WO2011109494A2 - A method for inhibiting alternative pathway mediated disorders with anti-properdin antibodies that inhibit c5 interactions with properdin - Google Patents

A method for inhibiting alternative pathway mediated disorders with anti-properdin antibodies that inhibit c5 interactions with properdin Download PDF

Info

Publication number
WO2011109494A2
WO2011109494A2 PCT/US2011/026841 US2011026841W WO2011109494A2 WO 2011109494 A2 WO2011109494 A2 WO 2011109494A2 US 2011026841 W US2011026841 W US 2011026841W WO 2011109494 A2 WO2011109494 A2 WO 2011109494A2
Authority
WO
WIPO (PCT)
Prior art keywords
properdin
antibody
formation
agent
mammal
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/026841
Other languages
French (fr)
Other versions
WO2011109494A3 (en
Inventor
Rekha Bansal
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novelmed Therapeutics Inc
Original Assignee
Novelmed Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novelmed Therapeutics Inc filed Critical Novelmed Therapeutics Inc
Priority to CN201180022197.3A priority Critical patent/CN103068396B/en
Priority to CA2811091A priority patent/CA2811091C/en
Priority to AU2011223660A priority patent/AU2011223660B2/en
Priority to EP11751270.7A priority patent/EP2544694B1/en
Priority to PCT/US2011/027964 priority patent/WO2011112850A2/en
Priority to CN201180023582.XA priority patent/CN103003302B/en
Priority to EP11754104.5A priority patent/EP2545075B1/en
Priority to AU2011224224A priority patent/AU2011224224B2/en
Priority to US13/583,879 priority patent/US8664362B2/en
Priority to CA2811221A priority patent/CA2811221C/en
Publication of WO2011109494A2 publication Critical patent/WO2011109494A2/en
Publication of WO2011109494A3 publication Critical patent/WO2011109494A3/en
Anticipated expiration legal-status Critical
Priority to US13/646,286 priority patent/US9745367B2/en
Priority to US14/863,301 priority patent/US20160207987A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to anti-properdin antibody agents that inhibit properdin binding to a complement protein, for example, C5 or C5b, and the use of such antibodies to selectively inhibit alternative complement pathway function in mammals in prophylactic and therapeutic settings to prevent, halt or reverse the disease process.
  • a complement protein for example, C5 or C5b
  • the complement system is important for host defense against pathogens and is involved in clearance of, for example, pathogens, bacterial cells, foreign antigens, and tumor cells.
  • the alternative complement pathway (AP) is activated as a result of both pathological inflammation and autoimmune diseases. Elevated levels of C3a, C5a, and C5b-9 have been found to be associated with several acute and chronic diseases. Therefore, inhibition of disease-induced AP activation is important for clinical benefit in the diseases where complement activation plays a role in disease pathology.
  • the complement system is activated via three distinct complement pathways; the classical, the lectin and the alternative pathways.
  • the classical pathway is activated via antigen-antibody complexes and is required for host defense.
  • the lectin pathway is a variation of the classical pathway.
  • the alternative pathway is activated by foreign material, artificial surfaces, dead tissues, bacteria, and dead yeast cells.
  • Therapeutic strategies that selectively inhibit activation of the alternative pathway without affecting the classical pathway are of disease relevance to treating diseases and disorders acsccoiated with AP activation. Under pathological conditions, activation of the alternative pathway generates anaphylatoxins, including C3a, C5a and the tissue damaging C5b-9 molecule also known as MAC.
  • inflammatory mediators mediate inflammation and tissue damage via cellular activation, release of inflammatory mediators, and deposition of C5b-9.
  • Cellular leukocyte chemotaxis and activation of macrophages, neutrophils, platelets, mast cells and endothelial cells provide evidence for the inflammatory response. Additionally, vascular permeability, cytolysis, and tissue injury processes also occur during inflammation. Activated cells release inflammatory mediators such as TNF-a, IL- ⁇ , IL-6, IL-8, VEGF, neutrophil elastase, and peroxide.
  • Properdin is required for the initiation of the alternative complement pathway, since its binding to C3b constitutes the necessary first step in AP activation.
  • Properdin binds C3b with high affinity.
  • Properdin-bound C3b subsequently binds with factor B to form the PC3bB complex, which is then cleaved by factor D to form the PC3bBb complex, where Ba is released.
