WO2012010849A2 - Methods of diagnosis and vaccines - Google Patents

Methods of diagnosis and vaccines Download PDF

Info

Publication number
WO2012010849A2
WO2012010849A2 PCT/GB2011/001104 GB2011001104W WO2012010849A2 WO 2012010849 A2 WO2012010849 A2 WO 2012010849A2 GB 2011001104 W GB2011001104 W GB 2011001104W WO 2012010849 A2 WO2012010849 A2 WO 2012010849A2
Authority
WO
WIPO (PCT)
Prior art keywords
mycoplasma
mhf
polypeptide
infection
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2011/001104
Other languages
French (fr)
Other versions
WO2012010849A3 (en
Inventor
Emily Ngaire Barker
Iain Robertson Peters
Christopher Richard Helps
Séverine TASKER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Bristol
Original Assignee
University of Bristol
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Bristol filed Critical University of Bristol
Publication of WO2012010849A2 publication Critical patent/WO2012010849A2/en
Publication of WO2012010849A3 publication Critical patent/WO2012010849A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/30Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycoplasmatales, e.g. Pleuropneumonia-like organisms [PPLO]
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56911Bacteria
    • G01N33/56933Mycoplasma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/55Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
    • A61K2039/552Veterinary vaccine
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/195Assays involving biological materials from specific organisms or of a specific nature from bacteria
    • G01N2333/30Assays involving biological materials from specific organisms or of a specific nature from bacteria from Mycoplasmatales, e.g. Pleuropneumonia-like organisms [PPLO]

Definitions

  • the present invention relates to methods of diagnosis of haemoplasma infection, and vaccines for the prevention of the same.
  • the methods and vaccines relate to the cat.
  • haemoplasmas is the trivial name given to a group of erythrocyte parasitizing bacteria of the genus Mycoplasma within the Mollicutes class. They are most closely related to the pneumoniae group of mucosal mycoplasmas. Analysis of 16S ribosomal RNA gene sequences from haemoplasmas resulted in their recent reclassification from the Haemobartonella and Eperythrozoon genera. The haemoplasma group can be further divided into haemofelis and haemominutum clades based on 15S rRNA and Ribonuclease P ribosomal gene phytogeny.
  • Diagnosis of haemoplasma infection was originally based on clinical signs and visualisation of epierythrocytic bodies by light microscopic examination of blood smears. More recently PCR technology has superseded cytology for diagnosis due to its superior sensitivity and specificity. PCR assays have also allowed accurate determination of the prevalence of the various haemoplasma species within their respective hosts. Development of serological assays for the diagnosis of haemoplasmosis has been attempted in the past. While early attempts by one group were reported to have been promising (unpublished data), no further information has been submitted for publication (Turner and others 1986).
  • Haemoplasmas have been found to infect a wide variety of mammalian species, from squirrel monkeys to llamas (Hoelzle 2008). And while they appear to be relatively host specific, different haemoplasmas may exist within an individual host (Kenny and others 2004, Tasker and others 2003, Willi and others 2006a).
  • CMhm prevalence ranges from 8.5 to 46.6%, Mhf prevalence from 0.2 to 21.7%, and CMt prevalence from 0.5 to 26.1 % (Bauer and others 2008, Fujihara and others 2007, Gentilini and others 2009, Kamrani and others 2008, Peters and others 2008, Roura and others 2010, Tasker 2006a, Willi and others 2006a, Willi and others 2006b).
  • Prevalence of the canine haemoplasmas ranges are even greater with Mhc prevalence from 0.9 to 20.0% and CMhp prevalence from 0.3 to 33.4%, with occasional dual-haemoplasma infections (Barker and others 2008, Inokuma and others 2006, Kenny and others 2004, Roura and others 2010, Wengi and others 2008).
  • haemotropic mycoplasmas is found in Tasker (2010). Infections with haemoplasmas can range from being asymptomatic, through mild pyrexia, to life- threatening (and occasionally fatal) haemolytic anaemia even in immunocompetent individuals. Of the feline haemoplasmas Mhf appears to be most significant in terms of haemolysis (Tasker 2006b).
  • CMhm Cats infected with CMhm are rarely clinically unwell, although a mildly lowered haematocrit is not uncommon when infected cats are compared to controls (George and others 2002, Tasker and others 2004, Tasker and others 2009b). A mildly lowered haematocrit was also seen in cats infected with CMt in a recent experimental study (Tasker and others 2009b). However, cats naturally infected with CMt are frequently found to be concurrently infected with one or more of the other haemoplasmas.
  • haemoplasma infection has been shown to modify response to viral and malarial infections, as well as response to irradiation (Baker and others 1971 , Contamin and Michel 1999).
  • the potential role of haemoplasma infection in modifying the pathogenicity of other infections has yet to be fully elucidated in cats.
  • CMhm infection has been associated with fatal myeloproliferative disease in chronically FeLV infected cats (George and others 2002), whilst other studies examining the effect of chronic FIV infection on acute Mhf or CMhm infection found no significant haematological differences between the retroviral positive and negative groups (Tasker and others 2006a, b). Long-term co-morbidity studies of natural cat populations have been limited by the presence of chronic infections and the lack of assays to determine exposure to haemoplasmas in the absence of a positive PCR result.
  • dnaK DNA chaperone heat shock protein 70
  • GPDH glyceraldehyde-3-phosphate dehydrogenase
  • EF-Tu elongation factor thermo-unstable
  • EF-Tu of Mycoplasma pneumoniae has been shown to mediate binding to host fibronectin (Balasubramanian and others 2009). Some of these proteins are also immunogenic and have been suggested as vaccine candidates in particular species, such as GAPDH in the respiratory pathogen Mycoplasma bovis (Perez-Casal and Prysliak 2007).
  • GAPDH in the respiratory pathogen Mycoplasma bovis
  • a 40KDa immunoreactive GAPDH homolog of Ms, MSG1 has been shown to be expressed at both surface and cytosolic locations, have GAPDH activity and appeared to have a role in erythrocyte adhesion (Hoelzle and others 2007c).
  • a 70KDa immunoreactive protein of Ms, HspA1 was determined to be a dnaK homolog; a finding that was supported by ATPase activity of the expressed recombinant HspA1 (Hoelzle and others 2007b).
  • Recombinant MSG1 has been trialled as a vaccine candidate in the pig; however despite induction of anti-MSG1 antibodies they were not protective against a high-dose infection challenge (Hoelzle and others 2009).
  • In an analysis of the immunoproteome of Mycoplasma mycoides subsp. mycoides which infects cattle a number of proteins were identified as being immunogenic, including gapA, dnaK, EF-Tu and phosphoglycerate kinase (pgk) (Jores and others 2009).
  • Ms proteins MSG1 and HspA1 have been generated and used in ELISA-based serological diagnostic assays for the detection of Ms infection in pigs and was found to be comparable to whole cell preparations (Hoelzle and others 2007a).
  • a fragment of Mhf dnaK has also been expressed and used in western blots to detect the presence of anti-dnaK antibodies in cats experimentally infected with Mhf, CMhm or CMt (Museux and others 2009).
  • EF-Ts Elongation Factor - Temperature sensitive
  • gapA glycosyl-phosphate dehydrogenase
  • pgk phosphoglycerate kinase
  • Mhf or CMhm are useful as immunogenic marker proteins or in a vaccine for cats.
  • GapA and pgk are both metabolic proteins found in the cytoplasm of bacteria playing an integral role in glycolytic metabolic pathways. Due to reductive evolution mycoplasmas have lost a significant number of genes, as a result some proteins have evolved to function in multiple roles within the cell. It is impossible to predict which of these metabolic proteins will be used in this way in individual species, more so whether they will play a role in the bacterial immunome.
  • a first aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 14 (Mhf EF-Ts) or a variant or fragment thereof.
  • SEQ ID No 14 provides the native amino acid sequence of Mhf elongation factor temperature- sensitive (EF-Ts).
  • EF-Ts forms part of a complex with elongation factors Tu and G, which together facilitate the events of translation (i.e. protein synthesis, where the DNA sequence is 'read' and amino-acids strung together).
  • EF-Ts serves as the guanine nucleotide exchange factor for EF-Tu, catalyzing the release of GDP from EF- Tu, allowing a molecule of GTP to bind in its place, so permitting the entry of the next aminoacyl rRNA into the ribosome. This may be assayed by incorporation into an ELISA, probing a western blot with plasma/serum or via enzymatic assays.
  • a second aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 10 (Mhf pgk) or SEQ ID No 26 (CMhm pgk) or a variant or fragment thereof.
  • SEQ ID No 10 provides the partial native amino-acid sequence of Mhf phosphoglycerate kinase
  • SEQ ID No 26 provides the native amino acid sequence of CMhm phosphoglycerate kinase.
  • the Mhf pgk fragment comprised the N-terminal 344 amino-acids of what is suspected to be a total of 400-415 amino-acids of the complete protein.
  • Pgk is an ubiquitous enzyme that catalyses the formation of ATP to ADP and vice versa acting as a transferase enzyme in the seventh step of glycolysis ⁇ This could be assayed by incorporation into an ELISA, probing a western blot with plasma/serum or via enzymatic assays.
  • a third aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 6 (Mhf gapA) or SEQ ID No 22 (CMhm gapA) or a variant of fragment thereof.
  • SEQ ID No 6 provides the native amino acid sequence of Mhf glyceraldehyde-3-phosphate dehydrogenase
  • SEQ ID No 22 provides the native amino acid sequence of CMhm glyceraldehyde-3-phosphate dehydrogenase.
  • GapA catalyzes the sixth step of glycolysis converting glyceraldehyde 3-phosphate to D- glycerate 1 ,3-bisphosphate.
  • a fourth aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 18 (CMhm dnaK) or a variant or fragment thereof.
  • SEQ ID No 18 provides the native amino acid sequence of CMhm DNA chaperone heat shock protein dnaK.
  • the expression of heat shock proteins is up regulated in response to cell stressors such as heat or other environmental changes. More specifically heat shock protein 70, aka. dnaK, functions as an intra-cellular chaperone for other proteins permitting correct protein folding and preventing protein aggregation during unfavourable conditions. It may also be present at lower levels as a house-keeping protein fulfilling similar functions. This could be assayed by incorporation into an ELISA, probing a western blot with plasma/serum or via enzymatic assays.
  • a fifth aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 2 (Mhf dnaK) or a variant thereof, or a fragment thereof with the amino acid sequence MSKKETIIG (SEQ ID No 29) or a fragment thereof from the sequence from position 309 to position 602 of Figure 3 (sequence B).
  • SEQ ID No 2 provides the native amino acid sequence of Mhf DNA chaperone heat shock protein dnaK.
  • Figure 3 indicates the amino-acid alignment between SEQ ID No 2 and the fragment of Mhf dnaK described by Museux and others (2009).
  • Position 309 onwards starts with the sequence QILLVGG (SEQ ID No 30) and so on, and ends with the sequence KTEVDKTKS (SEQ ID No 31).
  • the polypeptide is substantially free of other polypeptides with which it is naturally associated in the mycoplasma cell.
  • the polypeptide is substantially pure.
  • the polypeptide may be in a composition where it accounts for at least 95% of the total polypeptide, such as at least 96%, 97%, 98%, 99% or 99.5% as judged by Coomassie blue staining of a preparation separated by SDS-PAGE.
  • variant of the polypeptide we include polypeptides in which the sequence homology is at least 80% or 85% or 90%, more preferably at least 91 % or 92% or 93% or 94% or 95% or 96% or 97% or 98% or 99% or 99.5%, the % homology being assessed using the BLASTp algorithm [http://blast.ncbi.nlm.nih.gov/Blast.cgi, BLASTp (protein-protein BLAST), NCBI non-redundant protein sequence database (Altschul and others 1990).
  • the variants include polypeptides in which 1 or 2 or 3 or 4 or 5 or 6 or 7 or 8 or 9 or 10 or 11 or 12 or 13 or 14 or 15 or 16 or 17 or 18 or 19 or 20 amino acids have been replaced with another amino acid or have been deleted.
  • amino acids have been added to the polypeptide, for example in order to aid purification.
  • Suitable tags to facilitate purification include poly-histidine additions.
  • the variant retains the enzymatic active of the native polypeptide as given.
  • the variant is cross-reactive with the native polypeptide.
  • the variant is preferably able to bkid antibodies that have been raised to the native polypeptide, which can be tested for, for example by using a suitable ELISA.
  • fragment of the polypeptide we include fragments of the polypeptide that constitute 20% of the length of the native polypeptide, typically at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 97%.
  • the fragment is at least 20 amino acids, such as at least 30, 40, 50, 60, 70, 80 amino acids in length.
  • the fragment is cross- reactive with the native polypeptide.
  • the fragment is preferably able to bind antibodies that have been raised to the native polypeptide, which can be tested for, for example by using a suitable ELISA.
  • the fragment is either MSKKETIIG (SEQ ID No 29) or is a fragment from position 309 to position 602 of Figure 3 (sequence B).
  • polypeptide when used, unless the context does not allow it, the term includes the variants and fragments as defined including, in particular, the variants and fragments that are cross-reactive with the native polypeptide.
  • polypeptides and variants and fragments are typically immunogenic in the cat, giving rise to an immune response that can be measured by detecting antibodies to the polypeptide in the serum of a cat that has been immunised with the polypeptide or variant or fragment, for example by using an ELISA.
  • a sixth aspect of the invention provides a polynucleotide which encodes a polypeptide of any of the first, second, third, fourth or fifth aspects of the invention.
  • the polynucleotide is typically DNA, but may be RNA.
  • Preferred polynucleotides of the invention are SEQ ID No 1 , SEQ ID No 3, SEQ ID No 5, SEQ ID No 7, SEQ ID No 9, SEQ ID No 1 1 , SEQ ID No 13, SEQ ID No 15, SEQ ID No 17, SEQ ID No 19, SEQ ID No 21 , SEQ ID No 23, SEQ ID No 25 and SEQ ID No 27.
  • Codon usage refers to the triplet nucleotides that encode a specific amino-acid residue in a polypeptide chain or the termination of translation (stop codons).
  • the 'opal' codon UGA encodes for the amino-acid residue tryptophan, whilst in the majority of bacteria (including the Escherichia coli) UGA is a stop codon.
  • site-directed mutagenesis may be employed to convert the UGA codons to UGG, which also encodes the inclusion of tryptophan but is not translated as a stop codon in either the standard or mycoplasma codon usage tables.
  • a seventh aspect of the invention provides an expression vector comprising the polynucleotide of the sixth aspect of the invention.
  • the expression vector when present in a suitable host cell, allows for the expression of the polypeptides of the invention.
  • the expression vector may be a bacterial or yeast or insect cell or mammalian cell expression vector. It is preferred if the expression vector is a bacterial expression vector, such as an E. coli expression vector.
  • Suitable expression vectors are known in the art, for example in Sambrook et al Molecular Cloning, a laboratory manual, 2 nd edition, Cold Spring Harbor Laboraory Press, Card Spring Harbor, NY. ChampionTM pET Directional TOPO® Expression Kits (Invitrogen) manual part no. 25-0400 describes the use of this expression vector
  • An eighth aspect of the invention provides a host cell comprising a polynucleotide or expression vector of the invention.
  • the host cell may be any suitable host cell such as a bacterial cell, a yeast cell, an insect cell or a mammalian cell. Bacterial cells are preferred. Suitable host cells are known in the art, for example in Sambrook ef al.
  • polypeptides of the invention suitably are obtained by culturing a host cell which expresses the polypeptide by recombinant means, and then extracting the polypeptide from the host cell or culture medium (if secreted).
  • the polypeptide may be purified using methods well known in the art, such as ion-exchange chromatography, size-exclusion chromatography, affinity chromatography and the like.
  • purification using Ni 2* -affinity chromatography may be used.
  • the polypeptides of the invention may be packaged and presented for use in medicine, in particular in veterinary medicine.
  • the polypeptide or polypeptides of the invention may be packaged and presented for use in medicine.
  • the polypeptide is prepared as a sterile formulation, with appropriate pharmaceutical excipients, if required.
  • the polypeptide is substantially pure as described above.
  • the polypeptides, either alone or in combination with other antigenic proteins are useful as vaccines.
  • the vaccine of the invention therefore includes one or more polypeptides of the invention, optionally with other antigenic proteins, such as other mycoplasma proteins, and further optionally with one or more adjuvants.
  • Suitable adjuvants are known in the art and include, for example, alum.
  • a ninth aspect of the invention provides a method of vaccinating a cat against haemotropic mycoplasma infection, the method comprising administering to the cat one or more polypeptides according to any of the first, second, third, fourth or fifth aspects of the invention, or a vaccine according to the sixth aspect of the invention.
  • polypeptide includes variants or fragments thereof that are cross-reactive with the native polypeptide, and which are able to give rise to an immune response against the native polypeptide.
  • the polypeptide or polypeptides are administered by sub-cutaneous or intradermal or intra-muscular injection or by intra-nasal administration.
  • the amount of polypeptide or polypeptide is sufficient to give rise to a protective immune response in the cat.
  • western-blotting or ELISA may be used to determine whether the animal is able to produce an immune response to the recombinant protein itself.
  • animals may be challenged with infective doses of the selected haemoplasma at various time points following vaccine or placebo administration, then monitored for haemoplasma infection (clinical signs, haematological parameters and blood haemoplasma copy numbers).
  • haemoplasma infection clinical signs, haematological parameters and blood haemoplasma copy numbers.
  • a booster immunization is given at a suitable period after the initial immunization. If more than one t/pe of polypeptide is administered, they may be administered together or sequentially.
  • cat we include any member of the cat (felidae) family, in particular the domestic cat or wild felids such as tiger or lion.
  • An tenth aspect of the invention provides a composition comprising one or more polypeptides according to any of the first, second, third, fourth, fifth aspects of the invention and optionally other antigens, and optionally an adjuvant, or a vaccine according to the sixth aspect of the invention, for vaccinating a cat against haemotropic mycoplasma infection.
  • the invention also includes the use of a composition comprising one or more polypeptides according to any of the first, second, third, fourth, fifth aspects of the invention, or a vaccine according to the sixth aspect of the invention, in the manufacture of a medicament for vaccinating a cat against haemotropic mycoplasma infection.
  • the haemotropic mycoplasma infection is Mhf or CMhm or CMt.
  • An eleventh aspect of the invention provides an antibody directed to a polypeptide according to any of the first, second, third, fourth or fifth aspect of the invention.
  • Antibodies may be prepared by methods well known in the art, for example as described in “Monoclonal Antibodies: A manual of techniques", H Zola (CRC Press, 1988) and in “Monoclonal Hybridoma Antibodies: Techniques and Applications", J G R Hurrell (CRC Press, 1982), by using an appropriate antigen such as a polypeptide of the invention or a variant or fragment thereof which is cross-reactive with the native polypeptide, or a mycoplasma EF-Ts polypeptide or a variant or fragment thereof which is cross-reactive with the native polypeptide.
  • the antibody may be a polyclonal antibody or a monoclonal antibody or a recombinant antibody.
  • antibody we include fragment of antibodies such as Fab and Fv fragments, and synthetic antibody fragments such as scFv and dAb fragments.
  • the antibody is a specific antibody, in the sense that it binds the particular polypeptide but does not bind substantially to other polypeptides from the mycoplasma from which is may be obtained.
  • the antibody of the invention may be packaged and presented for use in medicine. Typically the antibody is prepared as a sterile formulation, with appropriate pharmaceutical excipients, if required.
  • a twelfth aspect of the invention provides a method of passively immunising a cat against haemotropic mycoplasma infection, the method comprising administering to the cat an antibody according to the eleventh aspect of the invention.
  • a sufficient amount of antibody is administered so as to provide protection against subsequent infection with mycoplasma.
  • the animal would be challenged with infective doses of the selected haemoplasma at various time points, then monitored for haemoplasma infection (clinical signs, haematological parameters and blood haemoplasma copy numbers).
  • the invention also includes an antibody according to the eleventh aspect of the invention for passively immunising a cat against haemotropic mycoplasma infection.
  • the invention also includes the use of an antibody according to the eleventh aspect of the invention in the manufacture of a medicament for passively immunising a cat against haemotropic mycoplasma infection.
  • haemotropic mycoplasma cats that have been infected with haemotropic mycoplasma are likely to contain antibodies directed at immunogenic polypeptides of the infecting haemotropic mycoplasma. They may also contain some of the immunogenic haemotropic mycoplasma polypeptides themselves. If the cat is diagnosed with haemotropic mycoplasma infection, typically it will be treated using antibiotics such as tetracyclines or fluoroquinolones. Supportive care may be given, such as fluid therapy if dehydrated, blood transfusion, or haemoglobin carrier solutions if severely anaemic. Appetite stimulation or nutritional support may be given if the cat is anorexic.
  • a thirteenth aspect of the invention provides a method of detecting whether a cat has been exposed to haemotropic mycoplasma infection, the method comprising determining whether a suitable sample from the cat is reactive with a polypeptide according to any of the first, second, third, fourth or fifth aspects of the invention.
  • the sample is a fluid sample from the cat which is known to contain antibodies. Suitable samples include whole blood, plasma, serum, or saliva.
  • the method comprises detecting the presence of antibodies in the sample which are reactive towards the polypeptide. Suitable methods for determining the presence of antibodies are known in the art, for example ELISA methods (enzyme-linked immunosorbent assay) as is discussed in more detail below.
  • a fourteenth aspect of the invention provides a method of detecting whether a cat has been exposed to haemotropic mycoplasma infection, the method comprising determining whether a sample from the cat contains one or more polypeptides according to the first, second, third, fourth or fifth aspects of the invention.
  • Suitable samples include whole blood, plasma, serum, urine, tissues, faeces, or saliva.
  • Antibody-based methods useful for detecting polypeptides in a sample include immunoassays, such as the enzyme linked immunosorbent assay (ELISA), western-blot and the radioimmunoassay (RIA).
  • a polypeptide-reactive monoclonal antibody can be used both as an immunoadsorbent and as an enzyme-labeled probe to detect and quantify the polypeptide.
  • the amount of polypeptide present in the sample can be calculated by reference to the amount present in a standard preparation using a linear regression computer algorithm.
  • Such an ELISA for detecting a tumour antigen is described in Lacobelli et al, Breast Cancer Research and Treatment 1 1: 19-30 (1988).
  • two distinct specific monoclonal antibodies can be used to detect polypeptide in a body fluid. In this assay, one of the antibodies is used as the immunoadsorbent and the other as the enzyme-labeled probe.
  • the above techniques may be conducted essentially as a "one-step” or “two-step” assay.
  • the "one-step” assay involves contacting a sample potentially containing the polypeptide with immobilized antibody and, without washing, contacting the mixture with the labeled antibody.
  • the "two-step” assay involves washing before contacting the mixture with the labeled antibody.
  • Other conventional methods may also be employed as suitable. It is usually desirable to immobilize one component of the assay system on a support, thereby allowing other components of the system to be brought into contact with the component and readily removed from the sample.
  • Suitable enzyme labels include, for example, those from the oxidase group, which catalyze the production of hydrogen peroxide by reacting with substrate.
  • Glucose oxidase is particularly preferred as it has good stability and its substrate (glucose) is readily available.
  • Activity of an oxidase label may be assayed by measuring the concentration of hydrogen peroxide formed by the enzyme-labeled antibody/substrate reaction.
  • radioisotopes such as iodine ( 125 l, 12 l), carbon ( 14 C), sulfur 35 S), tritium ( 3 H), indium ( 12 ln), and technetium ( 99 mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
  • CMhm gapA polypeptide is reactive against serum from feline post-CMhm infection but not reactive against serum from feline post-Mhf infection.
  • Differentiation of infecting species is important as Mhf is pathogenic, resulting in significant disease during acute infection, whilst CMhm less frequently results in disease, but is less readily cleared from the infected animal.
  • Animals infected with Mhf would most likely require antibiosis and supportive therapy (e.g. fluid therapy including blood transfusions, appetite stimulation) whilst those infected with CMhm rarely require therapy in the absence of concurrent disease unless attempted clearance of infection is desired.
  • CMhm dnaK polypeptide of the fourth aspect of the invention
  • Mhf dnaK polypeptide of the fifth aspect of the invention
  • the methods of the thirteenth and fourteenth aspects of the invention may be considered to be methods of diagnosing whether a cat is or has been infected with haemotropic mycoplasma.
  • the invention also includes an immunosorbent assay for detecting anti-mycoplasma protein antibodies in a sample, the assay comprising a solid phase coated with a polypeptide according to any of the first, second, third, fourth or fifth aspects of the invention wherein the anti-mycoplasma protein antibodies in a sample exposed to the solid phase will bind to the polypeptide, and a detectable label conjugate which will bind to the anti-mycoplasma protein antibodies bound to the solid phase.
  • the invention also includes a solid substrate with a polypeptide according to any of the first, second, third, fourth or fifth aspects of the invention attached thereto.
  • the solid phase or solid substrate is a microtitre well or plate.
  • the conjugate comprises an anti-cat antibody.
  • the conjugate comprises a detectable moiety such as an enzyme, for example horseradish peroxidise or alkaline phosphatase.
  • the immunosorbent assay also contains a substrate for the enzyme.
  • the assay comprises a solid phase coated with a suitable polypeptide (such as one of the polypeptides of the first or second or third or fourth or fifth aspect of the invention, or a mycoplasma EF-Ts polypeptide, wherein anti-mycoplasma antibodies in a sample exposed to the solid phase will bind to the polypeptide; and a detectable label conjugate which will bind to the anti-CRCV antibodies bound to the solid phase.
  • a suitable polypeptide such as one of the polypeptides of the first or second or third or fourth or fifth aspect of the invention, or a mycoplasma EF-Ts polypeptide, wherein anti-mycoplasma antibodies in a sample exposed to the solid phase will bind to the polypeptide; and a detectable label conjugate which will bind to the anti-CRCV antibodies bound to the solid phase.
  • an antigenic fragment of the polypeptide that coats the solid phase is of sufficient size to be bound by an anti-mycoplasma antibody.
  • the haemotropic mycoplasma polypeptide, or antigenic variant or fragment thereof, that coats the solid phase is at least 10 amino acids in length. More preferably, the haemotropic mycoplasma polypeptide, or antigenic variant or fragment thereof, is at least 20, or at least 30, or at least 40, or at least 50, or at least 100 amino acids in length.
  • the invention also includes a kit of parts which include the components of the immunosorbent assays.
  • the kit of parts may thus include a solid phase such as a microtitre plate, the appropriate haemotropic mycoplasma protein for coating the solid phase, a detectable label conjugate, such as an anti-cat antibody, which will bind to anti- mycoplasma antibodies bound to the solid phase. If the detectable label conjugate is an enzyme, the kit of parts may also include a substrate for the enzyme.
  • the kit may also include a positive control sample that contains an anti-mycoplasma antibody, such as those described with reference to the eleventh aspect of the invention, and a negative control sample.
  • protein is coated on microtitre plates overnight at 4°C to 37°C, depending on the stability of the antigen. Unbound protein is washed off with a wash buffer such as phosphate buffered saline or Tris buffered saline. Serum or other samples are incubated on the plate, typically at 37°C for between 1 and several hours. Unbound material is washed off, the plates are incubated with enzyme-labelled (e.g.
  • horseradish peroxidase or alkaline phosphatase antibody such as anti-host mammal (such as ant-feline) IgG or IgM for plasma/whole blood/serum samples, or anti-host mammal (such as anti-feline) IgA for saliva, for 1 to several hours at 37°C. Unbound antibody is washed off and plates are incubated with a substrate such as OPD for about 10 min where horseradish peroxidase was used, or p-nitrophenyl phosphate for about 75 min where alkaline phosphatase was used, and the optical density measured in a photometer.
  • a substrate such as OPD for about 10 min where horseradish peroxidase was used, or p-nitrophenyl phosphate for about 75 min where alkaline phosphatase was used, and the optical density measured in a photometer.
  • the polypeptide is a native haemotropic mycoplasma polypeptide.
  • FIG. 1 Western blot of RBC membrane antigen (R) and Mhf antigen (Hf) probed with plasma samples (1 :250) collected pre-infection (-7 and 0) and post-infection (15, 29, 43, 57, 71, 85, 99, 11 1 , 125, 139 and 153 DPI) from cat HF4.
  • the calculated molecular mass for the major bands (kDa) are shown.
  • the open triangle corresponds to the 71- 72kDa band 4.2 protein identified in both RBC and Mhf antigen preparations.
  • FIG. 2 A Comassie blue-stained PAGE gel (A) of RBC membrane antigen (R) and a Western blot (B) of a pooled plasma sample (P: days -7 and 0, all cats) and RBC membrane antigen (R) probed with the pooled plasma sample (1 :250).
  • the molecular mass (kDa) of each protein standard (S) is given on the left side.
  • the calculated molecular mass (kDa) of each identified band is given on the right side with the likely RBC membrane proteins corresponding to the bands (3, 24).
  • FIG 4 Two-dimensional electrophoresis of Mhf protein stained with Sypro Ruby. Immunogenic spots picked for mass-spectrometry indicated. Proteins were separated initially according to isoelectric point on a pH3-11 NL IPG strip (horizontal), then according to mass on a 8% poly-acrylamide gel (vertical; Precision Plus Protein standard on right hand side - major bands 75, 50, 25 kDa indicated).
  • FIG. 5 Mhf protein preparation separated by two-dimensional electrophoresis and western blotted with post-infection plasma from two Mhf infected cats. The pH orientation and three molecular mass markers are indicated. The three matched spots are indicated in white.
  • FIG. 7 Recombinant Mhf dnaK (rMhf dnaK) ELISA optical density results for plasma taken immediately prior to, and during, acute CMhm infection (HM2). Prior to infection no reactions towards rMhf dnaK were detected. At 29 days post-infection the cat demonstrated a weak reaction to rMhf dnaK, which decreased over the following 42 days.
  • Example 1 Antigen Specificity of the Humoral Immune Response to Mycoplasma haemofelis Infection
  • the aim of this study was to characterise the antigenic specificity of the humoral immune response made by cats infected with the feline haemoplasma, Mycoplasma haemofelis (Mhf).
  • a crude Mhf antigen preparation was prepared from red blood cells (RBCs) collected from a cat at a time of high bacteraemia. Plasma samples were collected from six cats pre- and post-experimental infection with Mhf, with regular sampling performed from 15 to 149 or 153 days post-infection (DPI). Pre-infection RBC membrane ghosts were prepared from these six cats, and used to identify erythrocyte proteins that may have contaminated the Mhf antigen preparation.
  • the Mhf antigen preparation comprised 11 protein bands.
  • the immunodominant bands on western blotting with infected cat plasma were of molecular mass 78, 68, 60, 48 and 38kDa.
  • Most cats (n 5) had plasma antibody that reacted with at least one band (always including 68kDa) at 15 DPI and all cats were seroreactive by 29 DPI.
  • the maximum number of antibody specificities from an individual animal was identified in plasma collected between 57 and 99 DPI. Contamination of the Mhf antigen preparation with RBC membrane proteins was observed.
  • the contaminating RBC proteins were of molecular mass 71-72kDa (consistent with band 4.2) and 261 and 238kDa (consistent with spectrin) and these were recognised by all plasma samples.
  • a range of Mhf antigens are recognised by cats infected experimentally with the organism. These represent possible targets for immunoassays, but care must be taken to prevent false positive results due to host protein contamination.
  • plasma samples were collected for 22 weeks following Mhf infection, to enable more extensive characterisation of proteins recognised by the immune system of infected cats and to attempt to determine whether autoantibodies specific for erythrocyte membrane antigens were induced by the infection.
  • infection of the cats was carried out by obtaining heparinised blood from barrier- maintained donor cats chronically infected with Mhf.
  • the blood type of the donor cats and all recipients was predetermined to be Type A (RapidVet-H blood typing cards, DMS Laboratories Inc, New Jersey, US).
  • Fresh blood was collected from donors and injected intravenously into the recipients.
  • These inocula comprised 2 ml of heparinised blood (infective dose HF14: 7.21 ⁇ 10 7 , others: 1.55 * 10 8 Mhf copies) given via pre-placed cephalic intravenous catheters within 5 min of collection from the donors. All procedures and experiments described were undertaken under a project license approved under the UK Animals (Scientific Procedures) Act 1986.
  • EDTA- anticoagulated blood samples were regularly collected from all cats and subjected to real-time PCR (qPCR) to confirm that Mhf infection was absent before inoculation, and present post-infection (Tasker and others 2009a; Tasker and others 2009b). Seven days before infection (day -7), on the day of infection (day 0), and approximately every 2 weeks thereafter, until day 149 (HF2) or 153 (HF1 , 4, 6, 8 and 12), an additional 1 ml volume of EDTA anticoagulated blood was collected from each cat, centrifuged (2200 * g, 3 min) and the plasma removed and stored at -20°C until use.
  • qPCR real-time PCR
  • a pooled plasma sample was made by mixing an equal volume of the pre-infection plasma samples collected during the study.
  • Plasma samples, from EDTA blood (the RBC were used for other purposes e.g. Coombs' test), were used in order to minimize the total volume of blood collected from the animals and to comply with the terms of the studies' project license.
  • RBCs were sedimented by centrifugation at 600g for 10 min, plasma and buffy coat were aspirated, and the RBCs were washed and centrifuged in an equal volume of phosphate-buffered saline (PBS; 0.15M, pH 7.4). The PBS and remaining buffy coat was aspirated and the wash repeated twice more. The final packed, washed RBC were incubated in PBS containing 0.15% Tween-20 and 3% (w/v) EDTA, and incubated for 30 min at ambient temperature, in a vertical shaker (speed 150rpm) to dislodge the Mhf.
  • PBS phosphate-buffered saline
  • Debris and erythrocytes were pelleted by centrifugation at 600g for 10 min and the resultant supernatant was centrifuged at 40,000g for 30 min at 4°C to pellet the Mhf. The supernatant was removed, the pellet resuspended in 1 ml PBS and centrifuged through 20% sodium diatrozoat meglumine and diatrozoat sodium (76% Urografin; Bayer pic, Newbury, Berkshire, UK) at 15,000rpm for 40min at 4°C, and the final pellet was resuspended in 1.0 ml PBS.
  • the resulting Mhf antigen preparation was depleted of any contaminating albumin or IgG using the ProteoExtract Albumin/lgG Removal Kit (Calbiochem, Merck Chemicals Ltd., Nottingham, UK) according to the manufacturer's instructions.
  • the flow-through and the wash from the columns were added to a 20K iCON concentrator (Pierce Biotechnology, Fisher Scientific UK Ltd., Loughborough, Leicestershire, UK) and centrifuged at 6,000g for 1 hour.
  • the protein concentration in the retained solution was measured using a Qubit (Invitrogen Ltd., Paisley, Scotland) before storage at -80°.
  • RBC membrane ghosts were prepared from 1 ml EDTA anticoagulated blood from the six plasma source cats (HF1 , 2, 4, 6, 8 and 12), prior to infection, using the methods described by Barker (Barker 1991 ). Briefly, RBCs from 1 ml EDTA anticoagulated blood were washed six times in 10 volumes of PBS with aspiration of the supernatant and buffy-coat between washes. RBCs were lysed by adding 10 volumes of ice-cold lysis buffer (20mM Tris, pH 7.6) and pelleted by centrifugation at 40,000g for 30min at 4°C. The supernatant and opaque buttons of residual leucocytes were removed, using a pipette, leaving the translucent RBC membranes.
  • the membranes were washed a minimum of four times in ice-cold lysis buffer until the supernatant was clear of haemoglobin.
  • the concentration of protein in the final solution was measured by Qubit and stored at -80°C prior to use. PAGE and Western Blot Analysis
  • PAGE Polyacrylamide gel electrophoresis
  • NuPAGE electrophoresis system Invitrogen Ltd., Paisley, UK
  • proteins were transferred to nitrocellulose membranes using the XCell mini-cell and Blot Module (Invitrogen, Paisley, UK) as per the manufacturer's instructions.
  • NuPAGE Novex 4-12% Bis-Tris precast gels, NuPAGE MOPS running buffer, NuPAGE LDS sample buffer (all Invitrogen Ltd) and Mhf or RBC membrane antigen (2Q ⁇ g per well) were used for the investigation of the humoral immune responses.
  • Protein transfer was performed using the NuPAGE transfer buffer (Invitrogen) and a pre-stained molecular weight standard (All Blue Precision Plus Protein Standard, Bio-Rad Laboratories Ltd., Hemel Hempstead, UK) was included on each gel to monitor transfer efficiency and to allow calculation of molecular mass,
  • the NuPAGE Large Protein Blotting Kit (Invitrogen Ltd.), which included 3-8% tris-acetate gels, the HiMark Pre-Stained High Molecular Weight Protein Standard and 0. 45 ⁇ nitrocellulose membranes, was used to further investigate antigenic proteins in the RBC membrane preparations, as this gave better separation of the high molecular weight proteins.
  • nitrocellulose membranes were blocked with 5% (w/v) non-fat milk in TBST (50 mM Tris, 150 mM NaCI, 0.05% Tween 20, pH-7.6) for 2 hours. Membranes were then cut in to strips, each including a lane of Mhf antigen and RBC membrane ghosts from the individual cat. The strips were probed overnight with 1 in 250 dilution of plasma (D-7, 0, 15, 29, 43, 57, 71 , 85, 99, 111 , 125, 139 and 149 or 153) in TBST + 5% non-fat milk.
  • D-7 0, 15, 29, 43, 57, 71 , 85, 99, 111 , 125, 139 and 149 or 153
  • a negative control omitting incubation with a plasma sample, was performed to control for reactivity between secondary antibody and the Mhf antigen and RBC membrane ghosts.
  • the antibody specific for the 71-72kDa protein identified in the RBC ghosts and the Mhf antigen preparations was present in plasma collected pre- (days -7 and 0) and post-infection, although the intensity of this band varied when plasma samples taken at different time points were compared for the same animal. This band was not considered to be of Mhf origin and was excluded from the analysis of the immune response to Mhf. None of the 12 pre-infection plasma samples contained antibody to any of the other 11 Mhf bands. No protein bands were identified when the secondary antibody alone was incubated with the antigen preparations (data not shown).
  • Mhf antigen preparations Contamination of Mhf antigen preparations with host blood-derived proteins is a recognized problem and such contaminants may originate from the cellular components (RBC and white blood cells) and the plasma.
  • blood was collected from an experimentally infected cat at the time of presumptive peak Mhf copy number (1 1 DPI), and before the onset of anaemia and Coombs' test positivity (Tasker and others 2009b). Blood collected after the onset of anaemia and Coombs' positivity was susceptible to severe haemolysis during the isolation procedure, resulting in haemoglobin and RBC membrane contamination of the Mhf preparations (unpublished observations).
  • a 71-72kDa protein band was detected in the Mhf and RBC membrane antigen preparations by all pre and post-infection plasma samples, but was not detected when the secondary antibody was used alone.
  • This protein band has molecular mass equivalent to the erythrocyte protein band 4.2 (Korsgren and others 1990; Steck and others 1974), and correlated with band 4.2 identified on a Commassie blue-stained PAGE gel of RBC membrane proteins. This band was not of a size that would be consistent with immunoglobulin light chains or ⁇ or ⁇ heavy chains identified in the blot of the pooled plasma sample.
  • the human anti-spectrin antibodies have been shown to cross-react with a protein migrating to an equivalent position as band 4.2 (Lutz and Wipf 1982). These physiological autoantibodies specific for erythrocyte proteins have a role in the removal of damaged and senescent RBC (reviewed by Kay 2005).
  • This broad protein band may therefore be composed of host-derived proteins. The size of this protein would be consistent with that of immunoglobulin light chain, but the band was not recognized by the secondary antibody alone. Further work is required to determine the identity of this band.
  • Mhf The major antigenic determinants of Mhf, to which infected cats respond serologically, were of molecular mass 78, 68, 60, 48 and 38kDa. All cats produced antibodies reactive with all of these bands by 57 DPI. A previous study found significant reactivity to Mhf determinants of molecular mass 150, 52 and 14 kDa by 30 DPI (Alleman and others 1999). Antibodies reactive with Mhf proteins of 53 and 54kDa were found in the plasma of cats in the present study, but the former specificity was only identified in one cat and the latter was seen in only four cats by 57 DPI, which is the time point closest to the last sample (60 DPI) analysed in the study by Alleman ef al.
  • mice infected with M. haemomuris develop serum antibodies to Mycoplasma determinants of molecular mass 118, 65, 53, 45, and 40 kDa at 42 DPI (Rikihisa and others 1997).
  • Pigs infected with Msu produce antibodies reactive with major MSu proteins of 70, 45 and 40kDa and minor proteins of 83, 73, 61 , 57, and 33kDa.
  • antibody specific for the major bands was present as early as 7 DPI and was well- established by 14 DPI (Hoeize and others 2006).
  • the variation in the molecular mass of the Mhf determinants detected in our study compared with those from previous studies may be due to the experimental methods used or the haemoplasma species investigated.
  • the major determinants described in the Msu study may correspond to Mhf determinants of 68, 48 and 38kDa described in the present study, but use of a different acrylamide gel concentration (4-12% gradient vs 10%) and buffer system in the two studies may have resulted in slightly different migration rates, affecting the calculation of molecular mass.
  • these differences may reflect variations between the Mycoplasma species as they reside in different clades within the haemoplasmas as determined by 16S rDNA and RNaseP phylogenetic analysis (Johansson and others 1999; Messick and others 2002; Neimark and others 2001 ; Peters and others 2008; Tasker and other 2003).
  • HspA1 70kDa protein
  • MSG1 40kDa protein
  • erythrocyte-bound antibody (as opposed to the circulating antibody investigated here) is specific for surface Mhf antigens or erythrocyte autoantigens and whether the antigenic specificity of antibody eluted from the erythrocytes of Mhf-infected cats differs from that of the circulating antibody pool.
  • Example 2 Identification of antigens specific for the humoral immune response to Mhf, CMhm and CMt infection
  • haemoplasma DNA Materials & Methods Sources of haemoplasma DNA. haemoplasma protein, host protein and pre- & post- immune plasma All procedures and experiments described were undertaken under a project license approved under the Animals in Scientific Procedures Act, 1986. Additional data from these experiments has been described in published reports (Peters and others 2010, Tasker and others 2009a, Tasker and others 2009b).
  • the high-speed pellet of haemoplasmas was subjected to differential gradient centrifugation, and subsequently concentrated using a 9 KDa molecular weight cut-off filter. A similar extraction procedure from uninfected erythrocyte membranes was also performed to obtain a negative control.
  • EDTA anti-coagulated blood was taken from barrier maintained SPF cats prior to and weekly thereafter following experimental infection with Mhf, CMhm or CMt.
  • Excess EDTA anti-coagulated blood from samples submitted to Langford Veterinary Services Diagnostic Laboratories (LVS-DL) for companion animal haemoplasma PCR were also collected. Blood was centrifuged and separated. Plasma was stored at -20°C until required. Partial sequencing of the haemoplasma genome
  • Haemoplasma genomic DNA was purified using Macherey-Nagel NucleoSpin® Blood kits, from the haemoplasma DNA rich supernatant. Extracted DNA was sheared by nebulisation into 2 to 5 Kbp fragments, as determined by gel electrophoresis. These fragments were ligated into pCR ® 4Blunt-TOPO ® and transformed into One Shot ® Chemically Competent Escherichia coli (TOPO ® Shotgun Subcloning Kit; Invitrogen). Purified plasmids from randomly selected clones were sequenced using dye-terminator chemistry with piasmid and custom primers.
  • Mhf organisms and un-infected erythrocyte membrane protein extracts were prepared for 2D SDS-PAGE using the Amersham 2D-clean up kit (GE Life Sciences). Proteins were initially separated according to isoelectric point on ImmobilineTM DryStrip pH 3-11 NL (GE Life Sciences), then according to mass (12.5% polyacrylamide gel). Gels were either western blotted onto a polyvinylidene difluoride (PVDF) membrane or stained using Sypro ® Ruby Protein Gel Stain (Invitrogen).
  • PVDF polyvinylidene difluoride
  • Membranes were blocked by gentle agitation for 5 hours in tris-buffered saline (25mM Tris, 150mM NaCI) with Tween-20 (0.1 % v/v) and 5% (w/v) non-fat milk (TBST-5M). Membranes were incubated overnight with test plasma (1 :500 dilution of plasma from each of two cats taken at different time point: 'pre-infection' - from 7 and 1 days pre-infection; 'post-infection' - from 139 and 153 days post-infection) in TBST-5M.
  • test plasma (1 :500 dilution of plasma from each of two cats taken at different time point: 'pre-infection' - from 7 and 1 days pre-infection; 'post-infection' - from 139 and 153 days post-infection
  • Washed membranes were incubated for 2 hours at room temperature in TBST-5M containing 1 :20,000 dilution of alkaline phosphatase conjugated goat anti-cat IgG (H+L) antibody.
  • Membranes were washed in Tris-buffered saline (25mM Tris, 150mM NaCI) with Tween-20 (0.1% v/v) (TBST) between steps (20 minutes; two wash changes; orbital shaker at 25rpm; room temperature). Following the final washes, visualisation was achieved using Lumi-Phos WBTM Chemiluminescent Substrate and exposure to Amersham Hyperfilm ECLTM.
  • the Mhf gapA, Mhf dnaK and CMhm gapA protein coding sequences were cloned into pET101/D-TOPO ® and expressed in BL21 StarTM (DE3) E. coli as fusion proteins with C- terminal His-tags (ChampionTM pET Directional TOPO ® Expression Kit, Invitrogen).
  • CMhm gapA coding sequence Prior to cloning the CMhm gapA coding sequence was subjected to site directed mutagenesis to convert opal stop codons (TGA) to tryptophan codons (TGG). His-tagged proteins were purified using the Ni-NTA Spin Kit (QIAgen).
  • Proteins were separated using one- dimensional gel electrophoresis (NuPAGE ® Novex ® Bis-Tris Gel System) and western blotted onto nitrocellulose. Product size was determined by comparison to a molecular weight ladder (Precision Plus ProteinTM Standards; Bio-Rad). Expressed protein bands were excised from the NuPAGE gels and subjected to trypsin-digestion and mass- spectrometry analysis to confirm their identity. Immunoblots of recombinant haemoplasma proteins
  • Wells were incubated with plasma (duplicates of 1:200, 1 :400 and 1 :800 dilutions in ⁇ /well PBST-10M) for 2 hours at room temperature under agitation then washed with PBST.
  • Wells were then incubated with either anti-cat IgG conjugated with alkaline phosphatase (heavy and light chains; Jackson ImmunoResearch) or anti-dog IgG conjugated with alkaline phosphatase (heavy and light chains; Sigma) at 1 :10,000 dilution in 100pl/well PBST-10M for 2 hours at room temperature under agitation and then washed with PBST.
  • Each plate contained wells to which (i) no plasma was added (triplicate), (ii) haemoplasma negative SPF feline plasma (1 :200, 1 :400 and 1 :800 dilutions) was added, (iii) duplicate two-fold serial dilutions of a strong positive feline plasma (1 :200 to 1 :409,600) was added.
  • a serum sample was deemed positive if its OD value was greater than the OP value of the 1 :51 ,200 dilution of the positive control (typically an OD of 0.100 at ⁇ 75min).
  • Anti-Mhf dnaK antibodies were detected using 1 D immunoblots in cats experimentally infected with Mhf, whilst cross-reactive antibodies were detected in cats experimentally infected with CMhm and CMt and in a dog naturally infected with Mhc. This suggests that an assay using rMhf dnaK could be used to detect exposure to haemotropic mycoplasmas in companion animals.
  • haemoplasma proteins pgk and EF-Ts
  • pgk and EF-Ts have been identified as immunogenic ie they are recognised with Mhf post-infection serum from cats, indicating suitability for use in a vaccine and as a marker of haemotropic mycoplasma infection.
  • Haemoplasma genomic DNA was purified using Macherey-Nagel NucleoSpin® Blood kits, from the haemoplasma DNA rich supernatant. Extracted DNA was sheared by nebulisation into 2 to 5 Kbp fragments, as determined by gel electrophoresis. These fragments were ligated into pCR ® 4Blunt-TOPO ® and transformed into One Shot ® Chemically Competent E. coli (TOPO ® Shotgun Subcloning Kit; Invitrogen). Purified plasmids from randomly selected clones were sequenced using dye-terminator chemistry with plasmid and custom primers.
  • BLASTn analysis of nucleotide sequences and BLASTp analysis of the corresponding amino-acid sequences was performed to identify the origin of the insert sequence (http://blast.ncbi.nlm.nih.gov/Blast.cqi).
  • Target specific primers were used in conjunction with plasmid primers to obtain contiguous sequence by PCR using Mhf and CMhm libraries as template.
  • VVAINDLTDP TLAHLLKYDTAHGPVRCYDISV EGDSIVLVNKCSGEKQSFKVISERDP ALPWKSL
  • VDCVLECTGRFTDKDAAMAHVEAGA KKWISAPAKGDLKTIVY VNHGTLTSSDQVISAASCTTNALAPWDALHKKYKIVSGF
  • MSG1 a surface- localised protein of Mycoplasma suis is involved in the adhesion to erythrocytes.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Organic Chemistry (AREA)
  • Virology (AREA)
  • Pulmonology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The invention relates to immunogenic polypeptides from Mycoplasma haemofelis (Mhf) and 'Candidatus Mycoplasma haemominutum' (CMhm), and their use as vaccines and as markers of infection in the cat. The polypeptides are dnaK, gapA, pgk and EF-Ts.

