequencies, while limited the number of co-produced amino acids, and secondarily, preserving chemical diversity at each site. Once the natural- variant loop/sheet sequences are selected, a library of coding-sequence oligonucleotides encoding all of the identified natural-variant sequences is constructed, making codon substitutions that are effective to preserve the existing consensus amino acid, and encode the selected variant amino acids, including variants encoded by degenerate codons.
[0163] The library of coding sequences for the natural-variants loops/sheets is added to the framework sequences, to construct the library of coding sequences for the natural-variant polypeptide libraries. In some embodiments, the coding library includes coding sequences for a pair of AB/CD, AB/EF, CD/EF or CD/FG loops, where each loop in the pair has one selected length. In another embodiment, the coding library includes coding sequences for any combination of all five loops, AB, BC, CD, EF and FG. In yet another embodiment, the coding library includes coding sequences for the C and F sheets. In still another embodiment, the coding library includes coding sequences for any combination of all beta sheets.
N+/- Libraries
[0164] In addition, the methods of the invention also provide other libraries referred to as the "N+/- libraries." These N+/- libraries are constructed with variations in bottom loops, AB, CD, and EF, the top loops, BC, DE, FG, or any combination of top and bottom loops, and any combination of the beta strands (e.g. , C and/or F). For "N+/- libraries," N is the most predominant amino acid at a particular position and amino acids upstream or downstream are designated +N or -N, respectively. For example, N+3 is an amino acid 3 positions upstream of N, while N-3 is an amino acid 3 positions downstream of N in a 3D structure of Fnlll.
Likewise, N+2 and N+l are amino acids at positions 2 and 1 upstream of N, respectively, while N-2 and N- 1 are amino acids at positions 2 and 1 downstream of N, respectively. By altering, N from the most predominantly abundant amino acid to a less abundant amino acid, the effect of that modification can be assessed on the abundance of amino acids at 1 , 2, or 3 positions away from N. In designing such a library, the frequency and abundance of amino acids surrounding the fixed N position are determined. These differences can be used to generate Fnlll cradle libraries. [0165] For illustrative purposes only, the consensus sequence in the CD/5 loop is SGGEW (SEQ ID NO:278) at loop positions 1, 2, 3, 4, and 5, with G being the predominant amino acid. Using the N+/- theory, if G in loop position 3 is fixed as it is the predominant amino acid (N), then the structural and microenvironmental effect of G on loop position 1 (N-2), loop position 2 (N-1), loop position 4 (N+1), and loop position 5 (N+2) is determined. The amino acid frequency of each position N-2, N-1, N+1, N+2 in the context of a fixed G at position N is calculated. Then, if G at loop position 3 is changed to S, the effect of S on positions N-2, N-1, N+1, N+2 (i.e. , loop positions 1, 2, and 4, 5,) is determined, and so forth. After all possible combinations are calculated the information yielded is an amino acid distribution (N-2, N-1, N, N+1, N+2) of a given position N within a predetermined loop region in the context of a specific amino acid at this position N. This information can then be used to generate a library.
[0166] In another illustration, the consensus sequence of sheet C is GYIVEYREK (SEQ ID NO:279) at sheet positions 1, 2, 3, 4, 5, 6, 7, 8 and 9, respectively of the sheet C. Using the N+/- theory, if Y in position 2 is kept fixed as it is the predominant amino acid (N), then the structural and local microenvironmental effect on G at position 1 (N-1), I at position 3 (N+1), V at position 4 (N+2), E at position 5 (N+3), Y at position 6 (N+4), R at position 7 (N+5), E at position 8 (N+6) and K at position 9 (N+7) is determined. Moreover, if Y at position 2 is changed to V, then the effect of this change on positions N-1, N+1, N+2, N+3, N+4, N+5, N+6 and N+7 (i.e. , sheet positions 1, 3, 4, 5, 6, 7, 8 and 9) is determined.
[0167] The Fnlll cradle molecules in a cradle library may be represented by a sequence set forth in SEQ ID NOs: 468-470. Cradle residues are shown in bold with X representing the amino acid substitution for the beta strands and Y representing the amino acid substitution for the loops with the loop length range given as a subscript. Any substitutions, including natural or engineered amino acids, or other molecules are contemplated. In some embodiments, any of the 19 amino acids other than the native residue can be substituted for the cradle residues. Substitutions may include, but are not limited to conservative substitutions that have little or no effect on the overall net charge, polarity, or hydrophobicity of the protein. Substitutions may also include an insertion and a deletion of one or more amino acids. Fnlll cradle molecules can include alanine substitutions at one or more of amino acid positions.
[0168] In some embodiments, the FG loop may be about 1-10 residues in length. In some embodiments, the FG loop may be about 5 or 6 residues in length. In some embodiments, the FG loop may be five residues in length. In some embodiments, positions 3 and/or 5 of the FG loop are a Gly residue. In some embodiments, position 1 of the FG loop is an Ala, Gly, Ser, Asn or Asp residue, position 2 of the FG loop is an Ala, Lys, Gly, Val or Gin residue, position 3 of the FG loop is a Gly, Leu, Val, Arg or Tyr residue, position 4 of the FG loop is an Glu, Leu, Asp, Tyr or Pro residue, and position 5 of the FG loop is a Gly, Ser, Thr, Asn or His residue. In some embodiments, the FG loop may be six amino acids in length. In some embodiments, position 1 of the FG loop is a Gly residue, position 2 of the FG loop is a Leu, Val or He residue, position 3 of the FG loop is a charged or polar residue, position 4 of the FG loop is a Pro residue, position 5 of the FG loop is a Gly residue, and position 6 of the FG loop is a polar residue. In some embodiments, position 1 of the FG loop is a Gly, Glu, Asp, Ser or Ala residue, position 2 of the FG loop is an Ala, Gly, Tyr, Val or Asn residue, position 3 of the FG loop is a Gly, Gin, Lys, Arg or Glu residue, position 4 of the FG loop is an Arg, Glu, Val, He or Leu residue, position 5 of the FG loop is a Ser, Gly, Val, Thr or Leu residue, and position 6 of the FG loop is a Glu, Gly, Lys, Ser or Pro residue.
[0169] In some embodiments, the CD loop may be about 3-11 residues in length. In some embodiments, the CD loop may be about 4-9 residues in length. In some embodiments, the CD loop may be four residues in length. In some embodiments, position 1 of the CD loop is a Asp, Gly, Glu, Ser or Asn residue, position 2 of the CD loop is a Gly, Ala, Asp, Asn or Glu residue, position 3 of the CD loop is a Gin, Glu, Arg, Gly or Thr residue, position 4 of the CD loop is a Pro, Thr, Glu, Ser or Gin residue. In some embodiments, the CD loop may be five amino acids in length. In some embodiments, position 1 of the CD loop is a Ser, Asp, Gly, Glu or Thr residue, position 2 of the CD loop is a Gly, Ser, Arg, Glu or Thr residue, position 3 of the CD loop is a Gly, Glu, Arg, Lys or Thr residue, position 4 of the CD loop is a Glu, Trp, Ala, Ser or Thr residue, position 5 of the CD loop is a Trp, Pro, Leu, Val or Thr residue. In some embodiments, the CD loop may be six amino acids in length. In some embodiments, position 1 of the CD loop is a Gly, Asn, Asp, Glu or Lys/Ser residue, position 2 of the CD loop is a Gly, Ser, Lys, Thr or Ala residue, position 3 of the CD loop is a Glu, Pro, Asp, Thr or Asn residue, position 4 of the CD loop is a Gly, Glu, Leu, Arg or Ser residue, position 5 of the CD loop is a Trp, Glu, Asp, Pro or Arg residue, and position 6 of the CD loop is a Glu, Val, Thr, Pro or Ala residue.
[0170] In some embodiments, the beta strand C may be about 6-14 residues in length. In some embodiments, the beta strand C may be about 8-11 residues in length. In some embodiments, the beta strand C may be 9 residues in length. In some embodiments, positions 2, 4 and 6 of the beta strand C are a hydrophobic residue. In some embodiments, positions 1, 3, 5 and 7-9 of the beta strand C are altered relative to the wild type sequence. In some
embodiments, position 1 of the beta strand C is selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg. In some embodiments, position 3 of the beta strand C is a hydrophobic residue. In some embodiments, position 3 of the beta strand C is selected from the group consisting of He, Val, Arg, Leu, Thr, Glu, Lys, Ser, Gin and His. In some embodiments, positions 5 and 7-9 of the beta strand C are selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
[0171] In some embodiments, the beta strand F may be about 8-13 residues in length. In some embodiments, the beta strand F may be about 9-11 residues in length. In some embodiments, the beta strand F may be 10 residues in length. In some embodiments, positions 1, 3, 5 and 10 of the beta strand F are altered relative to the wild type sequence. In some embodiments, positions 1, 3, 5 and 10 of the beta strand F are selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg. In some embodiments, positions 2, 4 and 6 of the beta strand F are a hydrophobic residue. In some embodiments, position 7 of the beta strand F is a hydrophobic residue. In some embodiments, position 7 of the beta strand F is selected from the group consisting of Arg, Tyr, Ala, Thr and Val. In some embodiments, position 8 of the beta strand F is selected from the group consisting of Ala, Gly, Ser, Val and Pro. In some embodiments, position 9 of the beta strand F is selected from the group consisting of Val, Leu, Glu, Arg and lie.
[0172] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 30 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0173] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 31 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 30, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0174] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 33 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 30, 31, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0175] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 35 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 30, 31, 33, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0176] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 37 of SEQ ID NO: l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86. [0177] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 38 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0178] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 39 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0179] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 40 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0180] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 41 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0181] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 42 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0182] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 43 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0183] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 44 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0184] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 45 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0185] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 47 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0186] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 49 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0187] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 50 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0188] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 67 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0189] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 69 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0190] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 71 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0191] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 73 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0192] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 75 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0193] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 76 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86. [0194] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 77 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0195] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 78 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85 and/or 86.
[0196] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 79 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 80, 81, 82, 83, 84, 85 and/or 86.
[0197] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 80 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 81, 82, 83, 84, 85 and/or 86.
[0198] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 81 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 82, 83, 84, 85 and/or 86.
[0199] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 82 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 81, 82, 83, 84, 85 and/or 86.
[0200] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 83 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 84, 85 and/or 86.
[0201] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 84 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 85 and/or 86.
[0202] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 85 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84 and/or 86.
[0203] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 86 of SEQ ID NO:l in combination with one or more residue corresponding to amino acid 30, 31, 33, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 47, 49, 50, 67, 69, 71, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84 and/or 85.
[0204] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 33 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0205] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 35 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0206] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 37 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0207] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 39 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0208] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 40 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0209] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 41 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0210] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 42 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85. [0211] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 43 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0212] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 44 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0213] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 45 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0214] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 46 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0215] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 47 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0216] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 48 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 70, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0217] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 70 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 72, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0218] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 72 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 74, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0219] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 74 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 76, 79, 80, 81, 82, 83, 84 and/or 85.
[0220] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 76 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 79, 80, 81, 82, 83, 84 and/or 85.
[0221] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 79 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 80, 81, 82, 83, 84 and/or 85.
[0222] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 80 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 81, 82, 83, 84 and/or 85.
[0223] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 81 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 82, 83, 84 and/or 85.
[0224] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 82 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 83, 84 and/or 85.
[0225] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 83 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 84 and/or 85.
[0226] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 84 of SEQ ID NO: 97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83 and/or 85.
[0227] In some embodiments, the cradle library may comprise a variation in an amino acid corresponding to amino acid 85 of SEQ ID NO:97 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 70, 72, 74, 76, 79, 80, 81, 82, 83 and/or 84. [0228] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 31 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0229] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 31 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0230] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 33 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0231] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 35 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0232] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 37 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0233] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 39 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0234] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 40 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0235] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 41 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0236] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 42 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0237] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 43 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0238] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 44 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 66, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0239] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 66 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 68, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0240] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 68 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 70, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0241] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 70 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 72, 75, 76, 77, 78, 79, 80 and/or 81.
[0242] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 72 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 75, 76, 77, 78, 79, 80 and/or 81.
[0243] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 75 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 76, 77, 78, 79, 80 and/or 81.
[0244] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 76 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 77, 78, 79, 80 and/or 81. [0245] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 77 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 78, 79, 80 and/or 81.
[0246] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 78 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 79, 80 and/or 81.
[0247] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 79 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 80 and/or 81.
[0248] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 80 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79 and/or 81.
[0249] In some embodiments, the cradle library comprises a variation in an amino acid corresponding to amino acid 81 of SEQ ID NO: 129 in combination with one or more residue corresponding to amino acid 31, 33, 35, 37, 39, 40, 41, 42, 43, 44, 66, 68, 70, 72, 75, 76, 77, 78, 79 and/or 80.
V. Computer- Assisted Fnlll Cradle Library Construction
[0250] Further provided herein are methods of making a cradle library of Fnlll domain variants based on sequence information obtained through, e.g. , bioinformatics and/or structural analysis. The first step in building a fibronectin library of the invention is selecting sequences that meet certain predetermined criteria. PFAM, ProSite and similar databases were searched for sequences containing Fnlll domains (Figure 1). These electronic databases contain catalogued expressed fibronectin and fibronectin-like protein sequences and can be queried for those Fnlll domains and similar sequences (e.g. , using the BLAST search algorithm). The Fnlll domain sequences can then be grouped to predefined criteria such as domain subclasses, sequence similarity or originating organism(s).
[0251] The choice of Fnlll domains based on the criteria of the invention dictates both the loop sizes and the initial amino acid sequence diversity to be introduced. By bioinformatics led design, the loop regions are flexible for insertion into multiple Fnlll domains. By specific targeted loop substitutions, overall scaffold stability is maximized while concurrently, non- immunogenic substitutions are minimized. Additionally, the library can be size tailored so that the overall diversity can be readily screened in different systems. Furthermore, the
representative diversity of the designed loops is still capable of binding a number of pre-defined targets. Moreover, the systematic design of loop still allows subsequent affinity maturation of recovered binding clones.
[0252] Fnlll domain sequences are then delineated whereupon the intervening beta strand and loop regions and constituent amino acids are then identified. This then determines the length of the existing loops and beta strands, the amino acid profiles for each loop length and beta strand length, hence the physical size and amino acid diversity that can be accommodated within these frameworks. Once the loops and beta strands are identified, sequences within each loop and beta strand are aligned, and the aligned sequences are then split into groups according to loop length and beta strand length. The distributions of beta strands lengths for sheets A-G and loop lengths for AB, BC, CD, EF and FG loops were identified (see, e.g. , Figure 4). Using this information, the most common beta strand lengths and loop sizes are selected. In some embodiments, the selected loop lengths are CD/4, CD/5, CD/6, FG/5 and FG/6, and the selected beta strand lengths are 9 residues for beta strand C and 10 residues for beta strand F.
[0253] For each beta strand, one can determine the preferred loop acceptor sites based on both comparative structural and sequence analysis. For example, one can use the structural overlay comparison of the overall loop and beta strand scaffolds between the Fnlll07, Fnlll10, Fnlll14 or any of the other known Fnlll domains. In identifying precise loop positions, the above step greatly minimizes necessary diversity loop mutations that would not result in functional ligand binding specificity.
[0254] Once loop lengths are selected, a positional amino acid frequency analysis is performed at each loop position, to determine the frequency of occurrence, in a set of native Fnlll domains. This method may include a frequency analysis and the generation of the corresponding variability profiles (VP) of existing loop sequences (see Example 6). In addition, the outward facing amino acids of sheets C and F were analyzed to determine the frequency of occurrence, in a set of native Fnlll domains (Figure 7B). Amino acids 1, 3, 5, 7-9 in beta strand C and amino acids 1, 3, 5, 7, and 10 in beta strand F are intended for use in the cradle library. High frequency (e.g. , >50 ) positions are considered conserved or fixed. Moderately high frequency or "semi-conserved" amino acids or (when 2 or 3 are combined account for >40 ) are chosen as "wildtype" at other positions. These wildtype amino acids are then systematically altered using, mutagenesis, e.g. , walk-through mutagenesis, to generate the cradle library.
"Variable" positions are those where typically, no one amino acid accounts for more than 20% of the represented set. [0255] A variability profile analysis of the Fnlll domain databases allows identification of loop/beta strand amino acid residue positions that fall within three categories, e.g. , 1) positions that should be conserved or "fixed," 2) semi-conserved, and/or 3) variable positions that are suitable for diversity generation. A variability profile analysis is performed and a threshold frequency is used to identify the most favorable sequences to be used in designating the overall loop/sheet diversity.
[0256] The conserved or a selected semi-conserved sequence (typically the most frequent amino acid in the semi-conserved residues) is considered the "wild type" or "consensus" residue in the loop sequence. This "consensus" or "frequency" approach identifies those particular amino acids under high selective pressure that occurs most frequently at a particular position.
[0257] Accordingly, these residue positions are typically fixed, with diversity being introduced into remaining amino acid positions (taking into account the identified preference for certain amino acids to be present at these positions). The threshold for occurrence frequency at which amino acid variation will be introduced can vary between selected levels as low as 40%, preferably 50% to as high as 100%. At the 100% threshold frequency, mutagenesis of amino acids can be introduced at all positions of the loop, and the only constraints on natural- variant amino acids will be the total number of variants and whether chemical equivalents are available.
[0258] When designing the diversity for any of the above-mentioned loops and beta strands, modified amino acid residues, for example, residues outside the traditional 20 amino acids used in most polypeptides, e.g. , homocysteine, can be incorporated into the loops as desired. This is carried out using art recognized techniques which typically introduce stop codons into the polynucleotide where the modified amino acid residue is desired. The technique then provides a modified tRNA linked to the modified amino acid to be incorporated (a so-called suppressor tRNA of, e.g. , the stop codon amber, opal, or ochre) into the polypeptide (see, e.g. , Kohrer, et al. , PNAS (2001) 98: 14310-14315).
[0259] The Fnlll cradle libraries of the invention and their construction are conducted with the benefit of sequence and structural information such that the potential for generating improved Fnlll cradle moleculesis increased. Structural molecular replacement modeling information can also be used to guide the selection of amino acid diversity to be introduced into the defined beta strand andloop regions. Still further, actual results obtained with the Fnlll cradle molecules of the invention can guide the selection (or exclusion), e.g. , affinity maturation, of subsequent Fnlll cradle molecules to be made and screened in an iterative manner.
[0260] Further provided herein is a method for selecting a protein binding domain specific for a target comprises (a) detecting target specific binding of one or more members of a cradle library comprising a plurality of Fnlll domain polypeptides having amino acid substitutions that correspond to at least amino acid position 31, 33, 47, 49, 71, 73, and/or 75 of SEQ ID NO: l ; and (b) selecting the protein binding domain that specifically binds the target. In some embodiments the method may further comprise first preparing the plurality of Fnlll domain polypeptide variants described herein, e.g. , Fnlll domains having amino acid substitutions that correspond to at least amino acid position 31, 33, 47, 49, 71, 73, and/or 75 of SEQ ID NO: l. In some embodiments a polypeptide identified as exhibiting a particular characteristic may be isolated. In some embodiments, the method may further comprise determining the nucleic acid and/or the amino acid of sequence of the selected protein binding domain. In some
embodiments, the selected protein binding domain may be synthesized or expressed.
[0261] In some embodiments, in silico modeling is used to eliminate the production of any Fnlll cradle molecules predicted to have poor or undesired structure and/or function. In this way, the number of Fnlll cradle molecules to be produced can be sharply reduced thereby increasing signal-to-noise in subsequent screening assays. In another particular embodiment, the in silico modeling is continually updated with additional modeling information, from any relevant source, e.g. , from gene and protein sequence and three-dimensional databases and/or results from previously tested Fnlll cradle molecules, so that the in silico database becomes more precise in its predictive ability (Figure 1).
[0262] In yet another embodiment, the in silico database is provided with the assay results, e.g. , binding affinity/avidity of previously tested Fnlll cradle molecules and categorizes the Fnlll cradle molecules, based on the assay criterion or criteria, as responders or nonresponders, e.g. , as Fnlll cradle molecules that bind well or not so well. In this way, the affinity maturation of the invention can equate a range of functional responses with particular sequence and structural information and use such information to guide the production of future Fnlll cradle molecules to be tested. The method is especially suitable for screening Fnlll cradle molecules for a particular binding affinity to a target ligand using, e.g. , a Biacore™ assay.
[0263] Accordingly, mutagenesis of noncontiguous residues within a loop region or a beta- strand can be desirable if it is known, e.g. , through in silico modeling, that certain residues in the region will not participate in the desired function. The coordinate structure and spatial interrelationship between the defined regions, e.g. , the functional amino acid residues in the defined regions of the Fnlll cradle molecules, e.g. , the diversity that has been introduced, can be considered and modeled. Such modeling criteria include, e.g. , amino acid residue side group chemistry, atom distances, crystallography data, etc. Accordingly, the number of Fnlll cradle molecules to be produced can be intelligently minimized. [0264] In some embodiments, one or more of the above steps are computer-assisted. In a particular embodiment, the computer assisted step comprises, e.g. , mining the NCBI, Genbank, PFAM, and ProSite databases and, optionally, cross-referencing the results against PDB structural database, whereby certain criteria of the invention are determined and used to design the desired loop diversity (Figure 1). The method is also amenable to being carried out, in part or in whole, by a device, e.g. , a computer driven device. For example, database mining fibronectin domain sequence selection, diversity design, oligonucleotide synthesis, PCR- mediated assembly of the foregoing, and expression and selection of candidate Fnlll cradle molecules that bind a given target, can be carried out in part or entirely, by interlaced devices. In addition, instructions for carrying out the method, in part or in whole, can be conferred to a medium suitable for use in an electronic device for carrying out the instructions. In sum, the methods of the invention are amendable to a high throughput approach comprising software (e.g. , computer-readable instructions) and hardware (e.g. , computers, robotics, and chips).
[0265] Further details regarding fibronectin and Fnlll sequence classification, identification, and analysis may be found, e.g. , PFAM. A program to screen aligned nucleotide and amino acid sequences, Johnson, G., Methods Mol. Biol. (1995) 51: 1-15; and Wu, et al., "Clustering of highly homologous sequences to reduce the size of large protein databases." Bioinformatics (2001) 17:282-283; Databases and search and analysis programs include the PFAM database at the Sanger Institute (pfam.sanger.ac.uk); the ExPASy PROSITE database (expasv.ch/prosite/); SBASE web (hydra.icgeb.trieste.it/sbase/); BLAST (located on the World Wide Web at ncbi.nlm.nih.gov/BLAST/); CD-HIT (bioinformatics.ljcrf.edu/cd-hi/); EMBOSS
(hqmp.mrc.ac.uk/Software/EMBOSS/); PHYLIP
(evolution.genetics.washington.edu/phylip.html); and FASTA (fasta.bioch.virginia.edu).
[0266] The bioinformatic analysis focuses on Fnlll domains genes for descriptive purposes, but it will be understood that genes for other Fn domains and other scaffold protein are similarly evaluated.
VI. Synthesizing Fnlll Cradle Libraries
[0267] The cradle library of polypeptides may be encoded by an expression library that has the format of a ribosome display library, a polysome display library, a phage display library, a bacterial expression library, or a yeast display library.
[0268] In some embodiments, the Fnlll cradle libraries of the invention are generated for screening by synthesizing individual oligonucleotides that encode the defined region of the polypeptide and have no more than one codon for the predetermined amino acid. This is accomplished by incorporating, at each codon position within the oligonucleotide either the codon required for synthesis of the wild-type polypeptide or a codon for the predetermined amino acid and is referred to as look-through mutagenesis (LTM) (see, e.g. , U.S. Patent Publication No. 20050136428).
[0269] In some embodiments, when diversity at multiple amino acid positions is required, walk-through mutagenesis (WTM) can be used (see, e.g. , U.S. Patent Nos. 6,649,340;
5,830,650; and 5,798,208; and U.S. Patent Publication No. 20050136428). In another embodiment, diversity can be created using the methods available from commercial vendors such as DNA2.0 and Geneart by providing information about the loop lengths of the AB, BC, CD, EF and FG loops, the positional distribution of amino acids at each position of the loop, and the top 7 amino acid abundance at each position of the loop.
[0270] The mixture of oligonucleotides for generation of the library can be synthesized readily by known methods for DNA synthesis. The preferred method involves use of solid phase beta-cyanoethyl phosphoramidite chemistry (see, e.g. , U.S. Pat. No. 4,725,677). For convenience, an instrument for automated DNA synthesis can be used containing specified reagent vessels of nucleotides. The polynucleotides may also be synthesized to contain restriction sites or primer hybridization sites to facilitate the introduction or assembly of the polynucleotides representing, e.g. , a defined region, into a larger gene context.