  • C5 convertase, which cleaves C5 into C5a and C5b.
  • the so-formed C5 represents an anchor protein that forms the C5b-9 complex upon association with C6, C7, C8, and C9.
  • Properdin concentration in blood is nearly 5 ⁇ g/mL, and, thus, it is the only non-protease molecule present at a much lower concentration than Factor D.
  • Properdin is an alternative pathway specific molecule, whose presence and function are required for the propagation of the alternative pathway.
  • inhibition of AP activation without inhibiting the classical complement pathway appears to be an important therapeutic strategy to inhibit the disease-induced activation of the AP.
  • blocking, inhibiting or preventing AP activation via depleting properdin, neutralizing properdin or inactivating properdin remains potentially important therapeutic strategies.
  • anti-properdin antibodies that bind to C5 or C5b have previously been discovered.
  • the antibodies of the present invention can inhibit properdin binding to C5 or C5b, and thus prevent the formation of C3a, C3b, C5a, C5b, and C5b-9.
  • anti-C5 antibodies can be generated that would inhibit properdin interaction to C5/C5b and prevent the formation of C3a, C3b, C5a, C5b, and C5b-9.
  • the antibodies of the present invention can inhibit the binding of C5 molecules to properdin and can provide a therapeutic benefit by preventing AP activation in a setting where the binding of properdin to C5 is preexisting. Treatment with anti-properdin antibodies that specifically prevent the binding of properdin to C5 can provide significant therapeutic benefit in pathological conditions where alternative complement pathway is activated.
  • Antibodies that can inhibit the binding of properdin to C3b have been developed, and those that de -polymerize polymeric properdin have been discussed. These antibodies can inhibit the formation of C3a, C5a, and C5b-9.
  • the present invention relates to a method of inhibiting alternative complement pathway activation in a mammal.
  • the method includes the step of administering to the mammal a therapeutically effective amount of an anti-properdin agent that specifically binds to properdin and prevents properdin binding to at least one complement protein, for example C5, C5b, or C9.
  • the present invention also relates antibodies that inhibit properdin binding to, for example, C5 or C5b and, as a result, the formation of C3a, C3b, C5a, C5b, and C5b-9.
  • the anti-properdin agent can bind to at least one complement protein, including, but not limited to, C5/C5b, C6, C7, C8, or C9.
  • the anti-properdin agent can be selected from the following group including, but not limited to: synthetic small molecules, aptamers of DNA, DNA fragments, SiRNA, monoclonal and polyclonal antibodies, and derivatives of the monoclonal and or polyclonal antibodies that block the binding of properdin to at least one of C5/C5b, C6, C7, C8, or C9, or any portion of the peptide similar to that found in at least one of C5/C5b, C6, C7, C8, or C9.
  • the anti-properdin agent can be an anti- properdin antibody that is registered as PTA-9641 (14G11).
  • Anti properdin monoclonal antibody 14G11 of the present invention binds the N terminal domain of SEQ ID NO: 15 AFAYQKRSGGLCQPCRSPRWSLWS. Such antibodies inhibit properdin binding to C5b and prevent AP activation.
  • the anti-properdin agent can be administered in vivo or ex vivo to a mammal, including a human.
  • the anti-properdin antibody can be a monoclonal, polyclonal, chimeric, recombinant, humanized, de-immunized, HumaneeredTM or a fully human antibody.
  • the anti-properdin antibody can also be an antibody fragment, such as a single chain antibody, IgG, F(ab')2, F(ab), F(ab') fragment, or truncated antibody, for example, an Fc truncated antibody.
  • the ratio of binding of the anti-properdin agent to properdin can be about 0.2:1 to about 1.5:1.
  • the prevention of properdin binding to at least one complement protein can allow for the inhibition of the alternative complement pathway in the mammal without affecting classical pathway activation.
  • the anti-properdin agent reduces the level of free properdin in a mammal.
  • the anti-properdin agent specifically binds properdin to prevent the binding of properdin to C5.
  • the antibody can bind to an epitope on the properdin monomer at its C5 binding site and prevents the formation of Olimers of Properdin and C3b shown in Figure 2.
  • the anti-properdin agent specifically binds properdin to prevent the binding properdin to C6, C7, C8, or C9.