Description

METHODS OF DIAGNOSIS AND VACCINES
The present invention relates to methods of diagnosis of haemoplasma infection, and vaccines for the prevention of the same. The methods and vaccines relate to the cat.
The listing or discussion of an apparently prior-published document in this specification should not necessarily be taken as an acknowledgement that the document is part of the state of the art or is common general knowledge.
'Haemoplasmas' is the trivial name given to a group of erythrocyte parasitizing bacteria of the genus Mycoplasma within the Mollicutes class. They are most closely related to the pneumoniae group of mucosal mycoplasmas. Analysis of 16S ribosomal RNA gene sequences from haemoplasmas resulted in their recent reclassification from the Haemobartonella and Eperythrozoon genera. The haemoplasma group can be further divided into haemofelis and haemominutum clades based on 15S rRNA and Ribonuclease P ribosomal gene phytogeny. Diagnosis of haemoplasma infection was originally based on clinical signs and visualisation of epierythrocytic bodies by light microscopic examination of blood smears. More recently PCR technology has superseded cytology for diagnosis due to its superior sensitivity and specificity. PCR assays have also allowed accurate determination of the prevalence of the various haemoplasma species within their respective hosts. Development of serological assays for the diagnosis of haemoplasmosis has been attempted in the past. While early attempts by one group were reported to have been promising (unpublished data), no further information has been submitted for publication (Turner and others 1986). These earlier studies may have been confounded by cytologically negative chronically infected haemoplasma carriers, resulting in positive results in cytologically negative cats. One group developing an enzyme-linked immunosorbent assay (ELISA) for the detection of the porcine haemoplasma Mycoplasma suis (Ms) antibodies in infected pigs reported significant quantities of porcine immunoglobulins as a contaminant of haemoplasma antigen preparation from blood, despite the inclusion of density gradient ultracentrifugation (Hoelzle and others 2006). The immunoglobulin contaminant displayed a marked ability to bind secondary conjugated antibodies, resulting in high background measurements.
Haemoplasmas have been found to infect a wide variety of mammalian species, from squirrel monkeys to llamas (Hoelzle 2008). And while they appear to be relatively host specific, different haemoplasmas may exist within an individual host (Kenny and others 2004, Tasker and others 2003, Willi and others 2006a). Three haemoplasmas have been documented worldwide in both the domestic cat and wild felids: Mycoplasma haemofelis (Mhf), 'Candidates Mycoplasma haemominutum' (CMhm), and 'Candidates Mycoplasma turicensis' (CMt) (Lobetti and Tasker 2004, Sykes and others 2007, Tasker and others 2003, Willi and others 2006b). A fourth feline haemoplasma, having close identity to the canine haemoplasma 'Candidates Mycoplasma haematoparvum' (CMhp), has been detected during a prevalence study conducted in the USA (Sykes and others 2007), but to date remains incompletely described and not reported elsewhere. Two haemoplasmas have been documented in the dog: Mycoplasma haemocanis (Mhc) and CMhp (Inokuma and others 2006, Kenny and others 2004, Sykes and others 2004, Wengi and others 2007).
Worldwide PCR based CMhm prevalence ranges from 8.5 to 46.6%, Mhf prevalence from 0.2 to 21.7%, and CMt prevalence from 0.5 to 26.1 % (Bauer and others 2008, Fujihara and others 2007, Gentilini and others 2009, Kamrani and others 2008, Peters and others 2008, Roura and others 2010, Tasker 2006a, Willi and others 2006a, Willi and others 2006b). Prevalence of the canine haemoplasmas ranges are even greater with Mhc prevalence from 0.9 to 20.0% and CMhp prevalence from 0.3 to 33.4%, with occasional dual-haemoplasma infections (Barker and others 2008, Inokuma and others 2006, Kenny and others 2004, Roura and others 2010, Wengi and others 2008). However, differences exist between the populations examined, e.g. client owned vs. feral, sick vs. healthy, and PCR assays used, which prevents direct comparison. A review of haemotropic mycoplasmas is found in Tasker (2010). Infections with haemoplasmas can range from being asymptomatic, through mild pyrexia, to life- threatening (and occasionally fatal) haemolytic anaemia even in immunocompetent individuals. Of the feline haemoplasmas Mhf appears to be most significant in terms of haemolysis (Tasker 2006b). Cats infected with CMhm are rarely clinically unwell, although a mildly lowered haematocrit is not uncommon when infected cats are compared to controls (George and others 2002, Tasker and others 2004, Tasker and others 2009b). A mildly lowered haematocrit was also seen in cats infected with CMt in a recent experimental study (Tasker and others 2009b). However, cats naturally infected with CMt are frequently found to be concurrently infected with one or more of the other haemoplasmas. In contrast to cats immunosuppression or splenectomy of the host appears to be required for disease to become clinically apparent in dogs infected with Mhc or CMhp (Kemming and others 2004, Lester and others 1995, Sykes and others 2004). Cats can remain infected with haemoplasmas, in the absence of clinical signs, for months to years, and therefore represent a source of infection (Berent and others 1998, Willi and others 2006a). This can present difficulties in terms of diagnosis and management, as they may be below the limit of PCR detection, and antibiotic treatment does not consistently clear infection. Carrier status is most commonly encountered with CMhm infection, less so with Mhf, which could account for difference in prevalence figures (Willi and others 2007). As one of the routes of infection remains the iatrogenic administration of blood products, the ability to identify these chronically infected animals is important during disease monitoring of potential blood donors (Hackett and others 2006).
In some host species haemoplasma infection has been shown to modify response to viral and malarial infections, as well as response to irradiation (Baker and others 1971 , Contamin and Michel 1999). The potential role of haemoplasma infection in modifying the pathogenicity of other infections has yet to be fully elucidated in cats. However, CMhm infection has been associated with fatal myeloproliferative disease in chronically FeLV infected cats (George and others 2002), whilst other studies examining the effect of chronic FIV infection on acute Mhf or CMhm infection found no significant haematological differences between the retroviral positive and negative groups (Tasker and others 2006a, b). Long-term co-morbidity studies of natural cat populations have been limited by the presence of chronic infections and the lack of assays to determine exposure to haemoplasmas in the absence of a positive PCR result.
Expression and analysis of some mycoplasmal metabolic proteins e.g. DNA chaperone heat shock protein 70 (dnaK), glyceraldehyde-3-phosphate dehydrogenase (GAPDH; gapA), elongation factor thermo-unstable (EF-Tu), has shown that in addition to their cytosolic role they can also be surface expressed and may play a role in host ceil attachment (Alvarez and others 2003, Balasubramanian and others 2009, Hoelzle and others 2007b, Hoelzle and others 2007c). GAPDH in Mycoplasma genitalium (MG301) has been shown to play a major role in binding to the host glycoprotein mucin (Alvarez and others 2003). EF-Tu of Mycoplasma pneumoniae has been shown to mediate binding to host fibronectin (Balasubramanian and others 2009). Some of these proteins are also immunogenic and have been suggested as vaccine candidates in particular species, such as GAPDH in the respiratory pathogen Mycoplasma bovis (Perez-Casal and Prysliak 2007). A 40KDa immunoreactive GAPDH homolog of Ms, MSG1 , has been shown to be expressed at both surface and cytosolic locations, have GAPDH activity and appeared to have a role in erythrocyte adhesion (Hoelzle and others 2007c). A 70KDa immunoreactive protein of Ms, HspA1 , was determined to be a dnaK homolog; a finding that was supported by ATPase activity of the expressed recombinant HspA1 (Hoelzle and others 2007b). Recombinant MSG1 has been trialled as a vaccine candidate in the pig; however despite induction of anti-MSG1 antibodies they were not protective against a high-dose infection challenge (Hoelzle and others 2009). In an analysis of the immunoproteome of Mycoplasma mycoides subsp. mycoides which infects cattle a number of proteins were identified as being immunogenic, including gapA, dnaK, EF-Tu and phosphoglycerate kinase (pgk) (Jores and others 2009).
Recombinant forms of Ms proteins MSG1 and HspA1 have been generated and used in ELISA-based serological diagnostic assays for the detection of Ms infection in pigs and was found to be comparable to whole cell preparations (Hoelzle and others 2007a). A fragment of Mhf dnaK has also been expressed and used in western blots to detect the presence of anti-dnaK antibodies in cats experimentally infected with Mhf, CMhm or CMt (Museux and others 2009). Before the present invention, no one has suggested that EF-Ts (Elongation Factor - Temperature sensitive) from mycoplasma is useful as an immunogenic marker or in a vaccine. Nor has anyone suggested that gapA (glyceraldehyde-3-phosphate dehydrogenase) or pgk (phosphoglycerate kinase) from Mhf or CMhm are useful as immunogenic marker proteins or in a vaccine for cats. GapA and pgk are both metabolic proteins found in the cytoplasm of bacteria playing an integral role in glycolytic metabolic pathways. Due to reductive evolution mycoplasmas have lost a significant number of genes, as a result some proteins have evolved to function in multiple roles within the cell. It is impossible to predict which of these metabolic proteins will be used in this way in individual species, more so whether they will play a role in the bacterial immunome.
Furthermore, before the present invention no-one had provided full length DNA and amino acid sequences for Mhf dnaK. Due to the absence of whole genome sequencing of any feline haemoplasmas, in fact any haemoplasmas per se, it is impossible to design amplification primers to the regions flanking the dnaK gene. Primers have to be designed to available sequences, or 'best guess' based on closely related bacterial species. Whilst this may allow the determination of partial fragments within a gene of interest the regions flanking a specific gene vary widely and cannot be predicted. In our case genome fragmentation and cloning was required to determine full sequence of Mhf dnaK.
A first aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 14 (Mhf EF-Ts) or a variant or fragment thereof. SEQ ID No 14 provides the native amino acid sequence of Mhf elongation factor temperature- sensitive (EF-Ts). EF-Ts forms part of a complex with elongation factors Tu and G, which together facilitate the events of translation (i.e. protein synthesis, where the DNA sequence is 'read' and amino-acids strung together). Specifically EF-Ts serves as the guanine nucleotide exchange factor for EF-Tu, catalyzing the release of GDP from EF- Tu, allowing a molecule of GTP to bind in its place, so permitting the entry of the next aminoacyl rRNA into the ribosome. This may be assayed by incorporation into an ELISA, probing a western blot with plasma/serum or via enzymatic assays. A second aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 10 (Mhf pgk) or SEQ ID No 26 (CMhm pgk) or a variant or fragment thereof. SEQ ID No 10 provides the partial native amino-acid sequence of Mhf phosphoglycerate kinase, and SEQ ID No 26 provides the native amino acid sequence of CMhm phosphoglycerate kinase. The Mhf pgk fragment comprised the N-terminal 344 amino-acids of what is suspected to be a total of 400-415 amino-acids of the complete protein. Pgk is an ubiquitous enzyme that catalyses the formation of ATP to ADP and vice versa acting as a transferase enzyme in the seventh step of glycolysis^ This could be assayed by incorporation into an ELISA, probing a western blot with plasma/serum or via enzymatic assays.
A third aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 6 (Mhf gapA) or SEQ ID No 22 (CMhm gapA) or a variant of fragment thereof. SEQ ID No 6 provides the native amino acid sequence of Mhf glyceraldehyde-3-phosphate dehydrogenase, and SEQ ID No 22 provides the native amino acid sequence of CMhm glyceraldehyde-3-phosphate dehydrogenase. GapA catalyzes the sixth step of glycolysis converting glyceraldehyde 3-phosphate to D- glycerate 1 ,3-bisphosphate. This could be assayed by incorporation into an ELISA, probing a western blot with plasma/serum or via enzymatic assays. A fourth aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 18 (CMhm dnaK) or a variant or fragment thereof. SEQ ID No 18 provides the native amino acid sequence of CMhm DNA chaperone heat shock protein dnaK. The expression of heat shock proteins is up regulated in response to cell stressors such as heat or other environmental changes. More specifically heat shock protein 70, aka. dnaK, functions as an intra-cellular chaperone for other proteins permitting correct protein folding and preventing protein aggregation during unfavourable conditions. It may also be present at lower levels as a house-keeping protein fulfilling similar functions. This could be assayed by incorporation into an ELISA, probing a western blot with plasma/serum or via enzymatic assays.
A fifth aspect of the invention provides a polypeptide comprising the amino acid sequence as set out in SEQ ID No 2 (Mhf dnaK) or a variant thereof, or a fragment thereof with the amino acid sequence MSKKETIIG (SEQ ID No 29) or a fragment thereof from the sequence from position 309 to position 602 of Figure 3 (sequence B). SEQ ID No 2 provides the native amino acid sequence of Mhf DNA chaperone heat shock protein dnaK. Figure 3 indicates the amino-acid alignment between SEQ ID No 2 and the fragment of Mhf dnaK described by Museux and others (2009). Position 309 onwards starts with the sequence QILLVGG (SEQ ID No 30) and so on, and ends with the sequence KTEVDKTKS (SEQ ID No 31).
Preferably, the polypeptide is substantially free of other polypeptides with which it is naturally associated in the mycoplasma cell. Preferably the polypeptide is substantially pure. For example, the polypeptide may be in a composition where it accounts for at least 95% of the total polypeptide, such as at least 96%, 97%, 98%, 99% or 99.5% as judged by Coomassie blue staining of a preparation separated by SDS-PAGE. By "variant" of the polypeptide we include polypeptides in which the sequence homology is at least 80% or 85% or 90%, more preferably at least 91 % or 92% or 93% or 94% or 95% or 96% or 97% or 98% or 99% or 99.5%, the % homology being assessed using the BLASTp algorithm [http://blast.ncbi.nlm.nih.gov/Blast.cgi, BLASTp (protein-protein BLAST), NCBI non-redundant protein sequence database (Altschul and others 1990). Typically the variants include polypeptides in which 1 or 2 or 3 or 4 or 5 or 6 or 7 or 8 or 9 or 10 or 11 or 12 or 13 or 14 or 15 or 16 or 17 or 18 or 19 or 20 amino acids have been replaced with another amino acid or have been deleted. By variant, we also include the possibility that amino acids have been added to the polypeptide, for example in order to aid purification. Suitable tags to facilitate purification include poly-histidine additions. Typically, the variant retains the enzymatic active of the native polypeptide as given. Preferably, the variant is cross-reactive with the native polypeptide. In other words, the variant is preferably able to bkid antibodies that have been raised to the native polypeptide, which can be tested for, for example by using a suitable ELISA.
By "fragment" of the polypeptide we include fragments of the polypeptide that constitute 20% of the length of the native polypeptide, typically at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 97%. Typically the fragment is at least 20 amino acids, such as at least 30, 40, 50, 60, 70, 80 amino acids in length. Preferably, the fragment is cross- reactive with the native polypeptide. In other words, the fragment is preferably able to bind antibodies that have been raised to the native polypeptide, which can be tested for, for example by using a suitable ELISA. In relation to Mhf dnaK, the fragment is either MSKKETIIG (SEQ ID No 29) or is a fragment from position 309 to position 602 of Figure 3 (sequence B).
When the term "polypeptide" is used, unless the context does not allow it, the term includes the variants and fragments as defined including, in particular, the variants and fragments that are cross-reactive with the native polypeptide.
The polypeptides and variants and fragments are typically immunogenic in the cat, giving rise to an immune response that can be measured by detecting antibodies to the polypeptide in the serum of a cat that has been immunised with the polypeptide or variant or fragment, for example by using an ELISA.
Partial sequences for Mhf dnaK gene have previously been published (303bp in AY150993, 899bp in FJ463263). Sequence AY150993 covers nucleotides 622 to 924 of the complete gene with six mismatches to SEQ ID No 1. Sequence FJ463263 covers nucleotides 26 to 924 of the complete gene, with seven mismatches to SEQ ID No 1.
A sixth aspect of the invention provides a polynucleotide which encodes a polypeptide of any of the first, second, third, fourth or fifth aspects of the invention. The polynucleotide is typically DNA, but may be RNA. Preferred polynucleotides of the invention are SEQ ID No 1 , SEQ ID No 3, SEQ ID No 5, SEQ ID No 7, SEQ ID No 9, SEQ ID No 1 1 , SEQ ID No 13, SEQ ID No 15, SEQ ID No 17, SEQ ID No 19, SEQ ID No 21 , SEQ ID No 23, SEQ ID No 25 and SEQ ID No 27. Codon usage refers to the triplet nucleotides that encode a specific amino-acid residue in a polypeptide chain or the termination of translation (stop codons). In Mycoplasma species the 'opal' codon UGA encodes for the amino-acid residue tryptophan, whilst in the majority of bacteria (including the Escherichia coli) UGA is a stop codon. To enable to complete expression of Mycoplasma species genes that include opal codons, site-directed mutagenesis may be employed to convert the UGA codons to UGG, which also encodes the inclusion of tryptophan but is not translated as a stop codon in either the standard or mycoplasma codon usage tables. To enable the inclusion of a C-terminal poly-histidine motif in the expressed protein, the stop codon (where known) may be removed from the native gene and the blunt 3' end of the native gene arranged such as to allow 'in-frame' reading of an expression vector sequence, such as the pET plasmid sequence, containing the poly- histidine motif. A seventh aspect of the invention provides an expression vector comprising the polynucleotide of the sixth aspect of the invention. The expression vector, when present in a suitable host cell, allows for the expression of the polypeptides of the invention. The expression vector may be a bacterial or yeast or insect cell or mammalian cell expression vector. It is preferred if the expression vector is a bacterial expression vector, such as an E. coli expression vector. Suitable expression vectors are known in the art, for example in Sambrook et al Molecular Cloning, a laboratory manual, 2nd edition, Cold Spring Harbor Laboraory Press, Card Spring Harbor, NY. Champion™ pET Directional TOPO® Expression Kits (Invitrogen) manual part no. 25-0400 describes the use of this expression vector
An eighth aspect of the invention provides a host cell comprising a polynucleotide or expression vector of the invention. The host cell may be any suitable host cell such as a bacterial cell, a yeast cell, an insect cell or a mammalian cell. Bacterial cells are preferred. Suitable host cells are known in the art, for example in Sambrook ef al.
Molecular cloning techniques, DNA sequencing and PCR methods useful in the practice of the invention are well known, for example in Sambrook er al.
The polypeptides of the invention suitably are obtained by culturing a host cell which expresses the polypeptide by recombinant means, and then extracting the polypeptide from the host cell or culture medium (if secreted). The polypeptide may be purified using methods well known in the art, such as ion-exchange chromatography, size-exclusion chromatography, affinity chromatography and the like. For the proteins containing a poly-histidine motif, purification using Ni2*-affinity chromatography may be used.
The polypeptides of the invention may be packaged and presented for use in medicine, in particular in veterinary medicine. The polypeptide or polypeptides of the invention may be packaged and presented for use in medicine. Typically the polypeptide is prepared as a sterile formulation, with appropriate pharmaceutical excipients, if required. Typically, the polypeptide is substantially pure as described above. In particular, the polypeptides, either alone or in combination with other antigenic proteins, are useful as vaccines. Typically, the vaccine of the invention therefore includes one or more polypeptides of the invention, optionally with other antigenic proteins, such as other mycoplasma proteins, and further optionally with one or more adjuvants. Suitable adjuvants are known in the art and include, for example, alum. A ninth aspect of the invention provides a method of vaccinating a cat against haemotropic mycoplasma infection, the method comprising administering to the cat one or more polypeptides according to any of the first, second, third, fourth or fifth aspects of the invention, or a vaccine according to the sixth aspect of the invention. For the avoidance of doubt, in this aspect of the invention the term "polypeptide" includes variants or fragments thereof that are cross-reactive with the native polypeptide, and which are able to give rise to an immune response against the native polypeptide. Typically, the polypeptide or polypeptides are administered by sub-cutaneous or intradermal or intra-muscular injection or by intra-nasal administration. The amount of polypeptide or polypeptide is sufficient to give rise to a protective immune response in the cat. Initially, western-blotting or ELISA may be used to determine whether the animal is able to produce an immune response to the recombinant protein itself. Then animals may be challenged with infective doses of the selected haemoplasma at various time points following vaccine or placebo administration, then monitored for haemoplasma infection (clinical signs, haematological parameters and blood haemoplasma copy numbers). Although a single immunization may be sufficient, typically, a booster immunization is given at a suitable period after the initial immunization. If more than one t/pe of polypeptide is administered, they may be administered together or sequentially.
By "cat" we include any member of the cat (felidae) family, in particular the domestic cat or wild felids such as tiger or lion.
An tenth aspect of the invention provides a composition comprising one or more polypeptides according to any of the first, second, third, fourth, fifth aspects of the invention and optionally other antigens, and optionally an adjuvant, or a vaccine according to the sixth aspect of the invention, for vaccinating a cat against haemotropic mycoplasma infection. The invention also includes the use of a composition comprising one or more polypeptides according to any of the first, second, third, fourth, fifth aspects of the invention, or a vaccine according to the sixth aspect of the invention, in the manufacture of a medicament for vaccinating a cat against haemotropic mycoplasma infection.