[0271] The synthesized polynucleotides can be inserted into a larger gene context, e.g. , a single scaffold domain using standard genetic engineering techniques. For example, the polynucleotides can be made to contain flanking recognition sites for restriction enzymes (see, e.g. , U.S. Pat. No. 4,888,286). The recognition sites can be designed to correspond to recognition sites that either exist naturally or are introduced in the gene proximate to the DNA encoding the region. After conversion into double stranded form, the polynucleotides are ligated into the gene or gene vector by standard techniques. By means of an appropriate vector (including, e.g. , phage vectors, plasmids) the genes can be introduced into a cell-free extract, phage, prokaryotic cell, or eukaryotic cell suitable for expression of the fibronectin binding domain molecules.
[0272] When partially overlapping polynucleotides are used in the gene assembly, a set of degenerate nucleotides can also be directly incorporated in place of one of the polynucleotides. The appropriate complementary strand is synthesized during the extension reaction from a partially complementary polynucleotide from the other strand by enzymatic extension with a polymerase. Incorporation of the degenerate polynucleotides at the stage of synthesis also simplifies cloning where more than one domain or defined region of a gene is mutagenized or engineered to have diversity. [0273] In another approach, the fibronectin binding domain is present on a single stranded plasmid. For example, the gene can be cloned into a phage vector or a vector with a filamentous phage origin of replication that allows propagation of single- stranded molecules with the use of a helper phage. The single-stranded template can be annealed with a set of degenerate polynucleotides representing the desired mutations and elongated and ligated, thus incorporating each analog strand into a population of molecules that can be introduced into an appropriate host (see, e.g. , Sayers, J. R., et al. , Nucleic Acids Res. (1988) 16:791-802). This approach can circumvent multiple cloning steps where multiple domains are selected for mutagenesis.
[0274] Polymerase chain reaction (PCR) methodology can also be used to incorporate polynucleotides into a gene, for example, loop diversity into beta strand framework regions. For example, the polynucleotides themselves can be used as primers for extension. In this approach, polynucleotides encoding the mutagenic cassettes corresponding to the defined region (or portion thereof) are complementary to each other, at least in part, and can be extended to form a large gene cassette (e.g., a fibronectin binding domain) using a polymerase, e.g. , using PCR amplification.
[0275] The size of the library will vary depending upon the loop/sheet length and the amount of sequence diversity which needs to be represented using mutagenesis methods. For example, the library is designed to contain less than 1015, 1014, 1013, 1012, 1011, 1010, 109, 108, 107, and 106 fibronectin binding domain.
[0276] The description above has centered on representing fibronectin binding domain diversity by altering the polynucleotide that encodes the corresponding polypeptide. It is understood, however, that the scope of the invention also encompasses methods of representing the fibronectin binding domain diversity disclosed herein by direct synthesis of the desired polypeptide regions using protein chemistry. In carrying out this approach, the resultant polypeptides still incorporate the features of the invention except that the use of a
polynucleotide intermediate can be eliminated.
[0277] For the libraries described above, whether in the form of polynucleotides and/or corresponding polypeptides, it is understood that the libraries may be also attached to a solid support, such as a microchip, and preferably arrayed, using art recognized techniques.
[0278] The method of this invention is especially useful for modifying candidate fibronectin binding domain molecules by way of affinity maturation. Alterations can be introduced into the loops and/or into the beta strand framework (constant) region of a fibronectin binding domain. Modification of the beta sheets and loop regions can produce fibronectin binding domains with better ligand binding properties, and, if desired, catalytic properties. Modification of the beta strand framework region can also lead to the improvement of chemo-physical properties, such as solubility or stability, which are especially useful, for example, in commercial production, bioavailability, and affinity for the ligand. Typically, the mutagenesis will target the loop region(s) of the fibronectin binding domain, i. e. , the structure responsible for ligand-binding activity which can be made up of the three loop regions. In a preferred embodiment, an identified candidate binding molecule is subjected to affinity maturation to increase the affinity/avidity of the binding molecule to a target ligand. In one embodiment, modifications to at least one loop and at least one beta sheet produces an Fnlll cradle molecule with an increased surface area available for binding to a target molecule. In one embodiment, modifications to at least one top loop, at least one bottom loop, and at least one beta sheet produces an Fnlll cradle molecule with an increased surface area available for binding to a target molecule. In one embodiment, modifications to the FG and CD loops and the C and/or F beta sheet produces an Fnlll cradle molecule with an increased surface area available for binding to a target molecule. In one embodiment, modifications to at least one loop and at least one beta sheet produces an Fnlll cradle molecule that can bind to different target molecules.
[0279] In general, the practice of the present invention employs, unless otherwise indicated, conventional techniques of chemistry, molecular biology, recombinant DNA technology, PCR technology, immunology (especially, e.g. , antibody technology), expression systems (e.g. , cell- free expression, phage display, ribosome display, and Profusion™), and any necessary cell culture that are within the skill of the art and are explained in the literature. See, e.g. ,
Sambrook, Fritsch and Maniatis, Molecular Cloning: Cold Spring Harbor Laboratory Press (1989); DNA Cloning, Vols. 1 and 2, (D.N. Glover, Ed. 1985); Oligonucleotide Synthesis
(M.J. Gait, Ed. 1984); PCR Handbook Current Protocols in Nucleic Acid Chemistry, Beaucage, Ed. John Wiley & Sons (1999) (Editor); Oxford Handbook of Nucleic Acid Structure, Neidle, Ed., Oxford Univ Press (1999); PCR Protocols: A Guide to Methods and Applications, Innis, et ah , Academic Press (1990); PCR Essential Techniques: Essential Techniques, Burke, Ed., John Wiley & Son Ltd (1996); The PCR Technique: RT-PCR, Siebert, Ed., Eaton Pub. Co. (1998); Current Protocols in Molecular Biology, eds. Ausubel, et ah , John Wiley & Sons (1992); Large- Scale Mammalian Cell Culture Technology, Lubiniecki, A., Ed., Marcel Dekker, Pub., (1990). Phage Display: A Laboratory Manual, C. Barbas (Ed.), CSHL Press, (2001); Antibody Phage Display, P. O'Brien (Ed.), Humana Press (2001); Border, et ah , "Yeast surface display for screening combinatorial polypeptide libraries," Nature Biotechnology (1997) 15:553-557; Border, et ah , "Yeast surface display for directed evolution of protein expression, affinity, and stability," Methods Enzymol. (2000) 328:430-444; ribosome display as described by Pluckthun, et ah, in U.S. Pat. No. 6,348,315, and Profusion™ as described by Szostak, et ah, in U.S. Pat. Nos. 6,258,558; 6,261,804; and 6,214,553, and bacterial periplasmic expression as described in U.S. Patent Publication No. 20040058403A1.
VII. Expression and Screening Systems
[0280] Libraries of polynucleotides generated by any of the above techniques or other suitable techniques can be expressed and screened to identify Fnlll cradle molecules having desired structure and/or activity. Expression of the Fnlll cradle molecules can be carried out using cell-free extracts (e.g. , ribosome display), phage display, prokaryotic cells, or eukaryotic cells (e.g. , yeast display).
[0281] In some embodiments, the polynucleotides are engineered to serve as templates that can be expressed in a cell free extract. Vectors and extracts as described, for example in U.S. Pat. Nos. 5,324,637; 5,492,817; 5,665,563, can be used and many are commercially available. Ribosome display and other cell-free techniques for linking a polynucleotide (i. e. , a genotype) to a polypeptide (i.e. , a phenotype) can be used, e.g. , Profusion™ (see, e.g. , U.S. Pat.
Nos. 6,348,315; 6,261,804; 6,258,558; and 6,214,553).
[0282] Alternatively, the polynucleotides of the invention can be expressed in a convenient E. coli expression system, such as that described by Pluckthun, Meth. Enzymol. (1989) 178:476- 515; and Skerra, et al. Biotechnology (1991) 9:273-278. The mutant proteins can be expressed for secretion in the medium and/or in the cytoplasm of the bacteria, as described by Better and Horwitz Meth. Enzymol. (1989) 178:476. In some embodiments, the Fnlll cradle molecules are attached to the 3' end of a sequence encoding a signal sequence, such as the ompA, phoA or pelB signal sequence (Lei, et al., J. Bacteriol. (1987) 169:4379). These gene fusions are assembled in a dicistronic construct, so that they can be expressed from a single vector, and secreted into the periplasmic space of E. coli where they will refold and can be recovered in active form (Skerra, et al., Biotechnology (1991) 9:273-278).
[0283] In some embodiments, the Fnlll cradle molecule sequences are expressed on the membrane surface of a prokaryote, e.g. , E. coli, using a secretion signal and lipidation moiety as described, e.g. , in U.S. Patent Publication Nos. 20040072740A1 ; 20030100023 Al; and 20030036092A1.
[0284] In some embodiments, the polynucleotides can be expressed in eukaryotic cells such as yeast using, for example, yeast display as described, e.g. , in U.S. Pat. Nos. 6,423,538;
6,331,391; and 6,300,065. In this approach, the Fnlll cradle molecules of the library are fused to a polypeptide that is expressed and displayed on the surface of the yeast.
[0285] Higher eukaryotic cells for expression of the Fnlll cradle molecules of the invention can also be used, such as mammalian cells, for example myeloma cells (e.g. , NS/0 cells), hybridoma cells, or Chinese hamster ovary (CHO) cells. Typically, the Fnlll cradle molecules when expressed in mammalian cells are designed to be expressed into the culture medium, or expressed on the surface of such a cell. The Fnlll cradle molecules can be produced, for example, as single individual domain or as multimeric chains comprising dimers, trimers, that can be composed of the same domain or of different Fnlll variant domain types (FnIII03-FnIII10: homodimer; FnIII10-FnIII08: heterodimer; Fnlll10- FnIII10 n, where n is an integer from 1-20 or
07 07
wild type or variant Fnlll domains; Fnlll - Fnlll n, where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll14- FnIII14 n, where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll07- FnIII10 n, where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll10- FnIII14 n, where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll07- FnIII14 n, where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll07- Fnlll10 - FnIII14 n, where n is an integer from 1-20 or wild type or variant Fnlll domains; Fnlll08- Fnlll09 - FnIII10 n, where n is an integer from 1-20 or wild type or variant Fnlll domains; and the like).
[0286] The screening of the expressed Fnlll cradle molecules (or Fnlll cradle molecules produced by direct synthesis) can be done by any appropriate means. For example, binding activity can be evaluated by standard immunoassay and/or affinity chromatography. Screening of the Fnlll cradle molecules of the invention for catalytic function, e.g. , proteolytic function can be accomplished using a standard hemoglobin plaque assay as described, for example, in U.S. Pat. No. 5,798,208. Determining the ability of candidate Fnlll cradle molecules to bind therapeutic targets can be assayed in vitro using, e.g. , a Biacore™ instrument, which measures binding rates of a Fnlll cradle molecule to a given target or ligand, or using the methods disclosed herein. In vivo assays can be conducted using any of a number of animal models and then subsequently tested, as appropriate, in humans.
[0287] The Fnlll cradle library is transfected into the recipient bacterial/yeast hosts using standard techniques as described in the Examples. Yeast can readily accommodate library sizes up to 107, with 103-105 copies of each Fnlll fusion protein being displayed on each cell surface. Yeast cells are easily screened and separated using flow cytometry and fluorescence- activated cell sorting (FACS) or magnetic beads. The yeast eukaryotic secretion system and glycosylation pathways of yeast also allow Fnlll type molecules to be displayed with N and O linked sugars on the cell surface. Details of yeast display are outlined in the Examples section.
[0288] In another embodiment, the yeast display system utilizes the a-agglutinin yeast adhesion receptor to display proteins on the cell surface. The proteins of interest, in this case, Fnlll libraries, are expressed as fusion partners with the Aga2 protein. [0289] These fusion proteins are secreted from the cell and become disulfide linked to the Agal protein, which is attached to the yeast cell wall (see Invitrogen, pYDl Yeast Display product literature). The plasmid, e.g. , pYDl, prepared from an E. coli host by plasmid purification (Qiagen), is digested with the restriction enzymes, Bam HI and Not I, terminally dephosphorylated with calf intestinal alkaline phosphatase. Ligation of the pYDl and CR products libraries, E. coli (DH5a) transformation and selection on LB-ampicillin (50 mg/ml) plates were performed using standard molecular biology protocols to amplify the libraries before electroporation into yeast cell hosts.
[0290] Methods for selecting expressed Fnlll library variants having substantially higher affinities for target ligands (e.g. , TNF, VEGF, VEGF-R etc), relative to the reference wild type Fnlll domain, can be accomplished as follows.
[0291] Candidate test ligands (e.g. , TNF, VEGF, VEGF-R etc), are fluorescently labeled (either directly or indirectly via a biotin-streptavidin linkage as described above). Those library clones that efficiently bind the labeled antigens are then enriched for by using FACS. This population of yeast cells is then re-grown and subjected to subsequent rounds of selection using increased levels of stringency to isolate a smaller subset of clones that recognize the target with higher specificity and affinity. The libraries are readily amenable to high-throughput formats, using, e.g. , FITC labeled anti-Myc-tag Fnlll binding domain molecules and FACS analysis for quick identification and confirmation. In addition, there are carboxyl terminal tags included which can be utilized to monitor expression levels and/or normalize binding affinity measurements.
[0292] To check for the display of the Aga2-FnIII fusion protein, an aliquot of yeast cells (8xl05 cells in 40 μΐ) from the culture medium is centrifuged for 5 minutes at 2300 rpm. The supernatant is aspirated and the cell pellet is washed with 200 μΐ of ice cold PBS/BSA buffer (PBS/BSA 0.5% w/v). The cells are re-pelleted and supernatant removed before re-suspending in 100 μΐ of buffer containing the biotinylated TNFa (200 nM). The cells were left to bind the TNFa at 20°C for 45 minutes after which they were washed twice with PBS/BSA buffer before the addition and incubation with streptavidin-FITC (2 mg/L) for 30 minutes on ice. Another round of washing in buffer was performed before final re- suspension volume of 400 μΐ in PBS/BSA. The cells were then analyzed on FACScan™ (Becton Dickinson) using CellQuest software as per manufacturer's directions.
[0293] To generate a library against TNFa, kinetic selections of the yeast displayed TNF-a fibronectin binding domain libraries involve initial labeling of cells with biotinylated TNF-a ligand followed by time dependent chase in the presence of large excess of un-biotinylated TNF-a ligand. Clones with slower dissociation kinetics can be identified by streptavidin-PE labeling after the chase period and sorted using a high speed FACS sorter. After Aga2-FnIII induction, the cells are incubated with biotinylated TNFa at saturating concentrations (400 nM) for 3 hours at 25°C under shaking. After washing the cells, a 40 hour cold chase using unlabelled TNFa (1 μΜ) at 25°C. The cells are then be washed twice with PBS/BSA buffer, labeled with Streptavidin PE (2 mg/ml) anti-HIS-FITC (25 nM) for 30 minutes on ice, washed and re-suspended and then analyzed on FACS ARIA sorter.
[0294] Library screening can be conducted in order to select Fnlll variants that bind to specific ligands or targets. Combinatorial screening can easily produce and screen a large number of variants, which is not feasible with specific mutagenesis ("rational design") approaches. Amino acid variant at various amino acid positions in Fnlll can be generated using a degenerate nucleotide sequence. Fnlll variants with desired binding capabilities can be selected in vitro, recovered and amplified. The amino acid sequence of a selected clone can be identified readily by sequencing the nucleic acid encoding the selected Fnlll.
[0295] In some embodiments, a particular Fnlll cradle molecule has an affinity for a target that is at least 2-fold greater than the affinity of the polypeptide prior to substitutions discussed herein. In some embodiments, the affinity is, is at least, or is at most about 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-fold increased compared to another Fnlll cradle molecule.
[0296] Further provided herein is a cradle polypeptide selected using the method of identifying a cradle polypeptide having a desired binding affinity to a target molecule disclosed herein. In some embodiments, the cradle polypeptide may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs:4-78, 80-85, 87-96, 98, 99, 101-128, 130- 141, 143, 145-147, 149-159, 161-199, 201-238 and 240-277.
Analysis and Screening of Fnlll Libraries for Function
[0297] Fnlll libraries can also be used to screen for Fnlll proteins that possess functional activity. The study of proteins has revealed that certain amino acids play a crucial role in their structure and function. For example, it appears that only a discrete number of amino acids participate in the functional event of an enzyme. Protein libraries generated by any of the above techniques or other suitable techniques can be screened to identify variants of desired structure or activity.
[0298] By comparing the properties of a wild-type protein and the variants generated, it is possible to identify individual amino acids or domains of amino acids that confer binding and/or functional activity. Usually, the region studied will be a functional domain of the protein such as a binding domain. For example, the region can be the AB, BC, CD, DE, EF and FG loop binding regions or the beta sheets of Fnlll domain. The screening can be done by any appropriate means. For example, activity can be ascertained by suitable assays for substrate conversion and binding activity can be evaluated by standard immunoassay and/or affinity chromatography.
[0299] From the chemical properties of the side chains, it appears that only a selected number of natural amino acids preferentially participate in a catalytic event. These amino acids belong to the group of polar and neutral amino acids such as Ser, Thr, Asn, Gin, Tyr, and Cys, the group of charged amino acids, Asp and Glu, Lys and Arg, and especially the amino acid His. Typical polar and neutral side chains are those of Cys, Ser, Thr, Asn, Gin and Tyr. Gly is also considered to be a borderline member of this group. Ser and Thr play an important role in forming hydrogen-bonds. Thr has an additional asymmetry at the beta carbon, therefore only one of the stereoisomers is used. The acid amide Gin and Asn can also form hydrogen bonds, the amido groups functioning as hydrogen donors and the carbonyl groups functioning as acceptors. Gin has one more CH2 group than Asn which renders the polar group more flexible and reduces its interaction with the main chain. Tyr has a very polar hydroxyl group (phenolic OH) that can dissociate at high pH values. Tyr behaves somewhat like a charged side chain; its hydrogen bonds are rather strong.
[0300] Histidine (His) has a heterocyclic aromatic side chain with a pK value of 6.0. In the physiological pH range, its imidazole ring can be either uncharged or charged, after taking up a hydrogen ion from the solution. Since these two states are readily available, His is quite suitable for catalyzing chemical reactions. It is found in most of the active centers of enzymes.
[0301] Asp and Glu are negatively charged at physiological pH. Because of their short side chain, the carboxyl group of Asp is rather rigid with respect to the main chain. This may be the reason why the carboxyl group in many catalytic sites is provided by Asp and not by Glu.
Charged acids are generally found at the surface of a protein.
[0302] Therefore, several different regions or loops of an Fnlll protein domain can be mutagenized simultaneously. This enables the evaluation of amino acid substitutions in conformationally related regions such as the regions which, upon folding of the protein, are associated to make up a functional site or the binding site. This method provides a way to create modified or completely new binding sites. The two loop regions and two beta sheets of Fnlll, which can be engineered to confer target ligand binding, can be mutagenized simultaneously, or separately within the CD and FG loops or C and F sheets to assay for contributing binding functions at this binding site. Therefore, the introduction of additional "functionally important" amino acids into a ligand binding region of a protein may result in de novo improved binding activity toward the same target ligand. [0303] Hence, new Fnlll cradle molecules can be built on the natural "scaffold" of an existing Fnlll polypeptide by mutating only relevant regions by the method of this invention. The method of this invention is suited to the design of de novo improved binding proteins as compared to the isolation of naturally occurring Fnllls.
VII. Kits
[0304] Kits are also contemplated as being made or used in some embodiments of the present invention. For instance, a polypeptide or nucleic acid of the present invention can be included in a kit or in a library provided in a kit. A kit can be included in a sealed container. Non-limiting examples of containers include a microtiter plate, a bottle, a metal tube, a laminate tube, a plastic tube, a dispenser, a pressurized container, a barrier container, a package, a compartment, or other types of containers such as injection or blow-molded plastic containers into which the dispersions or compositions or desired bottles, dispensers, or packages are retained. Other examples of containers include glass or plastic vials or bottles. The kit and/or container can include indicia on its surface. The indicia, for example, can be a word, a phrase, an abbreviation, a picture, or a symbol.
[0305] The containers can dispense or contain a pre-determined amount of a composition of the present invention. The composition can be dispensed as a liquid, a fluid, or a semi-solid. A kit can also include instructions for using the kit and/or compositions. Instructions can include an explanation of how to use and maintain the compositions.
VIII. Examples
[0306] The following examples are offered to illustrate but not to limit the invention.
Example 1
Phage Display Library and Selection
[0307] An Fnlll10 gene template was constructed (Koide, A., et al. , J Mol Biol (1998)
284: 1141-1151). A library can be created using a "shaved" template containing polyserine sequence at locations to be diversified (Koide, et al., supra, 2007 and Wojcik, et al. , supra,
2010). A synthetic DNA fragment that encodes signal sequence of DsbA (Steiner, et al. , Nat.
Biotechnol. (2006) 24:823-831) was fused to the gene for the template, and the fusion gene was cloned into the phage display vector pAS38 (Koide, A., et al. , supra, 1998). A phage-display combinatorial library was constructed by introducing codons for amino acid variation into the
Fnlll10 gene. Library construction procedures have previously been described (Koide, A., and
Koide, S., Methods Mol. Biol. (2007) 352:95-109). [0308] Phagemid particles can be prepared by growing XLl-Blue cells transfected with the phagemid library in the presence of 0.2 mM IPTG and helper phage (Lo Conte, et ah , J. Mol. Biol. (1999) 285:2177-2198; Fellouse, et al , J. Mol. Biol. (2005) 348: 1153-1162). Phagemid library selection can be performed as follows. In the first round, 0.5 μΜ of a target protein modified with EZ-Link Sulfo-NHS-SS-Biotin (Sulfosuccinimidyl 2(biotinamido)-ethyl-l,3- dithiopropionate; Pierce) is mixed with a sufficient amount of streptavidin-conjugated magnetic beads (Streptavidin MagneSphere® Pramagnetic Particles; Promega, Z5481/2) in TBS (50 mM Tris HC1 buffer pH 7.5 150 mM NaCl) containing 0.5% Tween20 (TBST). To this target solution, 1012"13 phagemids suspended in 1 ml TBST plus 0.5% BSA is added, and the solution is mixed and incubated for 15 min at room temperature. After washing the beads twice with TBST, the beads suspension containing bound phagemids is added to fresh E. coli culture. Phagemids were amplified as described before (Fellouse, et ah, supra, 2005). In a second round, phagemids are incubated with 0.1 μΜ target in TBST plus 0.5% BSA, and then captured by streptavidin-conjugated magnetic beads. Phagemids bound to the target protein are eluted from the beads by cleaving the linker within the biotinylation reagent with 100 mM DTT in TBST. The phagemids are washed and recovered as described above. After amplification, the third round of selection is performed using 0.02 μΜ target. Phage display is an established technique for generating binding members and has been described in detail in many publications such as Kontermann & Dubel (ed.), In: Antibody Engineering: Miniantibodies, 637-647, Springer- Verlag, (2001) and WO92/01047, each of which is incorporated herein by reference in its entirety.
Example 2
Yeast Surface Display
[0309] Yeast surface experiments are performed according to Boder, E. T., and
Wittrup, K. D., Methods Enzymol. (2000) 328:430-444 with minor modifications. The Express- tag in the yeast display vector, pYDl, (Invitrogen) was removed because it cross-reacts with anti-FLAG antibodies (Sigma). The genes for cradle molecules in the phagemid library after three rounds of selection are amplified using PCR and mixed with the modified pYDl cut with EcoRl and Xhol, and yeast EBY100 cells are transformed with this mixture. The transformed yeast cells are grown in the SD-CAA media at 30°C for two days, and then monobody expression is induced by growing the cells in the SG-CAA media at 30°C for 24 h.
[0310] Sorting of monobody-displaying yeast cells is performed as follows. The yeast cells are incubated with a biotinylated target (50 nM) and mouse anti-V5 antibody (Sigma), then after washing incubated with anti-mouse antibody-FITC conjugate (Sigma) and NeutrAvidin®-PE conjugate (Invitrogen). The stained cells are sorted based on the FITC and PE intensities. Typically, cells exhibiting the top -1% PE intensity and top 10% FITC intensity are recovered.
[0311] After FACS sorting, individual clones are analyzed. Approximate Kd values are determined from a titration curve by FACS analysis (Boder and Wittrup, supra, 2000). Amino acid sequences are deduced from DNA sequencing.
[0312] Effects of E. coli lysate on monobody-target interaction are tested by comparing binding in the presence and absence of E. coli lysate prepared from cell suspension with OD600 of 50.
Example 3
Protein Expression and Purification
[0313] The nucleic acid encoding any targets are cloned in the appropriate expression vector. In one example, genes for monobodies are cloned in the expression vector, pHFT2, which is a derivative of pHFTl (Huang, et ah , supra, 2006) in which the His-6 tag had been replaced with a His- 10 tag. Protein expression and purification can be performed as described previously (Huang, et al. , supra, 2006).
[0314] An expression vector comprising cDNA encoding an Fnlll polypeptide or a target molecule is introduced into Escherichia coli, yeast, an insect cell, an animal cell or the like for expression to obtain the polypeptide. Polypeptides used in the present invention can be produced, for example, by expressing a DNA encoding it in a host cell using a method described in Molecular Cloning, A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press (1989), Current Protocols in Molecular Biology, John Wiley & Sons (1987- 1997) or the like. A recombinant vector is produced by inserting a cDNA downstream of a promoter in an appropriate expression vector. The vector is then introduced into a host cell suitable for the expression vector. The host cell can be any cell so long as it can express the gene of interest, and includes bacteria {e.g. , E. coli), an animal cell and the like. Expression vector can replicate autonomously in the host cell to be used or vectors which can be integrated into a chromosome comprising an appropriate promoter at such a position that the DNA encoding the polypeptide can be transcribed.
Example 4
Ribosome Display
[0315] Ribosome display utilizes cell free in vitro coupled transcription/translation machinery to produce protein libraries. The Fnlll library genes are inserted upstream to kappa light immunoglobulin gene that does not have a termination stop codon causing the ribosome to stall, but not release, when it reaches the end of the mRNA. Additionally, the kappa domain spacer serves to physically distance the Fnlll protein from the ribosome complex so that Fnlll binding domain has better accessibility to recognize its cognate ligand. The mRNA library is introduced into either S30 E. coli ribosome extract preparations (Roche) or rabbit reticulate lysate (Promega). In either case, the 5' end of the nascent mRNA can bind to ribosomes and undergo translation. During translation, the ligand-binding protein remains non-covalently attached to the ribosome along with its mRNA progenitor in a macromolecular complex.
[0316] The functional Fnlll proteins can then bind to a specific ligand that is either attached to magnetic beads or microtiter well surface. During the enrichment process, non-specific variants are washed away before the specific Fnlll binders are eluted. The bound mRNA is detected by RT-PCR using primers specific to the 5' Fnlll and 3' portion of the kappa gene respectively. The amplified double stranded cDNA is then cloned into an expression vector for sequence analysis and protein production.
[0317] For prokaryotic translation reactions, the reaction mix can contain 0.2 M potassium glutamate, 6.9 mM magnesium acetate, 90 mg/ml protein disulfide isomerase (Fluka), 50 mM Tris acetate (pH 7.5), 0.35 mM each amino acid, 2 mM ATP, 0.5 mM GTP, 1 mM cAMP, 30 mM acetyl phosphate, 0.5 mg/ml E. coli tRNA, 20 mg/ml folinic acid, 1.5% PEG 8000, 40 ml S30 E. coli extract and 10 mg mRNA in a total volume of 110 ml. Translation can be performed at 37° C for 7 min, after which ribosome complexes can be stabilized by 5-fold dilution in ice-cold selection buffer (50 mM Tris acetate (pH 7.5), 150 mM NaCl, 50 mM magnesium acetate, 0.1% Tween 20, 2.5 mg/ml heparin).
Affinity selection for target ligands
[0318] Stabilized ribosome complexes can be incubated with biotinylated hapten (50 nM fluorescein-biotin (Sigma)) or antigen (100 nM IL-13 (Peprotech) biotinylated) as appropriate at 4°C for 1-2 h, followed by capture on streptavidin-coated M280 magnetic beads (Dynal). Beads were then washed to remove non-specifically bound ribosome complexes. For prokaryotic selections, five washes in ice-cold selection buffer can be performed. For eukaryotic selections, three washes in PBS containing 0.1% BSA and 5 mM magnesium acetate were performed, followed by a single wash in PBS alone. Eukaryotic complexes can then be incubated with 10 U DNAse I in 40 mM Tris-HCl, 6 mM MgCl2, 10 mMNaCl, 10 mM CaCl2 for 25 min at 37°C, followed by three further washes with PBS, 5 mM magnesium acetate, 1% Tween 20.
Recovery of mRNA from Selected Ribosome Complexes
[0319] For analysis of mRNA recovery without a specific disruption step, ribosome complexes bound to magnetic beads can directly be processed into the reverse transcription reaction. For recovery of mRNA from prokaryotic selections by ribosome complex disruption, selected complexes can be incubated in EB20 [50 mM Tris acetate (pH 7.5), 150 mM NaCl, 20 mM EDTA, 10 mg/ml Saccharomyces cerevisae RNA] for 10 min at 4°C. To evaluate the efficiency of the 20 mM EDTA for recovery of mRNA from eukaryotic selections, ribosome complexes can be incubated in PBS20 (PBS, 20 mM EDTA, 10 mg/ml S. cerevisae RNA) for 10 min at 4°C. mRNA can be purified using a commercial kit (High Pure RNA Isolation Kit, Roche). For prokaryotic samples, the DNAse I digestion option of the kit was performed; however, this step is not required for eukaryotic samples, as DNAse I digestion was performed during post-selection washes. Reverse transcription can be performed on either 4 ml of purified RNA or 4 ml of immobilized, selected ribosome complexes (i.e. , a bead suspension).
[0320] For prokaryotic samples, reactions contained 50 mM Tris-HCl (pH 8.3), 75 mM KC1, 3 mMMgCl2, 10 mMDTT, 1.25 primer, 0.5 mM PCR nucleotide mix (Amersham
Pharmacia), 1 URNAsin (Promega) and 5 U Superscript II (Invitrogen) and were performed by incubation at 50°C for 30 min. For eukaryotic samples, reactions contained 50 mM Tris-HCl (pH 8.3), 50 mM KC1, 10 mM MgCl2, 0.5 mM spermine, 10 mM DTT, 1.25 mM RT primers, 0.5 mM PCR nucleotide mix, 1 U RNasin and 5 U AMV reverse transcriptase (Promega) and can be performed by incubation at 48 °C for 45 min.
PCR of Selection Outputs
[0321] End-point PCR can be performed to visualize amplification of the full-length construct. A 5 ml sample of each reverse transcription reaction can be amplified with 2.5 UTaq polymerase (Roche) in 20 mM Tris-HCl (pH 8.4), 50 mM KC1, 1 mM MgCl2, 5% DMSO, containing 0.25 mM PCR nucleotide mix, 0.25 mM forward primer (T7B or T7KOZ for prokaryotic and or eukaryotic experiments, respectively) and 0.25 mM RT primer. Thermal cycling comprised 94°C for 3 min, then 94°C for 30 s, 50°C for 30 s and 72°C for 1.5 min for 30 cycles, with a final step at 72°C for 5 min. PCR products were visualized by electrophoresis on an ethidium bromide stained agarose gels. The isolated PCR products can then be sub- cloned into a bacterial pBAD expression vector for soluble protein production.