  • an anti-properdin antibody generated in a mouse can be prepared with a characteristic CDR(s) region that binds and inhibits properdin binding to C5 and C9.
  • the anti-properdin antibody can inhibit the formation of the C5b-9 complex, also known as MAC.
  • the invention provides a method to ameliorate a disease or condition associated with excessive or uncontrolled alternative pathway complement activation by administering a therapeutically effective amount of an anti- properdin agent that specifically binds to properdin to inhibit the binding of properdin to C5.
  • the antibody in another aspect of the invention, can be produced in a cell or mammal or it can be genetically engineered in a mammal, phage display or from a recombinant or natural antibody library.
  • administration of the anti-properdin antibody of and antigen binding fragment to a subject can result in at least one of the following: inhibition of properdin binding to C5, inhibition of properdin binding to C5b, inhibition of properdin binding to C9, reduction in the formation of C3bBb, reduction in the production of C3a and C5a, reduction in the formation of C5b-9 complex, reduction in the activation of neutrophils, reduction in the activation of monocytes reduction in the activation of platelets, reduction in the formation of leukocyte-platelet conjugates, reduction in TNF- alpha production, and the reduction in production of neutrophil elastase. Consequently, the antibody or fragment thereof can also inhibit the alternative pathway dependent rabbit erythrocyte lysis in human serum/plasma.
  • the invention relates to a method of inhibiting alternative complement pathway activation in a mammalian host that includes the administration of a therapeutically effective amount of an anti-properdin monoclonal antibody that specifically binds to an epitope on properdin, where the epitope is involved in C5, C5b or C9 binding.
  • the invention in another aspect, relates to a method of inhibiting alternative complement pathway activation without inhibiting the classical pathway activation in a mammal by administering in a mammal a therapeutically effective amount of an antibody that specifically binds to an epitope of properdin, which blocks the alternative pathway activation via the inhibition of properdin and C5 interaction without affecting the classical pathway activation.
  • the present invention relates to a method of inhibiting alternative complement pathway activation without inhibiting the classical pathway activation in a mammal.
  • the method includes the step of administering to a mammal a therapeutically effective amount of an antibody that specifically binds to properdin and inhibits deposition of C5b-9, which blocks the alternative pathway activation via the inhibition of properdin and C5 interaction without affecting the classical pathway activation.
  • the present invention relates to a method of inhibiting alternative complement pathway activation, including the step of administering to a mammal a therapeutically effective amount of an antibody blocks the formation of the PC3b complex, the PC3bB complex, and the PC3bBb complex via the inhibition of properdin and C5 interaction without affecting the classical pathway activation.
  • the present invention can provide a method of inhibiting activation of the alternative complement pathway in an individual who is at risk of developing a disease or a condition in which activation of the alternative complement pathway contributes to the disease pathology, exacerbates the disease, or causes the disease, via the administration of any specific antibodies of the present invention or antigen-binding fragments thereof disclosed herein to an individual in need.
  • the present invention can relate to a method of treating alternative pathway activation mediated by disease-related or pathological conditions including the step of administering to a mammal a therapeutically effective amount of an antibody or fragment thereof that specifically binds to properdin and blocks the initiation of C9 assembly and prevents the formation of C5b-9 complex formation at the site of pathology.
  • the present invention provides an anti- properdin agent in a pharmaceutically acceptable carrier which is selected from the group comprising: a dry, dispersible powder; anhydrous ethanol; small capsules; liposomes; a nebulized spray; and an injectable excipient.
  • the anti-properdin antibody can specifically bind to an epitope on the properdin monomer at its C5 binding site and can prevent the formation of polymers of Properdin and C3b.
  • the present invention relates to a method of making a rat or mouse anti-properdin monoclonal antibodies in a properdin-knockout mice or other rodent.
  • the method includes the step of administering to a mouse or other rodent an effective amount of properdin or fragment thereof to the properdin knockout an effective amount of the properdin or fragment thereof that causes the knockout rodent to produce antibodies against properdin.
  • the mouse or other rodent can include human immunoglobulin genes.
  • the fragment includes a peptide having a C5 binding domain.
  • the present invention also relates to an isolated antibody or antigen binding portion thereof that binds to human properdin and blocks C5 or C5b binding to properdin.
  • the antibody or antigen binding portion thereof comprises of a heavy chain variable domain that includes the amino acid sequences of the three CDRs (SEQID NO: 1) and a light chain variable domain that includes the amino acid sequences of the three CDRs (SEQ ID NO: 2).