Typically, in all of the vaccination methods of the invention, the haemotropic mycoplasma infection is Mhf or CMhm or CMt. An eleventh aspect of the invention provides an antibody directed to a polypeptide according to any of the first, second, third, fourth or fifth aspect of the invention. Antibodies may be prepared by methods well known in the art, for example as described in "Monoclonal Antibodies: A manual of techniques", H Zola (CRC Press, 1988) and in "Monoclonal Hybridoma Antibodies: Techniques and Applications", J G R Hurrell (CRC Press, 1982), by using an appropriate antigen such as a polypeptide of the invention or a variant or fragment thereof which is cross-reactive with the native polypeptide, or a mycoplasma EF-Ts polypeptide or a variant or fragment thereof which is cross-reactive with the native polypeptide. The antibody may be a polyclonal antibody or a monoclonal antibody or a recombinant antibody. By "antibody" we include fragment of antibodies such as Fab and Fv fragments, and synthetic antibody fragments such as scFv and dAb fragments. Preferably, the antibody is a specific antibody, in the sense that it binds the particular polypeptide but does not bind substantially to other polypeptides from the mycoplasma from which is may be obtained.
The antibody of the invention may be packaged and presented for use in medicine. Typically the antibody is prepared as a sterile formulation, with appropriate pharmaceutical excipients, if required.
A twelfth aspect of the invention provides a method of passively immunising a cat against haemotropic mycoplasma infection, the method comprising administering to the cat an antibody according to the eleventh aspect of the invention. A sufficient amount of antibody is administered so as to provide protection against subsequent infection with mycoplasma. Following administration of antibody the animal would be challenged with infective doses of the selected haemoplasma at various time points, then monitored for haemoplasma infection (clinical signs, haematological parameters and blood haemoplasma copy numbers). The invention also includes an antibody according to the eleventh aspect of the invention for passively immunising a cat against haemotropic mycoplasma infection. The invention also includes the use of an antibody according to the eleventh aspect of the invention in the manufacture of a medicament for passively immunising a cat against haemotropic mycoplasma infection.
It will be appreciated that more than one type of antibody of the invention may be administered either together or sequentially. It will be appreciated that cats that have been infected with haemotropic mycoplasma are likely to contain antibodies directed at immunogenic polypeptides of the infecting haemotropic mycoplasma. They may also contain some of the immunogenic haemotropic mycoplasma polypeptides themselves. If the cat is diagnosed with haemotropic mycoplasma infection, typically it will be treated using antibiotics such as tetracyclines or fluoroquinolones. Supportive care may be given, such as fluid therapy if dehydrated, blood transfusion, or haemoglobin carrier solutions if severely anaemic. Appetite stimulation or nutritional support may be given if the cat is anorexic.
A thirteenth aspect of the invention provides a method of detecting whether a cat has been exposed to haemotropic mycoplasma infection, the method comprising determining whether a suitable sample from the cat is reactive with a polypeptide according to any of the first, second, third, fourth or fifth aspects of the invention. Typically, the sample is a fluid sample from the cat which is known to contain antibodies. Suitable samples include whole blood, plasma, serum, or saliva. Typically, the method comprises detecting the presence of antibodies in the sample which are reactive towards the polypeptide. Suitable methods for determining the presence of antibodies are known in the art, for example ELISA methods (enzyme-linked immunosorbent assay) as is discussed in more detail below.
A fourteenth aspect of the invention provides a method of detecting whether a cat has been exposed to haemotropic mycoplasma infection, the method comprising determining whether a sample from the cat contains one or more polypeptides according to the first, second, third, fourth or fifth aspects of the invention. Suitable samples include whole blood, plasma, serum, urine, tissues, faeces, or saliva. Antibody-based methods useful for detecting polypeptides in a sample include immunoassays, such as the enzyme linked immunosorbent assay (ELISA), western-blot and the radioimmunoassay (RIA). For example, a polypeptide-reactive monoclonal antibody can be used both as an immunoadsorbent and as an enzyme-labeled probe to detect and quantify the polypeptide. The amount of polypeptide present in the sample can be calculated by reference to the amount present in a standard preparation using a linear regression computer algorithm. Such an ELISA for detecting a tumour antigen is described in Lacobelli et al, Breast Cancer Research and Treatment 1 1: 19-30 (1988). In another ELISA assay, two distinct specific monoclonal antibodies can be used to detect polypeptide in a body fluid. In this assay, one of the antibodies is used as the immunoadsorbent and the other as the enzyme-labeled probe.
The above techniques may be conducted essentially as a "one-step" or "two-step" assay. The "one-step" assay involves contacting a sample potentially containing the polypeptide with immobilized antibody and, without washing, contacting the mixture with the labeled antibody. The "two-step" assay involves washing before contacting the mixture with the labeled antibody. Other conventional methods may also be employed as suitable. It is usually desirable to immobilize one component of the assay system on a support, thereby allowing other components of the system to be brought into contact with the component and readily removed from the sample.
Suitable enzyme labels include, for example, those from the oxidase group, which catalyze the production of hydrogen peroxide by reacting with substrate. Glucose oxidase is particularly preferred as it has good stability and its substrate (glucose) is readily available. Activity of an oxidase label may be assayed by measuring the concentration of hydrogen peroxide formed by the enzyme-labeled antibody/substrate reaction. Besides enzymes, other suitable labels include radioisotopes, such as iodine (125l, 12 l), carbon (14C), sulfur 35S), tritium (3H), indium ( 12ln), and technetium (99mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
It will be appreciated that detection of the polypeptide of the first aspect of the invention (Mhf EF-Ts), or an antibody thereto, in a sample is indicative of infection with Mhf.
It will be appreciated that detection of the polypeptide of the second aspect of the invention (Mhf pgk or CMhm pgk), or an antibody thereto, in a sample is indicative of infection with Mhf or CMhm. It will be appreciated that detection of the polypeptide of the third aspect of the invention (Mhf gapA or CMhm gapA), or an antibody thereto, in a sample is indicative of infection with Mhf or CMhm. As is described in more detail in Example 2 below, in this embodiment it is possible to distinguish between infection with Mhf and CMhm since Mhf gapA polypeptide is reactive against serum from feline post-Mhf infection but not reactive against serum from feline post-CMhm infection. In contrast, CMhm gapA polypeptide is reactive against serum from feline post-CMhm infection but not reactive against serum from feline post-Mhf infection. Differentiation of infecting species is important as Mhf is pathogenic, resulting in significant disease during acute infection, whilst CMhm less frequently results in disease, but is less readily cleared from the infected animal. Animals infected with Mhf would most likely require antibiosis and supportive therapy (e.g. fluid therapy including blood transfusions, appetite stimulation) whilst those infected with CMhm rarely require therapy in the absence of concurrent disease unless attempted clearance of infection is desired.
It will be appreciated that detection of the polypeptide of the fourth aspect of the invention (CMhm dnaK), or an antibody thereto, in a sample is indicative of infection with CMhm. It will be appreciated that detection of the polypeptide of the fifth aspect of the invention (Mhf dnaK), or an antibody thereto, in a sample is indicative of infection with Mhf or CMhm.
It will be appreciated that the methods of the thirteenth and fourteenth aspects of the invention may be considered to be methods of diagnosing whether a cat is or has been infected with haemotropic mycoplasma.
The invention also includes an immunosorbent assay for detecting anti-mycoplasma protein antibodies in a sample, the assay comprising a solid phase coated with a polypeptide according to any of the first, second, third, fourth or fifth aspects of the invention wherein the anti-mycoplasma protein antibodies in a sample exposed to the solid phase will bind to the polypeptide, and a detectable label conjugate which will bind to the anti-mycoplasma protein antibodies bound to the solid phase. The invention also includes a solid substrate with a polypeptide according to any of the first, second, third, fourth or fifth aspects of the invention attached thereto. Typically, the solid phase or solid substrate is a microtitre well or plate.
Preferably, the conjugate comprises an anti-cat antibody. Preferably, the conjugate comprises a detectable moiety such as an enzyme, for example horseradish peroxidise or alkaline phosphatase. Preferably, the immunosorbent assay also contains a substrate for the enzyme.
The assay comprises a solid phase coated with a suitable polypeptide (such as one of the polypeptides of the first or second or third or fourth or fifth aspect of the invention, or a mycoplasma EF-Ts polypeptide, wherein anti-mycoplasma antibodies in a sample exposed to the solid phase will bind to the polypeptide; and a detectable label conjugate which will bind to the anti-CRCV antibodies bound to the solid phase.
It is appreciated that an antigenic fragment of the polypeptide that coats the solid phase is of sufficient size to be bound by an anti-mycoplasma antibody.
Preferably, the haemotropic mycoplasma polypeptide, or antigenic variant or fragment thereof, that coats the solid phase is at least 10 amino acids in length. More preferably, the haemotropic mycoplasma polypeptide, or antigenic variant or fragment thereof, is at least 20, or at least 30, or at least 40, or at least 50, or at least 100 amino acids in length.
The invention also includes a kit of parts which include the components of the immunosorbent assays. The kit of parts may thus include a solid phase such as a microtitre plate, the appropriate haemotropic mycoplasma protein for coating the solid phase, a detectable label conjugate, such as an anti-cat antibody, which will bind to anti- mycoplasma antibodies bound to the solid phase. If the detectable label conjugate is an enzyme, the kit of parts may also include a substrate for the enzyme. The kit may also include a positive control sample that contains an anti-mycoplasma antibody, such as those described with reference to the eleventh aspect of the invention, and a negative control sample.
Typically, protein is coated on microtitre plates overnight at 4°C to 37°C, depending on the stability of the antigen. Unbound protein is washed off with a wash buffer such as phosphate buffered saline or Tris buffered saline. Serum or other samples are incubated on the plate, typically at 37°C for between 1 and several hours. Unbound material is washed off, the plates are incubated with enzyme-labelled (e.g. horseradish peroxidase or alkaline phosphatase) antibody, such as anti-host mammal (such as ant-feline) IgG or IgM for plasma/whole blood/serum samples, or anti-host mammal (such as anti-feline) IgA for saliva, for 1 to several hours at 37°C. Unbound antibody is washed off and plates are incubated with a substrate such as OPD for about 10 min where horseradish peroxidase was used, or p-nitrophenyl phosphate for about 75 min where alkaline phosphatase was used, and the optical density measured in a photometer.
It will be appreciated that in the vaccination methods, immunological detection methods, kits of parts and solid substrates of the invention that the polypeptide is a native haemotropic mycoplasma polypeptide.
The invention will now be described by reference to the following non-limiting Examples and Figures wherein:
Figure 1 Western blot of RBC membrane antigen (R) and Mhf antigen (Hf) probed with plasma samples (1 :250) collected pre-infection (-7 and 0) and post-infection (15, 29, 43, 57, 71, 85, 99, 11 1 , 125, 139 and 153 DPI) from cat HF4. The calculated molecular mass for the major bands (kDa) are shown. The open triangle corresponds to the 71- 72kDa band 4.2 protein identified in both RBC and Mhf antigen preparations.
Figure 2 A Comassie blue-stained PAGE gel (A) of RBC membrane antigen (R) and a Western blot (B) of a pooled plasma sample (P: days -7 and 0, all cats) and RBC membrane antigen (R) probed with the pooled plasma sample (1 :250). The molecular mass (kDa) of each protein standard (S) is given on the left side. The calculated molecular mass (kDa) of each identified band is given on the right side with the likely RBC membrane proteins corresponding to the bands (3, 24). Three bands (*) were detected in the plasma sample (P) incubated with the secondary antibody alone and correspond to immunoglobulin light chains (29kDa), γ heavy chain of IgG (54kDa) and a faint band corresponding to μ heavy chain of IgM (75kDa).
Figure 3 Amino-acid alignment of Mhf dnaK (SEQ ID No 2) sequence (A) and the Mhf dnaK fragment (Accession number ACO07298) published by Museux and others (2009)(B) (SEQ ID No 32).
Figure 4 Two-dimensional electrophoresis of Mhf protein stained with Sypro Ruby. Immunogenic spots picked for mass-spectrometry indicated. Proteins were separated initially according to isoelectric point on a pH3-11 NL IPG strip (horizontal), then according to mass on a 8% poly-acrylamide gel (vertical; Precision Plus Protein standard on right hand side - major bands 75, 50, 25 kDa indicated).
Figure 5 Mhf protein preparation separated by two-dimensional electrophoresis and western blotted with post-infection plasma from two Mhf infected cats. The pH orientation and three molecular mass markers are indicated. The three matched spots are indicated in white.
Spot 12 = migrated at ~30kDa, 2 peaks (1911.9 and 1256.6 Da - including ion-spray) matched Mhf elongation factor-thermostable (predicted size 30.8kDa, pi: 5.94).
Spot 16 = migrated at ~45kDa, 4 peaks (2154.0, 1562.9, 1057.6, and 1012.6 Da - including ion spray) matched Mhf phosphoglycerate kinase. This gave a score of 97 (>20=significant)
Spot 23 = migrated 80kDa 2 peaks (1581.8 and 1744.9Da - including ion spray) matched Mhf heat shock protein 70 {dnaK) (predicted size 65.6kDa, pi: 5.02). This gave a score of 77. Figure 6 Recombinant Mhf dnaK (rMhf dnaK) ELISA optical density results for plasma taken immediately prior to, and during, acute Mhf infection from cats HF6 (A) and HF7 (B). Prior to infection no reactions towards rMhf dnaK were detected. At 8 days post-infection the HF6 cat demonstrated a weak reaction to rMhf dnaK, and by days 5 to 29 post-infection both cats showed a strong reaction to rMhf dnaK.
Figure 7 Recombinant Mhf dnaK (rMhf dnaK) ELISA optical density results for plasma taken immediately prior to, and during, acute CMhm infection (HM2). Prior to infection no reactions towards rMhf dnaK were detected. At 29 days post-infection the cat demonstrated a weak reaction to rMhf dnaK, which decreased over the following 42 days.
Example 1 : Antigen Specificity of the Humoral Immune Response to Mycoplasma haemofelis Infection
The aim of this study was to characterise the antigenic specificity of the humoral immune response made by cats infected with the feline haemoplasma, Mycoplasma haemofelis (Mhf). A crude Mhf antigen preparation was prepared from red blood cells (RBCs) collected from a cat at a time of high bacteraemia. Plasma samples were collected from six cats pre- and post-experimental infection with Mhf, with regular sampling performed from 15 to 149 or 153 days post-infection (DPI). Pre-infection RBC membrane ghosts were prepared from these six cats, and used to identify erythrocyte proteins that may have contaminated the Mhf antigen preparation.
The Mhf antigen preparation comprised 11 protein bands. The immunodominant bands on western blotting with infected cat plasma were of molecular mass 78, 68, 60, 48 and 38kDa. Most cats (n=5) had plasma antibody that reacted with at least one band (always including 68kDa) at 15 DPI and all cats were seroreactive by 29 DPI. The maximum number of antibody specificities from an individual animal was identified in plasma collected between 57 and 99 DPI. Contamination of the Mhf antigen preparation with RBC membrane proteins was observed. The contaminating RBC proteins were of molecular mass 71-72kDa (consistent with band 4.2) and 261 and 238kDa (consistent with spectrin) and these were recognised by all plasma samples. A range of Mhf antigens are recognised by cats infected experimentally with the organism. These represent possible targets for immunoassays, but care must be taken to prevent false positive results due to host protein contamination. We have recently investigated the kinetics and outcomes of experimental infection with each of the feline haemoplasma species, including Mhf (Tasker and others 2009a; Tasker and others 2009a). As part of those studies, plasma samples were collected for 22 weeks following Mhf infection, to enable more extensive characterisation of proteins recognised by the immune system of infected cats and to attempt to determine whether autoantibodies specific for erythrocyte membrane antigens were induced by the infection.
Materials and Methods:
Cats and Samples
Seven barrier-maintained, SPF derived domestic-shorthaired cats (7-month-old (n=6), 2- years-old (n=1); four neutered males and three entire females) were used in this study. All cats were infected experimentally with Mhf and details of the experimental procedures, inoculating doses administered and infection monitoring procedures have been described previously (Tasker and others 2009a; Tasker and others 2009b). The cats were designated as Cats HF1 , HF2, HF4, HF6, HF8, HF12 and HF14, with the discontinuous numbering being due to the inclusion of additional cats in the parallel studies mentioned previously (Tasker and others 2009a; Tasker and others 2009b). Briefly, infection of the cats was carried out by obtaining heparinised blood from barrier- maintained donor cats chronically infected with Mhf. The blood type of the donor cats and all recipients was predetermined to be Type A (RapidVet-H blood typing cards, DMS Laboratories Inc, New Jersey, US). Fresh blood was collected from donors and injected intravenously into the recipients. These inocula comprised 2 ml of heparinised blood (infective dose HF14: 7.21 χ 107, others: 1.55 * 108 Mhf copies) given via pre-placed cephalic intravenous catheters within 5 min of collection from the donors. All procedures and experiments described were undertaken under a project license approved under the UK Animals (Scientific Procedures) Act 1986. As described previously (Tasker and others 2009a; Tasker and others 2009b), EDTA- anticoagulated blood samples were regularly collected from all cats and subjected to real-time PCR (qPCR) to confirm that Mhf infection was absent before inoculation, and present post-infection (Tasker and others 2009a; Tasker and others 2009b). Seven days before infection (day -7), on the day of infection (day 0), and approximately every 2 weeks thereafter, until day 149 (HF2) or 153 (HF1 , 4, 6, 8 and 12), an additional 1 ml volume of EDTA anticoagulated blood was collected from each cat, centrifuged (2200 * g, 3 min) and the plasma removed and stored at -20°C until use. A pooled plasma sample was made by mixing an equal volume of the pre-infection plasma samples collected during the study. Plasma samples, from EDTA blood (the RBC were used for other purposes e.g. Coombs' test), were used in order to minimize the total volume of blood collected from the animals and to comply with the terms of the studies' project license.
Antigen Preparation
M. haemofelis
Whole blood was obtained from cat HF14 at a time of high Mhf blood copy number as determined by qPCR (4x109 Mhf copies/ml, 1 1 days post-infection [DPI]) (Tasker and others 2009a). At the time of euthanasia, once deep general anaesthesia had been induced with intravenous pentobarbitone, approximately 100mls of blood was collected into Alsever's solution (1 :1 v/v) (Sigma-Aldrich Ltd, Poole, Dorset, UK) by cardiac puncture prior to completion of the anaesthetic overdose. Mhf was isolated from the blood using the methods described by Hoelzle et al. (2003; 2006). Briefly, RBCs were sedimented by centrifugation at 600g for 10 min, plasma and buffy coat were aspirated, and the RBCs were washed and centrifuged in an equal volume of phosphate-buffered saline (PBS; 0.15M, pH 7.4). The PBS and remaining buffy coat was aspirated and the wash repeated twice more. The final packed, washed RBC were incubated in PBS containing 0.15% Tween-20 and 3% (w/v) EDTA, and incubated for 30 min at ambient temperature, in a vertical shaker (speed 150rpm) to dislodge the Mhf. Debris and erythrocytes were pelleted by centrifugation at 600g for 10 min and the resultant supernatant was centrifuged at 40,000g for 30 min at 4°C to pellet the Mhf. The supernatant was removed, the pellet resuspended in 1 ml PBS and centrifuged through 20% sodium diatrozoat meglumine and diatrozoat sodium (76% Urografin; Bayer pic, Newbury, Berkshire, UK) at 15,000rpm for 40min at 4°C, and the final pellet was resuspended in 1.0 ml PBS.
The resulting Mhf antigen preparation was depleted of any contaminating albumin or IgG using the ProteoExtract Albumin/lgG Removal Kit (Calbiochem, Merck Chemicals Ltd., Nottingham, UK) according to the manufacturer's instructions. The flow-through and the wash from the columns were added to a 20K iCON concentrator (Pierce Biotechnology, Fisher Scientific UK Ltd., Loughborough, Leicestershire, UK) and centrifuged at 6,000g for 1 hour. The protein concentration in the retained solution (approximately 1 ml) was measured using a Qubit (Invitrogen Ltd., Paisley, Scotland) before storage at -80°.
A similar procedure was attempted using blood from cats infected with CMhm (4.6x107 CMhm copies/ml, 21 DPI) and CMt (1 x105 CMt copies/ml, 17 DPI) but insufficient antigen was recovered, even when blood was collected at peak haemoplasma copy number for these species (unpublished observations).
RBC Membrane Ghosts
RBC membrane ghosts were prepared from 1 ml EDTA anticoagulated blood from the six plasma source cats (HF1 , 2, 4, 6, 8 and 12), prior to infection, using the methods described by Barker (Barker 1991 ). Briefly, RBCs from 1 ml EDTA anticoagulated blood were washed six times in 10 volumes of PBS with aspiration of the supernatant and buffy-coat between washes. RBCs were lysed by adding 10 volumes of ice-cold lysis buffer (20mM Tris, pH 7.6) and pelleted by centrifugation at 40,000g for 30min at 4°C. The supernatant and opaque buttons of residual leucocytes were removed, using a pipette, leaving the translucent RBC membranes. The membranes were washed a minimum of four times in ice-cold lysis buffer until the supernatant was clear of haemoglobin. The concentration of protein in the final solution was measured by Qubit and stored at -80°C prior to use. PAGE and Western Blot Analysis