Bacterial Expression and Production
[0322] Competent E. coli host cells are prepared as per manufacturer's instructions (Invitrogen PBAD expression system). Briefly, 40 μΐ LMG 194 competent cells and 0.5 μΐ pBAD Fnlll constructs (approximately 1 μg DNA) can be incubated together on ice for 15 minutes after which, a one minute 42°C heat shock was applied. The cells are then allowed to recover for 10 minutes at 37°C in SOC media before plating onto LB-Amp plates and 37°C growth overnight. Single colonies are picked the next day for small scale liquid cultures to initially determine optimal L-arabinose induction concentrations for Fnlll production.
Replicates of each clone after reaching an OD600=0.5 can be tested induced with serial (1 : 10) titrations of L-arabinose (0.2% to 0.00002% final concentration) after overnight growth at room temperature. Test cultures (1 ml) can be collected, pelleted and 100 μΐ lxBBS buffer (10 mM, 160 mM NaCl, 200 mM Boric acid, pH=8.0) added to resuspend the cells before the addition of 50 μΐ of lysozyme solution for 1 hour (37°C). Cell supernatants from the lysozyme digestions can be collected after centrifugation, and MgS04 can be added to final concentration 40 mM. This solution can be applied to PBS pre-equilibrated Ni-NTA columns. His-tagged bound Fnlll samples are washed twice with PBS buffer upon which elution can be accomplished with the addition of 250 mM imidazole. Purity of the soluble Fnlll expression can be examined by SDS- PAGE.
Example 5
Design of a Cradle library Based on the Fnlll Domain Exemplified with the Fnlll07, Fnlll10 and
Fnlll14 Domains
[0323] In this example, universal CD and FG loop sequences along with 3 beta strands between the loops which face outward for fibronectin binding domain library sequences are identified and selected using bioinformatics and the criteria of the invention. A generalized schematic of this process is presented in Figure 1.
Sequences
[0324] 7th Fnlll domain (Fnlll07)— FINC_HUMAN(1173-1265):
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEWHADQSSCTFDN LSPGLEYNVSVYTVKDDKESVPISDTI IP (SEQ ID NO:97)
[0325] 10th Fnlll domain (Fnlll10)— FINC_HUMAN(1447-1542):
VSDVPRDLEWAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKP GVDYTITVYAVTGRGDSPASSKPISINYRTEI (SEQ ID NO:280)
[0326] 14th Fnlll domain (Fnlll14)— FINC_HUMAN(1813-1901):
NVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPG TDYKIYLYTLNDNARSSPVVIDAST (SEQ ID NO: 129)
Alignment
[0327] Below is the sequence alignment of Fnlll repeats 7, 10, and 14 (SEQ ID NOs: 97, 280, 129 respectively). The structurally conserved hydrophobic core residues are shown in bold. -AB— BC
FnIII07 PLSPPTNLHL-EA NPDTG VLTVSWE RSTTPDIT GYRITTTPT
FnllllO VSDVPRDLEVVAA T—PT SLLISWD APAV-TVR YYRITYGET
FNIII14 NVSPPRRARVTDA T—ET TITISWR TKTE-TIT GFQVDAVPA CD— DE—EF—
FnIII07 NGQQGNS LEEWH ADQ SSCTFD NLSPGL EYNVSVYTVK
FnllllO -GGNSPV QEFTVP GSK STATIS GLKPGV DYTITVYAVT
FnIII14 -NGQT-P IQRTIK PDV RSYTIT GLQPGT DYKIYLYTLN FG
FnIII07 D—DKE—SVP ISDTIIP—
FnllllO GRGDSPASSKP ISINYRTEI
FnIII14 D-NA RSSP VVIDAST—
Definition of the Cradle
[0328] The portion of the fibronectin deemed the cradle are loops CD and FG along with amino acids in 3 beta strands between the loops which face outward (Figures 2 and 3). Cradle residues are highlighted in bold in the alignment shown below (SEQ ID NOs:97, 280, 129 respectively).
FnIII07 PLSPPTNLHL-EANPDTGVLTVSWERSTTPDITGYRITTTPT
FnllllO VSDVPRDLEVVAAT—PTSLLISWDAPAV-TVRYYRITYGET
F 11114 NVSPPRRARVTDAT—ETTITISWRTKTE-TITGFQVDAVPA
CD— I
FnIII07 NGQQGNS I LEEWHADQSSCTFDNLSPGLEYNVSVYTVK
FnllllO -GGNSPV I QEFTVPGSKSTATISGLKPGVDYTITVYAVT
FnIII14 -NGQT-P I IQRTIKPDVRSYTITGLQPGTDYKIYLYTLN
FG I
FnIII07 D— DKE— SVP I ISDTIIP—
FnllllO GRGDSPASSKP | ISINYRTEI
FnIII14 D-NA RSSP I VVIDAST—
Distribution of the Cradle Loops
[0329] The fibronectin family alignment, PF00041.full, was downloaded from PFAM in Stockholm (1.0 format located on the World Wide Web at
pfam.sanger.ac.uk/family/PF00041#tabview=2). The FG loop was truncated in PF00041.full and the data from US20090176654(A1) was used instead. The FG loop was defined to include the sequence TGRGDSPASSKPI and the terminal T and I are not defined as part of the FG loop in the cradle. As a result, the distribution data for the FG loop from U.S. Patent Publication No. 2009017654(A1) will be amended by subtracting 2 from each loop length in the distribution.
[0330] The BC loop was calculated for PF00041.full based on the definition in U.S. Patent Publication No. 2009017654(A1) of the DE loop to be the sequence 1 amino acid before the conserved W and up to, but not including, the conserved Y. The BC loop corresponded to columns 125 - 248 in PF00041.full. The BC loops were extracted and the gaps were removed. The length of each loop was determined and range of loop lengths was found to be 1 - 26. The distribution of loop length was determined.
[0331] The output is captured as BC_Loop.txt and formatted in Excel® to generate the table and graph which were saved as BC_Loop.xlsx and shown in Figure 4A. Following is the sequence of Fnlll10 (SEQ ID NO:280) with the cradle loops/sheets in bold.
βΐ
VSDVPRDLEVVAATPTSLLISWDAPAVTVRY YRI T YGE T
CD β2 β3
I GGNSPV I QEFTVPGSKSTATISGLKPGVDYTITVYAVT
FG
I GRGDSPASSKP | ISINYRTEI
[0332] The sheet before the CD loop was designated βΐ (also referred to as sheet C) and included the sequence YYRITYGET (residues 31-39 of SEQ ID NO:280). The CD loop was the sequence GGNSPV (residues 40-45 of SEQ ID NO:280). The sheet directly following the CD loop was β2 (also referred to as sheet D) and included the sequence QEFTV (residues 46-50 of SEQ ID NO: 280). The sheet before the FG loop was β3 (also referred to as sheet F) and included the sequence DYTITVYAVT (residues 67-76 of SEQ ID NO:280). The FG loop was the sequence GRGDSPASSKP (residues 77-87 of SEQ ID NO:280). βΐ corresponded to columns 236 - 271. The CD loop was columns 271 - 317. β2 was columns 318 - 323. β3 was columns 400 - 415.
[0333] The distribution for each sheet or loop was calculated with same Python code as the BC loop using the appropriate columns. The length distribution showed that the sheets, βΐ - β3, have a high amount of length conservation which correlates well with the structural duties of the sheets within the fibronectin molecule (Figures 4A and 4C). The CD and FG loops of the cradle show acceptance of a wide array of loop lengths (Figures 4B and 4D).
Sequence Conservation of the Beta Sheets in the Cradle
[0334] Amino acid sequences on βΐ length 9, β2 length 4, and β3 length 10 were analyzed for sequence conservation. [0335] The same code was used to calculate the distributions of β2 and β3. Position 1, 3, 5, 7, and 9 are of interest for design of the cradle library and showed moderately low sequence conservation as shown in Figures 5A. Position 2 is known to be a highly conserved Tyrosine which has an important packing role with a Tryptophan from the opposite sheet of the beta sandwich (Figure 5A). Positions 4 and 6 also have beta sandwich packing roles in the structure and show high sequence conservation (Figure 5A). Positions 2 and 4 of are interest in the cradle library and showed low conservation (Figure 5C). Overall β2 is not as highly conserved as βΐ or β3 (Figures 5B). Like in βΐ, the odd positions of β3 are intended to be used in library and show low to moderate conservation and even positions, which have structural support functions, show high sequence conservation.
[0336] The conservation was mapped onto Fnlll07, Fnlll10, and Fnlll14 where the cartoon and balls/sticks on βΐ - β3 are shown in Figure 6, colored according to conservation (White = high conservation, gray = moderate conservation, and black = low conservation).
Area of Binding Surface
[0337] A distinct advantage that the cradle library provides over a top or bottom side library is an increase in surface area of the binding surface on the fibronectin as shown in Figure 6. The top side binding fibronectin library consists of the BC, DE, and FG loops. The bottom side library is the AB, CD, and EF loops. The cradle is the CD and FG loops along with three beta strands.
[0338] The following alignment (SEQ ID NOs:97, 280, 129 respectively) shows top-side residues in bold.
FnIII07 PLSPPTNLHL-EANPDTGVLTVSWERSTTPDITGYRITTTPT
FnllllO VSDVPRDLEVVAAT—PTSLLI SWDAPAV—TVRYYRITYGET
FNIII14 NVSPPRRARVTDAT—ETTITIS WRTKTE—TITGFQVDAVPA
FnIII07 NGQQGNSLEEWHADQSSCTFDNLSPGLEYNVSVYTVK
FnllllO -GG SPVQEF TVPGSKSTATISGLKPGVDYTITVYAVT
FnIII14 -NGQT-PIQRTIKPDVRSYTITGLQPGTDYKIYLYTLN
FnIII07 D— DKE—SVPISDTIIP—
FnllllO GRGDSPASSKPI SINYRTEI
FnIII14 D-NA RSSPWIDAST-
[0339] The following alignment (SEQ ID NOs: 97, 280, 129 respectively) shows bottom- side residues in bold.
FnIII07 PLSPPTNLHL-EANPDTGVLTVSWERSTTPDITGYRITTTPT
FnllllO VSDVPRDLEVVAAT—PTSLLISWDAPAV-TVRYYRITYGET
FNIII14 NVSPPRRARVTDAT—ETTITISWRTKTE-TITGFQVDAVPA FnIII07 NGQQGNSLEEWHADQSSCTFDNLSPGLEYNVSVYTVK
FnllllO -GGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVT
FnIII14 -NGQT-PIQRTIKPDVRSYTITGLQPGTDYKIYLYTLN
FnIII07 D—DKE—SVPISDTIIP—
FnllllO GRGDSPASSKPISINYRTEI
FnIII14 D-NA RSSPWIDAST—
[0340] The following alignment (SEQ ID NOs: 97, 280, 129 respectively) shows cradle residues in bold.
FnIII07 PLSPPTNLHL-EANPDTGVLTVSWERSTTPDITGYRITTTPT
FnllllO VSDVPRDLEVVAAT—PTSLLISWDAPAV-TVRYYRIT YGET
FNIII14 NVSPPRRARVTDAT—ETTITISWRTKTE-TITGFQVDAVPA
FnIII07 NGQQGNS LEEWHADQSSCTFDNLSPGL E YNVS VYTVK
FnllllO —GGNSPVQEF T VPGSKSTATISGLKPG VD YT I TVYAVT
FnIII14 -NGQT-PIQRTIKPDVRSYT I TGLQPGTDYKIYLYTLN
Fnl 1107 D— DKE— SVP I SDT I IP—
Fnl II10 GRGDSPASSKP IS INYRTE I
Fnl 1114 D-NA RSSPWI DAST-
Analysis Summary
[0341] The following Table 1 (and Fig. 2B) shows that the cradle offers approximately two times the binding surface of the top or bottom side loops and has less conservation of the residues intended for library design than the top or bottom side libraries.
Table 1 Surface Area of the loops
Figure imgf000078_0001
[0342] Additionally, of the loops in the fibronectin molecule only the CD and FG loops have a large variation in allowed loop length. The length variation may indicate that these loops will tolerate more variation than the top or bottom side loops such as the EF loop which has a >90 conservation of loop length 6 as, defined with Fnlll10 sequence GLKPGV (residues 61-66 of SEQ ID NO:280), along with a >95 sequence conservation of the leucine in position 2. Although the cradle contains 3 beta strands of the largest beta sheet, it offers more amino acid residues to modify than the top or bottom loops. The alignment below shows sequences for Fnlll07, Fnlll10, and Fnlll14 (SEQ ID NOs:97, 280, 129 respectively) where the top loops are italics, the bottom side loops are underlined, and cradle residues are bold. Only residues that are amenable to library design are marked.
Fn l 1107 PLSPPTNLHL-EANPDTGVLTVSWEPSTTPDirGYRITTTPT
Fn l mo VSDVPRDLEVVAAT—PTSLLISWDAPAT/- TVRYYRITYGET
FNI 1114 NVSPPRRARVTDAT—ETTITISWRTKTE-TI TGFQVDAVPA
Fn l 1107 NGQQGNSLEEWHADQSSCTFDNLSPGLEYNVSVYTVg
Fn l mo -GGNSPVQEFTVPGSKSTAT ISGLKPGVDYT I TVYAVT
Fn l 1114 -NGQT-P IQRTI gPDVPSYT I TGLQPGTDYKIYLYTL
Fn l 1107 D— DKE—SVPISDTIIP—
Fn l mo GRGDSPASSKPISINYRTEI
Fn l 1114 D-NA RSSPWIDAST-
[0343] The top side, bottom side, cradle contain 19 - 23, 12 - 14, and 19 - 24 residues respectively that can be used when loop length variation is not applied. The top and bottom side contain only one loop whose length can be aggressively changed, whereas the cradle contains both of them.
Example 6
Creating a Diverse Mammalian Fnlll Domain Alignment
[0344] A profile was created using the Fnlll domains found in the human fibronectin protein, uniprot FINC_HUMAN or P02751.
[0345] The list below shows the profile members.
Fnlll01 HNC_HUMAN(607-699)
Fnlll02 HNC_HUMAN(720-808)
Fnlll03 FINC_HUMAN(811-898)
Fnlll04 HNC_HUMAN(908-995)
Fnlll05 HNC_HUMAN(996- 1083)
Fnlll06 HNC_HUMAN(1087-1172)
Fnlll07 FINC_HUMAN(1173-1265)
Fnlll' FINC_HUMAN( 1266- 1356)
Fnlll 09 FINC_HUMAN( 1357- 1445)
Fnlll 10 FINC_HUMAN( 1447- 1540)
Fnlll 11 FINC_HUMAN( 1541 - 1630)
Fnlll 12 FINC_HUMAN( 1631-1720)
Fnlll 13 FINC_HUMAN( 1723 - 1810)
Fnlll 14 FINC_HUMAN( 1813-1901)
Fnlll 15 FINC_HUMAN( 1902- 1991) [0346] The fasta sequence for each profile member was derived from the Uniprot entry. The sequences were aligned with Clustal X 2.0.11. The crystal structure of the Fnlll10, RCSB entry lfna, was used to highlight secondary structure and define regions on the alignment for later analysis. The sheets on the fibronectin were designated A - G and named from N-terminal to C-terminal in the protein.
[0347] The loops were labeled according to which sheets they were between. Example: Loop CD was between sheet C and sheet D.
Alignment Profile
[0348] The following alignment (FnIII_template.aln) (SEQ ID NOs: 100, 97, 129, 281-292 respectively) was loaded into Clustal X as Profile 1.
CLUSTAL 2.0.11 multiple sequence alignment
lfna SS ********* ****AB **B*****B Q********Q******Q Q****Q****DE** FnllllO VSDVPRDLEWAATPT—SLLISWDAP-AVTVRYYRITYGETGGN-SPVQEFTVPGSKST FnIIl07 PLSPPTNLHLEANPDTG-VLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEWHADQSS FnIII14 NVSPPRRARVTDATET- -TITISWRTKTET-ITGFQVDAVPANGQ—TPIQRTIKPDVRS FnIIl08 AVPPPTDLRFTNIGPD- -TMRVTWAPPPSIDLTNFLVRYSPVKNE-EDVAELSISPSDNA FnIII13 —PAPTDLKFTQVTPT- -SLSAQWTPP-NVQLTGYRVRVTPKEKT-GPMKEINLAPDSSS FnIIl04 —PSPRDLQFVEVTDV- -KVTIMWTPP-ESAVTGYRVDVIPVNLP-GEHGQRLPISRNTF FnIIl05 KLDAPTNLQFVNETDS- -TVLVRWTPP-RAQITGYRLTVGLTR-R-GQPRQYNVGPSVSK FnIIl09 GLDSPTGIDFSDITAN- -SFTVHWIAP-RATITGYRIRHHPEHFS-GRPREDRVPHSRNS FnIII15 AIDAPSNLRFLATTPN- -SLLVSWQPP-RARITGYI IKYEKPGSP-PREWPRPRPGVTE FnIII12 NIDRPKGLAFTDVDVD- -SIKIAWESP-QGQVSRYRVTYSSPEDG-IHELFPAPDGEEDT FnIIl02 -PLVATSESVTEITAS- -SFWSWVSA-SDTVSGFRVEYELSEEG-DEPQYLDLPSTATS FnIIl03 -PDAPPDPTVDQVDDT- -SIWRWSRP-QAPITGYRIVYSPSVEG-S-STELNLPETANS Fnlllll EIDKPSQMQVTDVQDN- -SISVKWLPSSSP-VTGYRVTTTPKNGP-GPTKTKTAGPDQTE FnIIl06 -PGSSIPPYNTEVTET- -TIVITWTPA PRIGFKLGVRPSQGG EAPREVTSDSGS FnlllOl SSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSV-GRWKEATIPGHLNS lfna SS *E** EF******j**********FG*******Q***
FnllllO ATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT
FnIIl07 CTFDNLSPGLEYNVSVYTVKDDKES VPISDTIIP
FnIII14 YTITGLQPGTDYKIYLYTLNDNARS SPWIDAST
FnIIl08 WLTNLLPGTEYWSVSSVYEQHES TPLRGRQKT
FnIII13 VWSGLMVATKYEVSVYALKDTLTS RPAQGWTT
FnIIl04 AEVTGLSPGVTYYFKVFAVSHGRES KPLTAQQTT
FnIIl05 YPLRNLQPASEYTVSLVAIKGNQES PKATGVFT
FnIIl09 ITLTNLTPGTEYWSIVALNGREES PLLIGQQS
FnIII15 ATITGLEPGTEYTIYVIALKNNQKS EPLIGRKKT
FnIII12 AELQGLRPGSEYTVSWALHDDMES QPLIGTQST
FnIIl02 VNIPDLLPGRKYIVNVYQISEDGEQ SLILSTSQT
FnIIl03 VTLSDLQPGVQYNITIYAVEENQES TPWIQQET
Fnlllll MTIEGLQPTVEYWSVYAQNPSGES QPLVQTAVT
FnIIl06 IWSGLTPGVEYVYTIQVLRDGQER DAPIVNKWT
FnlllOl YTIKGLKPGWYEGQLISIQQYGHQ EVTRFDFTT Mammalian Fibronectin Sequences
[0349] The Fnlll domain alignment was obtained from PFAM and saved as PF00041.full. The alignment from PFAM was truncated at the C-terminal portion of the FG loop and the entire Sheet G. The alignment was in Stockholm 1.0 format.
[0350] The file fn3.in contained 1985 unique mammalian sequences and was loaded into Clustal X as Profile 2. All the sequences in Profile 2 were aligned to Profile 1. Outliers were removed and all the sequences in Profile 2 were aligned to Profile 1. The final alignment for Profile 2 was fn3_final.aln which contained 1750 sequences.
[0351] The file fn3_final.aln was reformatted so that each protein had 1 line, all amino acids past the C-terminus of Fnlll10 were trimmed, and a header was added to the top. The file was saved as fibronectins.aln and was the base alignment for further analysis.
Amino Acid Distribution
[0352] The SWISS_PROT release current for July 15, 2010 was downloaded in fasta format. The release contained 518,415 non redundant sequences for a total 182,829,264 amino acids. The amino acid distribution in the SWISS_PROT release was calculated as a random occurrence reference.
Table 2 Table of amino acid distribution
Figure imgf000082_0001
Mammalian Fn!II Domain Motif
[0353] Below shows the mammalian Fnlll domain motif. Key: H = hydrophilic, P = polar, B = Basic, A = Acid, C = Charged, X = no preference, sheets are in bold, specific amino acids are underlined, subscripts indicate length variations without % and percent occurrence with %.
A AB B
[H] [C/P] [H] [C/P] [X] [H] [P] [C/P] [P/A] [P] [H] [P] [H] [P]
1 2 3 4 5 6 1 2 3 1 2 3 4 5
BC C
[W] [P/A] [P] [P/P] [P]3-8[H] [D/P] [P] [Y/F] [H/P] [H] [P/C] [H] [B/P] [C/P] [P] [P] 15% [H/P] 5%
1 2 3 4 5-12 1 2 3 4 5 6 7 8 9 10 11
CD
[P/A] [P/C] [P/C] [C50%/H30%/P25%] [H50%/P25%/C25%]55%[P/H]25%
1 2 3 4 5 6
D DE E
[C/P] [H/A] [H] [X] [H] [P] [P] [P/C] [P/A] [P] [P] [H] [P] [H] [P]
1 2 3 4 5 6 1 2 3 4 1 2 3 4 5
EF F
[G/P] [L] [C/P] [P/P] [G/P] [P] [C/P] [Y] [C/P] [H] [B/P] [H] [P/H] [A/P] [H] [P]
1 2 3 4 5 6 1 2 3 4 5 6 7 8 9 10
FG G
[P/A] [P/H] [G/P] [C/H] [G/S] [ C/P] 60% [C/P] [Y] [C/P] [H] [B/C] [H] [H/B] [A/P] [H] [P]
1 2 3 4 5 6 1 2 3 4 5 6 7 8 9 10
Cradle Library Description
[0354] The cradle library was originally defined as sheets C, D, and F with loops CD and FG. Sheet D is on the outside of the fibronectin molecule and unlikely to significantly contribute to binding residues. The definition of the cradle library is refined to be sheets C and F with loops CD and FG, and various combinations thereof.
[0355] Cradle library mapped onto the human fibronectin sequences (SEQ ID NOs:292, 288, 289, 283, 284, 291, 97, 281, 285, 100, 290, 287, 282, 129, and 286, respectively) is shown below. Cradle residues are shown in bold.
lfna SS *********A****AR **B*****B c********c *****C D****D****DE**
FnlllOl SSSGPVEVFITETPSQPNSHPIQ APQPSHISKYIL W PKNSV—G WKEATIPGHLNS FnIIl02 -PLVATSESVTEITAS—SFWSWVSA-SDTVSGFRVEYELSEEG—DEPQYLDLPSTATS FnIIl03 -PDAPPDPTVDQVDDT—SIWRWSRP-QAPITGYRIVYSPSVEG-S-STELNLPETANS FnIIl04 —PSPRDLQFVEVTDV—KVTIMWTPP-ESAVTGYRVDVIPVNLP—GEHGQRLPISRNTF FnIIl05 KLDAPTNLQFVNETDS—TVLVRWTPP-RAQITGYRLTVGLTR—R—GQPRQYNVGPSVSK
FnIIl06 -PGSSIPPYNTEVTET—TIVITWTPA PRIGFKLGVRPSQGG EAPREVTSDSGS
FnIIl07 PLSPPTNLHLEANPDTG-VLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEWHADQSS FnIIl08 AVPPPTDLRFTNIGPD—TMRVTWAPPPSIDLTNFLVRYSPVKNE—EDVAELSISPSDNA FnIIl09 GLDSPTGIDFSDITAN—SFTVHWIAP-RATITGYRIRHHPEHFS—GRPREDRVPHSRNS FnllllO VSDVPRDLEWAATPT—SLLISWDAP-AVTVRYYRITYGETGGN—SPVQEFTVPGSKST Fnlllll EIDKPSQMQVTDVQDN—SISVKWLPSSSP-VTGYRVTTTPKNGP—GPTKTKTAGPDQTE FnIII12 NIDRPKGLAFTDVDVD—SIKIAWESP-QGQVSRYRVTYSSPEDG—IHELFPAPDGEEDT FnIII13 —PAPTDLKFTQVTPT—SLSAQWTPP-NVQLTGYRVRVTPKEKT—GPMKEINLAPDSSS Fnll 114 NVSPPRRARVTDATET—TITISWRTKTET-ITGFQVDAVPANGQ—TPIQRTIKPDVRS
Fnll 115 AIDAPSNLRFLATTPN—SLLVSWQPP-RARITGYIIKYEKPGSP—PREWPRPRPGVTE lfna SS *E* * EF* * * * * *j * * * * * * * * * *] β* ***** *Q* * *
Fnll 101 YTIKGLKPGWYEGQLISIQQYGHQ EVTRFDFTT
Fnll 102 VNIPDLLPGRKYIV VYQISEDGEQ SLILSTSQT
Fnll 103 VTLSDLQPGVQYNITIYAVEENQES TPWIQQET
Fnll 104 AEVTGLSPGVTYYFKVFAVSHGRES KPLTAQQTT
Fnll 105 YPLRNLQPASEYTVSLVAIKGNQES PKATGVFT
Fnll 106 IWSGLTPGVEYVYTIQVLRDGQE DAPIVNKWT
Fnll 107 CTFDNLSPGLEYNVSVYTVKDDKES VPISDTIIP
Fnll 108 WLTNLLPGTEYWSVSSVYEQHES TPLRGRQKT
Fnll 109 ITLTNLTPGTEYWSIVALNGREES PLLIGQQS
Fnll 110 ATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT
Fnll 111 MTIEGLQPTVEYWSVYAQNPSGES QPLVQTAVT
Fnll 112 AELQGLRPGSEYTVSWALHDDMES QPLIGTQST
Fnll 113 VWSGLMVATKYEVSVYALKDTLTS RPAQGWTT
Fnll 114 YTITGLQPGTDYKIYLYTLNDNARS SPWIDAST
Fnll 115 ATITGLEPGTEYTIYVIALK NQKS EPLIGRKKT
[0356] The top side library is loops BC, DE, and FG and the bottom library is loops AB, CD, and EF. The AB loop has a length constraint of 3 amino acids with position 1 being Threonine or Serine 67.4% of the time. The BC loop allows for a large variation of loop length with no individual length conserved more than 28.8%. However, the BC loop does contain a critical Tryptophan residue at position 1 which is conserved at > 92% in all BC lengths and is necessary for proper folding of the fibronectin. Additionally, position 4 in the BC loop is a Proline with >33% conservation and the N-l position is a hydrophobic residue.
[0357] The CD loop has a Poisson distribution of length centered at 5 amino acids. The most abundant amino acid in the CD loop is Glycine in position 2 and N-2, and when there is a position 5, it a Tryptophan 30% of the time. The DE loop has a length constraint of 4 amino acids. The EF loop has a length constraint of 6 amino acids with a high amount of sequence conservation.
Position 1 : Glycine conserved at 44.2%
Position 2: Leucine, Valine, or Isoleucine conserved at 97.8%
Position 3 : Charged or polar amino acid
Position 4: Proline conserved at 57.5%
Position 5 : Glycine conserved at 44.4%
Position 6: Tends to be a polar amino acid
[0358] The FG loop length is either 5 (32.6%) or 6 (62.1%) with positions 3 and 5 having a Glycine >43% of the time. The remaining positions have conservation of <22% for any given amino acid. [0359] The top side library is limited due to length constraint of the DE loop and conserved amino acids in the BC loop. The bottom side library is limited by the 3 amino acid length constraint on the AB loop and the high amount of conservation throughout the EF loop.
[0360] The amino acid most participating in hydrophobic packing of the fibronectin are BC loop position 1 (W), sheet C position 2 (Y/F), EF loop position 2 (L), and sheet F position 2 (Y). Both the top and bottom side libraries contain loops which have important packing residues which may hinder effective variation. The cradle library loops do not contain structurally necessary amino acids. In addition, the cradle library utilizes the outward facing amino acids of sheets C and F to expand the binding surface.
[0361] The cradle library beta strands C and F are the two longest in the fibronectin molecule and interact extensively to form an anti-parallel beta sheet which may stabilize the protein when changes to the outward facing amino acids are made. Amino acids 1, 3, 5, 7-9 in sheet C and amino acids 1, 3, 5, 7, and 10 in sheet F are intended for use in the cradle library (Figure 7A).
[0362] The residue in sheets C and F were analyzed using a simplified amino acid type scheme where A/G/P/S/T are considered small and flexible, D/E/N/Q/H/K R are considered polar/charged, F/Y/W/I/L/V/M are considered hydrophobic, and C is disulfide making.
[0363] Figure 7B shows the simplified positional distribution for sheet C length 9 (SF = amino acids A/G/P/S/T; CP = D/E/N/Q/H/K R; H = F/Y/W/I/L/V/M; C = C). Positions 2, 4, and 6 showed a clear preference for hydrophobic amino acid and are pointing inwards towards the core of the fibronectin. Position 3 had a preference for hydrophobic amino acids, but not as strongly, and is pointing outward toward solvent. The top 10 amino acids by conservation in sheet C, length 9, position 3 were:
I, 17.2% E, 8.5%
V, 15.4% K, 5.6%
R, 13.2% S, 3.9%
L, 10.9% Q, 3.2%
T, 10.2% H, 3.0%
[0364] Position 1, 5, 7, 8, and 9 showed a clear preference for small flexible or
charged/polar amino acid and were pointing outwards towards solvent.
[0365] Figure 7B shows the simplified positional distribution for sheet F length 10.
Position 2, 4, and 6 showed a clear preference for hydrophobic amino acid and were pointing inwards towards the core of the fibronectin. Position 7 had a preference for hydrophobic amino acids, but not as strongly, and is pointing outward toward solvent. The top 5 amino acids by conservation in sheet F, length 10, position 7 were:
R 17.1% V 15.6%
A 7.8%
T 7.4%
V 7.1%
[0366] Position 1, 3, 5, and 10 showed a clear preference for small flexible or charged/polar amino acid and were pointing outwards towards solvent. Position 9 had a preference for hydrophobic amino acids. The top 5 amino acids by conservation in sheet F, length 10, position 9 were:
V 18.7%
L 13.0%
E 12.7%
R 8.3%
I 7.8%
[0367] Position 8 contained a highly conserved Alanine residue with Alanine or Glycine at
80% conservation. The top 5 amino acids by conservation in sheet F, length 10, position 8 were:
A 68.7%
G 11.5%
S 6.1%
V 2.9%
P 2.5%
Binding Surface Comparison
[0368] Shown below is the cradle library for Fnlll07, Fnlll10, and Fnlll14 (SEQ ID NOs:97, 100, 129, respectively).
lfna SS ********* A * * * *AR * *B* * ** *B c********c *****C D* * * *D** * *DE* *
FnIIl07 PLSPPTNLHLEANPDTG-VLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEWHADQSS FnllllO VSDVPRDLEWAATPT—SLLISWDAP-AVTVRYYRI TYGETGGN—SPVQEFTVPGSKST FnIII14 NVSPPRRARVTDATET—TITISWRTKTET-ITGFQVDAVPANGQ—TPIQRTIKPDVRS lfna SS *E** gp******p**********pQ*******Q***
Fnl1107 CTFDNLSPGLEYNVSVYTVKDDKES VPISDTIIP
FnllllO ATISGLKPGVDYTI TVYAVTGRGDSPASSKPISINYRT
FnIII14 YTITGLQPGTDYKIYLYTLNDNARS SPWIDAST
[0369] Shown below is the top side library for FnlH , Fnlll , and Fnffl14 (SEQ ID NOs:97, 100, 129, respectively).
lfna SS ********* A * * * *AR * *B* * ** *B c********c *****C D* * * *D** * *DE* *
FnIIl07 PLSPPTNLHLEANPDTG-VLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEWHADQSS FnllllO VSDVPRDLEWAATPT—SLLISWDAP—AVTVRYYRITYGETGGN-SPVQEFTVPGSKST FnIII14 NVSPPRRARVTDATET—TITISWRTKTET-ITGFQVDAVPANGQ—TPIQRTIKPDVRS lfna SS *E** gp******p**********pQ*******Q***
Fnl1107 CTFDNLSPGLEYNVSVYTVKDDKES VPISDTIIP
FnllllO ATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT
FnIII14 YTITGLQPGTDYKIYLYTLNDNARS SPWIDAST [0370] Shown below is the bottom side library for Fnlll , Fnlll , and Fnlll (SEQ ID NOs:97, 100, 129, respectively).
lfna SS ********* A * * * *AR * *B* * ** *B Q* * * ** * * *Q * * * **Q rj****rj****rjE**
FnIIl07 PLSPPTNLHLEANPDTG—VLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEWHADQSS FnllllO VSDVPRDLEWAATPT—SLLISWDAP-AVTVRYYRITYGETGGN—SPVQEFTVPGSKST FnIII14 NVSPPRRARVTDATET—TITISWRTKTET-ITGFQVDAVPANGQ—TPIQRTIKPDVRS lfna SS *E* * EF* * * * * *j ** * * * * * * * *]Τ0* * * * * * *Q* * *
FnIIl07 CTFDNLSPGLEYNVSVYTVKDDKES VPISDTIIP
FnllllO ATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT
FnIII14 YTITGLQPGTDYKIYLYTLNDNARS SPWIDAST
Table 3 Binding Surface of each library
Figure imgf000087_0001
Table 4 Binding Surface of each library relative to the Top Side library.
Figure imgf000087_0002
Cradle Library Summary
[0371] The cradle library consisting of beta strand C, beta strand F, loop CD, and loop FG of the Fnlll domain offers better stability and available binding surface than the directional loop based Top and Bottom Side libraries.
[0372] Figure 8 shows the amino acid distribution of the residues and amino acid variation compared with the distribution on CDR-H3 domains known to bind antigens. Figure 9C shows the biased amino acid distribution desired for the Cradle residues marked X and Y.
[0373] Figures 9D-9F show the mapping of the cradle library definition on the sequences of Fnlll07, Fnlll10, and Fnlll14. Figure 9D: Alignment of cradle residues for Fnlll07, Fnlll10 and Fnlll14. Beta sheets are shown as white residues on a black background and loops are shown as black text. Cradle residues are shown in bold with X representing the amino acid distribution for the beta sheets and Y representing the amino acid distribution for the loops with the loop length range given as a subscript. Figure 9E: Alignment of Fnlll07, Fnlll10 and Fnlll14 illustrating the cradle residues in beta sheets C and F and loops CD and FG. Beta sheets are shown as white residues on a black background and loops are shown as black text with Cradle residues shown in bold. Figure 9F: Shown are the Fnlll structural element residue ranges and Fnlll cradle residues ranges. Example 7
Cradle Molecules Binding to Lysozyme, Fc, and Human Serum Albumin (HSA)
[0374] The Example demonstrates the proof of principle for generating cradle molecules that bind to target molecules using calculated design libraries. Using the approaches described above, cradle binders were created against three targets (lysozyme, human Fc, and HSA) with Fn!II07, Fn!II10, and Fn!II14.
[0375] Fnlir' hits for lysozyme (SEQ ID NOs:97-99, respectively):
PTSPPTNLHLEANPDT
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITAYYIYTYKSDKTRY—LEEWHADQSSCTFDNLSPGLYYGVGAVATVRPHPTAGPISDTIIP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITHYLIYTYG-HHSAG—LEEWHADQSSCTFDNLSPGLGYSVYV TVAYK—TMGPISDTIIP
[0376] Fnlll10 hits for lysozyme (SEQ ID NOs:100-128, respectively):
VSDVPRDLEVVAATPTSLLISWDAPA
VSDVPRDLEWAATPTSLL ISWDAPAVTVR-TYYIMYSLWQHYVTNAL—QEFTVPGSKSTATI SGLKPG-VFYGILVYAVSWWS-R-W PISINYRT VSDVPRDLEWAATPTSLLISWDAPAVTVR-SYYIKYSTCSHYVRSGVG-QEFTVPGSKSTATI SGLKPG-VDYMIDVNAVLSEG-RGD PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-GYTT-YS YRDS QEFTVPGSKSTAT ISGLKPGVIYNILVSAVSEWW-K-Y PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-YYEIWYESYFY VLWQEFTVPGSKSTATI SGLKPG-VSYEITVSAVYWH—YAY PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-LYAIMYTAYEYRVMDAKLYQEFTVPGSKSTATI SGLKPG-VSYYINVAAVYLHR-YFY PISINYRT VSDVPRDLEWAATPTSLL IPWDAPAVTVR-GYKIDYWQTW AYYQEFTVPGSKSTATI SGLKPG-VSYAITVLAVYRW—YYS PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-GYGIDYGQRDYQQ GSQQEFTVPGSKSTATI SGLKPG-VQYDIYVGAVETYV-YAR PISINYRT VSDVPRDLEWAATPTSLL IS-DAPAVTVR-SYYIYY—YDYDG GSVQEFTVPGSKSTATI SGLKPG-VSYVISVAAVWYAA-YRY PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-NYLIDYGYKNYSI AG-QEFTVPGSKSIATI SGLKPG-VFYAILVAAVRYFW-YF PISINYRT ISDVPRDLEWAATPTSLL ISWDAPAVTVR-GYSIHYYY—YSF TG-QEFTVPGSKSTATI SGLKPG-VSYWIRVWAVRFWE-YLP PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-GYDIAYGVNYYYY SY-QEFTVPGSKSTATI SGLKPG-WYGIYVAAVRYWH-YLF PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-IYSIGS QEFTVPGSKSTATI SGLKPG-VWYWIYVAAVRAWS-YWH PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-EYYIYYGSSQE TEGQEFTVPGSKSTATI SGLKPG-VNYSIGVAAVQNIY-TYY PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-SYEIGYEYIYLQY SQEFTVPGSKSTATI SGLKPG-VMYSIWYAVNKVY-SYF PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-TYSISY—FDYLHL YSQEFTVQGSKSTATI SGLKPG-VYYAIYVWAVG-WW-LAD PISINYRT VSDVPRDLGWAATPTSLL ISWDAPAVTVR-KYMISYTLMGHLHYG—ASQEFTVPGSKSTATI SGLKPGWYYGIYVLAVSEYQ-VAS PISINYRT VSDVPRDLEWAATPTSLLISWDAPAVTVR-SYNISYSKYHYSPA— -YQEFTVPGSKSTATI SGLKPG-VQYYISVSAVHAHN-VAG PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVRGGYGIGYAKAGSVDA -YQEFTVPGSKSTTTI SGLKPG-VXYYIYVRAVFAH—PAY PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-KYQISYG—YYSNT— -DQEFTVPGSKSTATI SGLKPG-VDYWIYVSAVAWQA-DQG PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-TYSISYR—YGKWS -GQEFTVPGSKSTATI SGLKPG-VYYDIGVTAVTSW-SG PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVRQVYVIAYR—YYVRSW— -GQEFTVPGSKSTATI SGLKPG-VYYSINVLAVYYRT-WR PISINYRT VSDVPRDLEWAATPTSLLISWDAPAVTVR-SYDISYNGMAYTKTL— -VQEFTVPGSKSTATI SGLKPG-VNYLIDVIAVSFRR-WWS PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-NYAISYQ DDSPY— -VQEFTVPGSKSTATI SGLKPG-VNYDISVTAVGWWR-SGM PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-TYDIGYSSFNSSTLY— -VQEFTVPGSKSTATI SGLKPG-VNYDISVTAVRLQE-SQR PISINYRT VSDVPRDLEWAATPTSLLISWDAPAVTVR-EYDIYYVDSYYYFEGQYPHQEFTVPGSKSTATI SDLKPG-VTYDIGVKAVYNGSRIVE PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-VYEISYYSSESYL PGQEFTVPGSKSTATI SGLKPG-VTYDIHVSAVAYRG—AS PISINYRT VSDVPRDLEWAATPTSLL ISWDAPAVTVR-EYLIGYAV TEYGDRQEFTVPGSKSTATI SGLKPG-VLYDIRVLAVYARW—PK PISINYRT VSDVPRDLEWAATPTSLP ISWDAPAVTVR-YYSIWYYHY YPYAQEFTVPGSKSTATI SSLKQG-VRYFIDVLAVAWVR-WAY PISINYRT
[0377] Fnlll14 hits for lysozyme (SEQ ID NOs:129-141, respectively):
NVSPPRRARVTDATETTITISWRTKTETITGF-QvbAVPANGQ-TPIQRTIKPDVRSYTITG
NVSPPRRARVTDATETTITISWRTKTETITSF-WVWAKPYSYYWGSIQRTIKPDVRSYTITGLQPGTWYAINLYTLT-YRFWGDPWIDAST NVSPPRRARVTDATETTITISWRTKTETITYFGDVSAGPSSTYIESIQRTIKPDVRSYTITGLQPGTWYNIVLQTLYSWSYW—PWIDAST NVSPPRRARVTDATETTITISWSTKTETITSF-WGARP—YYYPYIQRTIKPDVRSYTITGLQPGTVYGIWLQTLR-YYYGYTPWIDAST NVSPPRRARVTDATETTITISWRTKTETITAF-EWAHP—NYDYYIQRTIKPDVRSYTITGLQPGTSYWIYLYTL—YSRRYLPWIDAST NVSPPRRARVTDATETTITISWRTKTETITSF-SVIAFPLRERAATIQRTIKPDVRSYTITGLQPGTLYSI ILNTL—WRYYPIPWIDAST NVSPPHRARVTDATETTITISWRTKTETITNF-LVYAYP—TEHVRIQRTIKPDVRSYTITGLQPGTKYWIYLYTLIYNMYY—PWIDAST NVSPPRRARVTDATETTITISWRTKTETITGF-SVWAQP—GYLEEIQRTIKPDVRSYTITGLQPGTSYDSIALSTLGRYRWSDPWIDAST NVSPPRRARVTDATETTITISWRTKTETITQF-HVTAGP—HWVGRIQRTIKPDVRSYTITGLQPGTAYLIYALSTLRSYRYQWPWIDAST NVSPPRRARVTDATETTITISWRTKTETITYF-HVSALP-LVYGSYIQRTIKPDVRSYTITGLQPGTTYDIYLSTLN-SHWLTAPWIDAST NVSPPRRARVTDATETTITISWRTKTETITRF-YVEATPSAAANTSIQRTIKPDVRSYTITGLQPGTMYQIWLATLS-YYASHYPWIDAST NVSPPRRARVTDATETTITISWRTKTETITSF-GVTAKP-VWSWGSIQRTIKPDVRSYTITGLQPGTGYAISLYTLLRYWYRYYPWIDAST NVSPPRRARVTDATETTITISWRTKTETITAF-YVQAYP—YSDHSIQRTIKPDVRSYTITGLQPGTYYDITLSTLR—SYYYRPWIDAST
[0378] Fnlll07 hit for human Fc (SEQ ID NOs: 142-143, respectively):
*****<;**¾**; **|¾*;.** *;***£**>.** *£)*;.* *<£>■***EF***<****¾****>**FG***<*G*>**
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEW
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYTIVAVSYSFYYY—LEEVVHADQSSCTFDNLSPGLSYDEVYVVTVAYKSHGVPISDTAPS
[0379] Fnlll10 hits for human Fc (SEQ ID NOs: 144- 147, respectively):
VS'DVPRDLEWAA'TPTSLL'I'SWDAP
VSDVPRDLEWAATPTSLLISWDAPAVTVRTYQIGYG-YNRGTS-QEFTVPGSKSTATISGLKPGVSYGIYVYAVYE WSYS—PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRYYSITYTYYQAFG-TQEFTVPGSKSTATISGLKPGVGYYIQVYAVGDRVS NGGPISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRYYGIYYS-MSSYG-RQEFTVPGSKSTATISGLKPGVTYQIYMSAVDN WGVG-YPISINYRT
[0380] Fnlllrl4 hits for human Fc (SEQ ID NOs: 148- 159, respectively):
NVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQ TPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARS—SPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITSFTVWASP RSYTH— IQRTIKPDVRSYTITGLQPGTYYR-IYLYTLY-NTYFS-PWIDAST
NVSPPRHARVTDATETTITISWRTKTETITSFRVWAAP TMYQYLYIQRTIKPDVRSYTITGLQPGTYYQAI ILGTLS-TSNTPSPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITSFFVQAYP YGELYIQRTIKPDVRSYTITGLQPGTSYG-IRLSTLI-DSDSYGPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITRFTWAHP GYPGYIQRTIKPDVRSYTITGLQPGTYYS-IDLRTLA-YAQGYSPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITRFTVTADP WYWYGIQRTIKPDVRSYTITGLQPGTYYSGIVLDTLS-WVSGGYPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITNFSVQAGPSI YYGYYIQRTIKPDVRSYTITGLQPGTQYS-ISLRTLWRWYGTYWPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITGFLVNAWP HWANVIQRTIKPDVRSYTITGLQPGTFYV-IYLATLQ-YSSVYSPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITSFAVHAQP VYANWIQRTIKPDVRSYTITGLQPGTYYG-INLATL—YGPNYWPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFSVFAYPES-GAYN IQRTIKPDVRSYTITGLQPGTAYD-IKLDTLL-SSYWYHPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITTFGVYAMHPEEGGYYY—IQRTIKPDVRSYTITGLQPGTWYG-IGLDTLY-SVHDERPWIDAST NVSPPRRARVTDATETTITISWRTKTETITRFYVTDALPG-DAYRYHRIQRTIKPDVRSYTITGLQPGTLYG-ISLTTLY-YAS-AIPWIDAST
[0381] Fnlll07 hits for HSA (SEQ ID NOs: 160-199, respectively):
Figure imgf000091_0001
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGY ITTTPTNGQQG—NSLEEVVHADQSSCTFDNLSPGLE—YNV-SVYTVKDDKESVPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTRDITTYGIETEYDHSV GLEEWHADQSSCTFDNLSPGLN-YDV-EWTVGWGVYQRPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITTYVISTVTSHTGP RLEEWHADQSSCTFDNLSXGLC-YDV-YVYTVTDTAYTTPISDTI IP