  • the anti-properdin antibody or antigen binding fragment thereof can comprise the heavy chain variable regions and the light chain variable regions of an antibody produced by the hybridoma cell line deposited under ATCC Accession Number PTA-9641.
  • the present invention further relates to an isolated antibody or antigen binding portion thereof that binds to human properdin.
  • the antibody or antigen binding fragment thereof comprises of a heavy chain variable domain containing the amino acid sequences of the three CDRs in SEQ ID NO: 1.
  • the present invention further relates to an isolated antibody or antigen binding portion thereof that binds to human properdin.
  • the antibody or antigen binding fragment thereof comprises of a light chain variable domain comprising the amino acid sequences of the three CDRs in SEQ ID NO: 2.
  • the anti-properdin antibody or antigen binding fragment thereof can also inhibit alternative pathway dependent rabbit erythrocyte lysis in human serum/plasma.
  • the present invention relates to a method of inhibiting alternative pathway complement activation in a mammal by the administration of a therapeutically effective amount of an anti-properdin antibody or antigen binding portion thereof to the mammal that specifically binds to properdin to inhibit alternative pathway complement activation, at a molar ratio of antibody to properdin monomer of about 0.2:1.
  • the antibody of the present invention can be administered in vivo or ex vivo.
  • the antibody or antigen binding portion thereof can specifically bind to an epitope on properdin and, consequently, inhibit the alternative complement pathway in the mammal.
  • the present invention can provide a method of treating a disease or disorder in which the AP activation plays a role.
  • the treatment comprises of the step of administering an anti properdin antibody or antigen-binding fragment thereof derived from murine monoclonal antibody (ATCC PTA-9641) to a mammal that selectively binds to properdin at the binding site of C5or C5b and inhibits formation of the C3bBb complex, the PC3bBb complex, the PC5 complex, the PC9 complex, and the PC3b complex.
  • the anti- properdin antibody or antigen-binding fragment thereof can have an equilibrium dissociation constant between about 1 nM to about 1 pM.
  • the antibodies of the present invention can be administered to a mammal that has, or is at risk of developing a disease or disorder in which AP activation plays a role.
  • the disease or disorder is selected from the group of multiple diseases, described herein, where alternative pathway plays a pathological role in the disease.
  • FIG. 1 illustrates the schematics of the hypothetical role of properdin in the assembly and formation of C5b-9.
  • FIG. 2 shows the formation of PC5bC3bBb convertase where if properdin can exist as a trimer.
  • FIG. 3 shows the binding affinity of properdin to C3b, C5/C5b, and C9
  • FIG. 4 shows the anti-properdin agent of the present invention can inhibit the hemolysis of rRBC.
  • FIG. 5 shows that both anti properdin IgG and F(ab') 2 bind properdin with high affinity.
  • FIG. 6 shows the inhibition of properdin binding to C5b and C9 by the anti- properdin antibody.
  • FIG. 7 shows the inhibition of AP-dependent formation of newly formed C3b in normal human serum.
  • FIG. 8 shows the inhibition of AP-dependent formation of PC3b complex in normal human serum.
  • FIG. 9 shows the inhibition of AP-dependent Bb formation in normal human serum.
  • FIG. 10 shows the inhibition of AP-dependent C5 formation in normal human serum.
  • FIG. 11 shows the inhibition of AP-dependent C9 formation in normal human serum.
  • FIG. 12 shows inhibition of AP-dependent C5b-9 formation in normal human serum.
  • FIG. 13 shows SEQ ID NOs: 1-6.
  • FIG. 14 shows SEQ ID NOs: 7-8.
  • FIG. 15 shows SEQ ID NOs: 9-10.
  • FIG. 16 shows SEQ ID NOs: 11-12.
  • FIG. 17 shows SEQ ID NOs: 13-14.
  • FIG. 18 shows SEQ ID NO: 15.
  • antibody or “antibody fragments thereof” refer to an intact antibody, or a binding fragment thereof that competes with the intact antibody for specific binding sites.
  • the binding fragments include Fab, Fab', F(ab') 2 , Fv, and single-chain antibodies.