Polyacrylamide gel electrophoresis (PAGE) was performed using the NuPAGE electrophoresis system (Invitrogen Ltd., Paisley, UK) under reducing conditions and proteins were transferred to nitrocellulose membranes using the XCell mini-cell and Blot Module (Invitrogen, Paisley, UK) as per the manufacturer's instructions. NuPAGE Novex 4-12% Bis-Tris precast gels, NuPAGE MOPS running buffer, NuPAGE LDS sample buffer (all Invitrogen Ltd) and Mhf or RBC membrane antigen (2Q^g per well) were used for the investigation of the humoral immune responses. Protein transfer was performed using the NuPAGE transfer buffer (Invitrogen) and a pre-stained molecular weight standard (All Blue Precision Plus Protein Standard, Bio-Rad Laboratories Ltd., Hemel Hempstead, UK) was included on each gel to monitor transfer efficiency and to allow calculation of molecular mass, The NuPAGE Large Protein Blotting Kit (Invitrogen Ltd.), which included 3-8% tris-acetate gels, the HiMark Pre-Stained High Molecular Weight Protein Standard and 0. 45 μητι nitrocellulose membranes, was used to further investigate antigenic proteins in the RBC membrane preparations, as this gave better separation of the high molecular weight proteins. After transfer, nitrocellulose membranes were blocked with 5% (w/v) non-fat milk in TBST (50 mM Tris, 150 mM NaCI, 0.05% Tween 20, pH-7.6) for 2 hours. Membranes were then cut in to strips, each including a lane of Mhf antigen and RBC membrane ghosts from the individual cat. The strips were probed overnight with 1 in 250 dilution of plasma (D-7, 0, 15, 29, 43, 57, 71 , 85, 99, 111 , 125, 139 and 149 or 153) in TBST + 5% non-fat milk. After washing, binding of plasma antibody was identified by use of an alkaline phosphatase conjugated goat anti-cat IgG H+L Fab' antibody (Jackson ImmunoResearch Europe Ltd., Newmarket, Suffolk, UK) diluted 1 in 20,000 in TBST + 5% non-fat milk and applied for 2 hours. The membranes were washed three times with TBST between steps and all incubations were at room temperature on a rocking platform. Following the final washes, visualisation was achieved using Lumi-Phos WB Chemiluminescent Substrate (Pierce Biotechnology) and exposure to Kodak Bio-max Film (Sigma-Aldrich, Poole, Dorset, UK) for 5 min.
A negative control, omitting incubation with a plasma sample, was performed to control for reactivity between secondary antibody and the Mhf antigen and RBC membrane ghosts. The pooled plasma sample (10μΙ of 1 :100 dilution), incubated with the secondary antibody, was used to identify bands resulting from plasma protein contamination of the antigen preparations. Images of the western blots were captured using a document scanner and analysed using the TotalLab TL100 software (Nonlinear Dynamics Limited, Newcastle upon Tyne, UK) in order to allow for correction of gel artefacts and comparison of banding patterns obtained from antigen preparations and different plasma samples.
Results:
Western blots were performed with RBC membrane ghosts and Mhf antigen preparations using plasma samples collected from 6 cats infected with MHf between 0 and 149 or 153 DPI. Antibodies were induced with specificity for 12 different bands in the Mhf antigen preparation (97, 93, 78, 72, 68, 60, 54, 53, 48, 38, 35 and 29-25kDa) and for a 71-72kDa band in the RBC membrane ghosts (Figure 1). The antibody specific for the 71-72kDa protein identified in the RBC ghosts and the Mhf antigen preparations was present in plasma collected pre- (days -7 and 0) and post-infection, although the intensity of this band varied when plasma samples taken at different time points were compared for the same animal. This band was not considered to be of Mhf origin and was excluded from the analysis of the immune response to Mhf. None of the 12 pre-infection plasma samples contained antibody to any of the other 11 Mhf bands. No protein bands were identified when the secondary antibody alone was incubated with the antigen preparations (data not shown).
Five of the six cats had developed antibody to at least one Mhf band (which always included the 68kDa band) at 15 DPI, and all six cats were had seroconverted by 29 DPI (Table 1). The maximum number of Mhf bands recognised by individual cats ranged from 8 to 1 1 , with the 78, 68, 60, 48 and 38kDa bands recognised by plasma antibodies from all cats. These same five bands were those that tended to be recognised first. The maximum number of Mhf bands recognised by an individual was in samples collected between 57 and 99 DPI. There was some variation in band intensity with individual plasma samples after this time but this was not related to any changes in the infection kinetics or clinical parameters in that particular animal (Table 1). The band between 29 and 25kDa appeared as a single broad band in the majority of cats at most time points, but one cat had reactivity initially (15 DPI) at 29kDa only (Figure 1 ) and another had distinct bands within the 29 and 25kDa range at 5 DPI.
Table 1 : Mhf antigens recognised during the humoral immune response in 6 Cats infected experimentally with the organism
Number of animals reacting to individual bands at indicated DPI
Calculated
molecular mass of -7 0 15 29 43 57 71 85 99 111 125 139 153 antigen band
97kDa 0 0 0 1 2 4 4 4 3 4 3 4 4
93kDa 0 0 0 0 0 2 2 2 2 2 2 2 2
78kDa* 0 0 4 5 5 6 6 5 6 5 5 6 6
68kDa' 0 0 5 6 6 6 6 6 6 6 6 6 6
60kDa* 0 0 4 6 6 6 6 6 5 6 5 5 5
54kDa 0 0 1 1 3 4 3 3 4 6 6 6 6
53kDa 0 0 0 0 1 1 1 1 1 1 1 1 1
48kDa* 0 0 4 4 5 6 6 6 6 6 6 6 6
38kDa" 0 0 4 5 5 6 6 6 6 6 6 6 6
35kDa 0 0 0 0 0 4 3 4 4 4 5 5 5
29kOa
0 0 1 6 6 6 6 6 6 6 6 6 6 25kDa
Average number of
bands 0 0 3.8 5.7 6.5 8.5 8.2 8.2 8.2 8.7 8.5 8.8 8.8 detected
* These bands were recognised by all cats and tended to be recognised first, and were thus considered the major antigenic determinants. The nature of the 71-72kDa band identified in the Mhf and RBC membrane antigen preparations by both pre-infection and post-infection plasma was further examined by comparison of feline RBC membrane proteins separated by PAGE and stained with Coomasie blue; a western blot of RBC membrane proteins probed with a pool of the plasma samples used in the study; and the pooled plasma sample probed with the secondary antibody (Figure 2). Bands at 54kDa and 29kDa were identified in the pooled plasma by the secondary antibody, corresponding to gamma heavy chain of IgG and immunoglobulin light chains. In addition, a faint band was present at 75kDa, which likely represents some cross-reactivity with the μ heavy chain of IgM. These bands were in contrast to the three bands (261 , 238 and 71 kDa) detected in the RBC membrane antigen preparation probed with the plasma pool (Figure 2) and the 78 individual plasma samples used in the study (data not shown). The high molecular mass bands (261 and 238) likely corresponded to a and β-spectrin bands that were visible on the Coomassie blue-stained RBC membrane ghost gel (Figure 2). The band at 71-72kDa did not correspond to the faint 75kDa band detected in the plasma pool but was the same weight as band 4.2 in the Coomassie blue-stained gel.
Discussion:
This study has characterised the specificity of the plasma antibody response to Mhf proteins made by cats infected experimentally with Mhf. This humoral immune response was monitored for 22 weeks following infection. To date, Mhf has not been cultured in w'iro and the only means of producing antigen for such studies is by in vivo amplification and isolation from the blood of an infected cat (Alleman and others). Similar techniques have been applied to the preparation of antigen from Msu (Hoelze and others 2003; Hoelze andf others 2006) and M. haemomuris (Rikihisa and others 1997). Contamination of Mhf antigen preparations with host blood-derived proteins is a recognized problem and such contaminants may originate from the cellular components (RBC and white blood cells) and the plasma. In order to maximise the amount of antigen recovered, blood was collected from an experimentally infected cat at the time of presumptive peak Mhf copy number (1 1 DPI), and before the onset of anaemia and Coombs' test positivity (Tasker and others 2009b). Blood collected after the onset of anaemia and Coombs' positivity was susceptible to severe haemolysis during the isolation procedure, resulting in haemoglobin and RBC membrane contamination of the Mhf preparations (unpublished observations). An albumin and IgG depletion step was included in the Mhf antigen preparation procedure as immunoglobulin contamination of Msu preparations has been reported (Hoelze and others 2006). Bands consistent with the heavy and light chains from IgG were not detected when the Mhf antigen preparation was incubated with the secondary antibody alone. The present study has used plasma harvested from EDTA blood samples collected for other assays rather than serum, in order to minimize the volume of blood collected from the animals. No problems were recognised with the use of plasma rather than serum in the western blotting procedure.
A 71-72kDa protein band was detected in the Mhf and RBC membrane antigen preparations by all pre and post-infection plasma samples, but was not detected when the secondary antibody was used alone. This protein band has molecular mass equivalent to the erythrocyte protein band 4.2 (Korsgren and others 1990; Steck and others 1974), and correlated with band 4.2 identified on a Commassie blue-stained PAGE gel of RBC membrane proteins. This band was not of a size that would be consistent with immunoglobulin light chains or γ or μ heavy chains identified in the blot of the pooled plasma sample. Therefore, reactivity involving the 71-72kDa band was considered to be the result of contamination of the Mhf antigen preparation by host erythrocyte proteins. These cats also had plasma antibody reactive with a and β- spectrin in the RBC membrane ghost preparations and this antibody was present both before and after Mhf infection. These bands were intermittently visible in the western blots with the Mhf antigen preparation, presumably due to their high molecular weight and inconsistent transfer when the standard blotting system was used. Naturally occurring autoantibodies to erythrocyte cytoskeleton proteins, including the spectrins, have been reported in a number of species including man (Ballas 1989; Lutz and Wipf 1982) and dogs (Barker and others 1991 ). The human anti-spectrin antibodies have been shown to cross-react with a protein migrating to an equivalent position as band 4.2 (Lutz and Wipf 1982). These physiological autoantibodies specific for erythrocyte proteins have a role in the removal of damaged and senescent RBC (reviewed by Kay 2005).
The plasma of all cats contained antibody reactive with a broad band of molecular mass 25-29kDa. This band appeared to be made up of a number of individual bands of similar size when two of the plasma samples collected at 15 DPI were used, but was present as a single band with all other positive plasma samples. A similar band was present in previous studies of antibody responses to Mhf (Alleman and others 1999) and Msu (Hoeize and others 2006) and corresponds to the immunoglobulin-containing area identified by two-dimensional SDS-PAGE/western blots of Msu (Hoeize and others 2007A). This broad protein band may therefore be composed of host-derived proteins. The size of this protein would be consistent with that of immunoglobulin light chain, but the band was not recognized by the secondary antibody alone. Further work is required to determine the identity of this band.
The major antigenic determinants of Mhf, to which infected cats respond serologically, were of molecular mass 78, 68, 60, 48 and 38kDa. All cats produced antibodies reactive with all of these bands by 57 DPI. A previous study found significant reactivity to Mhf determinants of molecular mass 150, 52 and 14 kDa by 30 DPI (Alleman and others 1999). Antibodies reactive with Mhf proteins of 53 and 54kDa were found in the plasma of cats in the present study, but the former specificity was only identified in one cat and the latter was seen in only four cats by 57 DPI, which is the time point closest to the last sample (60 DPI) analysed in the study by Alleman ef al.
Mice infected with M. haemomuris develop serum antibodies to Mycoplasma determinants of molecular mass 118, 65, 53, 45, and 40 kDa at 42 DPI (Rikihisa and others 1997). Pigs infected with Msu produce antibodies reactive with major MSu proteins of 70, 45 and 40kDa and minor proteins of 83, 73, 61 , 57, and 33kDa. In these pigs, antibody specific for the major bands was present as early as 7 DPI and was well- established by 14 DPI (Hoeize and others 2006). The variation in the molecular mass of the Mhf determinants detected in our study compared with those from previous studies may be due to the experimental methods used or the haemoplasma species investigated. For instance, the major determinants described in the Msu study (70, 45 and 40kDa) may correspond to Mhf determinants of 68, 48 and 38kDa described in the present study, but use of a different acrylamide gel concentration (4-12% gradient vs 10%) and buffer system in the two studies may have resulted in slightly different migration rates, affecting the calculation of molecular mass. Alternatively, these differences may reflect variations between the Mycoplasma species as they reside in different clades within the haemoplasmas as determined by 16S rDNA and RNaseP phylogenetic analysis (Johansson and others 1999; Messick and others 2002; Neimark and others 2001 ; Peters and others 2008; Tasker and other 2003).
Later studies of the immune response to Msu identified the 70kDa protein (HspA1) as a DnaK-like protein (Hoeize and others 2007b) and the 40kDa protein (MSG1 ) as a surface-localised adhesion protein with properties similar to glyceraldehyde-3-phosphate dehydrogenase (Hoeize and others 2007c). These proteins have been evaluated for use in diagnostic immunoassays (Hoeize and others 2007b) and the latter as a potential vaccine candidate (Hoeize and others 2009). A recent study investigating CMt infection found that the majority of cats seroconverted 3 to 4 weeks following infection to a recombinant, partial Mhf MSG1 protein by western blotting (Museux and others 2009). In addition, this study demonstrated reactivity to this recombinant protein in plasma collected from a cat infected with Mhf at 6 weeks post-infection and one infected with CMhm at 21weeks post-infection. Therefore, the results of that study agree with the present findings as five of the cats reported here seroconverted to the 68kDa protein by 29 DPI.
The cats utilised in the present study for the western blots, developed anaemia with positive Coombs' test results from 15 to 50 DPI (Tasker and others 2009b). There was no correlation between the Mhf antigenic determinants recognised and the development and subsequent disappearance of RBC-associated antibody. The first occasion on which the Coombs' test was positive correlated with the day on which the first plasma sample was collected for the analysis described in this study. Disappearance of the RBC-associated antibody did not correlate with the development or loss of reactivity to any particular Mhf antigenic determinant.
The results of the present study demonstrate that a range of Mycoplasma and erythrocyte antigenic determinants are recognised by circulating antibodies in cats with Mhf infection. The autoantibodies directed against the RBC membrane proteins a and β spectrin and the protein equivalent to band 4.2 were present in both pre-infection and post-infection samples. These likely represent physiological autoantibodies involved in the removal of senescent erythrocytes. It is of note that cats only become Coombs' test positive post-infection. It remains to be determined whether the erythrocyte-bound antibody (as opposed to the circulating antibody investigated here) is specific for surface Mhf antigens or erythrocyte autoantigens and whether the antigenic specificity of antibody eluted from the erythrocytes of Mhf-infected cats differs from that of the circulating antibody pool.
Example 2: Identification of antigens specific for the humoral immune response to Mhf, CMhm and CMt infection
Materials & Methods Sources of haemoplasma DNA. haemoplasma protein, host protein and pre- & post- immune plasma All procedures and experiments described were undertaken under a project license approved under the Animals in Scientific Procedures Act, 1986. Additional data from these experiments has been described in published reports (Peters and others 2010, Tasker and others 2009a, Tasker and others 2009b).
As part of another study (Peters and others 2010) blood was taken from either Mhf or CMhm infected SPF cats during periods of maximum parasitaemia. The erythrocytes were separated by centrifugation and the haemoplasma organisms dislodged from the erythrocyte surface using EDTA/Tween. The haemoplasma organisms were then separated from the erythrocytes and debris by low speed centrifugation. The supernatant containing the haemoplasmas was then subjected to high-speed centrifugation. The high-speed supernatant was determined by qPCR to be rich in haemoplasma DNA and was utilised in the generation of both haemoplasma genome libraries. The high-speed pellet of haemoplasmas was subjected to differential gradient centrifugation, and subsequently concentrated using a 9 KDa molecular weight cut-off filter. A similar extraction procedure from uninfected erythrocyte membranes was also performed to obtain a negative control.
As part of another study EDTA anti-coagulated blood was taken from barrier maintained SPF cats prior to and weekly thereafter following experimental infection with Mhf, CMhm or CMt. Excess EDTA anti-coagulated blood from samples submitted to Langford Veterinary Services Diagnostic Laboratories (LVS-DL) for companion animal haemoplasma PCR were also collected. Blood was centrifuged and separated. Plasma was stored at -20°C until required. Partial sequencing of the haemoplasma genome
Haemoplasma genomic DNA was purified using Macherey-Nagel NucleoSpin® Blood kits, from the haemoplasma DNA rich supernatant. Extracted DNA was sheared by nebulisation into 2 to 5 Kbp fragments, as determined by gel electrophoresis. These fragments were ligated into pCR®4Blunt-TOPO® and transformed into One Shot® Chemically Competent Escherichia coli (TOPO® Shotgun Subcloning Kit; Invitrogen). Purified plasmids from randomly selected clones were sequenced using dye-terminator chemistry with piasmid and custom primers. BLASTn analysis of nucleotide sequences and BLASTp analysis of the corresponding amino-acid sequences was performed to identify the origin of the insert sequence (http://blast.ncbi.nlm.nih.qov/Blast.cqiy Target specific primers were used in conjunction with piasmid primers to obtain contiguous sequence by PCR using Mhf and CMhm libraries as template. Identification of Mhf immunogenic proteins using two-dimensional sodium dodecyl sulphate pol acrylamide gel electrophoresis (2D SDS-PAGE)
Mhf organisms and un-infected erythrocyte membrane protein extracts were prepared for 2D SDS-PAGE using the Amersham 2D-clean up kit (GE Life Sciences). Proteins were initially separated according to isoelectric point on Immobiline™ DryStrip pH 3-11 NL (GE Life Sciences), then according to mass (12.5% polyacrylamide gel). Gels were either western blotted onto a polyvinylidene difluoride (PVDF) membrane or stained using Sypro® Ruby Protein Gel Stain (Invitrogen). Membranes were blocked by gentle agitation for 5 hours in tris-buffered saline (25mM Tris, 150mM NaCI) with Tween-20 (0.1 % v/v) and 5% (w/v) non-fat milk (TBST-5M). Membranes were incubated overnight with test plasma (1 :500 dilution of plasma from each of two cats taken at different time point: 'pre-infection' - from 7 and 1 days pre-infection; 'post-infection' - from 139 and 153 days post-infection) in TBST-5M. Washed membranes were incubated for 2 hours at room temperature in TBST-5M containing 1 :20,000 dilution of alkaline phosphatase conjugated goat anti-cat IgG (H+L) antibody. Membranes were washed in Tris-buffered saline (25mM Tris, 150mM NaCI) with Tween-20 (0.1% v/v) (TBST) between steps (20 minutes; two wash changes; orbital shaker at 25rpm; room temperature). Following the final washes, visualisation was achieved using Lumi-Phos WB™ Chemiluminescent Substrate and exposure to Amersham Hyperfilm ECL™. From the Sypro® Ruby stained gel protein spots corresponding to spots of immunoreactivity were cut out for trypsin- digestion and analysed using mass-spectrometry (4700 MALDI-TOF/TOF Mass Spectrometer; Applied Biosystems). Results were compared to known Mhf sequences and to the MSDB protein database. Generation of recombinant haemoplasma proteins
The Mhf gapA, Mhf dnaK and CMhm gapA protein coding sequences were cloned into pET101/D-TOPO® and expressed in BL21 Star™ (DE3) E. coli as fusion proteins with C- terminal His-tags (Champion™ pET Directional TOPO® Expression Kit, Invitrogen). Prior to cloning the CMhm gapA coding sequence was subjected to site directed mutagenesis to convert opal stop codons (TGA) to tryptophan codons (TGG). His-tagged proteins were purified using the Ni-NTA Spin Kit (QIAgen). Proteins were separated using one- dimensional gel electrophoresis (NuPAGE® Novex® Bis-Tris Gel System) and western blotted onto nitrocellulose. Product size was determined by comparison to a molecular weight ladder (Precision Plus Protein™ Standards; Bio-Rad). Expressed protein bands were excised from the NuPAGE gels and subjected to trypsin-digestion and mass- spectrometry analysis to confirm their identity. Immunoblots of recombinant haemoplasma proteins
Western-blot membranes were blocked in TBST-5M for 2 hours. The membranes were probed overnight with 1 :250 dilution of test plasma in TBST-5M. After washing, alkaline phosphatase conjugated goat anti-cat IgG (H+L) or anti-dog IgG antibody (Jackson ImmunoResearch Europe Ltd.) diluted 1 :20,000 in TBST-5M were added and incubated for 2 hours. The membranes were washed three times with TBST between steps and all incubations were at room temperature on a rocking platform. Following the final washes, visualisation was achieved using Lumi-Phos WB Chemiluminescent Substrate (Pierce Biotechnology) and exposure to Amersham Hyperfilm ECL (GE Life Sciences).
Screening of feline plasma using an ELISA of recombinant Mhf dnaK
Vinyl Flat Bottom Microtiter® plates (Thermo Fisher Scientific) were coated with rMhf dnaK (14ng/well) in a volume of 100μΙ sodium carbonate buffer (0.05M; pH 9.6) and incubated overnight at 4°C. The plates were washed with PBS (137mM NaCI, 1.47 mM KH2P04, 10mM Na2HP04l 2.7mM KCl; pH 7.0)-0.05% (v/v) Tween 20 (PBST), blocked using PBST containing 10% (w/v) fat-free milk powder (Marvel, Premier Foods; PBST- 10M) for 2 hours at room temperature under agitation and then washed with PBST. Wells were incubated with plasma (duplicates of 1:200, 1 :400 and 1 :800 dilutions in ΙΟΟμΙ/well PBST-10M) for 2 hours at room temperature under agitation then washed with PBST. Wells were then incubated with either anti-cat IgG conjugated with alkaline phosphatase (heavy and light chains; Jackson ImmunoResearch) or anti-dog IgG conjugated with alkaline phosphatase (heavy and light chains; Sigma) at 1 :10,000 dilution in 100pl/well PBST-10M for 2 hours at room temperature under agitation and then washed with PBST. Wells were then incubated with p-nitrophenyl phosphate (1 ΟΟμΙ/well; 1 mg/ml in sodium carbonate buffer, 0.05M, pH9.6) in the dark. Absorbance at 405nm and 495nm (to control for inter-well variation) was measured using a computer- assisted microplate reader (Labsystems Multiscan Ex Primary EIA v2.1-0 with Genesis v3.0) at 30, 60 & 75 minutes. Each plate contained wells to which (i) no plasma was added (triplicate), (ii) haemoplasma negative SPF feline plasma (1 :200, 1 :400 and 1 :800 dilutions) was added, (iii) duplicate two-fold serial dilutions of a strong positive feline plasma (1 :200 to 1 :409,600) was added. A serum sample was deemed positive if its OD value was greater than the OP value of the 1 :51 ,200 dilution of the positive control (typically an OD of 0.100 at ~75min). Equivocal results were those that were close to, but not greater than, the OD of the 1 :51 ,200 dilution of the positive control sample, and demonstrated consistently reducing ODs in the plasma dilutions. Pre- and post-infection (8, 15, 22, and 29 days post-infection for Mhf, CMhm & CMt; additional 36, 43, 50, 57, 64, 71 days post-infection for CMhm & CMt) plasma was available for cats experimentally infected with feline haemoplasmas. Plasma from 205 feline clinical samples submitted to LVS-DL for haemoplasma qPCR were available.