SLSPPTNLHLEANPDTGVLTVGWERSTTPGITSYSIDTAKDDVPY LEEWHADQSSCTFDNLSPGLN-YTV-WATVGWS-VDGPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITYYEINTTGYYGFYPG—GLEEWHADQSSCTFDNLSPGLY-YQV-TVQTWYSMWYHPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITYYGIWTLTWLQYYSYRWGLEEAVHADQSSCTFDNLSPGLV-YLV-YVGTVRSP-MARPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITWYWIGTWY—SGYMV—GLEEWHADQSSCTFDNLSPGLT-YWV-LVGTWRSPSRRPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDVTTYSIYTYGYWDSHYM—SLEEWHADQSRCTFDNLSPGLY-YSV-EVYTVYYGLYWPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITTYGIETQTVEWVY YLEEWHADQSSCTFDNLSPGLY-YNV-TVGTVMLD-AAYPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITDYYIITRS RW-G—YLEEWHADQSSCTFDNLSPGLR-YHV-YVWTVGH-Y-RDPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITNYLIQTDYFAFIK-G—VLEEWHADQSSCTFDNLSPGLY-YYV-GVDTVSVPSH-GPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITYYTIATADYTYSY-A—HLEEWHADQSSCTFDNLSPGLN-YEV-GVGTVSVYSYIGPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITYYSIDTWT-FGQW GLEEWHADQSSCTFDNLSPGLY-YYV-EWTVYEWAYSYPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITMYAITTYEYSRAW-Q—YLEEWHADQSSCTFDNLSPGLT-YYV-EVYTVRYT-WSDPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITDYNISTWLYTSVSVYT-ELEEWHAGQSSCTFDNLSPGLA-YWYVWSTVWEHFYPSPISDTIIP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITWYWINTSLANVRM SLEEWHADQSGCTFDNLSPGLY-YDV-QVRTVSAA-EGYPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITKYI I—YTGYGAS-Y—DLEEWHADQSSCTFDNLSPGLK-YTV-TVWTVSYA-SQVPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITMYSIYTYDYTRNY VLEEAVHADQSSCTFDNLSPGLYGYYV-GVGTVTGA-GWHPISDTI IP
PLSPPTNLHLEVNPDTGVLTVSWERSTTPGITQYDIATLSYGGRS-G—GLEEWHADQSSCTFDNLSPGLS-YW-SVSTVTSNEYSAPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITMYDIKTIYYKAYY-Y—GLEEWHADQSSCTFDNLSPGLY-YFV-GWTVERP-RYYPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITYYYIDTNG-G-YW-S—YLEEWHADQSSCTFDNLSPGLG-YPVGYVRTVYAGWLKGPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITYYYIGTYQ-GTTY-E—HLEEWHADQSSCTFDNLSPGLI-YLV-YVSTVYWDSMSSPISDTI IP
PLSPPANLRLEANPDTGVLTVSWERSTTPDITRYVIATGYGGSWY HLEEWHADQSRCTFDNLSPGLA-YYV-DVYTVTPGEKHSPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITKYI ISTYVDYGGY LEEWHADQSSCTFDNLSPGLG-YSV-TVSTVSAG-WDSPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITSYRISTEWRWRYT GLEEWHADQSSCTFDNLSPGLI-YGV-GVSTVWKHNSQAPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITMYYISTGGSSYKPD RLEEWHADQSSCTFDNLSPGLD-YMV-YVRTVMY-YNRSPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYSIATYLTYSNLV GLEEWHADQSSCTFDNLSPGLS-YKV-SVYTVYGY-SYGPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTSDITKYYIATWFGDYGY SLEEWHADQSSCTFDNLSPGLQ-YGV-SVATVKGGQAHYPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITKYYILTSG—YWG-G—GLEEWHADQSSCTFDNLSPGLT-YLV-SVWTVTH-YAGYPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITYYSITTSF-Y—Y-S—ELEEWHADQSSCTFDNLSPGLK-YMV-SVSTVSYS-VGSPISDTI IP PLSPPTNLHLEANPDTGVLTVSWERSTTPDITTYYISTQGQDERG-Y—VLEEWHADQSSCTFDKLSPGLI-YXV-IVWTVDDN-RYDPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITRYYIRTSYVRHGR LEEWHADQSSCTFDNLSPGLY-YNV-SVSTVGYY-YMLPISDTI IP
PLSPPTNLHLEANPDTGVLTVSRERSTTPDITTYSIYTHS GALYVLEEWHADQSSCTFDNPSPGLN-YNV-SVSTVHSRWRYGPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITMYGIVTIY—TRYY SLEEWHADQSSCTFDNLSPGLI-YWV-YVLTVYY-SWYRPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITTYVIDTGA—AVNY VLEEWHADQSSCTFDNLSPGLQ-YSV-DVWTVWYSWYMPISDTI IP
PLSPPTNPHLEANPDTGVLTVSWERSTTPDITTYWIGTYY SADERLEEWHADQSSCTFDNLSPGLY-YAV-WGTVGVWYRVAPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITYYYIHTYY-WKHWQ SLEEWHADQSSCTFDNLSPGLK-YGV-WVSTVYRV-VYYPISDTI IP
PLSPPTNLHLEASPDTGVLTVSWERSTTPDITTYLILTYLGYSR VLEEWHADQSSCTFDNLSPGLW-YMV-YVDTVGRVPYIGPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITVYYIYTYT-YNADL ILEEWHADQSSCTFDNLSPGLI-YSV-YVGTVAS-DDGRPISDTI IP
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITAYVI YTYSESDGRVLEEWHADQSSCTFDNLSPGLR-YSV-KVSTVY-YSYAYPISDTI IP
[0382] Fnlll10 hits for HSA (SEQ ID NOs:200-238, respectively):
*******<*¾**>*AB<*B*>***BC****<***C***>***CD****<*D** *DE*<*E*>**EF**<***F*****>****FG****<**G***>
VSDVPRDLEWAATP^
VSDVPRDLEWAATPTSLLISWDAPAVTVRGYYISYYYHSTRD SQEFTVPGSKSTATISGLKPGVSY-YVGVGAV-WKKDYYF PISINYRT
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYYILYGDYNAYMD-YAGQEFTVPGSKSTATISGLKPGVGYVEIDVYAV—RTSEEQ PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRAYQIRYAY-YSVG RQEFTVPGSKSTATISGLRPGVKY-HISVYAV-NGGMVTD PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRYYWI IYWEAWEYVQ AQEFTVPGSKSTATISGLKPGVHY-GIMVSAV-SGEQPWY PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRIYSIYYYSYVMRGYY—FQEFTVLGSKSTATISGLKPGVNY-DINVQAV-YHRGWRY PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVAVRAYSIDYY-HDNGDG TQEFTVPGSKSTATISGLKPGVTY-GILVYAV-VS-NMGI PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRSYYIGYSAYDEYGG RQEFTVPGSKSTATISGLKPGVSY-SINVFAV-YTMTGRA PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRKYSIYYFSSYSGI AQEFTVPGSKSTATISGLKPGVYY-GIYVEAV-YH-HYSP PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRNYYIQYM-VNYND TQEFTVPGSKSTATISGLKPGVYY-DIKVAAV-YV-AEDR PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRKYYITYYRGRSG NQEFTVPGSKSTATISGLKPGVKY-HILVSAV-KYPFRRL PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRTYWIVY-YRSVYSN GQEFTVPGSKSTATISGLKPGVIY-SIRVIAV—SYYYYG PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRTYSISYSFGLDYEY DQEFTVPGSKSTATISGLKPGVQY-YIWDAV—AGWQYY PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRGYSIKYG-ST-ISA DQEFTVPGSKSTATISGLKPGVFY-VIMVWAV-YYAYANY PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRSYHIYDYYNVHSYY GQEFTVPGSKSTATISGLKPGVSY-AIYVGAV-NE-KQLG- -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTVRTYVISYMSYDAQGG-Q-NQEFTVPGSKSTATISGLKPGVAY-NI IVSAV-GGGQQAV- -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTVREYSIYHSWTLVYR RQEFTVPGSKSTATISGLKPGVNY-YIYVGAV-DNGYGPD- -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTLRYYEIKYSGSSLY VQXFTVPGSKSTATIXGLKPGVSY-NIGVSXV-WQAFWPV- -PISINYRT VSDVPRDLGWAATPTSLRI SWDAPAVTVRSYDIYYWYTTGG SQEFTVPGSKSTATISGLKPGVMY-NIYVTAV-DA-DVGG- -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTVRRYYIGYNWQSPAW NQEFTVPGSKSTATISGLKPGVYY-QIYVAAVLRYGDY-A- -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTVRSYSIGYF-GAYRNW VQEFTVPGSKSTATISGLKPGVTY-YIEVYAV-YS-NPVY- -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTVRKYQIYYYYSAYVKE SQEFTVPGSKSTATISGLKPGVSY-NIAVYAV-SKSRYQP- -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTVRNYAIYYYDD—DTG RQEFTVPGSKSTATISGLKPGVDY- YIGVEAV-WY-WVSS- -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTVRTYTIWYV QRYAY—SQEFTVPGSKSTATISGLKPGVSY- SISVRAV—STDRYY— -PISINYRT VSDVPRDLEWAATPTSLLI SWDAPAVTVRYYSIAYW QLYLP—VQEFTVPGSKSTATISGLKPGVSY-GITVEAV-MSGYSIY- -PISINYRT VSDVPRDLEWAAAPTSLLI SWDAPAVTVRKYYIWYGYSY-FVAYSSYQEFTVPGSKSTATISGLKPGVRY-YIGVLAV-KYPGDYY- -PISINYRT VSDVPRDLEWAATPTSLLISWDAPAVTVRYHSIGYNY YGMYQEFTVPGSKSTATISGLKPGVYY- YIYVRAV-TGREAA-- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRTYQIEYV -SSYYRWTQEFTVPGSKSTATISGLKPGWY-FIYVAAV-RDGPN-D- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRSYKISYYGY- HWVYQEFTVPGSKSTATISGLKPGVSY-LISVSAV-DY-YGVL- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRTYYIGYGMYT YGQEFTVPGSKSTTTISGLKPGWY-DIYVWAV-GFGRYVD- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRNYYIGYRY TVANWCYQEFTVPGSKSTATISGLKPGVSY-WITAKAV-VF-EGDH- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRKYYIGYKL QVMEPDQEFTVPGSKSTATISGLKPGVEY-WIGVDAV-SYYWGFD- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRGYGIYYGDT GDTQEFTVPGSKSTATISGLKPGVMY- -SIWFAV-EW-YMWQ- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRYYWIQYYI YYSRGTQEFTVPGSKSTATISGLKPGVNY- -SIGVQAV—QAYFGE-- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRSYRIMYS—GYYAWEYSRQEFTVPGSKSTATISGLKPGVIY-AIHVSAV-VT--NWEG- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRDYWIYYRYS WPYGSQEFTVPGSKSTATISGLKPGVTY-DIQVEAV-YG--SESG- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRYYYGIYYAGKAGGDYFITQEFTVPGSKSTATISGLKPGVEY- -RIYVAAV-GY-HYTP- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRNYSIKYK YIPYVSHQEFTVPGSKSTATISGLKPGVTY--SIRVQAV-YYLIERY- -PISINYRT
VSDVPRDLEWAATPTSLLISWDAPAVTVRIYYIAYGY-YPGWGRAGSQEFTVPGSKSTATISGLKPGVTY-GISVSAV-EE-RRKV- -PISINYRT
[0383] Fn!II14 hits for HSA (SEQ ID NOs:239-277, respectively):
NVSPPRRARVTDATETTITISWRTKTETITGFQVDAWANGQ TPIQRTIKPDVRSYTITGLQPGTbYklYLYTLNDNAR£3—SPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITDFEVAALPMVST GIQRTIKPDVRSYTITGLQPGTTYYISLYTLDDDGPG—TPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITSFNWAYPS-SQDG IQRTIKPDVRSYTITGLQPGTGYQIHLTTLG-HLSF—SPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFTVDAAPSLWD NIQRTIKPDVRSYTITGLQPGTYYI ILLYTLYNYDA—-LPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITLFEVYADPQVSNGT -YIQRTIKPDVRSYTITGLQPGTYYRIGLYTLSDYEKS- -TPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITRFFVSAVPF ETG- TIQRTIKPDVRSYTITGLQPGTAYDIALYTLF-GYYY- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITDFGWASPY LGQ- -GIQRTIKPDVRSYTITGLQPGTAYSIKLHTLH-VHDY- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFYVAADPTEDG KIQRTIKPDVRSYTITGLQPGTYYTIHLRTLYYLVA— -VPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFDVAANPSYLG AIQRTIKPDVRSYTITGLQPGTAYDIALGTL EXYVSGPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFGVGADPA-MYIEYP- -YIQRTIKPDVRSYTITGLQPGTQYGIYLTTLS-QASD- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFGVRAYPTYRS SIQRTIKPDVRSYTITGLQPGTLYRISLYTLDSAG-Y- -NPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITQFSVYAYPARSKYH —IQRTIKPDVRSYTITGLQPGTGYRIYLQTLG-GYSD- -EPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITEFDVGADPG KGH- -AIQRTIKPDVRSYTITGLQPGTSYLIGLRTLN-RVLH- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITSFRVDAGPGVAG SIQRTIKPDVRSYTITGLQPGTYYQIQLAALAYGY -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITRFYVSAQPRFYYYN —IQRTIKPDVRSYTITGLQPGTDYTIGLYTLG-VYMH- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFSVEAYPRWYAL —IQRTIKPDVRSYTITGLQPGTSYYIYLWTLMMDTS— -SPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITEFFVMAEP—YYGEGY- -YIQRTIKPDVRSYTITGLQPGTSYSINLYTLK-RPYL- -YPWIDAST NVSPPRRARVTDATETTITISWRTKTETITSFYVMAQPTNYYGQST- YIQRTIKPDVRSYTITGLQPGTYYGIQLYTLMYRAS— -APWIDAST NVSPPRRARVTDATETTITISWRTKTETITTFDVYAYPG-YGGSYW- -SIQRTIKPDVRSYTITGLQPGTSYEIELETLH-YSHA- -YPWIDAST NVSPPRRARVTDATETTITISWRTKTETITYFSVLAHPL—EVSSY- SIQRTIKPDVRSYTITGLQPGTGYRIFLSTLR-WYYG- -MPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFSVYANPMYPFY —IQRTIKPDVRSYTITGLQPGTYYEIYLGTLYYFAT— -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFYVSAYPYYVAY DIQRTIKPDVRSYTITGLQPGTYYDINLSTLSYSDN— -SPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFKVRAYPA-YNYGGW- SIQRTIKPDVRSYTITGLQPGTYYSIYLDTLYLGAYW- -YPWIDAST
NVSPPRSARVTDATETTITISWRTKTETITYFWGAFPAYSAHV DIQRTIKPDVRSYTITGLQPGTGYI INLETLINATG— -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITQFWVLAGPSVWTGRM— SIQRTIKPDVRSYTITGLQPGTTYYIGLYTLQYYEY— -SPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITTFRVWARPYLYYW —IQRTIKPDVRSYTITGLQPGTHYDIGLSTLS-STWY- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFHVNAQPSSPP WIQRTIKPDVRSYTITGLQPGTYYGISLYTLSWRGEY- -HPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITRFSVLAYPS-KRTTYT- PIQRTIKPDVRSYTITGLQPGTGYTIRLYTLSPYYWV- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITWFYVSAFPL-LVDG —IQRTIKPDVRSYTITGLQPGTYYGINLYTLS S- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITYFYVYAKPRYIN SIQRTIKPDVRSYTITGLQPGTDYSIYLDTLYWGGEY- -GPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITAFNVYASPEYWRYGYFR- FIQRTIKPDVRSYTITGLQPGTGYYIYLYTLYHKYGY- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITAFYVHAVPMLWWNG —IQRTIKPDVRSYTITGLQPGTSYTINLETLRMSSHY- -YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITSFYVRALPVSAW PIQRTIKPDVRSYTITGLQPGTGYNIGLVTLYYGASY- -VPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITAFYVGAHPWYNL EIQRTIKPDVRSYTITGLQPGTGYVISLYTLWHHNE— -APWIDAST
NVSPPRRARVTDATETTITISWRTKTETITSFWVHAYPSGASGG —IQRTIKPDVRSYTITGLQPGTNYGIALATLTHYYTY- -SPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITGFHVFASPWYSGSQ SIQRTIKPDVRSYTITGLQPGTTYYIGLNTLYIPGHE- -PPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITSFYVDAGP WYRPDAYEYIQRTIKPDVRSYTITGLQPGTGYSIQLYTLYAYAYL—YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITLFYVYAYPR-YYPG IQRTIKPDVRSYTITGLQPGTSYSIYLSTLW-DTKG—YPWIDAST
NVSPPRRARVTDATETTITISWRTKTETITTFMWAYPM-FQYR IQRTIKPDVRSYTITGLQPGTSYTIYLQTLG-YASW—YPWIDAST
Example 8
Proof of Principle with Small Ubiquitin-Like Modifier (SUMO) Using Structure-Guided Design
[0384] The inventors used SUMO as a non- limiting model for demonstration of the methods described herein. The following description is given for the purpose of illustrating various embodiments of the invention and is not meant to limit the present invention in any fashion. One skilled in the art will appreciate that the present invention is well adapted to carry out the objects mentioned, as well as those objects, ends and advantages inherent herein. SUMO is used to represent the general embodiments for the purpose of proof of principle and is not intended to limit the scope of the invention. The described methods and compositions can be used with respect to a plethora of target molecules and are not limited solely to SUMO.
Changes therein and other uses which are encompassed within the spirit of the invention as defined by the scope of the claims will occur to those skilled in the art.
[0385] SUMOs are structurally similar to ubiquitin and are post-translationally conjugated to other proteins resulting in a variety of functional modulations. In humans, there are four SUMO isoforms (SUMO 1-4) (Gareau and Lima, Nature Rev. (2010) 11:861-871). SUMOl and SUM02 share 41% sequence identity (72% similarity) but are functionally distinct (Figure 10B, bottom) (Saitoh and Hinchey, /. Biolog. Chem. (2000) 275:6252-6258; Vertegaal, et al. , Mol. Cell Proteomics (2006) 5:2298-2310). SUM02 and SUM03, collectively referred to as SUM02/3, share 97% sequence identity and are assumed to be functionally identical (Gareau and Lima, supra, 2010; Johnson, Annual Rev. Biochem. (2004) 73:355-382). SUM04's relevance as a post-translational modification is not clear (Bohren, et al , Protein Express. Purif. (2007) 54:289-294; Owerbach, et al , Biochemical Biophysical Res. Comm. (2005)
337:517-520). Thus, most studies in SUMO biology have focused on SUMOl and SUM02/3. SUMOylation play important roles in regulating diverse cellular processes including DNA repair, transcription, nuclear transport and chromosome dynamics (Gareau and Lima, supra, 2010; Johnson, supra, 2004). The dominant mechanism by which SUMOylation alters protein function appears to be through SUMO-mediated interactions with other proteins containing a short peptide motif known as a SUMO-interacting motif (SIM) (Johnson, supra, 2004;
Kerscher, EMBO Repts. (2007) 8:550-555; Song, et al. , Proc. Natl. Acad. Sci. USA (2004) 101: 14373-14378).
[0386] The existence of few inhibitors of SUMO/SIM interactions limits the ability to finely dissect SUMO biology and provides for an ideal model system to demonstrate the effectiveness of the methods and compositions described herein. In the only reported example of such an inhibitor, a SIM-containing linear peptide was used to inhibit SUMO/SIM interactions, establishing their importance in coordinating DNA repair by non-homologous end joining (NHEJ) (Li, et al , Oncogene (2010) 29:3509-3518). This peptide sensitized cancer cells to radiation and chemotherapeutic-induced DNA damage, illustrating a therapeutic potential for SUMO/SIM inhibitors. These findings clearly establish the utility of SUMO/SIM inhibitors, but the peptide inhibitor suffers from two significant shortcomings. First, the peptide binds equally well to SUMOl and SUM02/3, making it impossible to differentiate the roles of each isoform. Second, the peptide has low affinity for SUMO (K<j ~5 μΜ) (Song, et al. , supra, 2004). As a result, high concentrations of the peptide are required for inhibition. Most natural SIM peptides exhibit similarly low affinities and discriminate individual SUMO isoforms by ~ 10-fold or less (Kerscher, supra, 2007; Chang, et al. , J. Biological Chem. (2010)
285:5266-5273; Hecker, et al , J. Biol. Chem. (2006) 281 : 16117-16127; Sekiyama, et al , J. Biological Chem. (2008) 283:35966-35975; Zhu, et al , J. Biological Chem. (2008)
283:29405-29415). Higher affinity reagents capable of selectively inhibiting the SIM interactions of individual SUMO isoforms could be powerful tools for better defining the functions of each isoform and potentially as more potent therapeutics. However, the development of such highly selective inhibitors presents a formidable challenge as the SIM binding site is highly conserved among SUMO isoforms (Figures 16Λ, and 10B, bottom) (Chupreta, et al. , Molec. Cell. Biol. (2005) 25:4272-4282). The development of a SUMO/SIM inhibitor or affinity agent that distinguishes between certain isoforms of SUMO can be used as a model system to demonstrate the ability to design and produce such affinity agents using the methods and compositions described herein.
Fn!II Cradle Library
[0387] Libraries have been designed and constructed in which positions in the beta-strand regions of the Fnlll scaffold, in addition to loop positions, are diversified. Two different libraries are described herein that differ in that positions in the CD loop (residues 41-45) were diversified in Library BLl but not the other, library BL2. The libraries were constructed in the phage display format following procedures that have been published (Wojcik, et al. , supra, 2010) and described herein. The BLl and BL2 libraries were estimated to contain 6xl010 and lxlO10 unique sequences, respectively.
[0388] Selection of cradle molecules from the libraries was performed as described previously (Koide, A., et al. , 2009). The following targets in the form of poly-histidine tagged proteins were used: human SUMOl, human ubiquitin, human Abl SH2 domain, human SFMBT2 domain, human SCMHl domain, and green fluorescent protein. Multiple clones were identified for most of targets. Representative binding data are shown in Figure 15. The amino acid sequences of monobody clones are given in Table 6.
Table 5 Amino acid diversity used for the cradle libraries.
Position Diversity
BL1 library
30 (R) D, F, H, I, L, N, V, or Y
31 (Y) F, H, L, or Y
33 (R) D, F, H, I, L, N, V, orY
41-45 5 and 6 residues of [Y(30 ), S(15 ), G(10%), F(5%), W(5 ), all others except for C (2.5% each)]
47 (E) A, E, K, or T
49 (T) A, E, K, or T
75-85 7-13 residues of [Y(30%), S(15%), G(10%), F(5%), W(5%), all others except for C (2.5% each)]
BL2 library
30 (R) D, F, H, I, L, N, V, or Y
31 (Y) F, H, L, or Y
33 (R) D, F, H, I, L, N, V, orY
47 (E) A, E, K, or T
49 (T) A, E, K, or T
75-85 7-13 residues of [Y(30%), S(15%), G(10%), F(5%), W(5%), all others except for C (2.5% each)]
ST1 library
31 (Y) D, H, N, or Y
33 (R) A, D, E, G, H, K, N, P, Q, R, S, or T
73 (Y) A, D, F, H, I, L, N, P, S, T, V, or Y
75 (V) D, F, H, I, L, N, V, or Y
76 (T) D, H, N, orY
77 (G) S
78 (R) A, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, or Y
79 (G) D, E, H, K, N, Q, or Y
80 (D) A, D, F, H, I, L, N, P, S, T, V, or Y
81 (S) F, I, L, or V
82 (P) A, D, F, H, I, L, N, P, S, T, V, or Y
83 (A) D, F, H, I, L, N, V, or Y
84 (S) A or S
85 (S) D, F, H, I, L, N, V, or Y
88 (I) S
Wild-type residues are shown in parenthesis. Table 6 Amino acid sequences of cradle molecules generated from cradle libraries.
Sequences are grouped according to their binding target.
"x" designates a diversified position in the libraries. Because the lengths of the CD and FG loops were varied in the BLl and BL2 libraries, the numbers of "x"s shown for these libraries are for guidance only and they do not accurately reflect the actual numbers of residues.
BLl Library (SEQ ID NO:3)
Library
VSSVPTKLEVVAATPTSLLISWDAPAVTVxxYxITYGETG-xxxxxxQxFxVPGSKSTATISGLSPGVDYTITVYAxxxxxxxxxxxxxxSPISINYRT
10 20 30 40 CD loop 50 60 70 FG loop 90
human SUMOl (SEQ ID NOS:4-l l. respectively)
VSSVPTKLEVVAATPTSL LISWDAPAVTVDHYVI TYGETG-SYSSYGQE FAVPGSKSTAT ISGLSPGVDYT ITVYAY EFQFEMYMSYS PISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-G-VYGPQEFEVPGSKSTATISGLSPGVDYT ITVYAW-F-YQQAYEHYVSSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVLFYHITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYAYYS- DYTY SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYAWYD- -YSWG-YYGYSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GN-SPVQEFEVPGSKSTATISGLSPGVDYT ITVYAW IYS-DSVYSASPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGYAYSASQEFEVPGSKSTATISGLSPGVDYT ITVYAY ESYYWGFAGYSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-VFGAGPQEFEVPGSKSTATISGLSPGVDYT ITVYAY-E-EWSESMYMSYSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYHITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYAYWE-AFSGDLYYSSSPISINYRT
human ubiquitin (SEQ ID NOS: 12-27, respectively)
VSSVPTKLEVVAATPTSL LISWDAPAVTVDHYNITYGETG-AFWHYVQAFTVPGSKSTATISGLSPGVDYT ITVYAEW—DQYVVG SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-GGYYSFQAFEVPGSKSTATISGLSPGVDYT ITVYAFWP-DDYYYGGSEYSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYHITYGETG-GSWSGYQEFTVPGSKSTATISGLSPGVDYT ITVYANS SWYWYNPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETG-AHYYYFQEFEVPGSKSTATISGLSPGVDYT ITVYAVSH-GTDGNKLYFFSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GWWYGVQAFTVPGSKSTATISGLSPGVDYT ITVYAEDS GGRHSISPISXNYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-WY-SPPQEFTVPGSKSTATISGLSPGVDYT ITVYAWNW—SAG LQSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYAWS WKYWYHGSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYI ITYGETG-GGYYSYQTFTVPGSKSTATISGLSPGVDYT ITVYAN EFGKSYPYTMNPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVLYYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYATDY-GPGYPY ESPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYHITYGETG-GVWSGYQEFTVPGSKSTATISGLSPGVDYT ITVYAVQH QE IWPYYYSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYFITYGETG-GSWSYYQEFAVPGSKSTATISGLSPGVDYT ITVYAYSY EPYYYYNPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-SF-SPPQEFTVPGSKSTATISGLSPGVDYT ITVYAMMW—GWEYYDYNISPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYI ITYGETG-SYHGW-QTFTVPGSKSTATISGLSPGVDYT ITVYADSS TWPYWYYSSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-SF-SPPQEFTVPGSKSTATISGLSPGVDYT ITVYAMMW—GWEYYDYNISPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETG-GVWYGYQEFTVPGSKSTATISGLSPGVDYT ITVYAMTS YFQEYWSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-SF-SPPQEFTVPGSKSTATISGLSPGVDYT ITVYAMMW—GWEYYDYNISPISINYRT
human Abl SH2 domain (SEQ ID NOS:28-44, respectively)
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETG-GYPSPVQTFTVPGSKSTATISGLSPGVDYTITVYAWD YDW—YAIGSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYVITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVYAWYTFQYDYYVTQS-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYFITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVYAWDNWD-DYYY SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVVFYVITYGETG-SYSGW-QEFEVPGSKSTAT ISGLSPGVDYTITVYAY YYQNPE-SYYSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYFITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVYAWY YGYYGPQYTSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYYITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVYAWYQHDFDYHVWGS-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVHYYVITYGETG-WW-GPVQEFTVPGSKSTAT ISGLSPGVDYTITVYAY WKYSYKYSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-AFGSG-QEFEVPGSKSTAT ISGLSPGVDYTITVYA KWMYS-YMYN-PISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYFITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVYAWSYELTGDYLQQF-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYNITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYAWY—EYGGYMEID-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-VPYYGWQEFEVPGSKSTATISGLSPGVDYTITVYAY-P-GSNWFYDWW-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-SYGSYPQAFEVPGSKSTAT ISGLSPGVDYTITVY TESEGYISS—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVYHYVYLITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVYA KWKYSYQY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYYITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVYA-WYWNDYYMSSM—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-GN-SPVQEFEVPGSKSTATISGLSPGVDYTITVYA—TYGDAYWHYYY-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVVHYHITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVYA DWQYSYMY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVDFYVYLITYGETG-GN-SPVQEFTVPGSKSTAT ISGLSPGVDYTITVY GYSDSWNWPY-SPISINYRT ("SH13")
SFMBT2 (SEP ID NO:45)
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-FSFGSSQTFKVPGSKSTATISGLSPGVDYTITVYA FYWSKYY—SPISINYRT
0 SCMH1 (SEP ID NO:46-47, respectively)
VSSVPTKLEVVAATPTSLLISWDAPAVDLYVYLITYGETG-VASWGYQEFTVPGSKSTATISGLSPGVDYTITVYA YGGNYWY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVHYYVYLITYGETG-YYSYG-QEFEVPGSKSTATISGLSPGVDYTITVYA YNGSGWMVQ-SPISINYRT
Green fluorescent protein (SEP ID NP:48-78, respectively)
VSSVPTKLEVVAATPT SLLISWDAPAVTVDHYYI TYGETG—AYWYSQAFTVPGSKSTATISGLSPGVDYT ITVYA STKFNQY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYHITYGETG—HYWYYQAFAVPGSKSTATISGLSPGVDYT ITVYA SSIDYMY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYYITYGETG-GY-WFPSTFTVPGSKSTATISGLSPGVDYT ITVYA SMSPSGYFYSPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYFITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA YGEWDWWSW-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYFITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA-YHVSFPSDEEGM-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYYITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITIYA FGSYHYWEH—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA YGEYKWWSY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA YGGYEYWYY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA RGYFKWWEY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYFITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA—GMVYYGWERES-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVVHYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYALYEGGQHFGYSFS-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA YGSYSYWMY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYAGYVEWQSAKNVH—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYNITYGETG-GSWYAYQTFEVPGSKSTATISGLSPGVDYTITVYA—SFSGDMYYYY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYAGYVAFDYYWRGGY-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVHYYYITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA SLWDWYSS SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYFITYGETG-GYFSSWQEFTVPGSKSTATISGLSPGVDYT ITVYA-GYAGSFPSYE SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA YGDYYYWLY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYT ITVYA YGEFGWWRY—SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYHITYGETG-GPWWGYQTFAVPGSKSTATISGLSPGVDYTITVYT- SSHHPGWW- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETG-YYAYSYQTFTVPGSKSTATISGLSPGVDYTITVYA- —WSYFDGPVY- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYHITYGETG-GPWWGYQTFAVPGSKSTATISGLSPGVDYTITVYT-—SSHHPGWWS- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYHITYGETG-SYWHY-QAFEVPGSKSTATISGLSPGVDYTITVYA- QTRNRYME- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYA- —YGDFMYWKY- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYA-—YGGYSYWLH- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYHITYGETG-SHYWSYQKFTVPGSKSTATISGLSPGVDYTITVYA- SPEGRGSYYGW- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYNITYGETG-VWFPY-QTFTVPGSKSTATISGLSPGVDYTITVYA-—SMVDYEYWW- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVVHYLITYGETG-GAGSSYQTFAVPGSKSTATISGLSPGVDYTITVYA- YMSNYYSY- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYHITYGETG-GSGWGYQAFAVPGSKSTATISGLSPGVDYTITVYA- SSDYLKYY- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYA- YDIGWFPAHYG- -SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVVFYLITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYA- YSTGGSYKSQ-- -SPISINYRT
BL2 Library (SEQ ID NO:79)
Library
VSSVPTKLEVVAATPTSLLISWDAPAVTVxxYxITYGETG-GN-SPVQxFxVPGSKSTATISGLSPGVDYTITVYAxxxxxxxxxxxxxxSPISINYRT
10 20 30 40 50 60 70 FG loop 90
o
o human Abl SH2 domain (SEQ ID NO:80-85. respectively)
VSSVPTKLEVVAATPTSLLISWDAPAVTVVHYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYA LLSSSHWVYE-SPISINYRT ( "GG3" )
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYLITYGETG-GN-SPVQEFKVPGSKSTATISGLSPGVDYTITVYAGSDYYYYYQGAYW-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYA NWAYSYRY-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVFYYVITYGETG-GN-SPVQEFEVPGSKSTATISGLSPGVDYTITVYA NYPYSYMY-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYLITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYA WDPYWDVM-SPISINYRT
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYVITYGETG-GN-SPVQEFTVPGSKSTATISGLSPGVDYTITVYAGWGNWELGYSWS—SPISINYRT
ST1 Library (SEQ ID NO:86)
Library
VSSVPTKLEVVAATPTSLLISWDASSSSVSxYxITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVxAxxSxxxxxxxxSPSSINYRT
10 20 30 40 50 60 70 90
human SUM01 (SEQ ID NO:87-96, respectively)
VSSVPTKLEVVAATPTSLLISWDASSSSVSHYHITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAFYSDDDLYFAFSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYGITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAYHSYDDIYYALSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYAITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAYHSYDDIFLADSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYEITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAYYSHEDIFYAVSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYEITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVAAYHSYHDIFYAVSPSSINYRT
VSSVPTKLEVVAATPTSLLISWDASSSSVSHYEITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVTAYDSYYDIYIAYSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSYYEITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVIAFYSHDDIYISDSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYAITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAYYSYDDLYVSDSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYAITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVFAYYSYDDIYYAYSPSSINYRT VSSVPTKLEVVAATPTSLLISWDASSSSVSHYDITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVHAYYSYDD IYVAISPSSINYRT
Structure-Guided Library Design
[0389] Many proteins are members of large structurally conserved families. Binding proteins that can specifically target functional sites on individual members of highly related protein families are valuable tools for studying the unique functions of these molecules.
Proteins in such families often exhibit high levels of sequence similarity in addition to conserved structural features making it difficult to generate binding proteins that effectively discriminate individual family members. This problem is more pronounced when targeting a functional site that is particularly highly conserved among family members. Taken together, these factors make the production of such reagents a challenge.
[0390] In recent studies, the structure of an Fnlll domain variant (ySMB-1) bound to yeast small ubiquitin-like modifier protein (ySUMO) has been determined. ySMB-1 bound to ySUMO at a functional site normally used to interact with short peptide motifs known as SUMO interacting motifs (SIMs) (Figure 10A). The SIM binding site constitutes the most conserved surface among SUMO family proteins (Figure 10B) (Hecker, et ah , J. Biol. Chem. (2006) 281: 16117-16127). Despite this high level of conservation, ySMB-1 was shown to effectively discriminate ySUMO from two closely related human homologs, hSUMO-1 and hSUMO-2.
[0391] Specific, high-affinity cradle molecules binding to the SIM binding sites of SUMO family proteins could potentially be used as inhibitors of SUMO/SIM interactions. Since the roles of these interactions in different SUMO proteins are not well understood, such cradle molecules could be valuable tools in studying SUMO biology. However, Fnlll domain variants to hSUMO- 1 and hSUMO-2 have not been identified in combinatorial libraries in which loops of the Fnlll domain are diversified, with the exception of a single hSUMO-1 binding clone which crossreacts with ySUMO and hSUMO-2. These difficulties suggest that an alternative approach is required to obtain Fnlll domain variants to these targets. Cradle molecules were generated that bind to the SIM binding site of hSUMO-1 by making a structure-guided library based on the architecture of the ySUMO-binding Fnlll domain variant ySMB-1. The idea behind this strategy was to maintain the useful binding mode of ySMB-1 and recognition of the SIM binding site, but allow for sufficient alteration in the cradle molecule binding surface to accommodate sequence differences in the predicted epitopes on other SUMO proteins.
[0392] Cradle molecules were isolated that specifically target individual human SUMO isoforms as well as the yeast homolog of SUMO (ySUMO), which has about 45% sequence identitiy (about 67% similarity) with human SUMOs (hSUMOs) (Figures 10B, bottom, and 16A). Numerous cradle molecules to ySUMO with mid-nM Kd values were successfully isolated (Figures 16C, D and 19).
[0393] To further improve the design of a cradle library, the crystal structure of a ySUMO- binding Fnlll domain variant bound to ySUMO was determined which revealed the structural basis for targeting ySUMO. Guided by this structural information, a "SUMO-targeted" cradle library that produced isoform- specific cradle molecules to hSUMOl was developed. Cradle molecules that bound to the SIM-binding site of human SUMOl with k<j values of -100 nM but bound to SUM02 400 times more weakly were obtained from this library. Functional studies also demonstrated that these cradle molecules are highly selective inhibitors of hSUMOl/SIM interactions and also of hSUMOl conjugation.
Structure-Guided Design of a SUMO-Targeted Phage Display Library
[0394] To guide the library design, the residues in the ySMB-1 epitope on ySUMO was compared with the equivalent residues in hSUMO-1 and hSUMO-2. The ySMB-1 paratope residues that contacted or were near each of these epitope positions were then identified (Figures 11A, 11B). In the ySMB-l/ySUMO structure, ySMB-1 forms a binding surface using an engineered FG loop and a portion of the undiversified Fnlll scaffold. In the SUMO-targeted library both of these surfaces are diversified (Figure 11C). A SUMO-targeted library was designed by introducing amino acid diversity at each ySMB-1 paratope position that included the wild- type ySMB-1 residue and other amino acid types that might allow effective complementation of any of the three SUMO targets (Figure 11B). For example, polar amino acids and amino acids with complementary charge were included at positions expected to contact a charged residue in one or more SUMO isoforms, hydrophobic amino acids were included at positions expected to contact hydrophobic surface and small amino acid residues were included at positions that may have steric clashes with larger side chains in some of the SUMO proteins and so on.