  • anti-properdin agent refers to small molecules, DNA fragments, SiRNA, aptamers of DNA, monoclonal and polyclonal antibodies, and derivatives of the monoclonal and or polyclonal antibodies that block the binding of properdin to C5 or any portion of the peptide similar to that found in C5.
  • CDR complementary determining region
  • conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Conservative modifications can include amino acid substitutions, additions and deletions.
  • epitopope refers to a group of three dimensional structures on the antigen where the monoclonal antibody and fragments thereof would bind.
  • the term “monoclonal” refers to an antibody that binds to a sequence of amino acids and has a single specific epitope on its target antigen.
  • Properdin is known to bind C3b with high affinity. It was discovered that the properdin binding to C5 and C5b is important for properdin functions and that monoclonal antibodies, which specifically inhibit properdin binding to C5 or C5b, inhibit properdin function via the inhibition of C5b-9 formation and inhibition of C3b formation.
  • One embodiment of the present invention relates to anti-properdin antibodies that can bind to properdin and inhibit properdin binding to C5 or C5b.
  • Properdin binds to C9 with high affinity, which suggests a role for properdin in MAC assembly.
  • the antibodies of the present invention can inhibit: a) AP activation and b) AP induced formation of C5b-9.
  • the prevention of properdin binding to C5/C9 can allow for the inhibition of the alternative complement pathway in the mammal without affecting classical pathway activation.
  • the ratio of binding of the antibody to properdin can be about 0.2:1 to about 1.5:1.
  • the anti-properdin agent can prevent and/or reverse the binding of properdin to C5 and C9.
  • One embodiment of the present invention therefore relates to anti-properdin antibodies that can bind to properdin and inhibit properdin binding to C5 or C5b required for its function.
  • the anti-properdin antibody can inhibit the formation of the C5b-9 complex, also known as MAC.
  • Properdin can also exist as a polymer, for example, a dimer, a trimer, or atetramer. Properdin binds to C3b, and antibodies that inhibit properdin binding to C3b have been developed.
  • the present invention can include antibodies that can inhibit properdin binding to C5b and C9.
  • C5 provides an anchor to the formation of C5b-9 complexes and C9 is responsible for the formation of part of the C5b-9 complex.
  • the antibodies of the present invention can inhibit MAC assembly and provides a mechanism by which MAC is formed at the site of C3 convertase formation.
  • properdin can exist as a trimer.
  • - PC3bBb is a pure C3 convertase.
  • P(C5b)C3bBb is also a convertase with C5b bound to it.
  • This molecule can cleave C3 and C5, generating moles of C5b.
  • properdin- bound C3b could be replaced with C5b.
  • Properdin bound C5b participates in the formation of C5b-9. Properdin also binds C9 with high affinity, which could further stabilize the formation of functional polymeric C9 molecule.
  • Another embodiment of the present invention relates to antibodies that specifically bind to properdin, for example an anti-properdin antibody, and the use of such antibodies to inhibit alternative complement pathway activation via the inhibition of properdin binding to C5 or C5b.
  • the anti-properdin antibodies of the present invention are directed to or specifically bind to domains on properdin that are involved in controlling properdin function.
  • the anti-properdin antibodies or fragments thereof of the present invention can inhibit AP activation without inhibiting or effecting the classical complement pathway by several methods including, but not limited to selectively inhibiting the binding of properdin to C5 or C5b, reducing the formation of membrane attack complex C5b-9, reducing the formation of anaphylatoxins, for example C3a and/or C5a, reducing the formation of C3b, reducing the activation of neutrophils, monocytes and platelets, and/or reducing leukocyte aggregate formation.
  • the amino acid sequences of mammalian properdin are known.
  • the amino acid sequence of human properdin is disclosed in the GenBank database under Accession No. AAA36489.
  • Human properdin is a 469 amino acid protein that includes a signal peptide (amino acids 1-28), and six, non-identical thrombo spondin type 1 repeats (TSR) of about 60 amino acids each, as follows: amino acids 80-134 (TSR1), amino acids 139-191 (TSR2), amino acids 196-255 (TSR3), amino acids 260-313 (TSR4), amino acids 318-377 (TSR5), and amino acids 382-462 (TSR6).