Results
Mhf immunogenic proteins identified using 2D SDS-PAGE immunoblot
A number of spots were seen on the 2D post-infection immunoblot, but not the pre- infection immunoblot. Twenty one of these post-infection spots corresponded to visible protein spots on the Sypro® Ruby stained SDS-PAGE gel and could therefore be analysed by tandem mass-spectroscopy (Figure 4 shows a 2 dimensional SDS-PAGE gel stained with SYPRO-Ruby - spots that were analysed by mass-spectrometry are indicated; Figure 5 shows the three matched spots on a post-infection immunoblot). Of these spots three corresponded to the Mhf proteins dnaK, phosphoglycerate kinase (pgk), and elongation factor thermo-stable (EF-Ts). Due to the immunoreactivity of postinfection plasma to these three proteins they were classified as immunogenic.
Expression of recombinant haemoplasma proteins
From the Mhf and CMhm genomic DNA shot-gun libraries the whole coding sequences for Mhf dnaK and gapA, and CMhm gapA were identified. The CMhm gapA coding sequence was successfully subjected to site-directed mutagenesis prior to cloning and expression. All three proteins were successfully expressed, purified and their identities confirmed by the visualisation of protein bands of the predicted size on 1 D SDS-PAGE (Mhf dnaK ~75KDa; Mhf gapA ~40KDa; CMhm gapA ~40KDa) and by mass- spectrometry.
Immunoblots of recombinant haemoplasma proteins
Summary of reactivity (positive or negative *■) to recombinant haemoplasma proteins by plasma from experimental cats pre and post-infection with Mhf (n=2), CMhm (n=1), or CMt (n=1), and by plasma from a dog naturally infected with Mhc.
Test Plasma rMhf dnaK rMhf gapA rCMhm
gapA
Feline pre-infection X X X
Feline post-Mhf infection s X
(n=2) Feline post-CMhm infection X
(n=1 )
Feline post-CMt infection V X
(n=1)
Canine post-Mhc infection / X
(n=1 )
ELISA of recombinant Mhf dnaK
All experimental cats (n=16) were negative for anti-Mhf dnaK antibodies in pre-infection plasma samples. All cats (n=10) infected with Mhf showed a marked production of anti- Mhf dnaK antibodies on day 15 post-infection, with equivocal or weakly positive (n=2) and negative (n=8) results on day 8 post-infection (for example see Figure 6). Cats infected with CMhm (n=3) became weakly positive for anti-Mhf dnaK antibodies on days 22, 29 and 43 that persisted until at least 71 days post-infection (for example see Figure 7). Cats infected with CMt (n=3) became weakly positive (albeit greater than those to CMhm) for anti-Mhf dnaK antibodies on days 22 and 29 (n=2), antibody levels then decreased by 71 days post-infection, to equivocal/very weakly positive levels in two cats.
Of the clinical samples one was positive for Mhf alone by qPCR (threshold cycle: 16.5), whilst 20 were positive for CMhm alone (threshold cycles: 25.1-44.6; unknown in 1 case). None of the samples tested were positive for CMt and there were no dual haemoplasma infections. The Mhf positive cat was also positive for anti-Mhf dnaK antibodies. Of the 20 CMhm positive cats, 12 were positive for anti-Mhf dnaK antibodies, 2 were equivocal and 6 were negative. Of the 184 haemoplasma qPCR negative samples, 33 were positive for anti-Mhf dnaK antibodies, 10 were equivocal and the remainder (n=141) were negative.
Figure imgf000032_0001
Discussion
Two haemoplasma proteins, gapA and dnaK, have been identified and expressed one of which (dnaK) has been confirmed to be immunogenic in cats using a combination of 2D PAGE of crude whole haemoplasma preparation and immunoblotting. Anti-Mhf dnaK antibodies were detected using 1 D immunoblots in cats experimentally infected with Mhf, whilst cross-reactive antibodies were detected in cats experimentally infected with CMhm and CMt and in a dog naturally infected with Mhc. This suggests that an assay using rMhf dnaK could be used to detect exposure to haemotropic mycoplasmas in companion animals. In contrast, anti-rCMhm gapA antibodies were detected in a cat (n=1 ) experimentally infected with CMhm, whilst anti-rMhf gapA and cross-reactive antibodies were detected in cats (Mhf n=2; CMhm n=1 ) and dog (Mhc) infected with haemofelis clade haemoplasmas. No cross-reactive antibodies were detected against recombinant gapA from differing haemoplasma clades. This suggests that recombinant gapAs could be used to determine clade of infecting haemoplasma species in companion animals.
A further two haemoplasma proteins, pgk and EF-Ts, have been identified as immunogenic ie they are recognised with Mhf post-infection serum from cats, indicating suitability for use in a vaccine and as a marker of haemotropic mycoplasma infection.
Example 3: DNA and amino acid sequences of identified immunogenic proteins
As part of another study (Peters and others 2010) blood was taken from either Mhf or CMhm infected SPF cats during periods of maximum parasitaemia. The erythrocytes were separated by centrifugation and the haemoplasma organisms dislodged from the erythrocyte surface using EDTA/T een. The haemoplasma organisms were then separated from the erythrocytes and debris by low speed centrifugation. The supernatant containing the haemoplasmas was then subjected to high-speed centrifugation. The high-speed supernatant was determined by qPCR to be rich in haemoplasma DNA and was utilised in the generation of both haemoplasma genome libraries.
Haemoplasma genomic DNA was purified using Macherey-Nagel NucleoSpin® Blood kits, from the haemoplasma DNA rich supernatant. Extracted DNA was sheared by nebulisation into 2 to 5 Kbp fragments, as determined by gel electrophoresis. These fragments were ligated into pCR®4Blunt-TOPO® and transformed into One Shot® Chemically Competent E. coli (TOPO® Shotgun Subcloning Kit; Invitrogen). Purified plasmids from randomly selected clones were sequenced using dye-terminator chemistry with plasmid and custom primers. BLASTn analysis of nucleotide sequences and BLASTp analysis of the corresponding amino-acid sequences was performed to identify the origin of the insert sequence (http://blast.ncbi.nlm.nih.gov/Blast.cqi). Target specific primers were used in conjunction with plasmid primers to obtain contiguous sequence by PCR using Mhf and CMhm libraries as template.
Native haemoplasma genes are translated using the Mycoplasmal Spiroplasma code. Expressed (pET) genes are translated using the standard E. coli code.
Mhf genes
Heat shock protein 70 (dnaK)
Native gene sequence (SEQ ID No 1)
ATGTCCAAAAAAGAAACAATAATCGGTATCGACCTAGGAACCACTAACTCCTGTGTTGCT ATCGTTGAAAATGGTAATCCTAAGATCTTAGAAACAAATGAGGGTAAGAGAACTATTCCC TCTGTTGTTTCTTTCAAAGGTGATGAGATTATTGTTGGTGATAGCGCTAAGCGTCAGATG GTTACCAACAAGGATACTATTGTATCTATAAAGAGATTAATAGGTACTGGTAAGAAGGTA AAGGCTAGAGGTAAGGAGTACACTCCAGAGGAGATCTCTGCTTATATTCTTAAACACATA AAGAAATATGCCGAAGACAAGTTAGGGCACTCCGTTTCCAAGGCGGTTATTACTGTTCCA GCTTACTTTAACGACTCTGAACGTCAAGCAACTAAGAATGCCGGAACTATTGCTGGATTG GAAGTTGTAAGAATAGTTAACGAACCTACTGCTGCCGCTCTTGCTTACGGTCTAGACCAC AGCGAGAAGGAACAGAAGATATTGGTTTATGACTTGGGGGGAGGTACCTTTGACGTGTCT GTCCTTGATATGTCAGATGGTACTTTTGAAGTATTGGCTACTTCTGGTGATAACCATTTG GGTGGTGACGATTGGGATCAAGCGTTAATAGATTGGCTATTAGAGGAAATCAAGAAGGAA CACTCTATAGATCTTTCTTCAGATAATTTAGCACTTCAAAGACTTAAGGATGCCGCTGAG AAGGCAAAGATAGAGCTTTCTTCCGTTACTCAAACTCAAATACTCCTTCCGTTTCTTTCT ATGGTGGGTGGACAACCACTTAACATAGATAAAGTTGTTACTCGTGTTCAGTTTGAATCT TTAACTAAGCATTTAATTGAGAAGACTAGGAAGCCCTTCTTGGATGCTTTGAAGGAATCT AAGTTATCTGCTTCCGATATAGATCAAATTCTGTTGGTGGGTGGTTCTACCCGTATGCCT GCCGTTCAGGAGTTGGTTAAGAGCCTTTCCGGGAAGACACCTAACTTGTCTATTAATCCC GATGAAGTTGTTGCTTTAGGTGCTTCCGTTCAAGGTGCTATTCTTGCTGGGGATATTAAA GATATCCTGTTATTGGACGTTACGCCTTTAACTCTAAGTATTGAGACTTTAGGTGGTGTA GCAACTCCTTTAATTAAGAGAAATACTACTGTTCCTGTTGAAAAGACTCAGGTCTTCTCT ACAGCTGCAGACAACCAACCTTCTGTGGATATTCATGTTGTTCAAGGTGAGAGACCGATG GCAAATCAAAATAAATCATTGGGAATCTTTACTCTAGATGGAATTCAACCTGCTCCTAAA GGCGTTCCTCAAATTCAAGTTACCTTCTCTATTGATGCTAACGGTATTCTAAAGGTTAAA GCTGAGGATAAAGGGACAGGTAAGAGTAACTCTATTACCATAAACCAATCTTCTGGTTTG AGTGATGAGGAGATTCAAAGAATTATCAAGGAGGCTGAAGAGAATGCAGAGAAGGATCAG AAAGCAAAGGAGGCTATAGAGGTTAAGAATGAAGCGCAGTCTTGGATCTCAATAGTTGAA AAACAACTCTCTGAATCTAATGCGACTGATGAGCAGAAAGAATCTGCTCAGAAGATGGTT GATGAATTGAAGCTTCTTATTAAAGATGAGAAGATTGAGGAGTTAAAACAGAAGATGGAT GCGATTAAAACCTTGAGTCAGGATATGACTAAGTACGCACAGGATAATCCTAAAGAAGAG AGTGAGGAGGTTAAGGAAGCGGAGGTAGTAGAAGAGGATAAGACTGAGGTAGATAAAACT AAATCCTAA
Native amino-acid sequence (SEQ ID No 2)
MSKKETIIGIDLGTTNSCVAIVENGNPKILETNEGKRTIPSWSFKGDEIIVGDSAKRQM VTNKDTIVSIKRLIGTGKKVKARGKEYTPEEISAYILKHIKKYAEDKLGHSVSKAVITVP AYFNDSERQATK AGTIAGLEWRIVNEPTAAALAYGLDHSEKEQKILVYDLGGGTFDVS VLDMSDGTFEVLATSGDNHLGGDDWDQALIDWLLEEIKKEHSIDLSSDNLALQRLKDAAE KAKIELSSVTQTQILLPFLSMVGGQPLNIDKWTRVQFESLTKHLIEKTRKPFLDAL ES KLSASDIDQILLVGGSTR PAVQELVKSLSGKTPNLSINPDEWALGASVQGAILAGDIK DILLLDVTPLTLSIETLGGVATPLIKRNTTVPVEKTQVFSTAADNQPSVDIHWQGERPM A QNKSLGIFTLDGIQPAPKGVPQIQVTFSIDA GILKVKAED GTGKSNSITINQSSGL SDEEIQRIIKEAEENAEKDQKAKEAIEVK EAQSWISIVEKQLSESNATDEQKESAQK V DELKLLIKDEKIEELKQK DAIKTLSQDMTKYAQDNPKEESEEVKEAEWEEDKTEVDKT KS
Expression (PET) gene sequence (SEQ ID No 3)
ATGTCCAAAAAAGAAACAATAATCGGTATCGACCTAGGAACCACTAACTCCTGTGTTGCT ATCGTTGAAAATGGTAATCCTAAGATCTTAGAAACAAATGAGGGTAAGAGAACTATTCCC TCTGTTGTTTCTTTCAAAGGTGATGAGATTATTGTTGGTGATAGCGCTAAGCGTCAGATG GTTACCAACAAGGATACTATTGTATCTATAAAGAGATTAATAGGTACTGGTAAGAAGGTA AAGGCTAGAGGTAAGGAGTACACTCCAGAGGAGATCTCTGCTTATATTCTTAAACACATA AAGAAATATGCCGAAGACAAGTTAGGGCACTCCGTTTCCAAGGCGGTTATTACTGTTCCA GCTTACTTTAACGACTCTGAACGTCAAGCAACTAAGAATGCCGGAACTATTGCTGGATTG GAAGTTGTAAGAATAGTTAACGAACCTACTGCTGCCGCTCTTGCTTACGGTCTAGACCAC AGCGAGAAGGAACAGAAGATATTGGTTTATGACTTGGGGGGAGGTACCTTTGACGTGTCT GTCCTTGATATGTCAGATGGTACTTTTGAAGTATTGGCTACTTCTGGTGATAACCATTTG GGTGGTGACGATTGGGATCAAGCGTTAATAGATTGGCTATTAGAGGAAATCAAGAAGGAA CACTCTATAGATCTTTCTTCAGATAATTTAGCACTTCAAAGACTTAAGGATGCCGCTGAG AAGGCAAAGATAGAGCTTTCTTCCGTTACTCAAACTCAAATACTCCTTCCGTTTCTTTCT ATGGTGGGTGGACAACCACTTAACATAGATAAAGTTGTTACTCGTGTTCAGTTTGAATCT TTAACTAAGCATTTAATTGAGAAGACTAGGAAGCCCTTCTTGGATGCTTTGAAGGAATCT AAGTTATCTGCTTCCGATATAGATCAAATTCTGTTGGTGGGTGGTTCTACCCGTATGCCT GCCGTTCAGGAGTTGGTTAAGAGCCTTTCCGGGAAGACACCTAACTTGTCTATTAATCCC GATGAAGTTGTTGCTTTAGGTGCTTCCGTTCAAGGTGCTATTCTTGCTGGGGATATTAAA GATATCCTGTTATTGGACGTTACGCCTTTAACTCTAAGTATTGAGACTTTAGGTGGTGTA GCAACTCCTTTAATTAAGAGAAATACTACTGTTCCTGTTGAAAAGACTCAGGTCTTCTCT ACAGCTGCAGACAACCAACCTTCTGTGGATATTCATGTTGTTCAAGGTGAGAGACCGATG GCAAATCAAAATAAATCATTGGGAATCTTTACTCTAGATGGAATTCAACCTGCTCCTAAA GGCGTTCCTCAAATTCAAGTTACCTTCTCTATTGATGCTAACGGTATTCTAAAGGTTAAA GCTGAGGATAAAGGGACAGGTAAGAGTAACTCTATTACCATAAACCAATCTTCTGGTTTG AGTGATGAGGAGATTCAAAGAATTATCAAGGAGGCTGAAGAGAATGCAGAGAAGGATCAG AAAGCAAAGGAGGCTATAGAGGTTAAGAATGAAGCGCAGTCTTGGATCTCAATAGTTGAA AAACAACTCTCTGAATCTAATGCGACTGATGAGCAGAAAGAATCTGCTCAGAAGATGGTT GATGAATTGAAGCTTCTTATTAAAGATGAGAAGATTGAGGAGTTAAAACAGAAGATGGAT GCGATTAAAACCTTGAGTCAGGATATGACTAAGTACGCACAGGATAATCCTAAAGAAGAG AGTGAGGAGGTTAAGGAAGCGGAGGTAGTAGAAGAGGATAAGACTGAGGTAGATAAAACT AAATCCAAGGGCGAGCTCAATTCGAAGCTTGAAGGTAAGCCTATCCCTAACCCTCTCCTC GGTCTCGATTCTACGCGTACCGGTCATCATCACCATCACCATTGA
Expression (pET) amino-acid sequence (SEQ ID No 4)
MSKKETIIGIDLGTTNSCVAIVEKGNPKILETNEGKRTIPSWSFKGDEIIVGDSAKRQM VTNKDTIVSIKRLIGTGKKVKARGKEYTPEEISAYILKHIKKYAEDKLGHSVSKAVITVP AYFNDSERQATKNAGTIAGLEWRIVNEPTAAALAYGLDHSEKEQKILVYDLGGGTFDVS VLDMSDGTFEVLATSGDNHLGGDDWDQALIDWLLEEIKKEHSIDLSSDNLALQRLKDAAE KAKIELSSVTQTQILLPFLSMVGGQPLNIDKWTRVQFESLTKHLIEKTRKPFLDALKES KLSASDIDQILLVGGSTR PAVQELVKSLSGKTPNLSINPDEWALGASVQGAILAGDIK DILLLDVTPLTLSIETLGGVATPLIKRNTTVPVEKTQVFSTAADNQPSVDIHWQGERPM A QNKSLGIFTLDGIQPAPKGVPQIQVTFS IDANGILKVKAED GTGKSNSITINQSSGL SDEEIQRI I EAEENAEKDQKAKEAIEVK EAQSWISIVEKQLSESNATDEQ ESAQKMV DELKLLIKDEKIEELKQKMPAIKTLSQDMTKYAQDNP EESEEVKEAEWEEDKTEVDKT KSKGELNSKLEGKPIPNPLLGLDSTRTGHHHHHH Glyceraldehyde 3-phosphate dehydrogenase (gapA)
Native gene sequence (SEQ ID No 5)
ATGAAAAACATTGCGATCAACGGATTCGGAAGAATCGGAAGACTTGCTTTTAGAGAAATT CTTAAAAATAAAGAATTAAAAGTTGTTGCCATCAACGACTTGACTGATCCTAAGACACTT GCTCACCTTCTTAAATATGATACAGCTCATGGACCTGTTAGATGCTATGATATCAGTGTT GAAGGTGACAGTATTGTTTTAGTTAATAAATGTAGTGGAGAAAAACAATCCTTCAAAGTT ATTTCTGAAAGAGATCCTAAAGCTCTTCCTTGGAAGTCTTTAAATGTAGATTGCGTTCTT GAATGTACTGGTCGTTTTACCGATAAAGATGCAGCTATGGCTCATGTTGAAGCGGGGGCT AAGAAAGTAGTTATCTCCGCTCCAGCAAAAGGTGATTTAAAGACAATCGTTTACAACGTA AACCATGGTACTTTAACTTCTTCTGATCAAGTTATCTCAGCAGCTTCCTGTACAACTAAC GCTTTAGCTCCCGTTGTAGATGCTCTTCACAAGAAGTACAAAATTGTTTCTGGGTTTATG ACAACCATTCATGCTTATACAGCGGATCAAAGACTTCAAGACTCTCCTCATAGCGATCTA AGACGTTCAAGAGCGGCTGGTTCTTCAATCATCCCAACTTCAACAGGTGCTGCTGCAGCT ATTGGTAAAGTTATTCCTGAACTTCTAGGTAAGTTAGATGGTGTTGCTCACCGTGTTCCA ACTATTACAGGTTCCTTAGTAGATATGATATTAAGAATGGAATCTACTCCTACAGCTGAG GAGATAAATGCAACTATTAAAGATGCTTCTTCTGAAACTCTATGTTACTGTGAAGATCCT ATCGTTTCTTCCGATATTATTTCTCATACAGCGGCTTCTATCTTTGACTCTCTTTTAACT AAGGTTCTTCCAACTGGAGAGGTTAAGCTTTACACTTGGTACGATAACGAATCTTCTTAT GTGAATCAGCTTGTTAGAACTTTAAACTACTTTGCTTCTCTTTAA
Native amino-acid sequence (SEQ ID No 6)
MKNIAINGFGRIGRLAFREILKN EL VVAINDLTDP TLAHLLKYDTAHGPVRCYDISV EGDSIVLVNKCSGEKQSFKVISERDP ALPWKSL VDCVLECTGRFTDKDAAMAHVEAGA KKWISAPAKGDLKTIVY VNHGTLTSSDQVISAASCTTNALAPWDALHKKYKIVSGF TTIHAYTADQRLQDSPHSDLRRSRAAGSSI IPTSTGAAAAIGKVIPELLGKLDGVAHRVP TITGSLVDMILRMESTPTAEEINATIKDASSETLCYCEDPIVSSDIISHTAAS IFDSLLT KVLPTGEVKLYTWYDNESSYVNQLVRTLNYFASL
Expression (pET) gene sequence (SEQ ID No 7) ATGAAAAACATTGCGATCAACGGATTCGGAAGAATCGGAAGACTTGCTTTTAGAGAAATT CTTAAAAATAAAGAATTAAAAGTTGTTGCCATCAACGACTTGACTGATCCTAAGACACTT GCTCACCTTCTTAAATATGATACAGCTCATGGACCTGTTAGATGCTATGATATCAGTGTT GAAGGTGACAGTATTGTTTTAGTTAATAAATGTAGTGGAGAAAAACAATCCTTCAAAGTT ATTTCTGAAAGAGATCCTAAAGCTCTTCCTTGGAAGTCTTTAAATGTAGATTGCGTTCTT GAATGTACTGGTCGTTTTACCGATAAAGATGCAGCTATGGCTCATGTTGAAGCGGGGGCT AAGAAAGTAGTTATCTCCGCTCCAGCAAAAGGTGATTTAAAGACAATCGTTTACAACGTA AACCATGGTACTTTAACTTCTTCTGATCAAGTTATCTCAGCAGCTTCCTGTACAACTAAC GCTTTAGCTCCCGTTGTAGATGCTCTTCACAAGAAGTACAAAATTGTTTCTGGGTTTATG ACAACCATTCATGCTTATACAGCGGATCAAAGACTTCAAGACTCTCCTCATAGCGATCTA AGACGTTCAAGAGCGGCTGGTTCTTCAATCATCCCAACTTCAACAGGTGCTGCTGCAGCT ATTGGTAAAGTTATTCCTGAACTTCTAGGTAAGTTAGATGGTGTTGCTCACCGTGTTCCA ACTATTACAGGTTCCTTAGTAGATATGATATTAAGAATGGAATCTACTCCTACAGCTGAG GAGATAAATGCAACTATTAAAGATGCTTCTTCTGAAACTCTATGTTACTGTGAAGATCCT ATCGTTTCTTCCGATATTATTTCTCATACAGCGGCTTCTATCTTTGACTCTCTTTTAACT AAGGTTCTTCCAACTGGAGAGGTTAAGCTTTACACTTGGTACGATAACGAATCTTCTTAT GTGAATCAGCTTGTTAGAACTTTAAACTACTTTGCTTCTCTTAAGGGCGAGCTCAATTCG AAGCTTGAAGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTCTACGCGTACCGGT CATCATCACCATCACCATTGA
Expression (pET) amino-acid sequence (SEQ ID No 8
MK IAINGFGRIGRLAFREILKNKELKWAINDLTDPKTLAHLLKYDTAHGPVRCYDI SV EGDSIVL KCSGEKQSF VISERDPKALPWKSLI DCVLECTGRFTDKDAAMAHVEAGA KKWISAPAKGDLKTIVYNV HGTLTSSDQVI SAASCTTNALAPWDALHKKYKIVSGFM TTIHAYTADQRLQDSPHSDLRRSRAAGSS I IPTSTGAAAAIGKVI PELLGKLDGVAHRVP TITGSLVDMILRMESTPTAEEINATIKDASSETLCYCEDPIVSSDI ISHTAAS I FDSLLT KVLPTGEV LYTWYDNESSYVNQLVRTLNYFASLKGELNSKLEGKPI PNPLLGLDSTRTG HHHHHH Phosphoglycerate kinase (pgk)
Native gene sequence (partial) (SEQ ID No 9) ATGGTTTACGATAAGGCGACGCTAAGGGATGTTTCCCTAGATGGAAAAAGAGTAGTAATT CGTCTTGATTTAAACGTACCCGTTAAAGACGGAAAGATTACTGACAATAATAGGGTAGTT CAAACTTTACCTACGGTTCGTTATCTTCTTGAGAAGGGTTGTAAATTAGTTGTTCTTAGT CACTTCTCCAGAATTAAAGATATTTCTGAGGTTACTTCTGGAAAGAAATCTCTTAAAGTA GTAGCTGAGGAATTTCAAAAACTACTTCCTGATAACAAGGTTGCCTTTGTTTCTGATATT GACTTTAACAATGTTGCTTCTTTTGTTAATTCCAATACGGATGTGGATTTGTTTGTTCTT GAGAACACTAGATATTATGACGTTGATGCCCATAACTCTTTAGTTAAATGGGAGTCTAAG AATTATCCAGACTTATCTAAGTTTTGAGCTTCCCTTGGGGAGGTGTTTATTAATGATGCT TTTGGTACCTCCCACAGAGCTCATGCTTCCAACGTAGGTATTGCGGGACATCTTCCTTCT GCAATTGGATTATTGGTTGAGAAGGAGTTAGATATGCTTGGTAAAGCAGTTTCCTCTACA GATTCTCCTAAGGTTTTAATCTTGGGCGGTTCTAAGGTATCCGATAAGTTGAAGTTAATA AATGCGATCGCTCCCAAGGTAGATAAGCTTCTTATTGGTGGGGGTATGTCTTATACCTTC CTTAAAGCACAAGGGAAGGAGGTTGGTAAGTCTATAGTGGAAACTGAAATGATTGAAGAA TGTAAGGATCTTCTTCAGAGATATGCTGGCAAATTGGTTCTTCCCGTTGATCACGTTGTA GCTCCCGAATTTAAAGATATAGCTGGGAGTGTGGTTGATTTAGAGGAGAAGAATTGGGGG GATAATATGGCTTTAGATATTGGCCCTAAGACTGTTGAACTTTATAGAAGTGTTCTTGAG AGTGCTAAAGTTGTTATTTGAAACGGTCCTATGGGAGTATTTGAATTTGATAACTTTGCA GAGGGTACAAA Native amino-acid sequence (partial) fSEQ ID No 10)
MVYDKATLRDVSLDGKRWIRLDLNVPVKDGKITDNN WQTLPTVRYLLEKGCKLWLS HFSRIKDISEVTSGK SL WAEEFQKLLPDNKVAFVSDIDF VASFV SNTDVDLFVL ENTRYYDVDAHNSLVKWESKNYPDLSKFWASLGEVFINDAFGTSHRAHASNVGIAGHLPS AIGLLVEKELDMLG AVSSTDSPKVLILGGSKVSDKLKLINAIAPKVDKLLIGGGMSYTF LKAQG EVGKSIVETEMIEECKDLLQRYAGKLVLPVDHWAPEFKDIAGSWDLEEKNWG D MALDIGPKTVELYRSVLESAKWI NGPMGVFEFDNFAEGT
Expression (pET) gene sequence (Gene fragment) fSEQ ID No 1 1 )
ATGGTTTACGATAAGGCGACGCTAAGGGATGTTTCCCTAGATGGAAAAAGAGTAGTAATT CGTCTTGATTTAAACGTACCCGTTAAAGACGGAAAGATTACTGACAATAATAGGGTAGTT CAAACTTTACCTACGGTTCGTTATCTTCTTGAGAAGGGTTGTAAATTAGTTGTTCTTAGT CACTTCTCCAGAATTAAAGATATTTCTGAGGTTACTTCTGGAAAGAAATCTCTTAAAGTA GTAGCTGAGGAATTTCAAAAACTACTTCCTGATAACAAGGTTGCCTTTGTTTCTGATATT GACTTTAACAATGTTGCTTCTTTTGTTAATTCCAATACGGATGTGGATTTGTTTGTTCTT GAGAACACTAGATATTATGACGTTGATGCCCATAACTCTTTAGTTAAATGGGAGTCTAAG AATTATCCAGACTTATCTAAGTTTTGGGCTTCCCTTGGGGAGGTGTTTATTAATGATGCT TTTGGTACCTCCCACAGAGCTCATGCTTCCAACGTAGGTATTGCGGGACATCTTCCTTCT GCAATTGGATTATTGGTTGAGAAGGAGTTAGATATGCTTGGTAAAGCAGTTTCCTCTACA GATTCTCCTAAGGTTTTAATCTTGGGCGGTTCTAAGGTATCCGATAAGTTGAAGTTAATA AATGCGATCGCTCCCAAGGTAGATAAGCTTCTTATTGGTGGGGGTATGTCTTATACCTTC CTTAAAGCACAAGGGAAGGAGGTTGGTAAGTCTATAGTGGAAACTGAAATGATTGAAGAA TGTAAGGATCTTCTTCAGAGATATGCTGGCAAATTGGTTCTTCCCGTTGATCACGTTGTA GCTCCCGAATTTAAAGATATAGCTGGGAGTGTGGTTGATTTAGAGGAGAAGAATTGGGGG GATAATATGGCTTTAGATATTGGCCCTAAGACTGTTGAACTTTATAGAAGTGTTCTTGAG AGTGCTAAAGTTGTTATTTGGAACAAGGGCGAGCTCAATTCGAAGCTTGAAGGTAAGCCT ATCCCTAACCCTCTCCTCGGTCTCGATTCTACGCGTACCGGTCATCATCACCATCACCAT TGA
Expression (pET) amino-acid sequence (SEQ ID No 12)
MVYDKATLRDVSLDGKRWIRLDLNVPVKDGKITDNNRWQTLPTVRYLLEKGCKLWLS HFSRIKDISEVTSGKKSLKWAEEFQKLLPDNKVAFVSDIDF NVASFVNSNTDVPLFVL ENTRYYDVDAHNSLVKWESK YPDLSKFWASLGEVFINDAFGTSHRAHAS VGIAGHLPS AIGLLVEKELDMLGKAVSSTDSPKVLILGGSKVSDKLKLINAIAPKVDKLLIGGGMSYTF L AQGKEVG SIVETEMIEECKDLLQRYAGKLVLPVDHWAPEFKDIAGSWDLEE N G DNMALDIGPKTVELYRSVLESA WIWNKGELNSKLEGKPIPNPLLGLDSTRTGHHHHHH
Elongation Factor-Thermo-stable (EF-Ts)
Native gene sequence (SEQ ID No 13)
ATGGCTATCGATAAAGACCTAATTTTAAAGCTTAGAAATGCAAGTCAAGCTGGTCTTGCT GACTGTAAGAAGGCTTTAGAGGAGAATAATAATGATCTTGAGGCTTCTATTAAGTGACTT CGTACAAAAGGAATAGCTAAGGCCACAAACAAGAACGCCTTAAGGGAGGCTAAGGAGGGG AGTACCTTTGTTAAGAAAGATGGTAAGGGAGTTGTCATTATGGAGATGAATTCTGAAACT GACTTTGTCGCTAATTCCAAAGAATTTACTGCTTTGGCAGACAGAATTATGGATTCTATT TTGAATCTAGGGAAAGAGGATTTAGGAGATGTCAATAGTTTGAAGATGGATAGTGGAGAA AGTGTAGCAGATGGTTGTCTTCACCTTTCCTCTATAACTGGAGAGAAGATTGTTTTAAGC AGGGCTAAGTATATTTCTCTGGGAAGTGGGGAATCTGTTGCCTGCTATAGGCATAATAAC GGAAGAATGTCTGCCTTTGTTATCCTTAATAAGGATCTTAAGGATGAAGATATTTATGGC TTAGCAGTTCACTATGCAGCCAATAATCCTAAATTTATTTCTTCAGATCAGGTGGATGAA TCATGAATTAATTCGGAGAGGGAGATAATTACTACTCTTCTAGAGAAGGAGAATAAGCCT AAGGAGTTTCATGCAAATATTATTGAACAGAGAATTAAGAAATTGATTGCCCAAGAGGCT TTCGTAGAGCAGCCTTATTTATATGATACTTCTAAGAAGATAAAGGATAGACTGAATGAC TTAGGAGCTGAAGTTAAAATGGCTATGTATTTCGGATTAGGAGAATCTAAGTAG Native amino-acid sequence (SEQ ID No 14)
MAIDKDLIL LRNASQAGLADC KALEENNNDLEASIKWLRTKGIAKATNK ALRXAKEG STFVKKDGKGWIMEMNSETDFVANSKEFTALADRIMDSILNLGKEDLGDVNSLKMDSGE SVADGCLHLSSITGE IVLSRAKYISLGSGESVACYRHNNGRMSAFVILNKDL DEDIYG LAVHYAANNPKFISSDQVDESWINSEREI ITTLLEKENKPKEFHANIIEQRIKKLIAQEA FVEQPYLYDTS KIKDRLNDLGAEVKMAMYFGLGESK
Expression (pET) gene sequence (Predicted) (SEQ ID No 15)
ATGGCTATCGATAAAGACCTAATTTTAAAGCTTAGAAATGCAAGTCAAGCTGGTCTTGCT GACTGTAAGAAGGCTTTAGAGGAGAATAATAATGATCTTGAGGCTTCTATTAAGTGGCTT CGTACAAAAGGAATAGCTAAGGCCACAAACAAGAACGCCTTAAGGGAGGCTAAGGAGGGG AGTACCTTTGTTAAGAAAGATGGTAAGGGAGTTGTCATTATGGAGATGAATTCTGAAACT GACTTTGTCGCTAATTCCAAAGAATTTACTGCTTTGGCAGACAGAATTATGGATTCTATT TTGAATCTAGGGAAAGAGGATTTAGGAGATGTCAATAGTTTGAAGATGGATAGTGGAGAA AGTGTAGCAGATGGTTGTCTTCACCTTTCCTCTATAACTGGAGAGAAGATTGTTTTAAGC AGGGCTAAGTATATTTCTCTGGGAAGTGGGGAATCTGTTGCCTGCTATAGGCATAATAAC GGAAGAATGTCTGCCTTTGTTATCCTTAATAAGGATCTTAAGGATGAAGATATTTATGGC TTAGCAGTTCACTATGCAGCCAATAATCCTAAATTTATTTCTTCAGATCAGGTGGATGAA TCATGGATTAATTCGGAGAGGGAGATAATTACTACTCTTCTAGAGAAGGAGAATAAGCCT AAGGAGTTTCATGCAAATATTATTGAACAGAGAATTAAGAAATTGATTGCCCAAGAGGCT TTCGTAGAGCAGCCTTATTTATATGATACTTCTAAGAAGATAAAGGATAGACTGAATGAC TTAGGAGCTGAAGTTAAAATGGCTATGTATTTCGGATTAGGAGAATCTAAGAAGGGCGAG CTCAATTCGAAGCTTGAAGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTCTACG CGTAC CGGT CAT CATC AC CATCACCATTG A Expression (pE"Q amino-acid sequence (Predicted) (SEQ ID No 16)
MAID DLILKL NASQAGLADCKKALEE M^DLEAS IK LRTKGIAKATN WAL EAKEG STFVKKDGKGWIMEMNSETDFVAJSISKEFTAIJADRI DS ILNLGKEDLGDVNSLKMDSGE SVADGCLHLSS ITGEKIVLSRA YISLGSGESVACYRH G MSAFVILNKDLKDEDIYG LAVHYAANNPKFISSDQVDESWINSEREI ITTLLEKENKPKEFHANI IEQRIKKLIAQEA FVEQP YLYDTSKKI KDRLNDLGAEVKMAMYFGLGESKKGELNS KLEGKP I PNPLLGLDST RTGHHHHHH CMhm genes
Heat shock protein 70 {dnaK)
Native gene sequence (SEQ ID No 17)
ATGTCAGTTAAAAAAGAAGTGATTCTAGGTATTGACCTAGGTACTACTAACTCTTGTGTA GCAGTAATAGAGGGAGGTAAATCTAAGGTGCTAGAAACCCCAGAAGGAAAGAGAACTATT CCTTCTATAGTAGCCTTCAAAGGAGAACAAATAATAGTAGGAGAAAGCGCTAAACGACAG ATGGTTACAAATAAAAACACGATCTATTCTATTAAGAGGCTGATAGGTACTGACCAAAAG GTAACTGCTCAGGGGAAAGAATATACACCTGAAGAAATATCTGCATATATTCTTTCCTAC ATCAAAGAGTATTCTGAAAAGAAATTAGGTCATGATGTTCAGAAAGCAGTTATTACAGTA CCAGCCTACTTTAATGATGGACAGAGACAATCTACAAAGAATGCAGGAAAAATAGCAGGA CTTGAAGTAGTAAGAATAGTAAATGAACCTACTGCAGCTGCACTAGCTTATGGTCTTGAT AAGAAAGATGGAGATCAGAAGATATTAGTTTATGACTTAGGAGGAGGAACATTTGATGTA TCTATCTTAGAAATTGCTGAGGGAACATTTAAGGTGCTTTCTACCTCTGGAGATAATAAG CTAGGAGGAGATGATTGAGACCAACGAATTATTAACTGATTACTTGAAACTATTAAAAAA GAACATGGAGCTGATCTCTCAAAGGATAATCTTGTGTTACAAAGATTAAAAGAAGCAGCA GAAAAAGCAAAAATAGAACTTTCTTCAGTGCAACAAACTCAAATTATGTTGCCCTTCCTA ACTATGATTGGAGGAGAGCCTCTAAATGTAGACTTAACTCTTTCTAGAGCTCAATTTGAA TTACTAACAAAAGATTTACTAGATAGAACAGTAAGACCTGTAGAAGATGCTGTCAAAGAA TCTCAACTGAAATTAAGTGATATAGATCAAATACTTCTAGTAGGAGGCTCTACTAGGATG CCAGCAGTGCAAGCACTTGTAGAAAAATTAACTGGAAAGAAACCTAATCTTTCAATAAAT CCTGATGAGGTAGTAGCATTGGGAGCAGCTGTTCAAGCAGGAGTACTAGCAGGAGATGTA AAAGATGTACTCTTGCTGGATGTAACTCCCCTAACCTTAAGTATTGAAACACTAGGGGGA GTAGCTACTCCCCTAATACAACGGAATACTACTATACCTACAGAAAAGAAGCAGATTTTC TCTACAGCAATAGATAATCAACCAAGTGTAGATATTCATGTAGTACAGGGAGAGCGACCT ATGGCTGCAGATAACACTACTTTAGGTACTTTTGCACTGACTGGTATTAAGATGGCACCT AAAGGCGTACCGAAAATAGAAGTTTCCTTCTCTATAGACGCTAATGGTATCTTAACTGTA AGGGCAGAAGATAAAGATACAGGTAAGAGTAACAATATAGTAATTAAAAATGCATCAGGA CTCTCAGAAGAAGAGATAAATAGAAAGATTAAGGAAGCTGAAGAAAATCTAGAAAAAGAT AAAAAGGTAAGGGAAGAAGTTGAAACAGTAAATCAGGCTGAATCTTGAATTTCTATGCTG GAAAAACAAATGGAAGACAAAAAAGAAGATGTTCCAGCTTCTCTAAAAGATGAGGCTAAA AAACTAATAGATGAA Native amino-acid sequence CSEQ ID No 18)
MSV KEVILGIDLGTTNSCVAVIEGGKSKVLETPEGKRTIPSIVAFKGEQIIVGESAKRQ MVTNK TIYSIKRLIGTDQKVTAQGKEYTPEEISAYILSYIKEYSEKKLGHDVQ AVITV PAYPNDGQRQSTK AGKIAGLEWRIVNEPTAAALAYGLDKKDGDQKILVYDLGGGTFDV SILEIAEGTFKVLSTSGDNKLGGDD PQRI INWLLETIKKEHGADLSKDNLVLQRLKEAA EKA IELSSVQQTQIMLPFLTMIGGEPL VDLTLSRAQFELLTKDLLDRTVRPVEDAVKE SQL LSDIDQILLVGGSTRMPAVQALVEKLTG KPNLSINPDEWALGAAVQAGVLAGDV KDVLLLDVTPLTLS IETLGGVATPLIQR TTIPTEKKQIFSTAIDNQPSVDIHWQGERP MAADNTTLGTFALTGIKMAPKGVPKIEVSFSIDANGILTVRAEDKDTGKSNNIVI JSIASG LSEEEINRKIKEAEENLEKDKKVREEVETVNQAES ISMLEKQMEDKKEDVPASLKDEAK KLIDE
Expression (pET) gene sequence (Gene fragment) (SEQ ID No 19)