[0395] All residues of the FG loop were varied except one, S77 that did not contact ySUMO in the ySMB-l/ySUMO crystal structure and did not appear to be capable of direct participation in any similar interface. Y76 was varied to D, H, N and Y, because, although it did not directly contact ySUMO in the ySMB-1 interface, it was suspected that this position may be capable of interacting with the conserved R55 in all SUMOs (Figure 11A). Leucine 81 of ySMB-1 is buried in a pocket in the ySUMO surface that is conserved across all SUMO isoforms, and an equivalent "anchor" leucine or valine is conserved in all SIM/SUMO complexes for which there are structures. As a result, amino acid diversity was restricted at this position to F, L, I and V. E47 and S86 of the Fnlll scaffold made very minimal contact in the ySMB-1 interface and were not varied. Though P87 of the scaffold did make significant contact in the ySMB-1 interface, it was held constant to avoid perturbation of the turn structure it introduces which would likely change the overall positioning of the FG loop. The total number of encoded sequences in the SUMO-targeted library was 1.6 x 1011 and the actual size of the phage library produced was 2.0 x 109.
Selection of Reprogrammed SUMO-Binding Cradle Molecules
[0396] Using the SUMO-targeted library described above, four rounds of selection against hSUMO-1, hSUMO-2 and ySUMO were conducted. The enrichment ratio is defined as the number of phage recovered in the presence of target divided by the number recovered in the absence of target and generally reflects the number and affinity level of functional binders in the sorted phage population. After four rounds of selection good enrichment ratios were observed for both ySUMO and hSUMO-1 (-20 and 50 respectively). Thirty-two random clones for each target were assayed for binding activity using phage ELISA and 100% of clones tested positive for binding in the cases of ySUMO and hSUMO-1.
[0397] Five random ySUMO clones and 10 random hSUMO-1 clones were expressed as soluble proteins and assessed for binding activity via surface plasmon resonance (SPR).
Consistent with phage ELISA results, all clones produced binding signals. For ySUMO Kd estimates ranged from 39 nM to 3.3 μΜ. Similarly, for hSUMO-1, Kd estimates ranged from 145 nM to 3.6 μΜ (Figure 12B). Thus, the SUMO-targeted library succeeded in producing functional cradle molecules to both ySUMO and hSUMO- 1 and the library performed similarly against both of these targets.
Sequence Profiles of ySUMO and hSUMO-1 Binding Cradle Molecules
[0398] Sequencing revealed that all 10 SPR tested hSUMO-1 cradle molecules contained mutations away from wild-type residues at position 33 in the Fnlll scaffold and all but one clone contained mutations at position 31. At position 73, the wild-type tyrosine was recovered -50% of the time. FG loop sequences in hSUMO-1 monobodies all bore clear resemblance to ySMB-1 suggesting that the ySMB-1 binding mode was maintained in these monobodies as intended.
[0399] Interestingly, the wild-type scaffold residues were recovered in all SPR tested ySUMO clones except for one which contained a Y to F mutation at position 73 (Figures 12A, 12B). FG loop sequences of ySUMO cradle molecules also bore resemblance to ySMB-1 though they were somewhat more divergent than those of hSUMO-1 monobodies. [0400] To further examine the sequence properties of ySUMO and hSUMO-1 binding cradle molecules an additional 34 clones for hSUMO-1 and an additional 35 clones for ySUMO were sequenced. All of these clones tested positive for target binding by phage ELISA. Overall sequence profiles for both ySUMO and hSUMO- 1 cradle molecules showed close relation to the ySMB-1 sequence and to each other suggesting that, as designed, the cradle molecules from this library maintain a ySMB-1 like binding mode to both targets (Figures 12A, 12C). However, a sharp difference was observed between ySUMO and hSUMO-1 binding cradle molecules at beta strand residues. Out of 40 ySUMO binding clones, 39 contained wild-type residues at positions 31 and 33. Out of 44 hSUMO-1 binding clones, none contained the wild-type arginine at position 33 and most did not contain the wild-type tyrosine at position 31. Cradle molecules to both targets show a tendency toward tyrosine at position 73. The strong departure from wild- type beta strand residues in hSUMO- 1 cradle molecules suggests that mutations in the Fnlll beta strand are necessary to bind hSUMO-1 using a ySMB-l-like binding mode. Thus, modification in the beta strand residues can enhance the selectivitiy and/or affinity of a cradle molecules or cradle library for a target.
[0401] The dominant amino acids at position 33 in hSUMO-1 cradle molecules were alanine and glutamic acid, representing a truncation and inversion of charge compared to the wild-type arginine (Figure 12C). In a modeled ySMB-l/hSUMO-1 structure, the wild-type arginine residue of the Fnlll scaffold exhibits a potential steric and electrostatic clash with K23 of hSUMO-1 (Figure 13). This clash could be resolved by the observed mutations in the hSUMO-1 -binding cradle molecules. An explanation for the strong preference for histidine over the wild-type tyrosine at position 31 in the Fnlll beta strand is not clear from the modeled structure.
[0402] In contrast to the beta strand residues, the FG loop sequences of cradle molecules recovered against ySUMO and hSUMO-1 exhibit similar amino acid preferences at most positions (75, 76, 78, 80, 81 and 84). This similarity is consistent with FG loop residues contacting predominantly those positions that are conserved between ySUMO and hSUMO-1 (Fig. 11A). Interestingly, at positions 80 and 81, hSUMO-1 cradle molecules show more pronounced preference than ySUMO cradle molecules suggesting stronger selective pressure at these positions in the hSUMO-1 interface. Also, at position 79, cradle molecules to hSUMO-1 have a significant preference for aspartate (Fig. 12C).
[0403] Based on the modeled structure of the ySMB-l/hSUMO-1 complex, positions 79 and 80 in hSUMO-1 cradle molecules would be close to two lysine residues of hSUMO-1, one of which is an arginine instead in ySUMO (Figure 12A). In ySMB-1, Y79 forms a stacking interaction with R47 of ySUMO (Figure 11A). The lysine residue at position 47 in hSUMO-1 may be better accommodated by aspartate. The basic residues in this region of hSUMO-1 normally interact with a conserved acidic stretch in SIMs and the "DD" motif in hSUMO-1 cradle molecules marks a shift toward a more SIM-like sequence. Interestingly, these two acidic residues are not strongly conserved in ySUMO cradle molecules, suggesting that reliance on these contacts for binding may not be as strong. hSUMO-1 cradle molecules exhibit a significant preference for isoleucine over leucine at the "anchor" position in the SIM interface. In hSUMO-1 the identity of a core residue in the SIM binding surface, 139 (ySUMO) is truncated to Valine (Figure 12A). This mutation results in a deeper pocket at the "anchor" position (Chupreta, et al. , supra. (2005)) which may explain a strong preference for a bulkier side chain in hSUMO-1 cradle molecules.
[0404] Despite some differences, overall, FG loop sequence preferences are similar in cradle molecules to ySUMO and hSUMO-1 suggesting that similar FG loop sequences can effectively mediate binding to both targets. In one extreme example of this similarity, one pair of cradle molecules (one to ySUMO and one to hSUMO-1) have FG loop sequences that differ by only one amino acid at position 84. The ySUMO cradle molecule contained alanine at this position while the hSUMO-1 cradle molecule contained serine (Figure 14A). Since alanine occurs at this position in most hSUMO-1 binders (Figure 12C), it is highly unlikely that the alanine mutation in the ySUMO cradle molecule would significantly alter binding activity to hSUMO-1. Interestingly, beta strand residues in these two cradle molecules are different suggesting that in this instance beta strand residues alone may dictate which target these cradle molecules bind.
[0405] Binding of these two clones to ySUMO and hSUMO-1 was assessed by phage ELISA. The hSUMO-1 cradle molecule bound to both hSUMO-1 and ySUMO. But, as expected, the ySUMO cradle molecule which contained wild-type Fnlll scaffold residues bound only to ySUMO (Figure 14B). These results show that an effectively identical FG loop can be used to recognize both ySUMO and hSUMO- 1 but mutations in the Fnlll scaffold are necessary to bind hSUMO-1. These results also provide clear evidence supporting the beta strand-based mechanism for specificity in cradle molecules.
Specificity of Selected Cradle Molecules
[0406] Because the SUMO-targeted library was designed based on the binding mode of a cradle molecule to ySUMO, it is quite possible that ySUMO binding activity may be maintained in the recovered hSUMO-1 cradle molecules. To examine this, the binding of hSUMO-1 cradle molecules to ySUMO using phage ELISA was assessed, cross-reactivity with hSUMO-2 was also tested. No hSUMO-1 cradle molecules showed binding to hSUMO-2, however approximately 50% of hSUMO-1 cradle molecules showed significant binding to ySUMO (Figure 14C). Interestingly, sequence analysis revealed no obvious differences in amino acid preferences for hSUMO-1 specific and cross-reactive cradle molecules (Figure 14D). These results suggest different origins of specificity in different cradle molecules and that specific binding to hSUMO- 1 likely requires multiple and varying mutations which exploit subtle differences in the amino acid preferences of ySUMO and hSUMO- 1 in the binding interface.
[0407] An alternative explanation for similar sequences of specific and non-specific cradle molecules is that phage ELISA using GST-fusions of target proteins can produce strong binding signals even for weak interactions. The low resolution of affinity in this assay may produce false positives for cross-reactivity. If many of the hSUMO-1 binding cradle molecules classified as crossreactive are actually specific, this could explain the similarity in sequence profiles between these two groups. Notably, the phage ELISA data are unlikely to produce false negatives for crossreactivity since even weak binding produces a significant signal. Thus, classification of hSUMO-1 cradle molecules as specific is likely to be accurate. However, Kd measurements for these cradle molecules are necessary to thoroughly and quantitatively assess cross-reactivity.
Diverse Fnlll Domain Variants Recognize the SIM-Binding Site of ySUMO and
Discriminate ySUMO from hSUMOs
[0408] To understand how Fnlll domain variants recognize ySUMO, the epitopes of two of the highest affinity ySUMO-binding Fnlll domain variants, ySMB-1 and ySMB-2 (Figures 16C, D and 17), were mapped using NMR chemical shift perturbation. Despite distinct amino acid sequences in their variable loops (Figure 16C), both Fnlll domain variants bound to similar epitopes centered on the SIM binding site (Figure 16E). Binding of 33 other ySUMO Fnlll domain variants was inhibited by ySMB-1, indicating that they too bound to the SIM-binding site (Figure 18). Like ySMB-1, most ySUMO-binding Fnlll domain variants have polyserine sequences in the BC and DE loops that originate from incomplete mutagenesis of the template vector in library construction, suggesting that these loops do not contribute to binding (Figures 16C and 17). Furthermore, many of these Fnlll domain variants have an 11-residue FG loop with a centrally located acidic residue and flanking aromatic and hydrophobic residues (Figures 16C and 17). Together, these results suggest that essentially all the ySUMO-binding Fnlll domain variants recognize the SIM-binding site using a similar mode of interaction.
[0409] Most ySUMO-binding Fnlll domain variants exhibited negligible levels of binding to hSUMOl or hSUM02 in phage ELISA assays (Figure 19A). Such high selectivity was unexpected, because the SIM-binding site is the most highly conserved surface between ySUMO and hSUMO proteins (Figure 16A). SPR measurements showed that ySMB-1 (selective for ySUMO in ELISA) bound to ySUMO with a 82 nM Kd and to hSUMOl with a -54 μΜ Kd and exhibited no detectable binding to hSUM02 (Figure 2 IB), discriminating ySUMO from hSUMOs by more than 600-fold in affinity. ySMB-9 (non-selective in ELISA) bound to all three SUMO proteins. Although ySMB-9 bound to hSUMOl with higher affinity (68 nM Kd) than either ySUMO or hSUM02 (Figure 19B), it discriminated hSUM02 by only ~ 70-fold, that is 10-fold less selective than ySMB-1. Notably, ySMB-9 does not have polyserine BC and DE loops like most other ySUMO-binding Fnlll domain variants, and it also has a significantly shorter FG loop (Figures 16B and 17). Although competition data suggested that ySMB-9 binds to the SIM-binding site (Figure 17), its distinct sequence features suggest that it employs a different mode of interaction than most ySUMO-binding Fnlll domain variants, leading to its lower specificity. Together, these findings demonstrate that the binding mode of most ySUMO-binding Fnlll domain variants is particularly effective in discriminating ySUMO and hSUMOs despite binding to the highly conserved SIM-binding site. Thus, it was expected that generating Fnlll domain variants that bind to hSUMOs in a mode similar to the ySUMO- binding Fnlll domain variants would yield clones with higher isoform selectivity toward hSUMOs.
Crystal Structure of the ySMB-l/ySUMO Complex.
[0410] To understand the structural basis for the isoform-selective recognition of the SIM- binding site, the crystal structure of ySMB-1 in complex with ySUMO at 2.4A resolution (structural statistics in Table 8) was determined. Consistent with the NMR epitope mapping data, ySMB-1 bound to the SIM binding site (Figures 20A and 16E). The Fnlll domain variant formed the binding surface using a single variable loop (FG loop) and residues from the invariant Fnlll beta strands (Figure 20A). As inferred from their polyserine sequences, the BC and DE loops of ySMB-1 were not involved in direct contacts with ySUMO.
[0411] Residues 78-85 of the ySMB-1 FG loop form a beta hairpin that provides 84% of the Fnlll domain variant binding surface with non-loop residues contributing the remainder (Figures 20B and 21 A). The edge of this hairpin docks along the hydrophobic center of the SIM-binding site forming an intermolecular beta sheet with ySUMO and closely mimicking the interaction mode of SIMs (Figures 20B, C) (Kerscher, supra, 2007; Reverter, D., and
Lima, C. D., Nature (2005) 435:687-692; Song, et al , J. Biological Chem. (2005)
280:40122-40129). SIMs generally contain a stretch of hydrophobic residues flanked by a stretch of acidic residues, e.g., DVLIVY (SEQ ID NO:296) in RanBP2 and TLDIVD (SEQ ID NO:294) in PIASx (Song, et al , supra, 2004; Li, et al, supra, 2010; Minty, et al , J. Biological Chem. (2000) 275, 36316-36323). In ySMB-1, this motif is mimicked by the FG loop sequence DLYYSY (SEQ ID NO:295) (residues 80-85) (Figures 16C, and 20B, C). D80 of the Fnlll domain variant aligns with the "top" basic portion of the SIM binding site in a similar orientation as a conserved acidic stretch in SIMs (Kerscher, supra, 2007; Song, et ah , supra, 2005) and Tyr residues line the hydrophobic tract where aliphatic residues are usually found in SIMs.
[0412] The cystal structure suggests a structural basis for isoform selectivity of ySUMO- binding Fnlll domain variants and for difficulties in generating Fnlll domain variants to hSUMOs. Only five of the sixteen residues in the ySMB-1 epitope are poorly conserved between ySUMO and hSUMOs (positions 25, 34, 36, 50 and 54) (Figure 10B, bottom). Three of these residues (N25, E34 and F36) form a cluster at one side of the interface that is highly buried, comprising 23% (147 A2) of total ySUMO surface buried by the Fnlll domain variant (Figures 20B and 22A). hSUMOl contains N25K and F36H. hSUM02 contains E34V and F36Q. Thus, any Fnlll domain variant that forms an interface similar to ySMB-1 is not likely to tightly bind to hSUMOl or hSUM02/3. Notably, this cluster is contacted in large part by scaffold residues in ySMB-1 (Y31, R33 and Y73) (Figures 20C and 22A). Because these beta strand residues were not varied in the library and are anchored in a conformationally rigid beta sheet, non-conservative substitutions in the cluster in hSUMOs could not have been accommodated, making the generation of ySMB-l-like Fnlll domain variants for hSUMOs impossible. These structural restraints would eliminate a potentially very large number of ySMB-l-like Fnlll domain variants that have an FG loop otherwise capable of binding to hSUMOs. Thus, these observations strongly suggest that residues within the Fnlll beta strands serve as both positive design elements favoring ySUMO binding and negative design elements disfavoring binding to hSUMOs.
Crystallographic Information And Refinement Statistics For The Structure Of The ySMB-l/ySUMO Complex (PDB ID: 3QHT)
] Data Collection*
Beamline APS 1 -11 ) 1
Space Group P2 |2|2
Cell Parameters a = 59.64 A, b = 175.46 A, c = 52.83 A ! α = β = γ = 90°
Wavelength 0.97872 A
Resolution 50.00 - 2.40 A (2.49 - 2.40 A)
Unique Reflections 22,586
j -" j?Merge 0.085 (0.643)
Completeness 100.0% (99.5%)
Figure imgf000111_0001
^Rbee is R with 5% of reflections sequestered before refinement.
Table 8 Interface Statistics For Fnlll Domain Variant ySMB-1 And SIM Peptides
ySMB-1 Average SIM Peptide*
Buried Surface 670 A2 635 + 80 A2
SC Value 0.72 0.77 + 0.02
] % Neutral and Non-Polar 64 64 + 12
Atoms in Interface
^Values reported arc the average for ? SI MO/SIM complexes ( PI )B I DS 1 WYW. 1 /5S. 2ASQ. 2 KQS and 2RPQ). The standard deviations in these values across all five complexes are given. Buried surface and % composition values calculated using the PROTORP server (Reynolds, et al, Bioinformatics (Oxford, England) (2009) 25:413-414). SC values calculated using the sc program in the CCP4 suite (The CCP4 Suite, Acta Cryst (1994) D50:760-763; Lawrence and Colman, J. Molec. Biol. (1993) 234:946-950). Structure-Guided Design of a SUMO-Targeted Cradle Library.
[0413] Based on the theory that the binding mode of ySMB-1 could be used as a template for designing isoform-specific cradle inhibitors of hSUMO/SIM interactions, a library was designed that was aimed at "reprogramming" ySMB-1 for binding to hSUMO proteins. Amino acid diversity at each ySMB-1 paratope position that included the wide-type amino acid and other amino acid types that might allow effective complementation of any of the three SUMO proteins was introduced (Figure 22A) (SI Methods). Notably, this library included diversity at previously invariant beta strand positions that participated in ySUMO binding. The number of independent clones in the constructed phage-display library was 2.0 x 109 giving reasonable coverage of the theoretical size of the design (1.6 x 10 n).
Selection of Cradle Molecules from the SUMO-Targeted Cradle Library.
[0414] After four rounds of library sorting against hSUMOl, hSUM02, and ySUMO, 32 randomly chosen clones for each target were assayed for binding activity using phage ELISA. All clones tested positive for binding in the cases of ySUMO and hSUMOl but none bound to hSUM02. Five ySUMO-binding and 10 hSUMOl -binding cradle molecules were expressed as soluble proteins and assessed using SPR, all of which produced binding signals (Figure 22B), consistent with phage ELISA results. For ySUMO, the cradle molecules exhibited K<j values similar to those of Fnlll domain variants from the previous naive library (39 nM to 3.3 μΜ) (Figures 17, 23 and 16C). For hSUMOl, K<j estimates ranged from 118 nM to 3.6 μΜ (Figure 22B). Thus, unlike the original library, the SUMO-targeted library readily produced cradle molecules with good affinity to both ySUMO and hSUMOl.
[0415] NMR chemical shift perturbation assays validated that a newly generated hSUMOl- binding cradle molecule, hSlMB-4, targeted the SIM-binding site (Figure 22C). Binding of 15 other hSUMOl -binding cradle molecules was inhibited by hSlMB-4 as tested in ELISA, strongly suggesting that all these hSUMOl -binding cradle molecules targeted the SIM binding site as intended (Figure 24).
[0416] The amino acid sequences of 44 hSUMOl -binding clones and 40 ySUMO-binding clones revealed that cradle molecules to both targets contained FG loop sequences highly similar to ySMB-1 (Figure 22D), suggesting that a ySMB-l-like binding mode was maintained in these cradle molecules and that ySMB-l-like FG loop sequences are effective for binding to both ySUMO and hSUMOl. In contrast, beta strand residues were sharply different in cradle molecules to the two targets (Figure 22D). The wild- type ySMB-1 beta strand residues were highly conserved among ySUMO-binding cradle molecules, but in hSUMOl -binding cradle molecules the wild-type amino acid was never recovered at position 33 and only infrequently
- I l l - recovered at position 31. These results strongly support the inventor's position that isoform selectivity in ySUMO-binding cradle molecules arises from contacts made by the non-loop regions of the cradle scaffold. Consistent with this mechanism, in a pair of cradle molecules with nearly identical FG loop sequences, hS lMB-22 and ySMB-ST6, it was observed that ySMB-ST6 containing the wild-type scaffold residues bound only to ySUM, while hS lMB-22 containing altered scaffold residues bound to both ySUMO and hSUMOl (Figures 22 A and 22E). Taken together these results illustrate the importance of altering non-loop residues in the Fnlll domain in order to facilitate binding to hSUMOl.
[0417] Modeling a ySMB-1 interface with hSUMOl provides a clear rationale for the observed mutations at non-loop residues in the hSUMOl -binding cradle molecules. N25K and F36H substitutions in hSUMOl with respect to ySUMO result in a likely electrostatic and steric clash between R33 of the Fnlll domain and K25 of hSUMOl as well as a loss of a close, edge- plane aromatic interaction between Y73 of the Fnlll domain and F36 in ySUMO (Figure 22F). Notably, the most favored amino acid types at position 33 in hSUMOl -binding cradle molecules were Ala and Glu, either of which should resolve a clash with K25, supporting this molecular mechanism for binding specificity. hSUMOl -Binding Cradle Molecules Are Isoform Specific.
[0418] hSUMOl -binding cradle molecules had varied ability to discriminate hSUMOl and ySUMO as assessed by phage ELISA (Figures 25A and 26A). There were several clones (e.g., hS lMB-7, 16 and 23) that showed no detectable binding to ySUMO, representing at least 100- fold weaker binding to ySUMO than to hSUMOl (Figures 25 A and 26A). The difference in the affinity of hS lMB-4 to ySUMO and hSUMOl , as measured by SPR, was ~20-fold, validating the phage ELISA experiment that gave a ~10-fold difference (Figures 25B and 26B). No distinct features were evident between the sequences of clones that did and did not discriminate ySUMO (Figure 26B), suggesting that the mechanism of ySUMO/hSUMO l discrimination is complex, likely involving several positions, and varied across different clones. As expected from the failure of our library to generate cradle molecules to hSUM02, the hSUMOl -binding cradle molecules showed no measurable binding to hSUM02 in phage ELISA (Figures 25A and 26A), and the affinity of hS lMB-4 to hSUM02 determined by SPR was very weak (Kd = 43 μΜ; Figure 25B), corresponding to 360 fold discrimination between hSUMOl and hSUM02. Taken together, these data demonstrate that the SUMO-targeted cradle library has the capacity of generating diverse cradle molecules that have high affinity and high specificity to hSUMOl. New Cradle Molecules Inhibit the SUMOl/SIM Interaction and SUMOl Conjugation.
[0419] To investigate the potential utility of hSUMOl-specific cradle molecules as tools for studying SUMO biology, their effects on three major processes: SUMO/SIM interactions, SUMOylation, and deSUMOylation were examined. hSlMB-4 completely inhibited the SIM- mediated interaction between SUMOl-RanGAP and RanBP2 (Johnson, supra, 2004; Mahajan, et al , Cell (1997) 88:97-107; Matunis, et al , J. Cell Biol. (1996) 135: 1457-1470) in a dose- dependent manner (Figure 27 A), further validating that these cradle molecules bind to the SIM- binding site as intended and demonstrating their efficacy as inhibitors of SUMO/SIM interactions.
[0420] The effects of cradle molecules on SUMOylation were then examined by monitoring the in vitro formation of covalent complexes between SUMOs and the SUMO El-activating (SAE1/SAE2) and E2-conjugating (Ubc9) enzymes of the SUMO conjugation cascade
(Figure 27B). In this assay, both hSUMOl and hSUM03 were present as substrates, enabling the direct assessment of the isoform specificity of the cradle molecules. In the absence of a cradle molecule or in the presence of the ySUMO-specific ySMB-1 cradle molecule, El and E2 were conjugated with both hSUMOl and hSUM03 (Figure 27B, lanes 1 and 2). In contrast, in the presence of either hSlMB-4 or hSlMB-5, conjugation of hSUMOl was inhibited at the El- dependent step, while hSUM03 conjugation was enhanced (Figure 27B, lanes 3-8). Because hSUMOl and hSUM03 compete for the same El-activating enzyme, the enhancement of hSUM03 conjugation is most likely because hSUMOl was effectively eliminated as a competitor and thus the El enzyme was more available to hSUM03. The potent inhibition of hSUMOl conjugation by the cradle molecules was remarkable, because a SIM-based peptide inhibitor did not inhibit this process (Li, et al. , supra, 2010).
[0421] Superposition of the ySMB-l/ySUMO complex structure with the crystal structure of the El/hSUMOl complex (Olsen, et al. , supra, 2010) suggests that a cradle molecule binding to hSUMOl in a manner similar to ySMB-1 would not cause steric clashes with the structurally well-defined regions of El. Rather, the cradle molecule would be positioned in the trajectory of a long disordered loop in the SAE1 subunit (residues -175-205) (Figure 28). As a result, it is contemplated that steric clashes between the cradle molecule and the SAE1 loop prevent binding of a cradle molecule/hSUMOl complex to El, thus inhibiting SUMOylation at the El dependent step. The previously reported inhibitor based on a SIM peptide is much smaller and would not likely cause such a steric hindrance, explaining why it did not inhibit SUMOylation (Li, et al , supra, 2010). hSlMB-4 was significantly more effective than hSlMB-5 in inhibiting SUMOylation (Figure 27B), although their Kd values for hSUMOl only differ by ~2-fold and their sizes are essentially identical (Figure 22B). This difference in inhibition efficacy could be explained by subtle variations in the spatial arrangement of the two cradle molecules when bound to hSUMOl, consistent with the proposed mechanism.
[0422] Neither hSlMB-4 nor hSlMB-5 affected deSUMOylation as assayed in vitro by monitoring SENP1 cleavage (Tatham and Hay, Methods Mol. Biol. (2009) 497:253-268) at the hSUMOl C-terminal di-glycine sequence (Figure 29). Superposition of the ySMB-l/ySUMO structure with the structure of hSUMOl bound to SENP1 (Shen, et al , Nat. Struct. Mol. Biol. (2006) 13: 1069-1077) suggests no apparent clashes between the cradle molecule and protease and that a cradle molecule binding similarly to ySMB-1 would not inhibit the SENPl/hSUMOl interaction.
Materials and Methods
[0423] Phage Display Library Construction. The SUMO-targeted phage display library was prepared as previously described (Koide, A., et al , supra, 2007) incorporating recent optimizations (Wojcik, et al , supra, 2010). The library was created using a "shaved" template containing polyserine sequences in the BC, DE, and FG loops. Amino acid diversity was introduced at FG loop and scaffold positions using degenerate codons as indicated in
Figure 11B and high-efficiency Kunkel mutagenesis.
[0424] Phage Display Selection. For use in selection, ySUMO, hSUMO-1 and hSUMO-2 were expressed as a C-terminal fusion to an engineered GST (glutathione- S -transferase) variant devoid of cysteine residues (C to S mutations) except for a single cysteine near the N-terminus. This was accomplished by cloning the genes into a previously reported vector (Wojcik, et al , supra, 2010). In the case of hSUMO-1 a C52A mutant was used and in the case of hSUMO-2 a C47S mutant was used. The GST fusion targets were modified with a redox cleavable biotin moiety using EZ-link Biotin HPDP (Pierce). For phage amplification, XLl-Blue E. Coli cells transformed with the Lacl containing plasmid pMCSG21 (termed XL21 cell) were used to maintain transcription silence until IPTG addition. Cradle molecules displaying phage were prepared by growing XL21 cells transfected with the phagemid library in the presence of 0.2 mM IPTG and helper phage K07 (Koide, A., and Koide, S., supra, 2007; Sidhu, S. S., et al , Methods Enzymol. (2000) 328:333-363). In the first round of library selection, 50 nM biotinylated GST-target was mixed with a sufficient amount of streptavidin-conjugated magnetic beads (Streptavidin MagneSphere® Paramagnetic Particles; Promega, Z5481/2) in TBS (50 mM Tris HC1 buffer pH 7.5 150 mM NaCl) containing 0.05% Tween 20 (TBST). Beads were blocked with a 5 μΜ solution of biotin in TBST. To this target solution, 1011"12 phage suspended in 0.5 ml TBST + 0.5% BSA were added, and the solution was mixed and incubated for 15 min. at room temperature. After washing the beads twice with TBST, the beads suspension containing bound phage were added to a fresh XL21 culture. Phages were amplified as described before (Sidhu, et al. , supra, 2000). In the second round, phage were preincubated in TBST + 0.5% BSA with 500 nM unbiotinylated GST competitor to remove GST binders from the population. Target binding phages were then captured by streptavidin conjugated magnetic beads loaded with 10 nM GST-target. Phages bound to the target protein were eluted from the beads by cleaving the linker within the biotinylation reagent with 100 mM DTT in 50 mM Tris pH=8.0. The phagemids were washed and recovered as described above. After amplification, the third and fourth rounds of selection were performed using 1 nM and 0.1 nM target respectively.
[0425] Protein Expression and Purification. GST-fusion proteins were produced by cloning genes into a previously described vector (Wojcik, et al , supra, 2010). All other proteins were expressed by cloning genes into the pHFT2 vector. pHFT2 is a pHFTl derivative containing a 10-His tag instead of 6-His. Unless otherwise noted, all proteins were expressed by growing BL21(DE3) cells harboring the appropriate pHFT2 vector in ZYP-5052
autoinduction media according to the methods of Studier, et al., Protein Express. Purif. (2005) 41 :207-234. Proteins were purified using Ni-Sepharose columns (GE Healthcare), or His-Mag magnetic particles (Novagen) in conjunction with a Kingfisher instrument (Thermo).
[0426] Surface Plasmon Resonance. Cradle molecules purified as described above were immobilized via His-tag to an NTA surface using a Biacore™ 2000 instrument so that the theoretical maximum response (Rmax) from target binding was 100-200 RU. Target protein at varying concentrations was then flowed over the surface at a flow rate of 30 μΕ/min and the binding signal recorded. Fitting of kinetic traces was carried out using the BIAevaluation software. For equilibrium experiments, the equilibrium binding response was recorded for multiple target concentrations and fit to a simple 1: 1 saturation binding curve.
[0427] Phage ELISA. For phage amplification, E. coli XLl-Blue cells transformed with the Lacl containing plasmid pMCSG21 (Stols, et al. , Protein Express. Purif. (2007)
53:396-403) (termed "XL21" hereafter) were used. Cradle molecule displaying phage were prepared by growing XL21 cells transfected with phagemid of individual clones in the presence of 0.2 mM IPTG and helper phage K07 (Koide, A., and Koide, S., supra, 2007; Sidhu, et al. , supra, 2000). Cultures were then centrifuged and phage containing supernatant used for ELISA assays. All incubations were at room temperature. In all instances except for the phage titration experiment used to test hSUMOl -binding cradle molecule specificity (Figure 26), wells of a 96- well Microlon© (Greiner) ELISA plate were treated with a 2 μg/mL solution of a GST-fusion of the appropriate target protein, or GST alone in 50 mM Tris CI buffer containing 150 mM NaCl, pH 7.5 (TBS) and incubated for 1 hour followed by blocking with 0.5% BSA in TBS for 1 hour. In the hSUMOl binder specificity experiment, 2 μg/mL NeutrAvidin® in TBS was coated, followed by blocking with 0.5% BSA and an addition of a 50 nM solution of his-tagged ySUMO, hSUMOl or hSUM02 in complex with the BT-Tris NTA compound, which non- covalently links a biotin moiety to a his-tag (Koide, A., et al , supra, 2007; Reichel, et al , Analytical Chem. (2007) 79:8590-8600), and incubated for 30 minutes. In epitope mapping competition experiments, wells coated with GST- target were then incubated with either 1 μΜ ySMB-1, or 1 μΜ hSlMB-4 in TBS or TBS only for one hour. In other experiments this step was not performed. After washing the wells with TBS + 0.1% Tween 20 (TBST), 50 μΐ of a 30% solution of phage supernatant in TBS + 0.5% BSA was added to the wells and incubated for 30 minutes. In the phage titration experiment, serial 5-fold dilutions of this 30% solution were also tested. In competition experiments, ΙμΜ ySMB-1, or ΙμΜ hSlMB-4 was included in the binding mixture. Bound phages were then detected using an anti-M13 antibody conjugated to horseradish peroxidase (GE Healthcare) in conjunction with the Ultra TMB ELISA colorimetric substrate (Pierce). Reactions were quenched after 5 minutes by addition of H2SO4 and phage binding quantified by absorbance measured at 450 nm.