  • TSR1 signal peptide
  • TSR2 non-identical thrombo spondin type 1 repeats
  • Anti-properdin antibodies can be selected based on their ability to inhibit properdin binding to C5 and then selected based on AP dependent hemolysis of rRBC (rabbit erythrocytes). These antibodies can bind to properdin in about a 0.2:1 stoichiometric ratio. Inhibition of alternative pathway (AP) complement activation can cause reduced levels of C3a, C5a, and C5b-9, inhibit the activation of monocytes, inhibit the formation of monocyte - platelets, and inhibit neutrophil-platelet aggregates.
  • AP alternative pathway
  • the anti-properdin antibody can inhibit the binding of properdin to C5.
  • the anti-properdin antibody can inhibit the binding of properdin to C5b.
  • the anti-properdin antibody can inhibit the binding of properdin to C9.
  • the anti-properdin antibody can affect the binding in about a 0.2: 1 molar ratio of antibody to properdin, an about 1:1 molar ratio of antibody to properdin, an about 1.5:1 ratio of antibody to properdin and with a maximum of about 10:1 antibody to properdin.
  • the anti-properdin antibody can bind properdin with high affinity, can inhibit C5 binding, can inhibit C3a, C5a, and C5b-9 formation, can inhibit neutrophil, monocyte and platelet activation, can inhibit leukocyte platelet conjugate formation, and can prevent alternative complement pathway activation.
  • the antibodies of the present invention can have no effect on classical pathway activation.
  • the monoclonal antibodies of the present invention may not inhibit the classical pathway.
  • Moclonal antibodies of the present invention can bind to a region on properdin that is only involved in AP activation via its binding to the C5 or C5b complement proteins.
  • the antibodies of the present invention can comprise heavy chains and light chains of CDR1, CDR2 and CDR3 of mAb, or combinations thereof.
  • the amino acid sequences of the variable heavy chain are shown in SEQ ID NO: 1 (CDR1), SEQ ID NO: 2 (CDR2), and SEQ ID NO: 3 (CDR3).
  • variable light chain CDRs are shown SEQ ID NO: 4 (CDR1), SEQ ID NO: 5 (CDR2), and SEQ ID NO: 6 (CDR3). Accordingly, in another embodiment, the present invention can provide an isolated monoclonal antibody, or antigen binding portion thereof comprising the CDR regions that can bind to human properdin.
  • the present invention can provide an isolated monoclonal antibody, or antigen binding portion thereof comprising: (a) a heavy chain variable region comprising of CDR1, CDR2, and CDR3 which include the amino acid sequences of SEQ ID NOs: 1, 2, and 3, respectively; and (b) a light chain variable region comprising CDR1, CDR2, and CDR3 which include the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively; wherein the antibody specifically binds human properdin.
  • an antibody of the present invention can comprise heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences of the preferred antibodies described herein, and wherein the antibodies retain the desired functional properties of the anti-properdin antibodies of the invention.
  • the invention can provide an isolated monoclonal antibody, or antigen binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein: (a) the heavy chain variable region comprises an amino acid sequence that is at least 80% homologous to the amino acid sequence of SEQ ID NO: 1; (b) the light chain variable region comprises an amino acid sequence that is at least 80% homologous to the amino acid sequence of SEQ ID NO: 9; and (c) the antibody specifically binds to human properdin.
  • the anti-properdin antibody can be, for example, a chimeric antibody, humanized antibody, human antibody, a humanized antibody or a chimeric antibody.
  • the V # and/or V L amino acid sequences of the antibodies of the present invention may be 85%, 90%, 95%, 96%, 97%, 98% or 99% homologous to the sequences set forth herein.
  • An antibody having V # and V L regions having high homology, for example, 80% or greater, to the V# and VL regions of the sequences set forth above, can be obtained by mutagenesis.
  • an antibody of the present invention can include a heavy chain variable region comprising heavy chain CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising of the light chain CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the preferred antibodies described herein, for example, NM4540, or conservative modifications thereof, and wherein the antibodies retain the desired functional properties of the anti-properdin antibodies of the invention
  • an anti-properdin monoclonal antibody can be labeled as 14G11.
  • the anti-properdin antibody 14G11 can bind properdin and can inhibit: properdin binding to C5 and C9, C3a, C5a, and C5b-9 formation, AP C3 convertase formation, and cellular activation.
  • Properdin binds to C5 and can guide the formation of C5b-9 complex at the site of pathology.