ATGTCAGTTAAAAAAGAAGTGATTCTAGGTATTGACCTAGGTACTACTAACTCTTGTGTA GCAGTAATAGAGGGAGGTAAATCTAAGGTGCTAGAAACCCCAGAAGGAAAGAGAACTATT CCTTCTATAGTAGCCTTCAAAGGAGAACAAATAATAGTAGGAGAAAGCGCTAAACGACAG ATGGTTACAAATAAAAACACGATCTATTCTATTAAGAGGCTGATAGGTACTGACCAAAAG GTAACTGCTCAGGGGAAAGAATATACACCTGAAGAAATATCTGCATATATTCTTTCCTAC ATCAAAGAGTATTCTGAAAAGAAATTAGGTCATGATGTTCAGAAAGCAGTTATTACAGTA CCAGCCTACTTTAATGATGGACAGAGACAATCTACAAAGAATGCAGGAAAAATAGCAGGA CTTGAAGTAGTAAGAATAGTAAATGAACCTACTGCAGCTGCACTAGCTTATGGTCTTGAT AAGAAAGATGGAGATCAGAAGATATTAGTTTATGACTTAGGAGGAGGAACATTTGATGTA TCTATCTTAGAAATTGCTGAGGGAACATTTAAGGTGCTTTCTACCTCTGGAGATAATAAG CTAGGAGGAGATGATTGGGACCAACGAATTATTAACTGGTTACTTGAAACTATTAAAAAA GAACATGGAGCTGATCTCTCAAAGGATAATCTTGTGTTACAAAGATTAAAAGAAGCAGCA GAAAAGGCAAAAATAGAACTTTCTTCAGTGCAACAAACTCAAATTATGTTGCCCTTCCTA ACTATGATTGGAGGAGAACCGCTAAATGTAGACTTAACTCTTTCTAGAGCTCAATTTGAA TTATTAACAAAAGATTTACTAGATAGAACAGTAAGACCTGTAGAAGATGCTGTTAAAGAA TCTCAACTGAAATTAAGTGATATAGATCAAATACTTCTAGTAGGAGGTTCTACTAGAATG CCAGCTGTTCAAGCACTTGTAGAAAAACTGACTGGAAAGAAACCTAATCTTTCAATAAAT CCTGATGAGGTAGTAGCATTGGGAGCAGCTGTTCAAGCAGGAGTACTAGCAGGAGATGTA AAAGATGTACTCCTGCTTGATGTAACTCCCTTAACTCTAAGTATTGAGACACTAGGGGGA GTAGCTACTCCCCTAATACAACGGAATACTACTATACCTACAGAAAAGAAGCAGATTTTC TCTACAGCAATAGATAATCAACCAAGTGTAGATATTCATGTAGTACAGGGAGAGCGACCT ATGGCTGCAGATAACACTACTTTAGGTACTTTTGCACTGACTGGTATTAAGATGGCACCT AAAGGCGTACCGAAAATAGAAGTTTCCTTTTCTATAGACGCTAATGGTATCTTAACTGTA AGGGCAGAAGATAAAGATACAGGTAAGAGTAACAATATAGTAATTAAAAATGCATCAGGA CTCTCAGAAGAAGAGATAAATAGAAAGATTAAGGAAGCCGAAGAAAATTTAGAAAAAGAT AAAAAGGTAAGGGAAGAAGTTGAAACAGTAAATCAGGCTGAATCTTGGATTTCTATGCTG GAAAAGGGCGAGCTCAATTCGAAGCTTGAAGGTAAGCCTATCCCTAACCCTCTCCTCGGT CTCGATTCTACGCGTACCGGTCATCATCACCATCACCATTGA
Expression (pET) amino-acid sequence (SEQ ID No 20)
MSVKKEVILGIDLGTTNSCVAVIEGGKSKVLETPEGKRTIPSIVAFKGEQI IVGESAKRQ MVTKK TIYS IKRLIGTDQKVTAQGKEYTPEEISAYILSYIKEYSEKKLGHDVQ AVITV PAYFNDGQRQSTKNAGKIAGLEWRIVNEPTAAALAYGLDKKDGDQKILVYDLGGGTFDV SILEIAEGTF VLSTSGDNKLGGDDWDQRI I WLLETIKKEHGADLS DNLVLQRLKEAA EKA IELSSVQQTQIMLPFLTMIGGEPL VDLTLSRAQFELLTKDLLDRTVRPVEDAVKE SQLKLSDIDQILLVGGSTRMPAVQALVEKLTGKKPNLSINPDEWALGAAVQAGVLAGDV KDVLLLDVTPLTLS IETLGGVATPLIQRNTTIPTE KQI FSTAIDNQPSVDIHWQGERP MAADNTTLGTFALTGIKMAPKGVPKIEVSFS IDANGILTVRAEDKDTGKSNNIVIK ASG LSEEEINRKI EAEENLEKDKKVREEVETV QAESWISMLE GELNSKLEG PIPNPLLG LPS TRTGHHHHHH Glyceraldehyde 3-phosphate dehydrogenase {gapA)
Native gene sequence (SEQ ID NO 21 )
ATGGAGTTTTACAGAGTTGCTATTAATGGATTTGGAAGAATAGGTAGGTTATTATTTAGA AATTTGTTATCCTCACCTAGCGTTAATGTAGTAGCAGTTAATGATATTGTTGATGCATCG GTTTTAGCTCATTTATTAAAGTATGACAGCTCTCAAGGAGTGTTGAAAGATTGAGAGGTT AAAAGTGATGCAGAAAACATTTACTTAACTCACATTGATAGCGGAAAACAAAAAACAGTG AAGGTCTTTAATTTCTTGAAAGAAAAGAGCTACCACTGGGGAGAGTTAGAAGTTGATTGC GTGGTGGAATGTTCGGGACGTTTATTAACTAAAGATGCAGTGCAATGCCACTTGGATGCA GGAGCTGAGAAAGTATTAATCTCAGCTCCTGCAAAAGATGATGCTATAAAAACTATTGTT TTTAACGTAAATCATAATTCGATTAGCACTTCTGATACGGTAATTTCTGGAGCTTCTTGC ACTACCAATGCATTGGCTCCTGTTGTTAAAGTGTTGCATAGAAAATTTGGAGTGCAGTCT GGATTTATGACTACCATTCACGCCTTTACTTCAGACCAGAGACTACAAGATGCGCCTCAT GCAGATTTAAGAAGAACTCGAGCAGCTGCCAATTCGATTATTCCAACTACCACCGGAGCA GCTGCCGCTATAGGTAAAGTGATTCCTGACTTGAAAGGTAAGCTAGATGGAATTGCTCAT AGAGTTCCAGTTTTGACAGGCTCATTAGTAGACTTGGTGGTACGTTTAGGTAAAAATGTT ACAGCAGAGGAGGTCAACGCTGCTCTAGAATCGGCTCAGAATGAAACCATGTTATATTTG AAAGATCCAATAGTGTCTTCAGATATTGTCGGAAGCACTTATGGGTCTATTTTTGACTCC CTCTTAACTAAAGTGTTACCTACCGGAGAAGTGAAATTATATGCATGATATGATAATGAG TCTTCTTATGTTAGCCAATTGTCTAGAACACTCCACTACTACATCTCTTTGTAG
Native amino-acid sequence (SEQ ID No 22)
MEFYRVAINGFGRIGRLLFRNLLSSPSVNWAVNDIVDASVLAHLLKYDSSQGVLKD EV KSDAENIYLTHIDSGKQKTVKVFNFLKEKSYH GELEVDCWECSGRLLTKDAVQCHLDA GAEKVLISAPAKDDAIKTIVFNWHNSISTSDTVISGASCTTNALAPVVKVLHRKFGVQS GFMTTIHAFTSDQRLQDAPHADLRRTRAAANS II PTTTGAAAAIGKVI PDLKGKLDGIAH RVPVLTGSLVDLWRLGKNVTAEEVNAALESAQNETMLYLKDPIVSSDIVGSTYGSIFDS LLTKVLPTGEVKLYAWYDNESSYVSQLSRTLHYYISL Expression (pET) gene sequence (Gene fragment) (SEQ ID No 23)
CACCATGGAGTTTTACAGAGTTGCTATTAATGGATTTGGAAGAATAGGTAGGTTATTATT TAGAAATTTGTTATCCTCACCTAGCGTTAATGTAGTAGCAGTTAATGATATTGTTGATGC ATCGGTTTTAGCTCATTTATTAAAGTATGACAGCTCTCAAGGAGTGTTGAAAGATTGGGA GGTTAAAAGTGATGCAGAAAACATTTACTTAACTCACATTGATAGCGGAAAACAAAAAAC AGTGAAGGTCTTTAATTTCTTGAAAGAAAAGAGCTACCACTGGGGAGAGTTAGAAGTTGA TTGCGTGGTGGAATGTTCGGGACGTTTATTAACTAAAGATGCAGTGCAATGCCACTTGGA TGCAGGAGCTGAGAAAGTATTAATCTCAGCTCCTGCAAAAGATGATGCTATAAAAACTAT TGTTTTTAACGTAAATCATAATTCGATTAGCACTTCTGATACGGTAATTTCTGGAGCTTC TTGCACTACCAATGCATTGGCTCCTGTTGTTAAAGTGTTGCATAGAAAATTTGGAGTGCA GTCTGGATTTATGACTACCATTCACGCCTTTACTTCAGACCAGAGACTACAAGATGCGCC TCATGCAGATTTAAGAAGAACTCGAGCAGCTGCCAATTCGATTATTCCAACTACCACCGG AGCAGCTGCCGCTATAGGTAAAGTGATTCCTGACTTGAAAGGTAAGCTAGATGGAATTGC TCATAGAGTTCCAGTTTTGACAGGCTCATTAGTAGACTTGGTGGTACGTTTAGGTAAAAA TGTTACAGCAGAGGAGGTCAACGCTGCTCTAGAATCGGCTCAGAATGAAACCATGTTATA TTTGAAAGATCCAATAGTGTCTTCAGATATTGTCGGAAGCACTTATGGGTCTATTTTTGA CTCCCTCTTAACTAAAGTGTTACCTACCGGAGAAGTGAAATTATATGCATGGTATGATAA TGAGTCTTCTTATGTTAGCCAATTGTCTAGAACACTCCACTACTACATCTCTTTGAAGGG CGAGCTCAATTCGAAGCTTGAAGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTC TACGCGTACCGGTCATCATCACCATCACCATTGA
Expression (pET) amino-acid sequence (SEQ ID No 24)
MEFYRVAINGFGRIGRLLFRNLLSSPSVNWAV DIVDASVLAHLLKYDSSQGVLKDWEV KSDAENIYLTHIDSG Q TV VFNFLKEKSYHWGELEVDCWECSGRLLTKDAVQCHLDA GAEKVLI SAPAKDDAI KTI VF V HNS I STSDTVIS GAS CTTNALAP W VLHRKFGVQS GFMTTIHAFTSDQRLQDAPHADLRRTRAAANS I IPTTTGAAAAIGKVI PDLKGKLDGI AH RVP VLTGS LVDLWRLGKNVTAEE VNAALES AQNETML YLKD PIVS S DIVGSTYGS I FDS LLTKVLPTGEVKLYAWYDNESSYVSQLSRTLHYYISLKGELNSKLEGKPI PNPLLGLDST RTGHHHHHH
Phosphoglycerate kinase (pgk)
Native gene sequence (SEQ ID No 25)
GTGAGGTACAATAAGGTCACTTTACGTGATCTTGAGCCTTCAGGAAAGACAGTTGTACTT AGATTGGACCTAAATGTGCCTGTTAAAGATGGTCAGGTGATGAACAAAACTAGAATATTG GGATCTATCGAGACTATTCAATATTTACTGGATAGAGAATGTAAGGTAGTGATATTGAGT CATTTTGATCGAATTAAGAATTATGATGAAATTGCTGACGGCTCTAAAAGTTTATTGCCT GTTGCCCAAGAAATTCAAAAAATATTTTTCAATAAGAAGGTACTTTTTATCAACACCACT TCCTTTGAAAATGTGAAAGGAACTATTAAAAATAACCCTAAAGTGGATATTTTTGTATTG GAAAATACAAGATACTATGATATAGATCCTCAAAGCAAGCAAAATGTCAAGTGAGAGAGT GGAAATAATCCAGCTCTAGCACAATTTTATTCTGAAATTGGAGATATTTTTGTGAATGAC GCTTTCGGCACTTCTCACAGAGCTCATGCTTCAAATGTGGGGGTAGCAGAGAGAAGCCAG CAAAGCGCTGTAGGTTTTCTTATTGAAAAGGAATTAAAAGCCCTTAATTTTGTATTAGAT GCTCCCCCAGACGGTAAAGTGATGATTTTGGGAGGTAGTAAGGTTTCAGATAAATTAAAG CTCATTAAAGAGATTGTTAATCATGTTAGTACATTAATAATTGGGGGAGGAATGGCTTAC ACATTTTTAAAAGCTCAGGGAAAATCTATAGGTAAATCTTTAGTCGAAGATGATTATTTA GATGAATGTTCTAAGTTATTAAAAAATTACTCTGGTAAAATAGTTCTTCCCATTGATCAT GTAGTGTCTGACTCTTTTGCAGATATTCCTGGACGTATTATTGAAGACAATTCCGATCAT TGGGGAGTTGGGATGGCATTAGATATAGGTCCTAAAACTATTGAAAAGTTTTCCAAGATA CTTGAAGGCGCTAAGATTGTGATCTGGAACGGACCTCTAGGGGTATTTGAAATGTCCAAT TATTCAAAAGGCACTTTTGAAATTCTTAAAAAGTTATCTGATTTAACTGCTAGTAAAGGG GTTTATTCTCTTATCGGTGGAGGAGATTCTGTGGCAGCTGCAGAAAAAAAGGGAATAGCG GATAAATTTAGTTTTGTGTCAACGGGTGGTGGAGCTACTTTAACATTTCTAGAACGAAGT AGTATGCCGGGAATAGAGGCCATTCAAAACAAATAG
Native amino-acid sequence (SEQ ID No 26)
MRYNKVTLRDLEPSGKTWLRLDLNVPVKDGQVMNKTRILGS IETIQYLLDRECKWILS HFDRIK_ YDEIADGSKSLLPVAQEIQKIFFN KVLFINTTSFE]WKGTIK NPKVDI FVL ENTR YYDIDPQS KQ VKWES GNNPALAQF YS E I GD I FVNDAFGTSHRAHASNVGVAERS Q QSAVGFLIE ELKALNFVLDAPPDGKVMILGGS VSDKLKLIKEIVNHVSTLIIGGGMAY TFLKAQGKS IGKSLVEDDYLDECSKLLK YSGKI VLP IDHWSDSFAD I PGRI I EDNSDH GVGMALDIGPKTIEKFSKILEGA IVIWNGPLGVFEMSNYSKGTFEILKKLSDLTASKG VYSLIGGGDSVAAAEKKGIADKFS FVSTGGGATLTFLERSSMPGIEAIQNK
Expression (pET) gene sequence (SEQ ID No 27)
ATGAGGTACAATAAGGTCACTTTACGTGATCTTGAGCCTTCAGGAAAGACAGTTGTACTT AGATTGGACCTAAATGTGCCTGTTAAAGATGGTCAGGTGATGAACAAAACTAGAATATTG GGATCTATCGAGACTATTCAATATTTACTGGATAGAGAATGTAAGGTAGTGATATTGAGT CATTTTGATCGAATTAAGAATTATGATGAAATTGCTGACGGCTCTAAAAGTTTATTGCCT GTTGCCCAAGAAATTCAAAAAATATTTTTCAATAAGAAGGTACTTTTTATCAACACCACT TCCTTTGAAAATGTGAAAGGAACTATTAAAAATAACCCTAAAGTGGATATTTTTGTATTG GAAAATACAAGATACTATGATATAGATCCTCAAAGCAAGCAAAATGTCAAGTGGGAGAGT GGAAATAATCCAGCTCTAGCACAATTTTATTCTGAAATTGGAGATATTTTTGTGAATGAC GCTTTCGGCACTTCTCACAGAGCTCATGCTTCAAATGTGGGGGTAGCAGAGAGAAGCCAG CAAAGCGCTGTAGGTTTTCTTATTGAAAAGGAATTAAAAGCCCTTAATTTTGTATTAGAT GCCCCCCCAGACGGTAAAGTGATGATTTTGGGAGGTAGTAAGGTTTCAGATAAATTAAAG CTCATTAAAGAGATTGTTAATCATGTTAGTACATTAATAATTGGGGGAGGAATGGCTTAC ACATTTTTAAAAGCTCAGGGAAAATCTATAGGTAAATCTTTAGTCGAAGATGATTATTTA GATGAATGTTCTAAGTTATTAAAAAATTACTCTGGTAAAATAGTTCTTCCCATTGATCAT GTAGTGTCTGACTCTTTTGCAGATATTCCTGGACGTATTATTGAAGACAATTCCGATCAT TGGGGAGTTGGGATGGCATTAGATATAGGTCCTAAAACTATTGAAAAGTTTTCCAAGATA CTTGAAGGCGCTAAGATTGTGATCTGGAACGGACCTCTAGGGGTATTTGAAATGTCCAAT TATTCAAAAGGCACTTTTGAAATTCTTAAAAAGTTATCTGATTTAACTGCTAGTAAAGGG GTTTATTCTCTTATCGGTGGAGGAGATTCTGTGGCAGCTGCAGAAAAAAAGGGAATAGCG GATAAATTTAGTTTTGTGTCAACGGGTGGTGGAGCTACTTTAACATTTCTAGAACGAAGT AGTATGCCGGGAATAGAGGCCATTCAAAACAAAAAGGGCGAGCTCAATTCGAAGCTTGAA GGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTCTACGCGTACCGGTCATCATCAC CATCACCATTGA
Expression (pET) amino-acid sequence (SEQ ID No 28)
MRYNKVTLRDLEPSGKTWLRLDL VPVKDGQVMNKTRILGSIETIQYLLDRECKWILS HFDRIKNYDEIADGSKSLLPVAQEIQKIFF KKVLFINTTSFElSrVKGTIKNNPKVDIFVL ENTRYYDIDPQSKQNVK ESGN PALAQFYSEIGDIFVNDAFGTSHRAHASNVGVAERSQ QSAVGFLIEKELKALNFVLDAPPDGKVMILGGSKVSDKLKLIKEIV HVSTLIIGGGMAY TFLKAQGKSIGKSLVEDDYLDECSKLLKNYSGKIVLPIDHWSDSFADIPGRIIEDNSDH GVGMALDIGP TIEKFSKILEGAKIVIWNGPLGVFEMSNYS GTFEILK LSDLTASKG VYSLIGGGDSVAAAEKKGIADKFSFVSTGGGATLTFLERSSMPGIEAIQNKKGELNSKLE GKPIPNPLLGLDSTRTGHHHHHH
References
Aileman, A. R., M. G. Pate, J. W. Harvey, J. M. Gaskin, and A. F. Barbet. 1999. Western immunoblot analysis of the antigens of Haemobartonella felis with sera from experimentally infected cats. J Clin Microbiol 37:1474-9.
Altschul, S. F., Gish, W., Miller, W., Myers, E. W. & Lipman, D. J. (1990) Basic local alignment search tool. Journal of Molecular Biology 215, 403-410
Alvarez, R. A., Blaylock, M. W. & Baseman, J. B. (2003) Surface localized glyceraldehyde-3-phosphate dehydrogenase of Mycoplasma genitalium binds mucin. Molecular Microbiology 48, 1417-1425
Baker, H. J., Cassell, G. H. & Lindsey, J. R. (1971) Research complications due to
Haemobartonella and Eperythrozoon infections in experimental animals.
American Journal of Pathology 64, 625-632
Balasubramanian, S., Kannan, T. R., Hart, P. J. & Baseman, J. B. (2009) Amino acid changes in elongation factor-Tu of Mycoplasma pneumoniae and Mycoplasma genitalium influence fibronectin binding. Infection and Immunity
Ballas, S. . 1989. Spectrin autoantibodies in normal human serum and in polyclonal blood grouping sera. Br J Haematol 71 :137-9.
Barker, R. N. 1991. Electrophoretic Analysis of Erythrocyte Membrane Proteins and Glycoproteins from Different Species. Comp Haematol Int 1 :155-160.
Barker, R. N., T. J. Gruffydd-Jones, C. R. Stokes, and C. J. Elson. 1991 . Identification of autoantigens in canine autoimmune haemolytic anaemia. Clin Exp Immunol
85:33-40.
Barker, E. N., Tasker, S., Day, M. J., Woolley, K., Birtles, R. J., Georges, K., Ezeokoli, C.
D., Cleaveland, S. & Helps, C. R. (2008) Development and use of novel real-time
PCR assays for canine haemotropic mycoplasmas. 18th European College of Veterinary Internal Medicine - Companion Animals Congress. Ghent, Belgium, p 198
Bauer, N., Balzer, H. J., Thure, S. & Moritz, A. (2008) Prevalence of feline haemotropic mycoplasmas in convenience samples of cats in Germany. Journal of Feline
Medicine and Surgery 10, 252-258
Berent, L. M., Messick, J. B. & Cooper, S. . (1998) Detection of Haemobartonella felis in cats with experimentally induced acute and chronic infections, using a polymerase chain reaction assay. American Journal of Veterinary Research 59, 1215-1220
Contamin, H. & Michel, J. C. (1999) Haemobartonellosis in squirrel monkeys [Saimiri sciureus) antagonism between Haemobartonella sp. and experimental Plasmodium falciparum malaria. Experimental Parasitology 91 , 297-305
Fujihara, M., Watanabe, M., Yamada, T. & Harasawa, R. (2007) Occurrence of 'Candidatus Mycoplasma turicensis' infection in domestic cats in Japan. Journal of Veterinary Medical Science 69, 1061-1063
Gentilini, F., Novacco, M., Turba, M. E., Willi, B., Bacci, M. L. & Hofmann-Lehmann, R.
(2009) Use of combined conventional and real-time PCR to determine the epidemiology of feline haemoplasma infections in northern Italy. Journal of Feline Medicine and Surgery 11 , 277-285
George, J. W., Rideout, B. A., Griffey, S. M. & Pedersen, N. C. (2002) Effect of preexisting FeLV infection or FeLV and feline immunodeficiency virus coinfection on pathogenicity of the small variant of Haemobartonella felis in cats. American Journal of Veterinary Research 63, 1 172-1 178
Hackett, T. B., Jensen, W. A., Lehman, T. L, Hohenhaus, A. E., Crawford, P. C, Giger, U. & Lappin, M. R. (2006) Prevalence of DNA of Mycoplasma haemofelis, 'Candidatus Mycoplasma haemominutum', Anaplasma phagocytophilum, and species of Bartonella, Neorickettsia, and Ehrlichia in cats used as blood donors in the United States. Journal of the American Veterinary Medical Association 229, 700-705
Hoelzle, K., Doser, S., Ritzmann, M., Heinritzi, K., Palzer, A., Elicker, S., Kramer, M.,
Felder, K. M. & Hoelzle, L. E. (2009) Vaccination with the Mycoplasma suis recombinant adhesion protein MSG elicits a strong immune response but fails to induce protection in pigs. Vaccine
Hoelzle, K., Grimm, J., Ritzmann, M., Heinritzi, K., Torgerson, P., Hamburger, A.,
Witten brink, M. M. & Hoelzle, L. E. (2007a) Use of recombinant antigens to detect antibodies against Mycoplasma suis, with correlation of serological results to hematological findings. Clinical and Vaccine Immunology 14, 1616-1622
Hoelzle, L. E. (2008) Haemotrophic mycoplasmas: Recent advances in Mycoplasma suis. Veterinary Microbiology 130, 215-226
Hoelzle, L. E., Hoelzle, K., Harder, A., Ritzmann, M., Aupperle, H., Schoon, H. A.,
Heinritzi, K. & Wittenbrink, M. M. (2007b) First identification and functional characterization of an immunogenic protein in unculturable haemotrophic
Mycoplasmas {Mycoplasma suis HspA1). FEMS Immunology and Medical
Microbiology 49, 215-223
Hoelzle, L. E., Hoelzle, K., Helbling, M., Aupperle, H., Schoon, H. A., Ritzmann, M.,
Heinritzi, K., Felder, K. M. & Wittenbrink, M. M. (2007c) MSG1 , a surface- localised protein of Mycoplasma suis is involved in the adhesion to erythrocytes.
Microbes and Infection 9, 466-474
Hoelzle, L. E., Hoelzle, K., Ritzmann, ., Heinritzi, K. & Wittenbrink, M. M. (2006)
Mycoplasma suis antigens recognized during humoral immune response in experimentally infected pigs. Clinical and Vaccine Immunology "I S, 116-122 Hoelzle, L. E., D. Adelt, K. Hoelzle, K. Heinritzi, and M. M. Wittenbrink. 2003.
Development of a diagnostic PCR assay based on novel DNA sequences for the detection of Mycoplasma suis (Eperythrozoon suis) in porcine blood. Vet
Microbiol 93:185-96.
Inokuma, H., Oyamada, M., Davoust, B., Boni, M., Dereure, J., Bucheton, B., Hammad, A., Watanabe, M., Itamoto, K., Okuda, M. & Brouqui, P. (2006) Epidemiological survey of Ehrlichia canis and related species infection in dogs in eastern Sudan. Annals of the New York Academy of Sciences 1078, 461-463
Johansson, K. E., J. G. Tully, G. Bolske, and B. Pettersson. 1999. Mycoplasma cavipharyngis and Mycoplasma fastidiosum, the closest relatives to Eperythrozoon spp. and Haemobartonella spp. FEMS Microbiol Lett 174:321-6.
Jores, J., Meens, J., Buettner, F. F., Linz, B., Naessens, J. & Gerlach, G. F. (2009) Analysis of the immunoproteome of Mycoplasma mycoides subsp. mycoides small colony type reveals immunogenic homologues to other known virulence traits in related Mycoplasma species. Veterinary Immunology and Immunopathology 131 , 238-245
Kamrani, A., Parreira, V. R., Greenwood, J. & Prescott, J. F. (2008) The prevalence of Bartonella, hemoplasma, and Rickettsia fe!is infections in domestic cats and in cat fleas in Ontario. Canadian Journal of Veterinary Research 72, 411-419
Kay, M. 2005. Immunoregulation of cellular life span. Ann N Y Acad Sci 1057:85-111. Kemming, G., Messick, J. B., Mueller, W., Enders, G., Meisner, F., Muenzing, S., Kisch- Wedel, H., Schropp, A., Wojtczyk, C, Packert, K., Messmer, K. & Thein, E. (2004) Can we continue research in splenectomized dogs? Mycoplasma haemocanis: Old problem - New insight. European Surgical Research 36, 198- 205
Kenny, M. J., Shaw, S. E., Beugnet, F. & Tasker, S. (2004) Demonstration of two distinct hemotropic mycoplasmas in French dogs. Journal of Clinical Microbiology 42, 5397-5399
Korsgren, C, J. Lawler, S. Lambert, D. Speicher, and C. M. Cohen. 1990, Complete amino acid sequence and homologies of human erythrocyte membrane protein band 4.2. Proc Natl Acad Sci U S A 87:613-7. Lester, S. J., Hume, J. B. & Phipps, B. (1995) Haemobartonella canis infection following splenectomy and transfusion. Canadian Veterinary Journal 36, 444-445
Lobetti, R. G. & Tasker, S (2004) Diagnosis of feline haemoplasma infection using a real-time PCR assay. Journal of the South African Veterinary Medical Association 75, 94-99
Lutz, H. U., and G. Wipf. 1982. Naturally occurring autoantibodies to skeletal proteins from human red blood cells. J Immunol 128:1695-9.
Messick, J. B., P. G. Walker, W. Raphael, L. Berent, and X. Shi. 2002. 'Candidatus Mycoplasma haemodidelphidis' sp. nov., 'Candidatus Mycoplasma haemolamae' sp. nov. and Mycoplasma haemocanis comb, nov., haemotrophic parasites from a naturally infected opossum (Didelphis virginiana), alpaca (Lama pacos) and dog {Canis familiaris): phylogenetic and secondary structural relatedness of their 16S rRNA genes to other mycoplasmas. Int J Syst Evol Microbiol 52:693-8.
Museux, K„ Boretti, F. S., Willi, B., Riond, B., Hoelzle, K., Hoelzle, L. E., Wittenbrink, M.
M., Tasker, S., Wengi, N., Reusch, C. E., Lutz, H. & Hofmann-Lehmann, R,
(2009) In vivo transmission studies of 'Candidatus Mycoplasma turicensis' in the domestic cat. Veterinary Research 40, 45
Neimark, H., K. E. Johansson, Y. Rikihisa, and J. G. Tully. 2001. Proposal to transfer some members of the genera Haemobartonella and Eperythrozoon to the genus Mycoplasma with descriptions of 'Candidatus Mycoplasma haemofelis',
'Candidatus Mycoplasma haemomuris', 'Candidatus Mycoplasma haemosuis' and 'Candidatus Mycoplasma wenyonii'. Int J Syst Evol Microbiol 51 :891-9.
Perez-Casal, J. & Prysliak, T. (2007) Detection of antibodies against the Mycoplasma bovis glyceraldehyde-3-phosphate dehydrogenase protein in beef cattle. Microbial Pathogenesis 43, 189-197
Peters, I. R., Helps, C. R., Gruffydd-Jones, T. J., Day, M. J. & Tasker, S. (2010) Antigen specificity of the humoral immune response to Mycoplasma haemofelis infection. Journal of Clinical Microbiology Submitted for publication
Peters, I. R., Helps, C. R., Willi, B., Hofmann-Lehmann, R. & Tasker, S. (2008) The prevalence of three species of feline haemoplasmas in samples submitted to a diagnostics service as determined by three novel real-time duplex PCR assays. Veterinary Microbiology 126, 142- 50
Peters, I. R., C. R. Helps, L. McAuliffe, H. Neimark, M. R. Lappin, T. J. Gruffydd-Jones, M. J. Day, L. E. Hoelzle, B. Willi, M. Meli, R. Hofmann-Lehmann, and S. Tasker. 2008. RNaseP RNA Gene (mpB) Phylogeny of Haemoplasmas and Other
Mycoplasma Species. J Clin Microbiol.
Rikihisa, Y., M. Kawahara, B. Wen, G. Kociba, P. Fuerst, F. Kawamori, C. Suto, S.
Shibata, and M. Futohashi. 1997. Western immunoblot analysis of Haemobartonella muris and comparison of 16S rRNA gene sequences of H. muris, H. felis, and Eperythrozoon suis. J Clin Microbiol 35:823-9.
Roura, X., Peters, I. R., Altet, L, Tabar, M. D., Barker, E. N., Planellas, M., Helps, C. R., Francino, O., Shaw, S. E. & Tasker, S. (2010) Real-time PCR detection of hemotropic mycoplasmas in healthy and unhealthy cats and dogs from the Barcelona area of Spain. Journal of Veterinary Diagnostic Investigation 22, 270- 274
Steck, T. L. 1974. The organization of proteins in the human red blood cell membrane. A review. J Cell Biol 62:1-19.
Sykes, J. E., Bailiff, N. L, Ball, L. M., Foreman, O., George, J. W. & Fry, M. M. (2004)
Identification of a novel hemotropic mycoplasma in a splenectomized dog with hemic neoplasia. Journal of the American Veterinary Medical Association 224,
1946-1951
Sykes, J. E., Drazenovich, N. L., Ball, L. M. & Leutenegger, C. M. (2007) Use of conventional and real-time polymerase chain reaction to determine the epidemiology of hemoplasma infections in anemic and nonanemic cats. Journal of Veterinary Internal Medicine 21 , 685-693 Tasker, S. (2006a) Current concepts in feline haemobartonellosis. In Practice 28, 136- 141
Tasker, S. (2006b) Feline haemoplasmas - The past, present and future. 6th European
College of Veterinary Internal Medicine - Companion Animals Congress. Amsterdam, Netherlands
Tasker, S. (2010) Haemotropic mycoplasmas: what's their real significance in cats?
Journal of Feline Medicine and Surgery 12, 369-381
Tasker, S., Binns, S. H., Day, M. J., Gruffydd-Jones, T. J., Harbour, D. A., Helps, C. R.,
Jensen, W. A., Olver, C. S. & Lappin, M. R. (2003) Use of a PCR assay to assess the prevalence and risk factors for Mycoplasma haemofelis and 'Candidatus
Mycoplasma haemominutum' in cats in the United Kingdom. Veterinary Record
152, 193-198
Tasker, S., Braddock, J. A., Baral, R., Helps, C. R., Day, M. J., Gruffydd-Jones, T. J. & Malik, R. (2004) Diagnosis of feline haemoplasma infection in Australian cats using a real-time PCR assay. Journal of Feline Medicine and Surgery 6, 345-354
Tasker, S., Caney, S. M„ Day, M. J., Dean, R. S., Helps, C. R., Knowles, T. G., Lait, P.
J., Pinches, M. D. & Gruffydd-Jones, T. J. (2006a) Effect of chronic feline immunodeficiency infection, and efficacy of marbofloxacin treatment, on 'Candidatus Mycoplasma haemominutum' infection. Microbes and Infection 8, 653-661
Tasker, S., Caney, S. M., Day, M. J., Dean, R. S., Helps, C. R., Knowles, T. G., Lait, P.
J., Pinches, M. D. & Gruffydd-Jones, T. J. (2006b) Effect of chronic FIV infection, and efficacy of marbofloxacin treatment, on Mycoplasma haemofelis infection.
Veterinary Microbiology 117, 169-179
Tasker, S., Peters, I. R., Day, M. J., Willi, B., Hofmann-Lehmann, R., Gruffydd-Jones, T.
J. & Helps, C. R. (2009a) Distribution of feline haemoplasmas in blood and tissue following experimental infection. Microbial Pathogenesis 47, 334-340
Tasker, S., Peters, I. R., Papasoulotis, K., Cue, S. M., Willi, B., Hofmann-Lehmann, R.,
Knowles, T. G., Gruffydd-Jones, T. J., Day, M. J. & Helps, C. R. (2009b) Description of outcomes of experimental infection with feline haemoplasmas: haematology, Coombs' testing and blood glucose concentrations. Veterinary
Microbiology DOI: 10. 016/j.vetmic.2009.06.028
Turner, C. M., Bloxham, P. A., Cox, F. E. & Turner, C. B. (1986) Unreliable diagnosis of
Haemobartonella felis. Veterinary Record 119, 534-535
Wengi, N., Willi, B., Boretti, F. S., Cattori, V., Riond, B., Meli, M. L, Reusch, C. E., Lutz,
H. & Hofmann-Lehmann, R. (2007) Real-time PCR-based prevalence study, infection follow-up and molecular characterization of canine hemotropic mycoplasmas. Veterinary Microbiology
Wengi, N., Willi, B., Boretti, F. S., Cattori, V., Riond, B., Meli, M. L, Reusch, C. E., Lutz, H. & Hofmann-Lehmann, R. (2008) Real-time PCR-based prevalence study, infection follow-up and molecular characterization of canine hemotropic mycoplasmas. Veterinary Microbiology 126, 132-141
Willi, B., Boretti, F. S., Baumgartner, C, Tasker, S., Wenger, B., Cattori, V., Meli, M. L.,
Reusch, C. E., Lutz, H. & Hofmann-Lehmann, R. (2006a) Prevalence, risk factor analysis, and follow-up of infections caused by three feline hemoplasma species in cats in Switzerland. Journal of Clinical Microbiology 44, 961-969
Willi, B., Boretti, F. S., Tasker, S., Meli, M. L, Wengi, N., Reusch, C. E., Lutz, H. &
Hofmann-Lehmann, R. (2007) From Haemobartonella to hemoplasma: Molecular methods provide new insights. Veterinary Microbiology 125, 197-209
Willi, B., Tasker, S., Boretti, F. S., Doherr, M. G., Cattori, V., Meli, M. L, Lobetti, R. G.,
Malik, R., Reusch, C. E., Lutz, H. & Hofmann-Lehmann, R. (2006b) Phylogenetic analysis of 'Candidatus Mycoplasma turicensis' isolates from pet cats in the
United Kingdom, Australia, and South Africa, with analysis of risk factors for infection. Journal of Clinical Microbiology 44, 4430-4435