[0428] NMR Epitope Mapping. NMR epitope mapping was performed by comparing chemical shifts in the ^-^N-HSQC spectra of labeled ySUMO and hSUMOl in the presence and absence of excess unlabeled cradle molecule. Uniformly 15N-labeled ySUMO and hSUMOl were produced by culturing BL21(DE3) cells harboring a pHFT2 derivative containing the ySUMO or hSUMOl gene in M9 media with 15NH4C1 as the sole nitrogen source. pHFT2 is a pHFTl (Huang, et al , supra, 2006) derivative containing a 10-His tag instead of 6-His. A hSUMOl mutant was used containing the C52A mutation. Protein expression was induced by the addition of 1 mM IPTG. Proteins were purified using a Ni- Sepharose column (GE Healthcare). After cleaving the N-terminal tag sequence with TEV protease, the proteins were concentrated and dissolved in 50 mM phosphate, 100 mM NaCl, pH = 6.5. ]H, 15N-HSQC spectra were collected on a Varian (Palo Alto, CA) INOVA 600 NMR spectrometer using pulse sequences provided by the manufacturer. All ySUMO spectra were recorded at 20°C. All hSUMOl spectra were recorded at 17°C. ySUMO resonances were assigned using previously reported assignments by Sheng, et al. (Sheng and Liao, Protein Sci. (2002) 11 : 1482-1491). hSUMOl resonances were assigned using previously reported assignments by Macauley, et al. J. Biological Chem. (2004) 279:49131-49137. Spectra were collected for the free [13N]-ySUMO (380 μΜ), free [13N]-hSUM01 (228 μΜ), [13N]-ySUMO (100 μΜ) in complex with unlabeled cradle molecule (200 μΜ) and [15N]-hSUM01 (242 μΜ) in complex with unlabeled cradle molecule (484 μΜ) in the above buffer. Residues affected by cradle molecule binding were identified by comparing the free and cradle molecule bound spectra. Amide cross-peaks were classified into five categories: strongly affected (a shift of greater than two peak widths), moderately affected (a shift of between one and two peak widths), weakly affected (a shift of approximately 1 peak width), unaffected (a shift of less than one peak width), and excluded (resonances that could not be unambiguously assigned) (Farmer, et al , Nature Struct. Biol. (1996) 3:995-997; Huang, et al , J. Molec. Biol. (1998) 281 :61-67).
[0429] X-ray Crystallography. ySMB-1 and ySUMO proteins were expressed and purified as described above. After removal of the tag sequence with TEV protease, the two proteins were mixed in a 1 : 1 molar ratio, concentrated to a total protein concentration of 4.9 mg/mL and dissolved in 10 mM Tris, 50 mM NaCl, pH = 8.0. The formation and
monodispersity of the complex was asserted by gel filtration. The ySMB-l/ySUMO complex was crystallized in 14% PEG 8000, 16% glycerol at 19 °C using the hanging drop vapor diffusion method. Crystals were frozen in a mixture of 80% mother liquor and 20% glycerol as a cryoprotectant. Diffraction data were collected at APS beamline 21-ID-F (Advanced Photon Source, Argonne National Laboratory). Crystal and data collection information are reported in Table 4. X-ray diffraction data were processed and scaled with HKL2000 (Otwinowski, Z., and Minor, W., Methods in Enz. (1997) 276:307-326). The structure was determined by molecular replacement using sequential search with two different models with the program MOLREP in CCP4 ((1994) The CCP4 suite). The ySUMO structure (residues 1013-1098 of chain C PDB ID code 2EKE) was used as a search model, along with the Fnlll structure with the variable loop regions deleted (PDB ID code 1FNA) (Dickinson, C, D., et al., J. Mol. Biol. (1994)
236: 1079-1092; Duda, et al., J. Molec. Biol. (2007) 369:619-630). Rigid body refinement was carried out with REFMAC5 (Murshudov, G. N., et al. , Acta Crystallogr D Biol Crystallogr (1997) 53:240-255). Model building and the search for water molecules was carried out using the Coot program (Emsley, P., and Cowtan, K., Acta Crystallogr D Biol Crystallogr (2004) 60:2126-2132). Simulated annealing was performed in CNS1.1 (Brunger, A. T., et al., Acta Crystallogr D Biol Crystallogr (1998) 54:905-921). The TLS (Translation/Libration/Screw) and bulk solvent parameters, restrained temperature factor and final positional refinement were completed with REFMAC5 (Murshudov, et al. , supra, 1997). Molecular graphics were generated using PyMOL (located on the World Wide Web at pymol.org). [0430] Design of the SUMO-targeted Cradle Library. Choice of positions and diversity in the SUMO-targeted library carried the following rationale. All residues of the FG loop were varied except one, S77 that did not contact ySUMO in the ySMB-l/ySUMO crystal structure and did not appear to be capable of direct participation in any similar interface. The inventors varied Y76 to D, H, N and Y, because, although it did not directly contact ySUMO in the ySMB-1 interface, it was suspected that this position may be capable of interacting with the conserved R55 in all SUMOs (Figure 22A). Leucine 81 of ySMB-1 is buried in a pocket in the ySUMO surface that is conserved across all SUMO isoforms, and an equivalent "anchor" leucine or valine is conserved in all SIM/SUMO complexes for which there are structures. As a result, the amino acid diversity at this position was restricted to F, L, I and V. E47 and S86 made very minimal contact in the ySMB-1 interface and were not varied. Though P87 of the FG loop did make significant contact in the ySMB-1 interface, it was held constant to avoid perturbation of the turn structure it introduces which would likely change the overall positioning of the FG loop.
[0431] Cradle Molecule Effects on SUMO/SIM Interactions. Wells of a Microlon© (Greiner) ELISA plate were coated with 2μg/mL GST-RanBP2 for 1 hour at room temperature. This IR1-M-IR2 construct of RanBP2 has been described previously (Tatham, et ah, Nat. Struct. Mol. Biol. (2005) 12:67-74). A complex was pre-formed between his-tagged
SUMOylated RanGAP (modified with SUMOl) and the BT-Tris-NTA reagent which non- covalently attaches a biotin moiety to a His-tag (Koide, A., et ah, Protein Eng. Des. Sel. (2009) 22:685-690; Reichel, et ah, supra, 2007). This complex was incubated with varying concentrations of hSlMB-4 for 1 hour and then the mixture was added to the ELISA plate and incubated for 30 min. Bound SUMO-RanGAP was then detected using a streptavidin- horseradish peroxidase conjugate in conjunction with the Ultra TMB ELISA reagent (Pierce). The reaction was quenched with 2M H2SO4, and the absorbance at 450 nm was measured.
[0432] Cradle Molecule Effects on SUMOylation. A mixture of hSUMOl and His6- SUM03 (24 μΜ ea.) was combined with either cradle molecule hSlMB-4 or hSlMB-5 at varying concentrations and incubated for 1 hour. A mixture of El (SAE1/2, 1.7 μΜ), E2 (Ubc9, 13.7 μΜ), and ATP (5.5 mM) was then added and the SUMOylation reaction allowed to proceed for 10 min. at 37°C. The reaction was then quenched by an addition of SDS-PAGE loading dye and reaction mixture was analyzed by SDS-PAGE.
[0433] Cradle Molecule Effects on DeSUMOylation. YFP-hSUMOl-ECFP fusion protein (63 μg/mL) was mixed with varying concentrations of cradle molecule hSlMB-4, hSlMB-5 or ySMB-1 as a control and incubated at room temperature for 30 mins. SENPl was then added at a final concentration of 32 nM and the mixture incubated for 15 min at 37°C. The reaction was stopped by putting the reaction containers on ice, adding SDS-PAGE sample buffer and then boiling for 5 mins. The reaction mixture was then analyzed by SDS-PAGE.
Example 9
Cradle Molecules Constructed Using Alternative Surfaces of the Fn!II Beta Sheets Library Design
[0434] The Fnlll domain has two beta sheets (Figure 30A), one constituted by beta strands A, B and E, and the other by beta strands C, D, F and G. The crystal structure of a cradle molecule in complex with its target, the Abl SH2 domain, revealed extensive interactions made by residues in the CDFG beta sheet region of the Fnlll domain that were not diversified in our library (Figure 30C) (Wojcik, et al , supra, 2010). Alanine scanning mutagenesis experiments demonstrated the energetic importance of these residues in binding (Wojcik, et al , supra, 2010). Similar use of these beta sheet surfaces was observed in a cradle molecule that bound to yeast small ubiquitin-like modifier (ySUMO) (Gilbreth, R. N., et al. , Proc Natl Acad Sci USA (2011) 108:7751-7756). These observations suggest that it may be possible to construct a target-binding surface that is distinct from the conventional design relied upon in antibody- mimic engineering, i. e. , interactions dominated by loops equivalent to the antibody
complementarity-determining regions (CDRs). The surface of the CDFG beta sheet is slightly concave, suggesting it is suitable for producing recognition surface complementary to convex surfaces found in most globular macromolecules.
[0435] To explore the efficacy of such alternative Fnlll library designs and how their performance compares to conventional loop-focused Fnlll engineering strategies, two distinct cradle molecule libraries were constructed. One library, which is called the cradle library, utilizes residues in beta strands C (residues 31 and 33) and D (residues 47 and 49) as well as residues in the FG and CD loops (Figures 30E and 31 A) to present a concave binding surface as described above. The other library, which is called the loop-only library, constitutes the conventional Fnlll library design utilizing positions in the BC, DE and FG loops with no residues diversified in the beta sheet regions (Figures 30D and 3 IB).
[0436] In both libraries, highly biased amino acid diversity and various loop lengths for the FG loop were used, as described previously (Wojcik, et al. , supra, 2010). In the loop-only library, this diversity was also used for positions in the BC loop that was also varied in length. The DE loop in the loop-only library was fixed in length and diversified only to Tyr or Ser with Gly also included at position 52 (Figure 3 IB). In the cradle library, codons that exclude Pro and Gly, amino acids that are likely detrimental to the structural integrity of the Fnlll domain, were used for positions in beta strand C, an internal beta strand. For beta strand D, an edge strand, a small subset of amino acids, Ala, Glu, Lys and Thr, was used. Ala and Thr were intended so as to avoid large side chains that might prevent target binding, and Glu and Lys were included as negative design elements to prevent aggregation mediated by the formation of an intermolecular beta sheet (Richardson, J. S., and Richardson, D. C, Proc Natl Acad Sci USA (2002)
99:2754-2759). Tyr73 was not diversified with a hope that this Tyr would always contribute to target interaction, as Tyr is highly suitable for making a protein-interaction interface (Koide, S., and Sidhu, S. S., ACS Chem Biol (2009) 4:325-334). Both libraries were constructed in the phage display format with estimated numbers of independent sequences of 2.0xl010 and 1.5xl010, respectively.
High- Affinity FNIII Cradle Molecules from the Cradle Librarie
[0437] The performance of the new cradle library with the conventional "loop only" library (Wojcik, et ah , supra, 2010) were compared using three targets, Abl SH2, human small ubiquitin-like modifier 1 (hSUMOl), and green fluorescent protein (GFP). The molecular platform for these libraries was identical, except for the locations of the diversified residues. These libraries contained similar numbers of independent sequences. For each combination of target and library, the following steps to generate cradle molecules were performed. First, cradle molecules from the phage display libraries were enriched. The N-terminal segment and C-terminal segment were then "shuffled" among cradle molecule clones in the enriched population for a given target, with a junction in the E strand to create a second-generation library in the yeast surface display format (Koide, et al. , supra, 2007). The gene shuffling step was incorporated to increase the sequence space beyond that sampled in the starting, phage- display library. Finally, the yeast surface display library was sorted using flow cytometry.
[0438] Fnlll domain variants to all the targets from both cradle and "loop only" libraries were generated. Many Fnlll domain variants exhibited high affinity with K<j values in the low nM range as measured in the yeast display format (Figures 31A-31C). These K<j values were in good agreement with those determined using purified Fnlll domain variants and surface plasmon resonance (Figure 3 ID). As in previously generated Fnlll domain variants, residues in the FG loop were mutated in all the Fnlll domain variants selected from both libraries, suggesting the central importance of the FG loop residues in target recognition of Fnlll domain variants. Some of the cradle molecules originating from the cradle libraries contained the wild- type CD loop and the D strand, suggesting either that these residues are not involved in target recognition in these cradle molecules or that substitutions of the wild-type residues did not confer affinity improvement. In contrast, the diversified positions in the C strand were mutated in all of the selected cradle molecules, and cradle molecules to different targets exhibited different amino acid sequences (Figure 31 A). When the C strand of a GFP-binding cradle molecule, GS#2, was changed back to the wild type sequence, the mutant completely lost binding to GFP (Figure 33). Together, these results support the importance of the C strand positions in target binding of cradle molecules derived from the cradle libraries.
[0439] It appears that the two libraries performed differently against different targets. For GFP, the cradle library clones had higher affinity than the counterparts from the loop-only library, but for hSUMOl the trend was opposite. High-affinity Fnlll domain variants were obtained from both libraries for Abl SH2. These results suggest that, whereas both libraries are capable of generating Fnlll domain variants to these diverse targets, the use of two distinct libraries increases the likelihood of generating highly functional Fnlll domain variants to a broader range of targets.
[0440] This work produced several loop-only Fnlll domain variants with good affinity for hSUMOl, whereas in a previous work a Fnlll domain variants termed ySMB-9 was the only hSUMOl binder that was recovered with a sub-μΜ ¾ (Gilbreth, et al , supra, 2011). One notable difference between the two studies is the inclusion of a loop-shuffling step in the present study. As shown below, the ySMB-9/hSUMOl crystal structure strongly suggests that residues from all three loops are important for binding in ySMB-9 and the same is likely true for the highly homologous cradle molecules isolated from the present work. Thus, consistent with previous studies (Hackel, et al , supra, 2008), loop shuffling expands the sequence space that can be searched and thus increases the probability of generating high-affinity Fnlll domain variants.
Crystal Structures of Cradle Molecule-Target Complexes Confirm Library Designs
[0441] The crystal structure of a cradle molecule isolated from the cradle library termed SH13 in complex with its target, the SH2 domain of Abl kinase, was determined at a resolution of 1.83A (Figures 31 A and 32A; Table 9). SH13 was among the initial cradle molecule clones generated directly from the phage-display libraries without loop shuffling and yeast display screening. Accordingly, it has low affinity with a ¾ value of ~4 μΜ. The SHI 3 cradle molecule maintained the Fnlll scaffold structure as evidenced by its minimal deviation from a previously determined cradle molecule structure (C RMSD < 0.7 A, excluding mutated residues) (Wojcik, et al. , supra, 2010; Gilbreth, et al. , supra, 2008). The overall structure of the Abl SH2 domain is likewise in good agreement with a previously published crystal structure of the Abl SH2 domain in complex with another cradle molecule (C RMSD < 0.5 A) (Wojcik, et al. , supra, 2010). The phospho-Tyr binding pocket of the SH2 domain contained electron density consistent with a sulfate ion, which was present in the crystallization solution.
Table 9 Data collection and refinement statistics (molecular re lacement)
Figure imgf000123_0002
AP , vance oton ource.
*Value hest resolution shell shown in parentheses
Rmerge
Figure imgf000123_0001
I(hkl)i - <l(hkl)> I /∑hki∑i< (¾/)i> over i observations of a reflection hkl. tR =∑ \ I (obs)l-I (calc)l I /∑ I (obs)l.
is R with 5% of reflections sequestered before refinement.
[0442] In accordance with the design of the cradle library, the SH13 cradle molecule binds to the target chiefly using the cradle surfaces (Figure 32A). The mode of interaction observed in the crystal structure is consistent with the epitope mapped using NMR chemical shift perturbation (Figure 32B). The concave surface presented by the cradle molecule effectively complements a convex surface of the Abl SH2 domain. The total surface area buried at the interaction interface is nearly 2000A2, with the SH13 cradle molecule contributing -1030 A2 and the Abl SH2 domain 960 A2. Notably, of the cradle molecule surface area buried in the interface, -90% is contributed by residues at positions that were diversified in the generation of the library. Similarly, out of 21 cradle molecule residues that are within 5 A of an SH2 atom, 15 were located at positions that were diversified in the cradle library. All but one of these 15 residues are directly involved in target recognition. The extensive contributions of diversified positions to the interface suggest that the library design is effective in concentrating amino acid diversity at positions that are capable of making direct contacts with a target. These characteristics also provide additional support for the utility of this face of the Fnlll beta sheets for constructing protein-interaction interfaces.
[0443] The epitope of the Abl SH2 domain recognized by SHI 3 is distinct from the phosphopeptide-binding interface that a previously reported cradle molecule recognizes (Wojcik, et ah , supra, 2010). However, the SH13 epitope is also a known functionally important surface of the SH2 domain. In the context of the full-length Abl kinase, this surface, centered on the aA helix, mediates interactions with the C-lobe of the kinase domain that help to keep the kinase in an inactive conformation. Almost a half (-475 A2) of the epitope for the SHI 3 cradle molecule is contributed by a linear segment including the entire aA helix and residues immediately adjacent to this helix (Figure 32B). The concave paratope of the SH13 cradle molecule seems suitable for recognizing the convex surface presented by this helix. It is unlikely that a cradle molecule with a convex paratope shape, typically observed in cradle molecules with exclusively loop-based binding surfaces, would be able to recognize this surface.
[0444] In order to better compare and contrast the structural basis for target recognition in Fnlll domain variants isolated from the two distinct types of libraries, the crystal structure of the Fnlll domain variant ySMB-9 bound to hSUMOl was determined at 2.15 A resolution
(Figure 32C; Table 9). The ySMB-9 Fnlll domain variant was recovered from the same "loop only" phage-display library using a slightly different selection scheme (Hogrefe, H. H., et ah , Gene (1993) 128: 119-126) and shows close homology to new hSUMOl cradle molecules recovered in this study (Figure 3 IB). Thus, the structure of the ySMB-9/hSUMOl complex provides a good example of how "loop only" Fnlll variants recognize their targets. The structure showed that ySMB-9 binds to hSUMOl in a "head-on" fashion using all three loops to form a contiguous binding surface in precisely the manner envisioned in typical loop-based Fnlll library designs (Figure 32C). The BC, DE and FG loops contribute 54%, 6% and 40% of the total Fnlll variant buried surface area respectively with no buried surface contributed by the beta sheet regions of the Fnlll domain.
[0445] The mode of interaction exhibited by the ySMB-9 Fnlll variant stands in stark contrast with the "cradle" surface employed by SH13 in binding to Abl SH2 (Figure 32A) and is also distinct from that previously observed for a yeast SUMO (ySUMO) -binding Fnlll variant, ySMB-1 (Figures 32C and 32D) (Gilbreth, et al , supra, 2011). The Fnlll variant ySMB-1 used the FG loop and the wild-type Fnlll scaffold to form a side-and-loop mode of interaction similar to that exhibited by SH13. Interestingly, both ySMB-1 and ySMB-9 bind to structurally equivalent, highly conserved epitopes in hSUMOl and ySUMO, respectively (Figure 32D). Thus, this pair of Fnlll variants demonstrate that both the "loop only" and "cradle" binding modes can be used to successfully recognize essentially the same target surface and further supports the validity of both library design strategies. Furthermore, the epitope recognized by ySMB-9 is flat in shape, demonstrating that, although loop-only binding surfaces tend to have convex shapes that would seem unsuitable for recognizing flat surfaces, it is possible to effectively produce binders to a flat epitope using a loop-only Fnlll variant library.
[0446] A new type of Fnlll cradle molecule library was developed in which positions for amino acid diversification are distinct from those of conventional Fnlll variant libraries. The new cradle library is effective in generating high- affinity cradle molecules, and its performance, compared with that of a conventional "loop only" library, appears different for different target molecules. Furthermore, the crystal structure of a cradle molecule from the new cradle library presents a concave paratope (Figure 32A), which is distinctly different from flat or convex paratopes often observed in Fnlll variants from "loop only" libraries (Figure 32C). The ability of the new library to produce concave paratopes is likely to be critical in using cradle molecules to inhibit protein-protein interaction interfaces, as the majority of protein surfaces range from flat to convex in shape. The SHI 3 structure showed that residues in the beta sheet region of the Fnlll domain underwent minimal backbone movements upon target binding. Thus, a small entropic penalty incurred by these residues upon binding may favorably contribute to achieving high affinity. Together, these results clearly illustrate that the single Fnlll domain can be used to produce diverse types of binding surfaces that collectively are capable of recognizing epitopes with distinct topography. This expands the utility of the Fnlll domain for producing synthetic binding interfaces.
[0447] In structural comparison of the Fnlll and immunoglobulin variable domains, the "DCFG" beta sheet of the Fnlll domain used for constructing a new binding site in this work corresponds to the beta sheet of the immunoglobulin variable domain that mediates heterodimerization between the variable domains of the heavy and light chains (Amzel, L. M., and Poljak, R. J., Annu Rev Biochem (1979) 48:961-997). Therefore, the immunoglobulin domains utilize this beta sheet surface for specific protein-protein interaction but not for recognizing foreign molecules. In the camelid single-domain antibodies (VHHS), the equivalent beta sheet contains several mutations, with respect to the conventional variable domain, that prevent heterodimerization (Desmyter, A., et ah , Nat Struct Biol (1996) 3:803-811 ; Hamers- Casterman, C, et al , Nature (1993) 363:446-448). Although the paratopes of most camelid VHHS reported to date are made with the three CDR loops and have convex topography
(De Genst, et al , Proc Natl Acad Sci USA (2006) 103:4586-4591), rare examples of VHH that use a binding mode equivalent to the "side and loop" mode have been identified
(Kirchhofer, A., et al. , Nat Struct Mol Biol (2010) 17: 133-138). These examples suggest that the VHH scaffold can also be used in the same manner as the Fnlll domain to generate such "side binders". The rarity of such VHH molecules is likely to originate from the manner by which their amino acid diversity is generated in the natural immune system. The gene recombination mechanism underlying the generation of immunoglobulin sequence diversity focuses on the CDRs (Wu, T., T., et al. , Proteins: Struct Funct Genet (1993) 16: 1-7).
Consequently, the "side" positions on the beta sheet are not extensively diversified in the natural immune repertoire, limiting the chance of generating "side binder" VHH molecules.
[0448] Whereas the Fnlll variants have been viewed as close mimics of antibodies due to their structural similarity, the design of the cradle library represents a departure from this "antibody mimic" mind set. It was emphasized that structural characterization of cradle molecule-target complexes was instrumental in identifying the unanticipated mode of cradle molecule-target interactions and the potential utility of the beta sheet surface for target recognition. Unlike immunoglobulin libraries derived from natural sources, cradle molecule libraries are generated using in vitro mutagenesis, affording full control over the choice of locations for amino acid diversification in a library. This freedom is an obvious but important advantage of synthetic scaffold systems. A similar approach should be effective in identifying distinct surfaces useful for constructing binding interfaces in other scaffolds. This design strategy gives general insights into the design of molecular recognition interfaces.
Materials and Methods
[0449] Protein production and modification. Target proteins (Abl SH2, hSUMOl, and GFP) and cradle molecules were produced as HislO-tag proteins using the pHFT2 vector (Koide, et al , supra, 2007), and purified as previously described (Gilbreth, et al , supra, 2011, Koide, A., et al, supra, 2009). The hSUMOl sample used in this work contained the C52A mutation that prevents dimer formation (Tatham, M. H., et al, J Biol Chem (2001)
276:35368-35374). Isotope-enriched samples were prepared as described previously
(Pham, T-N, and Koide, S., J Biomol NMR (1998) 11 :407-414). For SPR experiments, the His- tag segment of the targets was cleaved using the TEV protease. For crystallization the His-tag segment was removed from both the targets and cradle molecules.
[0450] Target proteins used for yeast display were biotinylated using EZ-Link NHS-PEG4- Biotin (Thermo Fisher Scientific). Typically 0.3-0.6 mg/ml of a target protein was incubated with 60 μΜ reagent for 30 min, and quenched the reaction by adding Tris-Cl (pH 8) at a final concentration of 0.1 M. Excess biotinylation reagent was removed by dialysis against 20 mM Tris CI buffer, pH 8 containing 100 mM NaCl and 1 mM EDTA. The level of biotinylation was determined to be ~ 1 per molecule using MALDI-TOF mass spectroscopy.
[0451] Phage and yeast display, library construction and selection. The "loop only" library has been described (Wojcik, et al. , supra, 2010). The cradle library was constructed using the Kunkel mutagenesis method as described previously (Koide, A., and Koide, S., supra, 2007, Sidhu, et al. , supra, 2000). Phage display selection was performed according to the methods previously described (Fellouse, F. A., et al. J Mol Biol (2007) 373:924-940, Koide, A., et al., supra, 2009). The His-tagged target proteins were incubated with equimolar
concentration of BTtrisNTA, a high affinity Ni-NTA compound containing a biotin moiety, for 30 min to form a BTtrisNTA/his-tagged protein complex, and the complex was incubated with cradle molecule phage-display libraries. The target concentrations used for rounds 1, 2 and 3 were 100, 100 and 50 nM for Abl SH2, 100, 50 and 50 nM for GFP, respectively, and 100 nM throughout for hSUMOl. Cradle molecule-displaying phages bound to the BTtrisNT A/target complexes were captured using Streptavidin (SAV)-coated magnetic beads. The captured phages were eluted with 10 mM EDTA solution that disrupts the linkage between the targets and BTtrisNTA. The recovered phages were amplified in the presence of 0.2 mM IPTG to induce the expression of cradle molecule -p3 fusion genes.
[0452] After three rounds of the phage-display library selection, the genes of selected cradle molecules was transferred to a yeast-display vector to make yeast libraries, using homologous recombination in yeast (Swers, J. S., et al., Nucleic Acids Res (2004) 32:e36). Gene shuffling during the construction of yeast-display libraries was incorporated as follows. A linearized yeast display vector, pGalAgaCamR (Koide, A., et al., J Mol Biol (2007) 373:941-953), was prepared using Ncol and Xhol digestion. Cradle molecule gene segments respectively encoding residues 1-74 and those for residues 54-94 separately were amplified using PCR from the enriched pool after the phage selection. Yeast strain EBY100 was then transformed using a mixture of the three DNA fragments. Correctly recombined clones contained the fusion gene for Aga2-cradle molecule- V5 tag. The transformants were selected in tryptophan-deficient media and Aga2-cradle molecule fusion protein was expressed as previously described (Koide, et al, supra, 2007, Boder and Wittrup, supra, 2000).
[0453] The yeast display libraries were sorted using 30 nM biotinylated Abl-SH2, 10 nM biotinylated hSUMOl, and 3 nM biotinylated GFP as described previously (Koide, et al, supra, 2007). The surface-displayed cradle molecules were detected with anti-V5 antibody (Sigma). NeutrAvidin® (NAV)-PE (InvitroGen) or SAV-PE (InvitroGen) and Alexa Fluor®-647 chicken anti-rabbit IgG (InvitroGen) were used as the secondary detection reagents for biotinylated protein and anti V5 antibody, respectively. A total of two rounds of library sorting were performed for Abl SH2 and hSUMOl, and one round for GFP.
[0454] Affinity measurements using yeast display. Individual clones from sorted libraries were isolated on agar plates and grown in liquid media as described previously (Koide, et al, supra, 2007, Boder and Wittrup, supra, 2000). Fifty thousand yeast cells for each clone were incubated with various concentrations of biotinylated target in the final volume of 20 μΐ in BSS buffer (50 mM Tris CI, 150 mM NaCl, pH 8, 1 mg/ml BSA) in the wells of a polypropyrene 96- well plate (Greiner 650201) on ice for 30 min with shaking. The wells of a 96- well filter plate (MultiScreenHTS HV, 0.45 μιη pore size; Millipore) were washed by adding 100 μΐ BSS and then removing the liquid by applying a vacuum. The cell suspensions from the binding reactions were transferred to the washed wells of the 96-well filter plate. The binding solution was removed by vacuum filtration. The yeast cells in the wells were washed with 100 μΐ of BSST (BSS buffer containing 0.1% Tween 20) twice in the same manner. Next, 20 μΐ of 10 μg/ml NAV-PE (InvitroGen) in BSS was added to each of the wells. After incubation on ice with shaking for 30 min, the cells were washed with BSST once. The cells were suspended in 300 μΐ BSS and analyzed using a Guava EasyCyte 6/L flow cytometer (Millipore). The Kd values were determined from plots of the mean PE fluorescence intensity versus target concentration by fitting the 1 : 1 binding model using the KaleidaGraph program (Synergy Software).
[0455] Surface plasmon resonance. All SPR measurements were carried out on a
Biacore™ 2000 instrument. For kinetic experiments, Abl SH2 was immobilized on a CM5 chip using amine coupling following methods provided by the manufacturer. Cradle molecules at varying concentrations were flowed over the surface at a flow rate of 100 μΐ/min and the binding signal was recorded. Quintuplicate data sets were processed and fit with a bimolecular model including mass transport using the Scrubber2 program (BioLogic Software, Campbell, Australia). The presence of mass transport was confirmed using varying flow rates.
Equilibrium experiments were performed as described previously (Gilbreth, et al , supra, 2011). Duplicate data sets were processed in Scrubber2 and saturation curves were fit with a 1 : 1 binding model using the Origin software (OriginLab, Northampton, MA).
[0456] Crystallization and structure determination. The SH13/Abl SH2 domain complex was purified with a Superdex 75 column (GE Lifesciences). The complex was concentrated to -10 mg/ml and crystallized in 0.2 M Magnesium chloride, 0.1 M Bis-Tris CI pH 5.5 and 25% PEG 3350 at 19°C by the hanging-drop vapor-diffusion method. The ySMB-9 and hSUMOl proteins were mixed in a 1 : 1 molar ratio, concentrated to a total protein concentration of -10 mg/mL and dissolved in 10 mM Tris CI, 50 mM NaCl, pH 8.0. The complex was crystallized in 24% PEG-8000, 0.1 M Imidazole, pH = 8.0 at 19°C using the hanging drop vapor diffusion method. Crystals were frozen in a mixture of 80% mother liquor and 20% glycerol as a cryoprotectant. Crystal and data collection information are reported in Table 1.
[0457] X-ray diffraction data were collected at the Advanced Photon Source beamlines (Argonne National Laboratory). Crystal and data collection information are reported in Supplementary Table 1. X-ray diffraction data were processed and scaled with HKL2000 (Otwinowski, Z., supra, 1997). The SH13/Abl SH2 structure was determined by molecular replacement using Phaser in the CCP4 program suite (The CCP4 Suite, supra ,1994;
Potterton, E., et al, Acta Cry stallo gr D Biol Crystallogr (2003) 59: 1131-1137). A multicopy search was performed with the Abl SH2 domain and the Fnlll scaffold, without the loop regions, as the search models (PDB IDs 2ABL and 1FNA, respectively). Simulated annealing, energy-minimization, B -factor refinement and map building were out using CNS (Brunger, A. T., et al, supra, 1998; Brunger, A. T., Nature protocols (2007) 2:2728-2733). The ySMB- 9/hSUMOl structure was determined by molecular replacement using sequential search with two different models with the program MOLREP in CCP4 (The CCP4 Suite, supra ,1994). The hSUMOl structure (residues 20-92 of chain B PDB ID code 1Z5S) was used as a search model, along with the Fnlll structure with the variable loop regions deleted (PDB ID code 1FNA) (Dickinson, et al, supra, 1994; Reverter, D., supra, 2005). Model building and the search for water molecules was carried out using the Coot program (Emsley, P., supra, 2004). TLS (Translation/Libration/Screw) and bulk solvent parameters, restrained temperature factor and final positional refinement were completed with REFMAC5 (Murshudov, et al , supra, 1997). Molecular graphics were generated using PyMOL (located on the World Wide Web at pymol.org). Surface area calculations were performed using the PROTORP protein-protein interaction server (Reynolds, et al, supra, 2009).
[0458] NMR spectroscopy. The following suite of spectra were taken on a uniformly 13C/15N enriched Abl SH2 domain (-200 μΜ) in 10 mM sodium phosphate buffer, pH 7.4 containing 150 mM NaCl, 50 μΜ EDTA and 0.005% sodium azide prepared in 90% H20 and 10% D20, using a Varian (Palo Alto, CA) INOVA 600 NMR spectrometer equipped with a cryogenic probe using pulse sequences provided by the manufacturer: ^^N-HSQC, HNCO, CBCACONH, HNCACB, CCONH, HN(CA)CO. NMR data were processed and analyzed using NMRPipe and NMR View software (Delaglio, F., et al, J Biomol NMR (1995) 6:277-293; Johnson, B. A., et al, J Biomol NMR (1994) 4:603-614). Resonance assignments were obtained using the PINE server (Bahrami, A., et al, PLoS Computational Biology (2009) 5:el000307) and verified by visual inspection in NMR view. For epitope mapping, the ^^N-HSQC spectra of the 15N enriched Abl SH2 domain (-60 μΜ) in the absence and presence of 1.25 fold molar excess of unlabeled SHI 3 cradle molecule were recorded. The ^^N-HSQC cross peaks were classified according to the degree of migration upon SHI 3 binding as described previously (Koide, et al, supra, 2007).