Claims

1. A polypeptide comprising the amino acid sequence as set out in SEQ ID No 14 ( hf EF-Ts) or a variant or fragment thereof.
2. A polypeptide comprising the amino acid sequence as set out in SEQ ID No 10 (Mhf pgk) or SEQ ID No 26 (CMhm pgk) or a variant or fragment thereof.
3. A polypeptide comprising the amino acid sequence as set out in SEQ ID No 6 (Mhf gapA) or SEQ ID No 22 (CMhm gapA) or a variant of fragment thereof.
4. A polypeptide comprising the amino acid sequence as set out in SEQ ID No 18 (CMhm dnaK) or a variant or fragment thereof.
5. A polypeptide comprising the amino acid sequence as set out in SEQ ID No 2 (Mhf dnaK) or a variant thereof, or a fragment thereof with the amino acid sequence MSKKETIIG or a fragment thereof from the sequence from position 309 to position 602 of Figure 3.
6. A polynucleotide encoding a polypeptide according to any of Claims 1 to 5.
7. An expression vector comprising a polynucleotide according to Claim 6.
8. A host cell comprising a polynucleotide according to Claim 6 or an expression vector according to Claim 7.
9. A polypeptide according to any of Claims 1 to 5 for use in medicine.
10. A vaccine comprising one or more of the polypeptides according to any of Claims 1 to 5 and optionally a further antigen and optionally an adjuvant.
11. A method of vaccinating a cat against haemotropic mycoplasma infection, the method comprising administering to the cat one or more polypeptides according to any of Claims 1 to 5, or a vaccine according to Claim 10.
12. A composition comprising one or more polypeptides according to any of Claims 1 to 5, or a vaccine according to Claim 10, for vaccinating a cat against haemotropic mycoplasma infection.
13. A method according to Claim 1 1 , or a composition according to Claim 12, wherein the haemotropic mycoplasma infection is Mycoplasma haemofelis (Mhf) or 'Candidates Mycoplasma haemominutum' (CMhm) or 'Candidates Mycoplasma turicensis' (CMt).
14. An antibody directed to a polypeptide according to any of Claims 1 to 5.
15. An antibody according to Claim 14 for use in medicine.
16. A method of passively immunising a cat against haemotropic mycoplasma infection, the method comprising administering to the cat an antibody according to Claim 14.
17. An antibody according to Claim 14 for passively immunising a cat against haemotropic mycoplasma infection.
18. A method of detecting whether a cat has been exposed to haemotropic mycoplasma infection, the method comprising determining whether a suitable sample from the cat is reactive with a polypeptide according to any of Claims 1 to 5.
19. A method of detecting whether a mammal has been exposed to haemotropic mycoplasma infection, the method comprising determining whether a sample from the mammal contains a mycoplasma EF-Ts polypeptide.
20. An immunosorbent assay for detecting anti-mycoplasma protein antibodies in a sample, the assay comprising a solid phase coated with a polypeptide according to any of Claims 1 to 5 wherein the anti-mycoplasma protein antibodies in a sample exposed to the solid phase will bind to the polypeptide, and a detectable label conjugate which will bind to the anti-mycoplasma protein antibodies bound to the solid phase.
21. A solid substrate with a polypeptide according to any of Claims 1 to 5 attached thereto.
22. Any novel mycoplasma vaccine as herein disclosed.
23. Any novel method for detecting haemotropic mycoplasma infection as herein disclosed.
PCT/GB2011/001104 2010-07-23 2011-07-22 Methods of diagnosis and vaccines Ceased WO2012010849A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US36700110P 2010-07-23 2010-07-23
US61/367,001 2010-07-23