Claims

Claims We claim:
1. A fibronectin type III (Fnlll) domain-based cradle polypeptide comprising one or more amino acid substitutions in at least a loop region and at least a non-loop region.
2. The cradle polypeptide of claim 1, wherein the non-loop region is selected from the group consisting of a beta strand C, a beta strand D, a beta strand F, and a beta strand G.
3. The cradle polypeptide according to claim 1 or 2, wherein the loop region is selected from the group consisting of an AB loop, a BC loop, a CD loop, a DE loop, an EF loop and an FG loop.
4. The cradle polypeptide according to any one of claims 1-3, comprising one or more amino acid substitutions in two loop regions and/or two non-loop regions.
5. The cradle polypeptide of claim 4, wherein the non-loop regions are the beta strands C and F, and the loop regions are the CD and FG loops.
6. The cradle polypeptide according to any one of claims 1-5, wherein the one or more amino acid substitutions are introduced to the cradle residues in the beta strands.
7. The cradle polypeptide according to any one of claims 1-6, further comprising an insertion and/or deletion of at least one amino acid in at least one loop and/or non-loop region.
8. The cradle polypeptide of claim 7, which comprises an insertion and/or deletion of at least one amino acid in two loop regions and/or two non-loop regions.
9. The cradle polypeptide of claim 8, wherein the non-loop regions are the beta strands C and F, and the loop regions are the CD and FG loops.
10. The cradle polypeptide according to any one of claims 1-9, wherein the one or more amino acid substitutions in the non-loop region do not change the structure of the Fnlll domain scaffold and/or the shape of the loop regions.
11. The cradle polypeptide according to any one of claims 1-10, wherein the one or more amino acid substitutions in the non-loop region exclude the non-cradle residues.
12. The cradle polypeptide according to any one of claims 1-11, wherein the Fnlll domain is the 1st, 2nd, 3rd, 4th, 5*, 6th, 7*, 8*, 9*, 10*, 11*, 12*, 13*, 14*, 15* or 16* Fnlll domain of human fibronectin.
13. The cradle polypeptide of claim 12, wherein the Fnlll domain is the 7 , 10 or 14* Fnlll domain of human fibronectin.
14. The cradle polypeptide of claim 13, wherein the Fnlll domain is the 7 Fnlll domain of human fibronectin (Fnlll 07 ).
15. The cradle polypeptide of claim 13, wherein the Fnlll domain is the 10 Fnlll domain of human fibronectin (Fnlll10).
16. The cradle polypeptide of claim 13, wherein the Fnlll domain is the 14* Fnlll domain of human fibronectin (Fnlll14).
17. The cradle polypeptide according to any one of claims 1-16, wherein the CD loop is about 3-11 residues in length.
18. The cradle polypeptide of claim 17, wherein the CD loop is about 4-9 residues in length.
19. The cradle polypeptide of claim 18, wherein the CD loop is 5 residues in length.
20. The cradle polypeptide according to any one of claims 1-19, wherein the FG loop is about 1-10 residues in length.
21. The cradle polypeptide of claim 20, wherein the FG loop is about 5 or 6 residues in length.
22. The cradle polypeptide of claim 21, wherein the FG loop is 5 residues in length.
23. The cradle polypeptide of claim 21, wherein the FG loop is 6 residues in length.
24. The cradle polypeptide of claim 23, wherein position 1 of the FG loop is a Gly residue, position 2 of the FG loop is a Leu, Val or lie residue, position 3 of the FG loop is a charged or polar residue, position 4 of the FG loop is a Pro residue, position 5 of the FG loop is a Gly residue, and position 6 of the FG loop is a polar residue.
25. The cradle polypeptide of claim 22, wherein positions 3 and/or 5 of the FG loop are a Gly residue.
26. The cradle polypeptide according to any one of claims 1-25, wherein the beta strand C is about 6-14 residues in length and the beta strand F is about 8-13 residues in length.
27. The cradle polypeptide of claim 26, wherein the beta strand C is about 8-11 residues in length.
28. The cradle polypeptide of claim 27, wherein the beta strand C is 9 residues in length.
29. The cradle polypeptide according to any one of claims 26-28, wherein positions 2, 4, and 6 of the beta strand C are a hydrophobic residue.
30. The cradle polypeptide according to any one of claims 26-29, wherein positions 1, 3, 5 and 7-9 of the beta strand C are altered relative to the wild type sequence.
31. The cradle polypeptide according to any one of claims 26-30, wherein position 1 of the beta strand C is selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
32. The cradle polypeptide according to any one of claims 26-31, wherein position 3 of the beta strand C is a hydrophobic residue.
33. The cradle polypeptide according to any one of claims 26-32, wherein position 3 of the beta strand C is selected from the group consisting of lie, Val, Arg, Leu, Thr, Glu, Lys, Ser, Gin and His.
34. The cradle polypeptide according to any one of claims 26-33, wherein positions 5 and 7-9 of the beta strand C are selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
35. The cradle polypeptide according to any one of claims 26-34, wherein the beta strand F is about 9-11 residues in length.
36. The cradle polypeptide of claim 35, wherein the beta strand F is 10 residues in length.
37. The cradle polypeptide according to claim 35 or 36, wherein positions 1, 3, 5 and 10 of the beta strand F are altered relative to the wild type sequence.
38. The cradle polypeptide according to any one of claims 35-37, wherein positions
1, 3, 5 and 10 of the beta strand F are selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
39. The cradle polypeptide according to any one of claims 35-38, wherein positions
2, 4 and 6 of the beta strand F are a hydrophobic residue.
40. The cradle polypeptide according to any one of claims 35-39, wherein position 7 of the beta strand F is a hydrophobic residue.
41. The cradle polypeptide according to any one of claims 35-40, wherein position 7 of the beta strand F is selected from the group consisting of Arg, Tyr, Ala, Thr and Val.
42. The cradle polypeptide according to any one of claims 35-41, wherein position 8 of the beta strand F is selected from the group consisting of Ala, Gly, Ser, Val and Pro.
43. The cradle polypeptide according to any one of claims 35-42, wherein position 9 of the beta strand F is selected from the group consisting of Val, Leu, Glu, Arg and lie.
44. The cradle polypeptide of claim 15, wherein the amino acid substitutions comprise positions 30, 31, 32, 33, 34, 35, 36, 37, 38 and/or 39 of SEQ ID NO:l.
45. The cradle polypeptide of claim 44, wherein the amino acid substitutions comprise positions 31, 33, 35, 37, 38 and/or 39 of SEQ ID NO:l.
46. The cradle polypeptide of claim 45, wherein the amino acid substitutions comprise positions 31 and/or 33 of SEQ ID NO:l.
47. The cradle polypeptide of claim 15, wherein the amino acid substitutions comprise positions 44, 45, 46, 47, 48, 49, 50 and/or 51 of SEQ ID NO: l.
48. The cradle polypeptide of claim 47, wherein the amino acid substitutions comprise positions 44, 45, 47 and/or 49 of SEQ ID NO:l.
49. The cradle polypeptide of claim 15, wherein the amino acid substitutions comprise positions 40, 41, 42, 43, 44 and/or 45 of SEQ ID NO:l.
50. The cradle polypeptide of claim 15, wherein the amino acid substitutions comprise positions 67, 68, 69, 70, 71, 72, 73, 74, 75 and/or 76 of SEQ ID NO:l.
51. The cradle polypeptide of claim 50, wherein the amino acid substitutions comprise positions 67, 69, 71, 73 and/or 76 of SEQ ID NO:l.
52. The cradle polypeptide of claim 50, wherein the amino acid substitutions comprise positions 71, 73, 75 and/or 76 of SEQ ID NO:l.
53. The cradle polypeptide of claim 15, wherein the amino acid substitutions comprise positions 76, 77, 78, 79, 80, 81, 82, 83, 84, 85 and/or 86 of SEQ ID NO: l.
54. The cradle polypeptide of claim 53, wherein the amino acid substitutions comprise positions 84 and/or 85 of SEQ ID NO:l.
55. The cradle polypeptide of claim 15, wherein the amino acid substitutions comprise positions 85, 86, 87, 88, 89, 90, 91, 92, 93 and/or 94 of SEQ ID NO:l.
56. The cradle polypeptide of claim 15, wherein the amino acid substitutions comprise positions 31, 33, 47, 49, 73 and/or 75 of SEQ ID NO:l.
56. The cradle polypeptide of claim 14, wherein the amino acid substitutions comprise positions 33, 35, 37, 39, 40 and/or 41 of SEQ ID NO:97.
57. The cradle polypeptide of claim 14, wherein the amino acid substitutions comprise positions 42, 43, 44, 45, 46, 47 and/or 48 of SEQ ID NO:97.
58. The cradle polypeptide of claim 14, wherein the amino acid substitutions comprise positions 70, 72, 74, 76 and/or 79 of SEQ ID NO:97.
59. The cradle polypeptide of claim 14, wherein the amino acid substitutions comprise positions 80, 81, 82, 83, 84 and/or 85 of SEQ ID NO:97.
60. The cradle polypeptide of claim 16, wherein the amino acid substitutions comprise positions 31, 33, 35, 37 and/or 39 of SEQ ID NO:129.
61. The cradle polypeptide of claim 16, wherein the amino acid substitutions comprise positions 40, 41, 42, 43 and/or 44 of SEQ ID NO: 129.
62. The cradle polypeptide of claim 16, wherein the amino acid substitutions comprise positions 66, 68, 70, 72 and/or 75 of SEQ ID NO: 129.
63. The cradle polypeptide of claim 16, wherein the amino acid substitutions comprise positions 76, 77, 78, 79, 80 and/or 81 of SEQ ID NO: 129.
64. The cradle polypeptide of claim 14, comprising an amino acid sequence set forth in SEQ ID NO:468.
65. The cradle polypeptide of claim 15, comprising an amino acid sequence set forth in SEQ ID NO:469.
66. The cradle polypeptide of claim 16, comprising an amino acid sequence set forth in SEQ ID NO:470.
67. A chimeric cradle polypeptide according to any one of claims 1-66, wherein part of the cradle polypeptide is replaced by a non-FnIII domain polypeptide that enhances the binding affinity of the cradle polypeptide for a target molecule.
68. The chimeric cradle polypeptide of claim 67, wherein the non-FnIII domain polypeptide is all or part of a complementarity determining region (CDR) of an antibody or a T- cell receptor.
69. The chimeric cradle polypeptide of claim 68, wherein the CDR is a CDR1, CDR2 or CDR3 of a single domain antibody.
70. The chimeric cradle polypeptide of claim 69, wherein the single domain antibody is a nanobody.
71. The chimeric cradle polypeptide of claim 68, wherein the CDR replaces part or all of the AB, BC, CD, DE, EF or FG loop.
72. A multispecific cradle polypeptide comprising multiple copies of one or more monomer cradle polypeptides according to any one of claims 1-71.
73. The multispecific cradle polypeptide of claim 72, wherein the monomer cradle polypeptides are linked by a linker sequence.
74. The multispecific cradle polypeptide of claim 73, wherein the linker sequence is selected from the group consisting of GGGGSGGGGS (SEQ ID NO: 471), GSGSGSGSGS (SEQ ID NO: 472), PSTSTST (SEQ ID NO: 473) and EIDKPSQ (SEQ ID NO: 474).
75. A cradle library comprising a plurality of cradle polypeptides according to any one of claims 1-74.
76. The cradle library of claim 75, wherein the cradle polypeptides comprise one or more amino acid substitutions corresponding to amino acid positions 30, 41, 42, 43, 44, 45, 76, 77, 78, 79, 80, 81, 82, 83, 84 and/or 85 of SEQ ID NO:l.
77. The cradle library of claim 76, wherein the cradle polypeptides further comprise one or more amino acid substitutions corresponding to amino acid positions 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 32, 34, 35, 36, 37, 38, 39, 40, 46, 48, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 74, 75, 86, 87, 88, 89, 90, 91, 92, 93 and/or 94 of SEQ ID NO:l.
78. The cradle library of claims 75, wherein the cradle polypeptides are at least 50%, 60%, 70%, 80%, or 90% identical to SEQ ID NO:l.
79. The cradle library according to any one of claims 75-78, wherein the cradle polypeptides further comprise an insertion of at least 1 amino acid in at least one loop region.
80. The cradle library of claim 79, wherein the cradle polypeptides comprise an insertion of at least 2 amino acids in at least one loop region.
81. The cradle library of claim 80, wherein the cradle polypeptides comprise an insertion of about 2-25 amino acids in at least one loop region.
82. The cradle library according to any one of claims 79-81, wherein the cradle polypeptides comprise a deletion of at least 1 amino acid in at least one loop region.
83. The cradle library of claim 82, wherein the cradle polypeptides comprise a deletion of at least 2 amino acids in at least one loop region.
84. The cradle library of claim 83, wherein the cradle polypeptides comprise a deletion of about 2-10 amino acids in at least one loop region.
85. The cradle library according to any one of claims 79, 83 and 84, wherein the cradle polypeptides comprise a deletion of at least 2 amino acids in two loop regions.
86. The cradle library according to any one of claims 79-85, wherein the cradle polypeptides comprise at least 1 amino acid insertion and 1 amino acid deletion in at least one loop region.
87. The cradle library of claim 86, wherein the cradle polypeptides comprise an insertion and deletion of at least 1 amino acid in the same loop region.
88. The cradle library according to any one of claims 79-87, which is pre-selected to bind a target molecule.
89. The cradle library of claim 75, wherein the cradle polypeptides comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 79, 86 and 468-470.
90. The cradle library of claim 75, wherein the cradle library contains at least 10,
100, 1000, 104, 105, 106, 107, 108, 109, 1010, 10", 1012, 1013, 1014, 1015 or more different cradle polypeptides.
A polynucleotide encoding a cradle polypeptide according to any one of claims
1-74.
92. The polynucleotide of claim 91, wherein the polynucleotide is an expression construct.
93. The polynucleotide of claim 92, wherein the expression construct is capable of expressing the encoded polypeptide in a bacterium, yeast or mammalian system.
94. A polynucleotide library encoding a cradle library according to any one of claims
75-90.
95. A method of producing a cradle polypeptide comprising:
a) expressing a polynucleotide encoding a cradle polypeptide according to any one of claims 91-93 in a host cell; and
b) isolating and/or purifying the expressed cradle polypeptide.
96. A method of forming a cradle library of Fnlll domain polypeptides useful in screening for the presence of one or more polypeptides having a selected binding or enzymatic activity, comprising:
(i) aligning beta strands C and F amino acid sequences and loops CD and FG amino acid sequences in a collection of native Fnlll domain polypeptides,
(ii) segregating the aligned beta strand and loop sequences according to length,
(iii) for a selected beta strand or loop of the length from step (ii), performing positional amino acid frequency analysis to determine the frequencies of amino acids at each beta strand or loop position,
(iv) for each beta strand, loop, and length analyzed in step (iii), identifying at each position a conserved or selected semi-conserved consensus amino acid and other natural-variant amino acids,
(v) for at least one selected beta strand, loop, and length, forming:
(1) a cradle library of mutagenesis sequences expressed by a library of coding sequences that encode, at each beta strand or loop position, the consensus amino acid, and, if the consensus amino acid has a occurrence frequency equal to or less than a selected threshold frequency of at least 50%, a single common target amino acid and any co-produced amino acids, or
(2) a cradle library of natural-variant combinatorial sequences expressed by a library of coding sequences that encode, at each beta strand or loop position, a consensus amino acid and, if the consensus amino acid has a frequency of occurrence equal to or less than a selected threshold frequency of at least 50%, other natural variant amino acids, including semi-conserved amino acids and variable amino acids whose occurrence rate is above a selected minimum threshold occurrence at that position, or their chemical equivalents,
(vi) incorporating the library of coding sequences into framework Fnlll coding sequences to form an Fnlll expression library, and
(vi) expressing the Fnlll domain polypeptides of the expression library.
97. The method of claim 96, wherein the selected threshold frequency is 100%.
98. The method of claim 96, wherein the selected frequency is about 50-95%.
99. The method according to any one of claims 96-98, wherein step (ii) segregates the loops and loop lengths into the CD loop at about 3-11 residues in length.
100. The method of claim 99, wherein the CD loop is about 3-9 residues in length.
101. The method of claim 99, wherein the CD loop is about 4-9 residues in length.
102. The method of claim 99, wherein the CD loop is 5 residues in length.
103. The method according to any one of claims 96-102, wherein step (ii) segregates the loops and loop lengths into the FG loop at about 1-10 residues in length.
104. The method of claim 103, wherein the FG loop is about 5 or 6 residues in length.
105. The method of claim 103, wherein the FG loop is 5 residues in length.
106. The method of claim 103, wherein the FG loop is 6 residues in length.
107. The method of claim 106, wherein position 1 of the FG loop is a Gly residue, position 2 the FG loop is a Leu, Val or lie residue, position 3 the FG loop is a charged or polar residue, position 4 the FG loop is a Pro residue, position 5 the FG loop is a Gly residue, and position 6 the FG loop is a polar residue.
108. The method according to claim 105, wherein positions 3 and/or 5 of the FG loop are a Gly residue.
109. The method according to any one of claims 96-108, wherein step (ii) segregates the beta strands into the beta strand C at about 6-14 residues in length and the beta strand F at about 8-13 residues in length.
110. The method of claim 109, wherein the beta strand C is about 8-11 residues in length.
111. The method of claim 109, wherein the beta strand C is 9 residues in length.
112. The method of claim 111, wherein positions 2, 4 and 6 of the beta strand C are a hydrophobic residue.
113. The method of claim 111, wherein positions 1, 3, 5 and 7-9 of the beta strand C are altered relative to the wild type sequence.
114. The method of claim 113, wherein position 1 of the beta strand C is selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
115. The method of claim 113, wherein position 3 of the beta strand C is a hydrophobic residue.
116. The method of claim 113, wherein position 3 of the beta strand C is selected from the group consisting of He, Val, Arg, Leu, Thr, Glu, Lys, Ser, Gin and His.
117. The method of claim 113, wherein positions 5 and 7-9 of the beta strand C are selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
118. The method of claim 109, wherein the beta strand F is about 9-11 residues in length.
119. The method of claim 109, wherein the beta strand F is 10 residues in length.
120. The method of claim 119, wherein positions 1, 3, 5 and 10 of the beta strand F are altered relative to the wild type sequence.
121. The method of claim 120, wherein positions 1, 3, 5 and 10 of the beta strand F are selected from the group consisting of Ala, Gly, Pro, Ser, Thr, Asp, Glu, Asn, Gin, His, Lys and Arg.
122. The method of claim 119, wherein positions 2, 4 and 6 of the beta strand F are a hydrophobic residue.
123. The method of claim 119, wherein position 7 of the beta strand F is a hydrophobic residue.
124. The method of claim 119, wherein position 7 of the beta strand F is selected from the group consisting of Arg, Tyr, Ala, Thr and Val.
125. The method of claim 119, wherein position 8 of the beta strand F is selected from the group consisting of Ala, Gly, Ser, Val and Pro.
126. The method of claim 119, wherein position 9 of the beta strand F is selected from the group consisting of Val, Leu, Glu, Arg and lie.
127. The method according to any one of claims 96-126, wherein the native Fnlll domain polypeptides comprise the wild type amino acid sequences of the 1st, 2nd, 3rd, 4th, 5th, 6th, 7*, 8th, 9*, 10*, 11*, 12*, 13*, 14*, 15* and/or 16* Fnlll domain of human fibronectin.
128. The method of claim 127, wherein the native Fnlll domain polypeptides comprise the wild type amino acid sequences of the 7*, 10* and/or 14* Fnlll domain of human fibronectin.
129. A cradle library useful in screening for the presence of one or more cradle polypeptides having a selected binding or enzymatic activity designed using a method of forming a cradle library of Fnlll domain polypeptides according to any one of claims 96-128.
130. A method of identifying a cradle polypeptide having a desired binding affinity to a target molecule, comprising:
a) reacting a cradle library of Fnlll domain polypeptides according to any one of claims 75-90 and 129 with the target molecule, and
b) screening the cradle library of Fnlll domain polypeptides to select those having a desired binding affinity to the target molecule.
131. The method of claim 130, wherein the method further comprises the step of identifying the polynucleotides that encode the selected polypeptides.
132. The method according to claim 130 or 131, wherein the target molecule is selected from the group consisting of lysozyme, human Fc, human serum albumin (HSA), human small ubiquitin-like modifier 1 (SUMOl), human ubiquitin, human Abl SH2 domain, human Scm-like with four mbt domains 2 (SFMBT2), sex comb on midleg homolog 1
(SCMH1) domain and green fluorescent protein (GFP).
133. A cradle polypeptide selected using the methods according to any one of claims 130-132.
134. The cradle polypeptide of claim 134 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:4-78, 80-85, 87-96, 98, 99, 101-128, 130-141, 143, 145-147, 149-159, 161-199, 201-238 and 240-277.
135. A kit comprising, in a container, a cradle polypeptide according to any one of claims 1-74, 133 and 134.
136. A kit comprising, in a container, a cradle library according to any one of claims 75-90 and 129.
137. A kit comprising, in a container, a polynucleotide encoding a cradle polypeptide according to any one of claims 91-93.
138. A kit comprising, in a container, a polynucleotide library encoding a cradle library according to any one of claims 75-90 and 129.
PCT/US2011/046160 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof Ceased WO2012016245A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
EP11746713.4A EP2598529A2 (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof
MX2013001144A MX345300B (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof.
JP2013523251A JP6092773B2 (en) 2010-07-30 2011-08-01 Fibronectin cradle molecule and its library
US13/813,409 US9512199B2 (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof
SG2013006580A SG187225A1 (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof
AU2011283646A AU2011283646B2 (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof
CN2011800474318A CN103403027A (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof
CA2805862A CA2805862A1 (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof
RU2013108962/10A RU2013108962A (en) 2010-07-30 2011-08-01 FIBRONECTIN MOLECULES CONTAINING A POCKET AND THEIR LIBRARIES
KR1020137005001A KR20130136443A (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof
IL224220A IL224220A (en) 2010-07-30 2013-01-14 Fibronectin cradle molecules and libraries thereof

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US36920310P 2010-07-30 2010-07-30
US36916010P 2010-07-30 2010-07-30
US36922210P 2010-07-30 2010-07-30
US61/369,222 2010-07-30
US61/369,203 2010-07-30
US61/369,160 2010-07-30
US201161474648P 2011-04-12 2011-04-12
US201161474632P 2011-04-12 2011-04-12
US61/474,648 2011-04-12
US61/474,632 2011-04-12

Publications (2)

Publication Number Publication Date
WO2012016245A2 true WO2012016245A2 (en) 2012-02-02
WO2012016245A3 WO2012016245A3 (en) 2012-08-09

Family

ID=44504247

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/046160 Ceased WO2012016245A2 (en) 2010-07-30 2011-08-01 Fibronectin cradle molecules and libraries thereof

Country Status (12)

Country Link
US (1) US9512199B2 (en)
EP (3) EP3248987A1 (en)
JP (2) JP6092773B2 (en)
KR (1) KR20130136443A (en)
CN (2) CN103403027A (en)
AU (1) AU2011283646B2 (en)
CA (1) CA2805862A1 (en)
IL (1) IL224220A (en)
MX (1) MX345300B (en)
RU (1) RU2013108962A (en)
SG (1) SG187225A1 (en)
WO (1) WO2012016245A2 (en)

Cited By (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012142515A2 (en) 2011-04-13 2012-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
WO2012158739A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
WO2012158678A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
WO2013049275A1 (en) 2011-09-27 2013-04-04 Janssen Biotech, Inc. Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces
US8569227B2 (en) 2010-04-30 2013-10-29 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
US8728483B2 (en) 2008-05-22 2014-05-20 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
WO2014126871A1 (en) 2013-02-12 2014-08-21 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
WO2014126884A1 (en) 2013-02-12 2014-08-21 Bristol-Myers Squibb Company High ph protein refolding methods
US8853154B2 (en) 2012-09-13 2014-10-07 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
WO2014165093A2 (en) 2013-03-13 2014-10-09 Bristol-Myers Squibb Company Fibronectin based scaffold domains linked to serum albumin or a moiety binding thereto
US8969289B2 (en) 2010-05-03 2015-03-03 Bristol-Myers Squibb Company Serum albumin binding molecules
US9017655B2 (en) 2008-11-24 2015-04-28 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
US9139825B2 (en) 2009-10-30 2015-09-22 Novartis Ag Universal fibronectin type III bottom-side binding domain libraries
WO2015143156A1 (en) 2014-03-20 2015-09-24 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
US9200059B2 (en) 2008-10-31 2015-12-01 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US9234028B2 (en) 2008-02-14 2016-01-12 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9296810B2 (en) 2008-05-02 2016-03-29 Novartis Ag Fibronectin-based binding molecules and uses thereof
US9328157B2 (en) 2003-12-05 2016-05-03 Bristol-Myers Squibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
WO2016086036A2 (en) 2014-11-25 2016-06-02 Bristol-Myers Squibb Company Methods and compositions for 18f-radiolabeling of biologics
US9416170B2 (en) 2011-10-31 2016-08-16 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9562089B2 (en) 2010-05-26 2017-02-07 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US20170174748A1 (en) * 2014-03-20 2017-06-22 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type iii domains
WO2017210335A1 (en) 2016-06-01 2017-12-07 Bristol-Myers Squibb Company Imaging methods using 18f-radiolabeled biologics
US10221232B2 (en) 2006-11-22 2019-03-05 Bristol-Myers Squibb Company Methods of treating cancer by administering IGF-IR binding molecules
US10766946B2 (en) 2015-09-23 2020-09-08 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US10787498B2 (en) 2013-02-06 2020-09-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
EP3666897A4 (en) * 2017-07-31 2020-11-04 The University Of Tokyo VERY VERSATILE PROCESS FOR REPRESENTING A CYCLIC PEPTID ON A PROTEIN STRUCTURE
WO2021174045A1 (en) 2020-02-28 2021-09-02 Bristol-Myers Squibb Company Radiolabeled fibronectin based scaffolds and antibodies and theranostic uses thereof
CN113527526A (en) * 2021-09-14 2021-10-22 美慕(北京)科技有限公司 Recombinant protein and construction method and application thereof
US11299534B2 (en) 2016-12-14 2022-04-12 Janssen Biotech, Inc. CD8A-binding fibronectin type III domains
US11345739B2 (en) 2016-12-14 2022-05-31 Janssen Biotech, Inc CD137 binding fibronectin type III domains
US11352440B2 (en) 2014-11-21 2022-06-07 Bristol-Myers Squibb Company Antibodies against CD73 and uses thereof
US11447538B2 (en) 2013-02-01 2022-09-20 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
US11447539B2 (en) 2016-12-14 2022-09-20 Janssen Biotech, Inc. PD-L1 binding fibronectin type III domains
US11524992B2 (en) 2015-09-23 2022-12-13 Bristol-Myers Squibb Company Glypican-3-binding fibronectin based scaffold molecules
US11628222B2 (en) 2019-10-14 2023-04-18 Aro Biotherapeutics Company CD71 binding fibronectin type III domains
WO2023114510A3 (en) * 2021-12-17 2023-07-27 Denali Therapeutics Inc. Polypeptide engineering, libraries, and engineered cd98 heavy chain and transferrin receptor binding polypeptides
US11781138B2 (en) 2019-10-14 2023-10-10 Aro Biotherapeutics Company FN3 domain-siRNA conjugates and uses thereof
JP2023548889A (en) * 2020-11-10 2023-11-21 ニューヨーク・ユニバーシティ NPC1 monobody and its monobody conjugate
US12037379B2 (en) 2021-04-14 2024-07-16 Aro Biotherapeutics Company CD71 binding fibronectin type III domains
US12239710B2 (en) 2021-04-14 2025-03-04 Aro Biotherapeutics Company FN3 domain-siRNA conjugates and uses thereof
US12410260B2 (en) 2019-01-11 2025-09-09 The University Of North Carolina At Chapel Hill Highly modular biepitopic and bispecific CAR-T cells for cancer immunotherapy
US12491255B2 (en) 2019-10-14 2025-12-09 Aro Biotherapeutics Company EPCAM binding fibronectin type III domains

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012135284A2 (en) 2011-03-28 2012-10-04 Cornell University Targeted protein silencing using chimeras between antibodies and ubiquitination enzymes
RU2605326C1 (en) * 2015-12-07 2016-12-20 Федеральное государственное бюджетное научное учреждение "Научно-исследовательский институт биохимии" (НИИ биохимии) RECOMBINANT CHIMERIC PROTEIN SUMO3-apoA-I FOR PRODUCING MATURE HUMAN APOLIPOPROTEIN A-I, Pichia pastoris YEAST STRAIN - PRODUCER OF RECOMBINANT CHIMERIC PROTEIN SUMO3-apoA-I AND METHOD OF PRODUCING MATURE HUMAN APOLIPOPROTEIN A-I
US11680091B2 (en) 2018-02-23 2023-06-20 The University Of Chicago Methods and composition involving thermophilic fibronectin type III (FN3) monobodies
EP3765604A4 (en) * 2018-03-16 2022-01-05 Cornell University EDITING BROAD-SPECTRUM PROTEOME WITH A MANIPULATED BACTERIAL UBIQUITIN LIGASE MIMIC
US12162953B2 (en) 2019-12-06 2024-12-10 Yale University Enhanced targeting platform
CN111217903B (en) * 2020-02-25 2022-11-15 芜湖天明生物技术有限公司 Recombinant human fibronectin III 1-C and preparation method and application thereof
US12049483B2 (en) * 2020-12-05 2024-07-30 New York University Selective and noncovalent inhibitors of oncogenic RAS mutants
CN113527525B (en) * 2021-09-14 2021-12-17 美慕(北京)科技有限公司 Recombinant protein and construction method and application thereof
JPWO2023145861A1 (en) * 2022-01-27 2023-08-03
CN115976031B (en) * 2022-07-18 2023-06-23 烟台市华昕生物医药科技有限公司 A kind of recombinant fibronectin and its application
CN119751650B (en) * 2025-03-07 2025-07-04 英特菲尔(成都)生物制品有限责任公司 Long-acting heat-resistant stable recombinant humanized fibronectin and preparation method thereof

Citations (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4725677A (en) 1983-08-18 1988-02-16 Biosyntech Gmbh Process for the preparation of oligonucleotides
US4888286A (en) 1984-02-06 1989-12-19 Creative Biomolecules, Inc. Production of gene and protein analogs through synthetic gene design using double stranded synthetic oligonucleotides
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5324637A (en) 1991-10-11 1994-06-28 Promega Corporation Coupled transcription and translation in eukaryotic cell-free extract
US5492817A (en) 1993-11-09 1996-02-20 Promega Corporation Coupled transcription and translation in eukaryotic cell-free extract
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
US5665563A (en) 1991-10-11 1997-09-09 Promega Corporation Coupled transcription and translation in eukaryotic cell-free extract
US5798208A (en) 1990-04-05 1998-08-25 Roberto Crea Walk-through mutagenesis
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5866344A (en) 1991-11-15 1999-02-02 Board Of Regents, The University Of Texas System Antibody selection methods using cell surface expressed libraries
US5922545A (en) 1993-10-29 1999-07-13 Affymax Technologies N.V. In vitro peptide and antibody display libraries
US6194550B1 (en) 1990-08-02 2001-02-27 Larry Gold Systematic polypeptide evolution by reverse translation
US6214553B1 (en) 1997-01-21 2001-04-10 Massachusetts General Hospital Libraries of protein encoding RNA-protein fusions
US6261804B1 (en) 1997-01-21 2001-07-17 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6300065B1 (en) 1996-05-31 2001-10-09 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6348315B1 (en) 1997-04-23 2002-02-19 University of Zürich, Assignee for Josef Hanes Polysome display in the absence of functional ssrA-RNA
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US6423538B1 (en) 1996-05-31 2002-07-23 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US20030036092A1 (en) 1991-11-15 2003-02-20 Board Of Regents, The University Of Texas System Directed evolution of enzymes and antibodies
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US6673901B2 (en) 1997-06-12 2004-01-06 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20040058403A1 (en) 2000-10-27 2004-03-25 Harvey Barrett R. Combinatorial protein library screening by periplasmic expression
WO2004041862A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
US20050136428A1 (en) 2003-06-27 2005-06-23 Roberto Crea Look-through mutagenesis
US6951725B2 (en) 2001-06-21 2005-10-04 Compound Therapeutics, Inc. In vitro protein interaction detection systems
WO2006023144A2 (en) 2004-07-06 2006-03-02 Bioren Inc. Look-through mutagenesis for developing altered polypeptides with enhanced properties
US7022479B2 (en) 2000-01-24 2006-04-04 Compound Therapeutics, Inc. Sensitive, multiplexed diagnostic assays for protein analysis
US7063943B1 (en) 1990-07-10 2006-06-20 Cambridge Antibody Technology Methods for producing members of specific binding pairs
US7078197B2 (en) 1999-07-27 2006-07-18 Compound Therapeutics, Inc. Peptide acceptor ligation methods
US20060286603A1 (en) 2001-04-26 2006-12-21 Avidia Research Institute Combinatorial libraries of monomer domains
US7195880B2 (en) 1998-12-02 2007-03-27 Adnexus Therapeutics, Inc. DNA-protein fusions and uses thereof
US20090017654A1 (en) 2007-07-10 2009-01-15 Hon Hai Precision Ind. Co., Ltd. Power plug assembly with improved connector configuration
US20090176654A1 (en) 2007-08-10 2009-07-09 Protelix, Inc. Universal fibronectin type III binding-domain libraries
US20110038866A1 (en) 2008-05-02 2011-02-17 Novartis Ag Improved fibronectin-based binding molecules and uses thereof

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2564161T3 (en) * 2000-07-11 2016-03-18 Research Corporation Technologies, Inc Artificial antibody polypeptides
EP2141243A3 (en) * 2000-10-16 2010-01-27 Brystol-Myers Squibb Company Protein scaffolds for antibody mimics and other binding proteins
US7598352B2 (en) * 2000-11-17 2009-10-06 University Of Rochester Method of identifying polypeptide monobodies which bind to target proteins and use thereof
WO2003104418A2 (en) * 2002-06-06 2003-12-18 Research Corporation Technologies, Inc. Reconstituted polypeptides
AR056857A1 (en) 2005-12-30 2007-10-24 U3 Pharma Ag DIRECTED ANTIBODIES TO HER-3 (RECEIVER OF THE HUMAN EPIDERMAL GROWTH FACTOR-3) AND ITS USES
NZ574093A (en) 2006-06-12 2011-03-31 Symphogen As Pan-cell surface receptor- specific therapeutics
WO2009023266A1 (en) 2007-08-14 2009-02-19 Ludwig Institute For Cancer Research Generation of antibodies to cell-surface receptors and cancer-associated proteins including egfr family members
EP2205629A2 (en) 2007-10-16 2010-07-14 Symphogen A/S Compositions comprising optimized her1 and her3 multimers and methods of use thereof
TWI496582B (en) 2008-11-24 2015-08-21 必治妥美雅史谷比公司 Bispecific egfr/igfir binding molecules
ES2860453T3 (en) 2009-10-30 2021-10-05 Novartis Ag Universal libraries of type III fibronectin underside binding domain
BR112012012160B1 (en) 2009-11-13 2022-04-26 Amgen, Inc. Material and methods to treat or prevent diseases associated with her-3

Patent Citations (51)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4725677A (en) 1983-08-18 1988-02-16 Biosyntech Gmbh Process for the preparation of oligonucleotides
US4888286A (en) 1984-02-06 1989-12-19 Creative Biomolecules, Inc. Production of gene and protein analogs through synthetic gene design using double stranded synthetic oligonucleotides
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US7022500B1 (en) 1988-12-28 2006-04-04 Protein Design Labs, Inc. Humanized immunoglobulins
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US6180370B1 (en) 1988-12-28 2001-01-30 Protein Design Labs, Inc. Humanized immunoglobulins and methods of making the same
US6632927B2 (en) 1989-12-21 2003-10-14 Celltech Therapeutics Limited Humanized antibodies
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5798208A (en) 1990-04-05 1998-08-25 Roberto Crea Walk-through mutagenesis
US6649340B1 (en) 1990-04-05 2003-11-18 Roberto Crea Walk-through mutagenesis
US5830650A (en) 1990-04-05 1998-11-03 Roberto Crea Walk-through mutagenesis
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US7063943B1 (en) 1990-07-10 2006-06-20 Cambridge Antibody Technology Methods for producing members of specific binding pairs
US6194550B1 (en) 1990-08-02 2001-02-27 Larry Gold Systematic polypeptide evolution by reverse translation
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US6639055B1 (en) 1991-06-14 2003-10-28 Genentech, Inc. Method for making humanized antibodies
US5324637A (en) 1991-10-11 1994-06-28 Promega Corporation Coupled transcription and translation in eukaryotic cell-free extract
US5665563A (en) 1991-10-11 1997-09-09 Promega Corporation Coupled transcription and translation in eukaryotic cell-free extract
US20040072740A1 (en) 1991-11-15 2004-04-15 Board Of Regents, The University Of Texas System. Directed evolution of enzymes and antibodies
US5866344A (en) 1991-11-15 1999-02-02 Board Of Regents, The University Of Texas System Antibody selection methods using cell surface expressed libraries
US20030036092A1 (en) 1991-11-15 2003-02-20 Board Of Regents, The University Of Texas System Directed evolution of enzymes and antibodies
US20030100023A1 (en) 1991-11-15 2003-05-29 Board Of Regents, The University Of Texas System Immunoassay and antibody selection methods using cell surface expressed libraries
US5922545A (en) 1993-10-29 1999-07-13 Affymax Technologies N.V. In vitro peptide and antibody display libraries
US5492817A (en) 1993-11-09 1996-02-20 Promega Corporation Coupled transcription and translation in eukaryotic cell-free extract
US5830721A (en) 1994-02-17 1998-11-03 Affymax Technologies N.V. DNA mutagenesis by random fragmentation and reassembly
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
US6300065B1 (en) 1996-05-31 2001-10-09 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6699658B1 (en) 1996-05-31 2004-03-02 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6423538B1 (en) 1996-05-31 2002-07-23 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6214553B1 (en) 1997-01-21 2001-04-10 Massachusetts General Hospital Libraries of protein encoding RNA-protein fusions
US6261804B1 (en) 1997-01-21 2001-07-17 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6258558B1 (en) 1997-01-21 2001-07-10 The General Hospital Corporation Method for selection of proteins using RNA-protein fusions
US6348315B1 (en) 1997-04-23 2002-02-19 University of Zürich, Assignee for Josef Hanes Polysome display in the absence of functional ssrA-RNA
US6673901B2 (en) 1997-06-12 2004-01-06 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US7195880B2 (en) 1998-12-02 2007-03-27 Adnexus Therapeutics, Inc. DNA-protein fusions and uses thereof
US7078197B2 (en) 1999-07-27 2006-07-18 Compound Therapeutics, Inc. Peptide acceptor ligation methods
US7022479B2 (en) 2000-01-24 2006-04-04 Compound Therapeutics, Inc. Sensitive, multiplexed diagnostic assays for protein analysis
US20040058403A1 (en) 2000-10-27 2004-03-25 Harvey Barrett R. Combinatorial protein library screening by periplasmic expression
US20060286603A1 (en) 2001-04-26 2006-12-21 Avidia Research Institute Combinatorial libraries of monomer domains
US6951725B2 (en) 2001-06-21 2005-10-04 Compound Therapeutics, Inc. In vitro protein interaction detection systems
WO2004041862A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
US20050136428A1 (en) 2003-06-27 2005-06-23 Roberto Crea Look-through mutagenesis
WO2006023144A2 (en) 2004-07-06 2006-03-02 Bioren Inc. Look-through mutagenesis for developing altered polypeptides with enhanced properties
US20090017654A1 (en) 2007-07-10 2009-01-15 Hon Hai Precision Ind. Co., Ltd. Power plug assembly with improved connector configuration
US20090176654A1 (en) 2007-08-10 2009-07-09 Protelix, Inc. Universal fibronectin type III binding-domain libraries
US20110038866A1 (en) 2008-05-02 2011-02-17 Novartis Ag Improved fibronectin-based binding molecules and uses thereof

Non-Patent Citations (112)

* Cited by examiner, † Cited by third party
Title
"Antibody Engineering: Miniantibodies", 2001, SPRINGER-VERLAG, pages: 637 - 647
"Antibody Phage Display", 2001, HUMANA PRESS
"Current Protocols in Molecular Biology", 1987, JOHN WILEY & SONS
"Current Protocols in Molecular Biology", 1992, JOHN WILEY & SONS
"DNA Cloning", vol. 1, 2, 1985
"Large-Scale Mammalian Cell Culture Technology", 1990, MARCEL DEKKER, PUB.
"Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
"Oligonucleotide Synthesis", 1984
"Oxford Handbook of Nucleic Acid Structure", 1999, OXFORD UNIV PRESS
"PCR Essential Techniques: Essential Techniques", 1996, JOHN WILEY & SON LTD
"PCR Handbook Current Protocols in Nucleic Acid Chemistry", 1999, JOHN WILEY & SONS
"Phage Display: A Laboratorv Manual", 2001, CSHL PRESS
"The PCR Technique: RT-PCR", 1998, EATON PUB. CO.
AL-LAZIKANI, J. MOL. BIOL., vol. 273, 1997, pages 927 - 948
AMZEL, L. M., POLJAK, R. J., ANNU REV BIOCHEM, vol. 48, 1979, pages 961 - 997
BAHRAMI, A., PLOS COMPUTATIONAL BIOLOGY, vol. 5, 2009, pages E1000307
BETTER, HORWITZ, METH. ENZYMOL., vol. 178, 1989, pages 476
BODER, E. T., WITTRUP, K. D., METHODS ENZYMOL., vol. 328, 2000, pages 430 - 444
BOHREN, PROTEIN EXPRESS. PURIF., vol. 54, 2007, pages 289 - 294
BORDER ET AL.: "Yeast surface display for screening combinatorial polypeptide libraries", NATURE BIOTECHNOLOGY, vol. 15, 1997, pages 553 - 557
BORDER: "Yeast surface display for directed evolution of protein expression, affinity, and stability", METHODS ENZYMOL., vol. 328, 2000, pages 430 - 444, XP009103962, DOI: doi:10.1016/S0076-6879(00)28410-3
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83
BRUNGER, A. T ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 54, 1998, pages 905 - 921
BRUNGER, A. T., NATURE PROTOCOLS, vol. 2, 2007, pages 2728 - 2733
CHANG ET AL., J. BIOLOGICAL CHEM., vol. 285, 2010, pages 5266 - 5273
CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOTHIA, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHUPRETA ET AL., MOLEC. CELL. BIOL., vol. 25, 2005, pages 4272 - 4282
CLAMP ET AL., BIOINFORMATICS, vol. 20, 2004, pages 426 - 427
COBAUGH ET AL., J. MOL. BIOL., vol. 378, 2008, pages 622 - 633
CROOKS ET AL., GENOME RES., vol. 14, 2004, pages 1188 - 1190
DE GENST ET AL., PROC NATL ACAD SCI USA, vol. 103, 2006, pages 4586 - 4591
DELAGLIO, F. ET AL., J BIOMOL NMR, vol. 6, 1995, pages 277 - 293
DESMYTER, A. ET AL., NAT STRUCT BIOL, vol. 3, 1996, pages 803 - 811
DICKINSON, C., D. ET AL., J. MOL. BIOL., vol. 236, 1994, pages 1079 - 1092
DUDA ET AL., J. MOLEC. BIOL., vol. 369, 2007, pages 619 - 630
EMSLEY, P., COWTAN, K., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 60, 2004, pages 2126 - 2132
FARMER ET AL., NATURE STRUCT. BIOL., vol. 3, 1996, pages 995 - 997
FELLOUSE ET AL., J. MOL. BIOL., vol. 348, 2005, pages 1153 - 1162
FELLOUSE, F. A., J MOL BIOL, vol. 373, 2007, pages 924 - 940
GALLOP ET AL., J. MED. CHEM., vol. 37, 1994, pages 1233 - 1250
GAREAU, LIMA, NATURE REV., vol. 11, 2010, pages 861 - 871
GILBRETH, R. N. ET AL., J MOL BIOL, vol. 381, 2008, pages 407 - 418
GILBRETH, R. N., PROC NATL ACAD SCI USA, vol. 108, 2011, pages 7751 - 7756
GLENNIE ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367 - 2375
HAMERS-CASTERMAN, C., NATURE, vol. 363, 1993, pages 446 - 448
HECKER, J. BIOL. CHEM., vol. 281, 2006, pages 16117 - 16127
HOGREFE, H. H. ET AL., GENE, vol. 128, 1993, pages 119 - 126
HONEGGER, PLIICKTHUN, J. MOL. BIOL., vol. 309, no. 3, 2001, pages 657 - 70
HUANG, J. MOLEC. BIOL., vol. 281, 1998, pages 61 - 67
INNIS ET AL.: "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS
JOHNSON, ANNUAL REV. BIOCHEM., vol. 73, 2004, pages 355 - 382
JOHNSON, B. A. ET AL., J BIOMOL NMR, vol. 4, 1994, pages 603 - 614
JOHNSON, G., METHODS MOL. BIOL., vol. 51, 1995, pages 1 - 15
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1983, U.S. DEPT. OF HEALTH AND HUMAN SERVICES
KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KARPOVSKY ET AL., J. EXP. MED., vol. 160, 1984, pages 1686
KERSCHER, EMBO REPTS., vol. 8, 2007, pages 550 - 555
KIRCHHOFER, A. ET AL., NAT STRUCT MOL BIOL, vol. 17, 2010, pages 133 - 138
KÖHRER ET AL., PNAS, vol. 98, 2001, pages 14310 - 14315
KOIDE, A. ET AL., J MOL BIOL, vol. 373, 2007, pages 941 - 953
KOIDE, A. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 104, 2007, pages 6632 - 6637
KOIDE, A. ET AL., PROTEIN ENG. DES. SEL., vol. 22, 2009, pages 685 - 690
KOIDE, A., J MOL BIOL, vol. 284, 1998, pages 1141 - 1151
KOIDE, A., KOIDE, S., METHODS MOL. BIOL., vol. 352, 2007, pages 95 - 109
KOIDE, S., SIDHU, S. S., ACS CHEM BIOL, vol. 4, 2009, pages 325 - 334
KYTE, DOOLITTLE, J MOL BIOL., vol. 157, no. 1, 1982, pages 105 - 32
LEFRANC, DEV. COMP. IMMUNOL., vol. 27, no. 1, 2003, pages 55 - 77
LEI ET AL., J. BACTERIOL., vol. 169, 1987, pages 4379
LI ET AL., ONCOGENE, vol. 29, 2010, pages 3509 - 3518
LIU, MA ET AL., PROC. NATL. ACAD. SCI. U.S.A, vol. 82, 1985, pages 8648
LIVINGSTONE, BARTON, COMPUT. APPL. BIOSCI., vol. 9, 1993, pages 745 - 756
LO CONTE ET AL., J. MOL. BIOL., vol. 285, 1999, pages 2177 - 2198
MACAULEY ET AL., J. BIOLOGICAL CHEM., vol. 279, 2004, pages 49131 - 49137
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MAHAJAN ET AL., CELL, vol. 88, 1997, pages 97 - 107
MATUNIS ET AL., J. CELL BIOL., vol. 135, 1996, pages 1457 - 1470
MINTY ET AL., J. BIOLOGICAL CHEM., vol. 275, 2000, pages 36316 - 36323
MURSHUDOV, G. N. ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 53, 1997, pages 240 - 255
OLSEN ET AL., NATURE, vol. 463, 2010, pages 906 - 912
OTWINOWSKI, Z., MINOR, W., METHODS IN ENZ., vol. 276, 1997, pages 307 - 326
OWERBACH, BIOCHEMICAL BIOPHYSICAL RES. COMM., vol. 337, 2005, pages 517 - 520
PAULUS, BEHRING INS. MITT., vol. 78, 1985, pages 118 - 132
PERSSON ET AL., J. MOL. BIOL., vol. 357, 2006, pages 607 - 620
PHAM, T-N, KOIDE, S., J BIOMOL NMR, vol. 11, 1998, pages 407 - 414
PLUCKTHUN, METH. ENZYMOL., vol. 178, 1989, pages 476 - 515
POTTERTON, E. ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 59, 2003, pages 1131 - 1137
REICHEL ET AL., ANALYTICAL CHEM., vol. 79, 2007, pages 8590 - 8600
REVERTER, D., LIMA, C. D., NATURE, vol. 435, 2005, pages 687 - 692
RICHARDSON, J. S., RICHARDSON, D. C., PROC NATL ACAD SCI USA, vol. 99, 2002, pages 2754 - 2759
SAITOH, HINCHEY, J. BIOLOG. CHEM., vol. 275, 2000, pages 6252 - 6258
SAMBROOK, FRITSCH, MANIATIS: "Molecular Cloning", 1989, COLD SPRING HARBOR LABORATORY PRESS
SAYERS, J. R. ET AL., NUCLEIC ACIDS RES., vol. 16, 1988, pages 791 - 802
SCHNEIDER, STEPHENS, NUCLEIC ACIDS RES., vol. 18, 1990, pages 6097 - 6100
SEKIYAMA ET AL., J. BIOLOGICAL CHEM., vol. 283, 2008, pages 35966 - 35975
SHEN ET AL., NAT. STRUCT. MOL. BIOL., vol. 13, 2006, pages 1069 - 1077
SHENG, LIAO, PROTEIN SCI., vol. 11, 2002, pages 1482 - 1491
SIDHU, S. S. ET AL., METHODS ENZYMOL., vol. 328, 2000, pages 333 - 363
SKERRA ET AL., BIOTECHNOLOGY, vol. 9, 1991, pages 273 - 278
SONG ET AL., J. BIOLOGICAL CHEM., vol. 280, 2005, pages 40122 - 40129
SONG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 101, 2004, pages 14373 - 14378
STEINER ET AL., NAT. BIOTECHNOL., vol. 24, 2006, pages 823 - 831
STOLS ET AL., PROTEIN EXPRESS. PURIF., vol. 53, 2007, pages 396 - 403
STUDIER ET AL., PROTEIN EXPRESS. PURIF., vol. 41, 2005, pages 207 - 234
SWERS, J. S. ET AL., NUCLEIC ACIDS RES, vol. 32, 2004, pages E36
TATHAM ET AL., NAT. STRUCT. MOL. BIOL., vol. 12, 2005, pages 67 - 74
TATHAM, HAY, METHODS MOL. BIOL., vol. 497, 2009, pages 253 - 268
TATHAM, M. H. ET AL., J BIOL CHEM, vol. 276, 2001, pages 35368 - 35374
VERTEGAAL ET AL., MOL. CELL PROTEOMICS, vol. 5, 2006, pages 2298 - 2310
WU ET AL.: "Clustering of highly homologous sequences to reduce the size of large protein databases", BIOINFORMATICS, vol. 17, 2001, pages 282 - 283
WU, T., T., PROTEINS: STRUCT FUNCT GENET, vol. 16, 1993, pages 1 - 7
ZHU ET AL., J. BIOLOGICAL CHEM., vol. 283, 2008, pages 29405 - 29415

Cited By (116)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10995131B2 (en) 2003-12-05 2021-05-04 Bristol-Myers Squibb Company Libraries of modified fibronectin type III tenth domain-containing polypeptides
US9862758B2 (en) 2003-12-05 2018-01-09 Bristol-Myers Quibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
US9328157B2 (en) 2003-12-05 2016-05-03 Bristol-Myers Squibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
US11149077B2 (en) 2006-11-22 2021-10-19 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR
US10221232B2 (en) 2006-11-22 2019-03-05 Bristol-Myers Squibb Company Methods of treating cancer by administering IGF-IR binding molecules
US9920108B2 (en) 2008-02-14 2018-03-20 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US10781247B2 (en) 2008-02-14 2020-09-22 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9234028B2 (en) 2008-02-14 2016-01-12 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9296810B2 (en) 2008-05-02 2016-03-29 Novartis Ag Fibronectin-based binding molecules and uses thereof
US9902762B2 (en) 2008-05-22 2018-02-27 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
US8728483B2 (en) 2008-05-22 2014-05-20 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
US10774130B2 (en) 2008-05-22 2020-09-15 Bristol-Myers Squibb Company Method of treating cancer by administering multivalent fibronectin based scaffold domain proteins
US10654913B2 (en) 2008-10-31 2020-05-19 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US12291797B2 (en) 2008-10-31 2025-05-06 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US9200059B2 (en) 2008-10-31 2015-12-01 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US11479880B2 (en) 2008-10-31 2022-10-25 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US10040842B2 (en) 2008-10-31 2018-08-07 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US9017655B2 (en) 2008-11-24 2015-04-28 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
US10183987B2 (en) 2008-11-24 2019-01-22 Bristol-Myers Squibb Company Polynucleotides encoding bispecific EGFR/IGF-IR binding molecules
US9771411B2 (en) 2008-11-24 2017-09-26 Bristol-Myers Squibb Company Method of treating cancer by administering EGFR and EGFR/IGFIR binding molecules
US10954286B2 (en) 2008-11-24 2021-03-23 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
US9139825B2 (en) 2009-10-30 2015-09-22 Novartis Ag Universal fibronectin type III bottom-side binding domain libraries
US10253313B2 (en) 2009-10-30 2019-04-09 Novartis Ag Universal fibronectin type III bottom-side binding domain libraries
US9234029B2 (en) 2010-04-30 2016-01-12 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
US8569227B2 (en) 2010-04-30 2013-10-29 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
US9982253B2 (en) 2010-04-30 2018-05-29 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
US8969289B2 (en) 2010-05-03 2015-03-03 Bristol-Myers Squibb Company Serum albumin binding molecules
US10221438B2 (en) 2010-05-03 2019-03-05 Bristol-Myers Squibb Company Serum albumin binding molecules
US9540424B2 (en) 2010-05-03 2017-01-10 Bristol-Myers Squibb Company Serum albumin binding molecules
US10934572B2 (en) 2010-05-03 2021-03-02 Bristol-Myers Squibb Company Serum albumin binding molecules
US11161893B2 (en) 2010-05-26 2021-11-02 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US10273286B2 (en) 2010-05-26 2019-04-30 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US9562089B2 (en) 2010-05-26 2017-02-07 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US10214579B2 (en) 2011-04-13 2019-02-26 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
EP3415528A2 (en) 2011-04-13 2018-12-19 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
WO2012142515A2 (en) 2011-04-13 2012-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
EP3144320A1 (en) 2011-04-13 2017-03-22 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US9469676B2 (en) 2011-04-13 2016-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
EP3896083A1 (en) 2011-04-13 2021-10-20 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
EP3318880A1 (en) 2011-05-17 2018-05-09 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
US11060085B2 (en) 2011-05-17 2021-07-13 Bristol-Myers Squibb Company Methods for the selection of binding proteins
US9347058B2 (en) 2011-05-17 2016-05-24 Bristol-Myers Squibb Company Methods for the selection of binding proteins
US11913137B2 (en) 2011-05-17 2024-02-27 Bristol-Myers Squibb Company Methods for the selection of binding proteins
US10898538B2 (en) 2011-05-17 2021-01-26 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
WO2012158739A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
US10150962B2 (en) 2011-05-17 2018-12-11 Bristol-Myers Squibb Company Methods for the selection of binding proteins
WO2012158678A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
WO2013049275A1 (en) 2011-09-27 2013-04-04 Janssen Biotech, Inc. Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces
EP4151785A1 (en) 2011-09-27 2023-03-22 Janssen Biotech, Inc. Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces
US9897612B2 (en) 2011-09-27 2018-02-20 Janssen Biotech, Inc. Fibronectin type III repeat based protein scaffolds with alternative binding surfaces
EP3540100A1 (en) 2011-09-27 2019-09-18 Janssen Biotech, Inc. Fibronectin tyoe iii repeat based protein scaffolds with alternative binding surfaces
US9200273B2 (en) 2011-09-27 2015-12-01 Janssen Biotech, Inc. Fibronectin type III repeat based protein scaffolds with alternative binding surfaces
US10571472B2 (en) 2011-09-27 2020-02-25 Janssen Biotech, Inc. Fibronectin type III repeat based protein scaffolds with alternative binding surfaces
US11279751B2 (en) 2011-10-31 2022-03-22 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US10464995B2 (en) 2011-10-31 2019-11-05 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9522951B2 (en) 2011-10-31 2016-12-20 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9416170B2 (en) 2011-10-31 2016-08-16 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9765132B2 (en) 2011-10-31 2017-09-19 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US10604556B2 (en) 2011-10-31 2020-03-31 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9493546B2 (en) 2012-09-13 2016-11-15 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US11813315B2 (en) 2012-09-13 2023-11-14 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US10406212B2 (en) 2012-09-13 2019-09-10 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8993265B2 (en) 2012-09-13 2015-03-31 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8933199B2 (en) 2012-09-13 2015-01-13 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US9662373B2 (en) 2012-09-13 2017-05-30 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8853154B2 (en) 2012-09-13 2014-10-07 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US10245302B2 (en) 2012-09-13 2019-04-02 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US11447538B2 (en) 2013-02-01 2022-09-20 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
US11512124B2 (en) 2013-02-06 2022-11-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
US10787498B2 (en) 2013-02-06 2020-09-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
EP3744728A1 (en) 2013-02-12 2020-12-02 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
US11345722B2 (en) 2013-02-12 2022-05-31 Bristol-Myers Squibb Company High pH protein refolding methods
WO2014126884A1 (en) 2013-02-12 2014-08-21 Bristol-Myers Squibb Company High ph protein refolding methods
WO2014126871A1 (en) 2013-02-12 2014-08-21 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
EP3299378A1 (en) 2013-02-12 2018-03-28 Bristol-Myers Squibb Company High ph protein refolding methods
US11053278B2 (en) 2013-02-12 2021-07-06 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
US10183967B2 (en) 2013-02-12 2019-01-22 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
EP3617220A1 (en) 2013-02-12 2020-03-04 Bristol-Myers Squibb Company High ph protein refolding methods
US10065987B2 (en) 2013-02-12 2018-09-04 Bristol-Myers Squibb Company High pH protein refolding methods
WO2014165093A2 (en) 2013-03-13 2014-10-09 Bristol-Myers Squibb Company Fibronectin based scaffold domains linked to serum albumin or a moiety binding thereto
US10442851B2 (en) 2014-03-20 2019-10-15 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
EP3647322A1 (en) 2014-03-20 2020-05-06 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
US11203630B2 (en) 2014-03-20 2021-12-21 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
WO2015143156A1 (en) 2014-03-20 2015-09-24 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
US12529165B2 (en) 2014-03-20 2026-01-20 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
US12534511B2 (en) 2014-03-20 2026-01-27 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
US20170174748A1 (en) * 2014-03-20 2017-06-22 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type iii domains
US11407815B2 (en) 2014-03-20 2022-08-09 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
US10450363B2 (en) 2014-03-20 2019-10-22 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
US11352440B2 (en) 2014-11-21 2022-06-07 Bristol-Myers Squibb Company Antibodies against CD73 and uses thereof
WO2016086036A2 (en) 2014-11-25 2016-06-02 Bristol-Myers Squibb Company Methods and compositions for 18f-radiolabeling of biologics
EP4218832A2 (en) 2014-11-25 2023-08-02 Bristol-Myers Squibb Company Methods and compositions for 18f-radiolabeling of the fibronectin type (iii) domain
US10766946B2 (en) 2015-09-23 2020-09-08 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US11434275B2 (en) 2015-09-23 2022-09-06 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US11524992B2 (en) 2015-09-23 2022-12-13 Bristol-Myers Squibb Company Glypican-3-binding fibronectin based scaffold molecules
US12492238B2 (en) 2015-09-23 2025-12-09 Bristol-Myers Squibb Company Glypican-3-binding fibronectin based scaffold molecules
WO2017210335A1 (en) 2016-06-01 2017-12-07 Bristol-Myers Squibb Company Imaging methods using 18f-radiolabeled biologics
US11932680B2 (en) 2016-12-14 2024-03-19 Janssen Biotech, Inc. CD8A-binding fibronectin type III domains
US12559541B2 (en) 2016-12-14 2026-02-24 Janssen Biotech, Inc. CD8A-binding fibronectin type III domains
US11447539B2 (en) 2016-12-14 2022-09-20 Janssen Biotech, Inc. PD-L1 binding fibronectin type III domains
US11345739B2 (en) 2016-12-14 2022-05-31 Janssen Biotech, Inc CD137 binding fibronectin type III domains
US11299534B2 (en) 2016-12-14 2022-04-12 Janssen Biotech, Inc. CD8A-binding fibronectin type III domains
US12258385B2 (en) 2016-12-14 2025-03-25 Janssen Biotech, Inc. CD137 binding fibronectin type III domains
EP3666897A4 (en) * 2017-07-31 2020-11-04 The University Of Tokyo VERY VERSATILE PROCESS FOR REPRESENTING A CYCLIC PEPTID ON A PROTEIN STRUCTURE
US12410260B2 (en) 2019-01-11 2025-09-09 The University Of North Carolina At Chapel Hill Highly modular biepitopic and bispecific CAR-T cells for cancer immunotherapy
US12589159B2 (en) 2019-10-14 2026-03-31 Aro Biotherapeutics Company CD71 binding fibronectin type III domains
US11781138B2 (en) 2019-10-14 2023-10-10 Aro Biotherapeutics Company FN3 domain-siRNA conjugates and uses thereof
US12491255B2 (en) 2019-10-14 2025-12-09 Aro Biotherapeutics Company EPCAM binding fibronectin type III domains
US11628222B2 (en) 2019-10-14 2023-04-18 Aro Biotherapeutics Company CD71 binding fibronectin type III domains
WO2021174045A1 (en) 2020-02-28 2021-09-02 Bristol-Myers Squibb Company Radiolabeled fibronectin based scaffolds and antibodies and theranostic uses thereof
EP4243854A4 (en) * 2020-11-10 2024-12-11 New York University NPC1 MONOBODIES AND MONOBODIES CONJUGATES THEREOF
JP2023548889A (en) * 2020-11-10 2023-11-21 ニューヨーク・ユニバーシティ NPC1 monobody and its monobody conjugate
US12239710B2 (en) 2021-04-14 2025-03-04 Aro Biotherapeutics Company FN3 domain-siRNA conjugates and uses thereof
US12037379B2 (en) 2021-04-14 2024-07-16 Aro Biotherapeutics Company CD71 binding fibronectin type III domains
CN113527526A (en) * 2021-09-14 2021-10-22 美慕(北京)科技有限公司 Recombinant protein and construction method and application thereof
WO2023114510A3 (en) * 2021-12-17 2023-07-27 Denali Therapeutics Inc. Polypeptide engineering, libraries, and engineered cd98 heavy chain and transferrin receptor binding polypeptides

Also Published As

Publication number Publication date
AU2011283646B2 (en) 2015-07-09
SG187225A1 (en) 2013-02-28
EP3248987A1 (en) 2017-11-29
MX345300B (en) 2017-01-24
AU2011283646A1 (en) 2013-03-07
MX2013001144A (en) 2013-06-05
US9512199B2 (en) 2016-12-06
RU2013108962A (en) 2014-09-10
KR20130136443A (en) 2013-12-12
IL224220A (en) 2017-07-31
CA2805862A1 (en) 2012-02-02
JP2016192973A (en) 2016-11-17
CN103403027A (en) 2013-11-20
EP3222631A3 (en) 2017-11-22
JP2013539362A (en) 2013-10-24
JP6092773B2 (en) 2017-03-08
US20140057807A1 (en) 2014-02-27
EP3222631A2 (en) 2017-09-27
WO2012016245A3 (en) 2012-08-09
CN107903321A (en) 2018-04-13
EP2598529A2 (en) 2013-06-05

Similar Documents

Publication Publication Date Title
US9512199B2 (en) Fibronectin cradle molecules and libraries thereof
Koide et al. Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold
ES2860453T3 (en) Universal libraries of type III fibronectin underside binding domain
ES2402576T3 (en) Antibody ultrahumanization by generation and selection of predicted mature cdr cohort and blast libraries
CA2900745C (en) Scaffold proteins derived from plant cystatins
US9885050B2 (en) Molecular affinity clamp technology and uses thereof
AU2008287426A1 (en) Universal fibronectin type III binding-domain libraries
AU2014210475B2 (en) Protein combination-based Fv library, and preparation method therefor
Steemson et al. Tracking molecular recognition at the atomic level with a new protein scaffold based on the OB-fold
Hentrich et al. Monoclonal antibody generation by phage display: History, state-of-the-art, and future
Contreras-Martínez et al. Intracellular ribosome display via SecM translation arrest as a selection for antibodies with enhanced cytosolic stability
US20160003843A1 (en) Engineered antibody scaffolds
Yasui et al. A sweet protein monellin as a non-antibody scaffold for synthetic binding proteins
Velappan et al. Construction, characterization and crystal structure of a fluorescent single-chain Fv chimera
EP1773994A2 (en) Polypeptide
Chen et al. Lesson from a Fab-enabled co-crystallization study of TDRD2 and PIWIL1
Ravindran et al. Improvement of the crystallizability and expression of an RNA crystallization chaperone
Fischman et al. Redirecting an anti-IL-1β antibody to bind a new, unrelated and computationally predicted epitope on hIL-17A
Pai et al. Conversion of scFv peptide-binding specificity for crystal chaperone development
Huang Design of leaps in protein function and implications for protein evolution
Venegas Generating and Characterizing Phosphospecific Affinity Reagents Using the Forkhead-Associated 1 Domain
Griffin Engineering and characterization of rhizavidin and Fab affinity reagents that possess unique function

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11746713

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 224220

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2805862

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2013/001144

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2013523251

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2011746713

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20137005001

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013108962

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2011283646

Country of ref document: AU

Date of ref document: 20110801

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013002345

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 13813409

Country of ref document: US

ENP Entry into the national phase

Ref document number: 112013002345

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20130130