Publications (2)

Publication Number Publication Date
WO2012010849A2 true WO2012010849A2 (en) 2012-01-26
WO2012010849A3 WO2012010849A3 (en) 2012-05-03

Family

ID=44503979

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2011/001104 Ceased WO2012010849A2 (en) 2010-07-23 2011-07-22 Methods of diagnosis and vaccines

Country Status (1)

Country Link
WO (1) WO2012010849A2 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024145641A3 (en) * 2022-12-30 2024-12-19 Idexx Laboratories, Inc. Compositions and methods for the detection of mycoplasma

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999014317A1 (en) * 1997-09-19 1999-03-25 Synbiotics Corporation Methods for the diagnosis of feline infectious anemia

Non-Patent Citations (65)

* Cited by examiner, † Cited by third party
Title
ALLEMAN, A. R., M. G. PATE, J. W. HARVEY, J. M. GASKIN, A. F. BARBET.: "Western immunoblot analysis of the antigens of Haemobartonella felis with sera from experimentally infected cats", J CLIN MICROBIOL, vol. 37, 1999, pages 1474 - 9, XP002662570
ALTSCHUL, S. F., GISH, W., MILLER, W., MYERS, E. W., LIPMAN, D. J.: "Basic local alignment search tool", JOURNAL OF MOLECULAR BIOLOGY, vol. 215, 1990, pages 403 - 410, XP002949123, DOI: doi:10.1006/jmbi.1990.9999
ALVAREZ, R. A., BLAYLOCK, M. W., 6ASEMAN, J. B.: "Surface localized glyceraldehyde-3-phosphate dehydrogenase of Mycoplasma genitalium binds mucin", MOLECULAR MICROBIOLOGY, vol. 48, 2003, pages 1417 - 1425
BAKER, H. J., CASSELL, G. H., LINDSEY, J. R.: "Research complications due to Haemobartonella and Eperythrozoon infections in experimental animals", AMERICAN JOURNAL OF PATHOLOGY, vol. 64, 1971, pages 625 - 632
BALASUBRAMANIAN, S., KANNAN, T. R., HART, P. J., BASEMAN, J. B.: "Amino acid changes in elongation factor-Tu of Mycoplasma pneumoniae and Mycoplasma genitalium influence fibronectin binding", INFECTION AND IMMUNITY, 2009
BALLAS, S. K.: "Spectrin autoantibodies in normal human serum and in polyclonal blood grouping sera", BR J HAEMATOL, vol. 71, 1989, pages 137 - 9
BARKER, E. N., TASKER, S., DAY, M. J., WOOLLEY, K., BIRTLES, R. J., GEORGES, K., EZEOKOLI, C. D., CLEAVELAND, S., HELPS, C. R.: "Development and use of novel real-time PCR assays for canine haemotropic mycoplasmas", 18TH EUROPEAN COLLEGE OF VETERINARY INTERNAL MEDICINE - COMPANION ANIMALS CONGRESS, 2008, pages 198
BARKER, R. N., T. J. GRUFFYDD-JONES, C. R. STOKES, C. J. ELSON: "Identification of autoantigens in canine autoimmune haemolytic anaemia", CLIN EXP IMMUNOL, vol. 85, 1991, pages 33 - 40
BARKER, R. N.: "Electrophoretic Analysis of Erythrocyte Membrane Proteins and Glycoproteins from Different Species", COMP HAEMATOL INT, vol. 1, 1991, pages 155 - 160
BAUER, N., BALZER, H. J., THURE, S., MORITZ, A.: "Prevalence of feline haemotropic mycoplasmas in convenience samples of cats in Germany", JOURNAL OF FELINE MEDICINE AND SURGERY, vol. 10, 2008, pages 252 - 258, XP022690368, DOI: doi:10.1016/j.jfms.2007.12.004
BERENT, L. M., MESSICK, J. B., COOPER, S. K.: "Detection of Haemobartonella felis in cats with experimentally induced acute and chronic infections, using a polymerase chain reaction assay", AMERICAN JOURNAL OF VETERINARY RESEARCH, vol. 59, 1998, pages 1215 - 1220
CONTAMIN, H., MICHEL, J. C.: "Haemobartonellosis in squirrel monkeys (Saimiri sciureus): antagonism between Haemobartonella sp. and experimental Plasmodium falciparum malaria", EXPERIMENTAL PARASITOLOGY, vol. 91, 1999, pages 297 - 305
FUJIHARA, M., WATANABE, M., YAMADA, T., HARASAWA, R.: "Occurrence of 'Candidatus Mycoplasma turicensis' infection in domestic cats in Japan", JOURNAL OF VETERINARY MEDICAL SCIENCE, vol. 69, 2007, pages 1061 - 1063
GENTILINI, F., NOVACCO, M., TURBA, M. E., WILLI, B., BACCI, M. L., HOFMANN-LEHMANN, R.: "Use of combined conventional and real-time PCR to determine the epidemiology of feline haemoplasma infections in northern Italy", JOURNAL OF FELINE MEDICINE AND SURGERY, vol. 11, 2009, pages 277 - 285, XP025974124, DOI: doi:10.1016/j.jfms.2008.06.008
GEORGE, J. W., RIDEOUT, B. A., GRIFFEY, S. M., PEDERSEN, N. C.: "Effect of preexisting FeLV infection or FeLV and feline immunodeficiency virus coinfection on pathogenicity of the small variant of Haemobartonella felis in cats", AMERICAN JOURNAL OF VETERINARY RESEARCH, vol. 63, 2002, pages 1172 - 1178
H ZOLA: "Monoclonal Antibodies: A manual of techniques", 1988, CRC PRESS
HACKETT, T. B., JENSEN, W. A., LEHMAN, T. L., HOHENHAUS, A. E., CRAWFORD, P. C., GIGER, U., LAPPIN, M. R.: "Prevalence of DNA of Mycoplasma haemofelis, 'Candidatus Mycoplasma haemominutum', Anaplasma phagocytophilum, and species of Bartonella, Neorickettsia, and Ehrlichia in cats used as blood donors in the United States", JOURNAL OF THE AMERICAN VETERINARY MEDICAL ASSOCIATION, vol. 229, 2006, pages 700 - 705
HOELZLE, K., DOSER, S., RITZMANN, M., HEINRITZI, K., PALZER, A., ELICKER, S., KRAMER, M., FELDER, K. M., HOELZLE, L. E.: "Vaccination with the Mycoplasma suis recombinant adhesion protein MSG1 elicits a strong immune response but fails to induce protection in pigs", VACCINE, 2009
HOELZLE, K., GRIMM, J., RITZMANN, M., HEINRITZI, K., TORGERSON, P., HAMBURGER, A., WITTENBRINK, M. M., HOELZLE, L. E.: "Use of recombinant antigens to detect antibodies against Mycoplasma suis, with correlation of serological results to hematological findings", CLINICAL AND VACCINE IMMUNOLOGY, vol. 14, 2007, pages 1616 - 1622
HOELZLE, L. E., D. ADELT, K. HOELZLE, K. HEINRITZI, M. M. WITTENBRINK: "Development of a diagnostic PCR assay based on novel DNA sequences for the detection of Mycoplasma suis (Eperythrozoon suis) in porcine blood", VET M ICROBIOL, vol. 93, 2003, pages 185 - 96, XP002423344, DOI: doi:10.1016/S0378-1135(03)00040-3
HOELZLE, L. E., HOELZLE, K., HARDER, A., RITZMANN, M., AUPPERLE, H., SCHOON, H. A., HEINRITZI, K., WITTENBRINK, M. M.: "First identification and functional characterization of an immunogenic protein in unculturable haemotrophic Mycoplasmas (Mycoplasma suis HspA1", FEMS IMMUNOLOGY AND MEDICAL MICROBIOLOGY, vol. 49, 2007, pages 215 - 223, XP009080119, DOI: doi:10.1111/j.1574-695X.2006.00184.x
HOELZLE, L. E., HOELZLE, K., HELBLING, M., AUPPERLE, H., SCHOON, H. A., RITZMANN, M., HEINRITZI, K., FELDER, K. M., WITTENBRINK, M: "MSG1, a surface-localised protein of Mycoplasma suis is involved in the adhesion to erythrocytes", MICROBES AND INFECTION, vol. 9, 2007, pages 466 - 474, XP005934792
HOELZLE, L. E., HOELZLE, K., RITZMANN, M., HEINRITZI, K., WITTENBRINK, M. M.: "Mycoplasma suis antigens recognized during humoral immune response in experimentally infected pigs", CLINICAL AND VACCINE IMMUNOLOGY, vol. 13, 2006, pages 116 - 122, XP002423343, DOI: doi:10.1128/CVI.13.1.116-122.2006
HOELZLE, L. E.: "Haemotrophic mycoplasmas: Recent advances in Mycoplasma suis", VETERINARY MICROBIOLOGY, vol. 130, 2008, pages 215 - 226, XP025425788, DOI: doi:10.1016/j.vetmic.2007.12.023
INOKUMA, H., OYAMADA, M., DAVOUST, B., BONI, M., DEREURE, J., BUCHETON, B., HAMMAD, A., WATANABE, M., ITAMOTO, K., OKUDA, M.: "Epidemiological survey of Ehrlichia canis and related species infection in dogs in eastern Sudan", ANNALS OF THE NEW YORK ACADEMY OF SCIENCES, vol. 1078, 2006, pages 461 - 463
J G R HURRELL: "Monoclonal Hybridoma Antibodies: Techniques and Applications", 1982, CRC PRESS
JOHANSSON, K. E., J. G. TULLY, G. BOLSKE, B. PETTERSSON: "Mycoplasma cavipharyngis and Mycoplasma fastidiosum, the closest relatives to Eperythrozoon spp. and Haemobartonella spp", FEMS MICROBIOL LETT, vol. 174, 1999, pages 321 - 6
JORES, J., MEENS, J., BUETTNER, F. F., LINZ, B., NAESSENS, J., GERLACH, G. F.: "Analysis of the immunoproteome of Mycoplasma mycoides subsp. mycoides small colony type reveals immunogenic homologues to other known virulence traits in related Mycoplasma species", VETERINARY IMMUNOLOGY AND IMMUNOPATHOLOGY, vol. 131, 2009, pages 238 - 245, XP026600304, DOI: doi:10.1016/j.vetimm.2009.04.016
KAMRANI, A., PARREIRA, V. R., GREENWOOD, J., PRESCOTT, J. F.: "The prevalence of Bartonella, hemoplasma, and Rickettsia felis infections in domestic cats and in cat fleas in Ontario", CANADIAN JOURNAL OF VETERINARY RESEARCH, vol. 72, 2008, pages 411 - 419
KAY, M.: "Immunoregulation of cellular life span", ANN N Y ACAD SCI, vol. 1057, 2005, pages 85 - 111
KEMMING, G., MESSICK, J. B., MUELLER, W., ENDERS, G., MEISNER, F., MUENZING, S., KISCH-WEDEL, H., SCHROPP, A., WOJTCZYK, C., PACKE: "Can we continue research in splenectomized dogs? Mycoplasma haemocanis: Old problem - New insight", EUROPEAN SURGICAL RESEARCH, vol. 36, 2004, pages 198 - 205
KENNY, M. J., SHAW, S. E., BEUGNET, F., TASKER, S.: "Demonstration of two distinct hemotropic mycoplasmas in French dogs", JOURNAL OF CLINICAL MICROBIOLOGY, vol. 42, 2004, pages 5397 - 5399
KORSGREN, C., J. LAWLER, S. LAMBERT, D. SPEICHER, C. M. COHEN: "Complete amino acid sequence and homologies of human erythrocyte membrane protein band 4.2", PROC NATL ACAD SCI U S A, vol. 87, 1990, pages 613 - 7
LACOBELLI ET AL., BREAST CANCER RESEARCH AND TREATMENT, vol. 11, 1988, pages 19 - 30
LESTER, S. J., HUME, J. B., PHIPPS, B.: "Haemobartonella canis infection following splenectomy and transfusion", CANADIAN VETERINARY JOURNAL, vol. 36, 1995, pages 444 - 445
LOBETTI, R. G., TASKER, S.: "Diagnosis of feline haemoplasma infection using a real-time PCR assay", JOURNAL OF THE SOUTH AFRICAN VETERINARY MEDICAL ASSOCIATION, vol. 75, 2004, pages 94 - 99
LUTZ, H. U., G. WIPF: "Naturally occurring autoantibodies to skeletal proteins from human red blood cells", J JMMUNO, vol. 128, 1982, pages 1695 - 9
MESSICK, J. B., P. G. WALKER, W. RAPHAEL, L. BERENT, X. SHI.: "Candidatus Mycoplasma haemodidelphidis' sp. nov., 'Candidatus Mycoplasma haemolamae' sp. nov. and Mycoplasma haemocanis comb. nov., haemotrophic parasites from a naturally infected opossum (Didelphis virginiana), alpaca (Lama pacos) and dog (Canis familiaris): phylogenetic and secondary structural r", INT J SYST EVOL MICROBIOL, vol. 52, 2002, pages 693 - 8
MUSEUX, K., BORETTI, F. S., WILLI, B., RIOND, B., HOELZLE, K., HOELZLE, L. E., WITTENBRINK, M. M., TASKER, S., WENGI, N., REUSCH,: "In vivo transmission studies of 'Candidatus Mycoplasma turicensis' in the domestic cat", VETERINARY RESEARCH, 2009, pages 40,45
NEIMARK, H., K. E. JOHANSSON, Y. RIKIHISA, J. G. TULLY: "Proposal to transfer some members of the genera Haemobartonella and Eperythrozoon to the genus Mycoplasma with descriptions of 'Candidatus Mycoplasma haemofelis', 'Candidatus Mycoplasma haemomuris', 'Candidatus Mycoplasma haemosuis' and 'Candidatus Mycoplasma wenyonii", INT J SYST EVOL MICROBIOL, vol. 51, 2001, pages 891 - 9
PEREZ-CASAL, J., PRYSLIAK, T.: "Detection of antibodies against the Mycoplasma bovis glyceraldehyde-3-phosphate dehydrogenase protein in beef cattle", MICROBIAL PATHOGENESIS, vol. 43, 2007, pages 189 - 197, XP022258348, DOI: doi:10.1016/j.micpath.2007.05.009
PETERS, . R., C. R. HELPS, L. MCAULIFFE, H. NEIMARK, M. R. LAPPIN, T. J. GRUFFYDD-JONES, M. J. DAY, L. E. HOELZLE, B. WILLI, M. ME: "RNaseP RNA Gene (rnpB) Phylogeny of Haemoplasmas and Other Mycoplasma Species", J CLIN MICROBIOL, 2008
PETERS, . R., HELPS, C. R., GRUFFYDD-JONES, T. J., DAY, M. J., TASKER, S.: "Antigen specificity of the humoral immune response to Mycoplasma haemofelis infection", JOURNAL OF CLINICAL MICROBIOLOGY, 2010
PETERS, . R., HELPS, C. R., WILLI, B., HOFMANN-LEHMANN, R., TASKER, S.: "The prevalence of three species of feline haemoplasmas in samples submitted to a diagnostics service as determined by three novel real-time duplex PCR assays", VETERINARY MICROBIOLOGY, vol. 126, 2008, pages 142 - 150, XP022351071, DOI: doi:10.1016/j.vetmic.2007.06.017
RIKIHISA, Y., M. KAWAHARA, B. WEN, G. KOCIBA, P. FUERST, F. KAWAMORI, C. SUTO, S. SHIBATA, M. FUTOHASHI: "Western immunoblot analysis of Haemobartonella muris and comparison of 16S rRNA gene sequences of H. muris, H. felis, and Eperythrozoon suis", J CLIN MICROBIOL, vol. 35, 1997, pages 823 - 9, XP002926817
ROURA, X., PETERS, . R., ALTET, L., TABAR, M. D., BARKER, E. N., PLANELLAS, M., HELPS, C. R., FRANCINO, 0., SHAW, S. E., TASKER, S: "Real-time PCR detection of hemotropic mycoplasmas in healthy and unhealthy cats and dogs from the Barcelona area of Spain", JOURNAL OF VETERINARY DIAGNOSTIC INVESTIGATION, vol. 22, 2010, pages 270 - 274
SAMBROOK ET AL.: "Molecular Cloning, a laboratory manual", COLD SPRING HARBOR LABORAORY PRESS
STECK, T. L.: "The organization of proteins in the human red blood cell membrane. A review", J CELL BIOL, vol. 62, 1974, pages 1 - 19
SYKES, J. E., BAILIFF, N. L., BALL, L. M., FOREMAN, O., GEORGE, J. W., FRY, M. M.: "Identification of a novel hemotropic mycoplasma in a splenectomized dog with hemic neoplasia", JOURNAL OF THE AMERICAN VETERINARY MEDICAL ASSOCIATION, vol. 224, 2004, pages 1946 - 1951
SYKES, J. E., DRAZENOVICH, N. L., BALL, L. M., LEUTENEGGER, C. M.: "Use of conventional and real-time polymerase chain reaction to determine the epidemiology of hemoplasma infections in anemic and nonanemic cats", JOURNAL OF VETERINARY INTERNAL MEDICINE, vol. 21, 2007, pages 685 - 693
TASKER, S., BINNS, S. H., DAY, M. J., GRUFFYDD-JONES, T. J., HARBOUR, D. A., HELPS, C. R., JENSEN, W. A., OLVER, C. S., LAPPIN, M.: "Use of a PCR assay to assess the prevalence and risk factors for Mycoplasma haemofelis and 'Candidatus Mycoplasma haemominutum' in cats in the United Kingdom", VETERINARY RECORD, vol. 152, 2003, pages 193 - 198
TASKER, S., BRADDOCK, J. A., BARAL, R., HELPS, C. R., DAY, M. J., GRUFFYDD-JONES, T. J., MALIK, R.: "Diagnosis of feline haemoplasma infection in Australian cats using a real-time PCR assay", JOURNAL OF FELINE MEDICINE AND SURGERY, vol. 6, 2004, pages 345 - 354, XP004644817, DOI: doi:10.1016/j.jfms.2003.12.003
TASKER, S., CANEY, S. M., DAY, M. J., DEAN, R. S., HELPS, C. R., KNOWLES, T. G., LAIT, P. J., PINCHES, M. D., GRUFFYDD-JONES, T. J: "Effect of chronic feline immunodeficiency infection, and efficacy of marbofloxacin treatment, on 'Candidatus Mycoplasma haemominutum' infection", MICROBES AND INFECTION, vol. 8, 2006, pages 653 - 661, XP028072120, DOI: doi:10.1016/j.micinf.2005.08.015
TASKER, S., CANEY, S. M., DAY, M. J., DEAN, R. S., HELPS, C. R., KNOWLES, T. G., LAIT, P. J., PINCHES, M. D., GRUFFYDD-JONES, T. J: "Effect of chronic FIV infection, and efficacy of marbofloxacin treatment, on Mycoplasma haemofelis infection", VETERINARY MICROBIOLOGY, vol. 117, 2006, pages 169 - 179, XP024935675, DOI: doi:10.1016/j.vetmic.2006.06.015
TASKER, S., PETERS, . R., DAY, M. J., WILLI, B., HOFMANN-LEHMANN, R., GRUFFYDD-JONES, T. J., HELPS, C. R.: "Distribution of feline haemoplasmas in blood and tissue following experimental infection", MICROBIAL PATHOGENESIS, vol. 47, 2009, pages 334 - 340
TASKER, S., PETERS, . R., PAPASOULOTIS, K., CUE, S. M., WILLI, B., HOFMANN-LEHMANN, R., KNOWLES, T. G., GRUFFYDD-JONES, T. J., DAY: "Description of outcomes of experimental infection with feline haemoplasmas: haematology, Coombs' testing and blood glucose concentrations", VETERINARY MICROBIOLOGY, 2009
TASKER, S.: "Current concepts in feline haemobartonellosis", PRACTICE, vol. 28, 2006, pages 136 - 141
TASKER, S.: "Feline haemoplasmas - The past, present and future", 6TH EUROPEAN COLLEGE OF VETERINARY INTERNAL MEDICINE - COMPANION ANIMALS CONGRESS, 2006
TASKER, S.: "Haemotropic mycoplasmas: what's their real significance in cats?", JOURNAL OF FELINE MEDICINE AND SURGERY, vol. 12, 2010, pages 369 - 381
TURNER, C. M., BLOXHAM, P. A., COX, F. E., TURNER, C. B.: "Unreliable diagnosis of Haemobartonella felis", VETERINARY RECORD, vol. 119, 1986, pages 534 - 535
WENGI, N., WILLI, B., BORETTI, F. S., CATTORI, V., RIOND, B., MELI, M. L., REUSCH, C. E., LUTZ, H., HOFMANN-LEHMANN, R.: "Real-time PCR-based prevalence study, infection follow-up and molecular characterization of canine hemotropic mycoplasmas", VETERINARY MICROBIOLOGY, 2007
WENGI, N., WILLI, B., BORETTI, F. S., CATTORI, V., RIOND, B., MELI, M. L., REUSCH, C. E., LUTZ, H., HOFMANN-LEHMANN, R.: "Real-time PCR-based prevalence study, infection follow-up and molecular characterization of canine hemotropic mycoplasmas", VETERINARY MICROBIOLOGY, vol. 126, 2008, pages 132 - 141, XP022351070, DOI: doi:10.1016/j.vetmic.2007.06.018
WILLI, B., BORETTI, F. S., BAUMGARTNER, C., TASKER, S., WENGER, B., CATTORI, V., MELI, M. L., REUSCH, C. E., LUTZ, H., HOFMANN-LEH: "Prevalence, risk factor analysis, and follow-up of infections caused by three feline hemoplasma species in cats in Switzerland", JOURNAL OF CLINICAL MICROBIOLOGY, vol. 44, 2006, pages 961 - 969, XP002425623, DOI: doi:10.1128/JCM.44.3.961-969.2006
WILLI, B., BORETTI, F. S., TASKER, S., MELI, M. L., WENGI, N., REUSCH, C. E., LUTZ, H., HOFMANN-LEHMANN, R.: "From Haemobartonella to hemoplasma: Molecular methods provide new insights", VETERINARY MICROBIOLOGY, vol. 125, 2007, pages 197 - 209, XP022306763, DOI: doi:10.1016/j.vetmic.2007.06.027
WILLI, B., TASKER, S., BORETTI, F. S., DOHERR, M. G., CATTORI, V., MELI, M. L., LOBETTI, R. G., MALIK, R., REUSCH, C. E., LUTZ, H.: "Phylogenetic analysis of 'Candidatus Mycoplasma turicensis' isolates from pet cats in the United Kingdom, Australia, and South Africa, with analysis of risk factors for infection", JOURNAL OF CLINICAL MICROBIOLOGY, vol. 44, 2006, pages 4430 - 4435, XP009080625, DOI: doi:10.1128/JCM.00987-06

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024145641A3 (en) * 2022-12-30 2024-12-19 Idexx Laboratories, Inc. Compositions and methods for the detection of mycoplasma

Also Published As

Publication number Publication date
WO2012010849A3 (en) 2012-05-03

Similar Documents

Publication Publication Date Title
Silva et al. The terminal portion of leptospiral immunoglobulin-like protein LigA confers protective immunity against lethal infection in the hamster model of leptospirosis
Kelly et al. Scrub typhus: the geographic distribution of phenotypic and genotypic variants of Orientia tsutsugamushi
Simborio et al. Evaluation of the combined use of the recombinant Brucella abortus Omp10, Omp19 and Omp28 proteins for the clinical diagnosis of bovine brucellosis
US8658387B2 (en) Ehrlichia canis DIVA (differentiate infected from vaccinated animals)
Singu et al. Ehrlichia chaffeensis expresses macrophage-and tick cell-specific 28-kilodalton outer membrane proteins
JP5759724B2 (en) Ehrliciacanis DIVA (distinguishes infected animals from vaccinated animals)
Lim et al. Evaluation of recombinant 28 kDa outer membrane protein of Brucella abortus for the clinical diagnosis of bovine brucellosis in Korea
EP2067036B1 (en) Method to differentiate infected from vaccinated animals using ehrlichia canis polypeptides
Noordhoek et al. A new attempt to distinguish serologically the subspecies of Treponema pallidum causing syphilis and yaws
Cheng et al. Characterization of the gene for an immunodominant 72 kDa lipoprotein of Mycoplasma mycoides subsp. mycoides small colony type
Lopez et al. High-throughput identification of T-lymphocyte antigens from Anaplasma marginale expressed using in vitro transcription and translation
EP2877196A1 (en) Ompa and asp14 in vaccine compositions and as diagnostic targets
Kanagavel et al. B-cell-specific peptides of Leptospira interrogans LigA for diagnosis of patients with acute leptospirosis
Tomson et al. Assessment of cell-surface exposure and vaccinogenic potentials of Treponema pallidum candidate outer membrane proteins
US8703432B2 (en) Recombinant Treponema spp. proteins for use in vaccine, antibodies against said proteins, and diagnostic and therapeutic methods including the same
AiHua et al. A sensitive and specific IgM-ELISA for the serological diagnosis of human leptospirosis using a rLipL32/1-LipL21-OmpL1/2 fusion protein
Bulashev et al. Immunogenicity and antigenicity of Brucella recombinant outer membrane proteins.
WO2010132758A2 (en) Ospc-based diagnostic test for lyme disease
McBride et al. Tyrosine-phosphorylated Ehrlichia chaffeensis and Ehrlichia canis tandem repeat orthologs contain a major continuous cross-reactive antibody epitope in lysine-rich repeats
Wu et al. Proteomic identification of immunodominant membrane-related antigens in Campylobacter jejuni associated with sheep abortion
WO2012010849A2 (en) Methods of diagnosis and vaccines
Yu et al. InlA and InlC2 of Listeria monocytogenes serotype 4b are two internalin proteins eliciting humoral immune responses common to listerial infection of various host species
Pornwiroon et al. Immunoproteomic profiling of Rickettsia parkeri and Rickettsia amblyommii
WO2022180041A1 (en) Compositions and methods for diagnosing, treating and preventing carrion's disease
MX2010009516A (en) Novel sequences of brachyspira, immunogenic compositions, methods for preparation and use thereof.

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11746601

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 11746601

Country of ref document: EP

Kind code of ref document: A2