  • the anti-properdin agents of the present invention can bind to properdin and inhibit the binding of properdin to C5 or C5b and, thus, can prevent AP activation.
  • the anti-properdin monoclonal antibody 14G11 of the present invention can bind to the N- terminal domain of SEQ ID NO: 15. Such antibodies can inhibit the binding of properdin to C5b and thus can prevent AP activation.
  • the antibody of the present invention can be a monoclonal, polyclonal, chimeric, recombinant, humanized, de-immunized, HumaneeredTM or fully human antibody.
  • the antibody can also be an antibody fragment, such as a single chain antibody, IgG, F(ab')2, F(ab), F(ab') fragment, or truncated antibody (e.g., Fc truncated antibody).
  • the antibody can be produced in a cell or mammal or it can be genetically engineered in a mammal, phage display or from a recombinant or natural antibody library.
  • the antibody can be administered in vivo or ex vivo.
  • the antibody can lack the ability to activate Fey receptors as well as lack immunogenicity in humans.
  • the administration of the neutralizing antibody of the present invention and antigen binding fragment to the subject can result in at least one of the following: inhibition of properdin binding to C5, inhibition of properdin binding to C5b, inhibition of properdin binding to C9, reduction in the formation of C3b, reduction in the formation of C3bBb, reduction in the production of C3a and C5a, reduction in the formation of C5b-9 complex, reduction in the activation of neutrophils, reduction in the activation of monocytes reduction in the activation of platelets, reduction in the formation of leukocyte -platelet conjugates, reduction in TNF-alpha production, and the reduction in production of neutrophil elastase. Consequently, the antibody or fragment thereof can also inhibit the alternative pathway dependent rabbit erythrocyte lysis in human serum/plasma.
  • the humanized monoclonal anti-properdin antibodies listed in sequences SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, and SEQ ID NO: 14 can contain at least one of the CDR sequences listed above. Additionally, the humanized monoclonal anti-properdin antibodies can contain any combination of at least one of the CDR sequences of the present invention.
  • Currently accepted therapeutic antibodies comprise murine, chimeric, primatized, and humanized antibodies.
  • Antigen binding fragments usually are considered single chain, variable region of the antibody, Fab, Fab2', truncated in the Fc domain, and scFv.
  • Chimeric and humanized fragments derived from such proteins contain CDRs which are the main peptide segments for binding. Homologies in the CDRs across various antibodies that can bind the same target can range from 50-70%, 70-80%, and 80-95%, or 100% in some examples of the CDRs.
  • These antibodies can be produced by various technologies such as CDR grafting, generating human antibodies in non-human primates, generating human antibodies in mouse, knockout mouse techniques as well as other methods can be employed to produce such antibodies.
  • human antibodies or antibodies from other species can be generated through display-type technologies, including, without limitation, phage display, retroviral display, ribosomal display, and other such techniques.
  • the resulting molecules can be subjected to additional maturation, such as affinity maturation, as such techniques are well known.
  • the anti-properdin antibody or fragments thereof can be used in therapeutic methods for the prophylactic and therapeutic treatment of diseases mediated, directly or indirectly, by a component of the alternative complement pathway, and/or by a factor generated following activation of the alternative complement pathway, described herein. Additional Criteria for Antibody Therapeutics
  • an anti-properdin antibody of the present invention can exhibit one or more of the following properties: (1) inhibits properdin binding to C5 (or C5b); (2) reduces PC3bBb formation/ or C3bBb formation, (3) reduces the concentration of free properdin, (4) reduces formation of C3b, (5) reduces formation of C3a, C5a and C5b-9, (6) reduces monocytes CDllb expression, (7) reduces neutrophil CDl lb expression, (8) reduces platelet CD62 P expression, (9) reduces leukocyte-platelet conjugate formation, (10) reduces tumor necrosis factor alpha (TNF-a), and (11) reduces neutrophil elastase formation.
  • Bispecific antibodies can be generated that comprise, for example, (i) two antibodies, one with a specificity to properdin and the other to a second molecule that are conjugated together, (ii) a single antibody that has one chain specific to properdin and a second chain specific to a second molecule, or (iii) a single chain antibody that has specificity to properdin and the other molecules.
  • Such bi-specific antibodies can be generated using techniques that are well known in the art.
  • the anti-properdin antibody or fragments thereof of the present invention can be used in therapeutic methods for the prophylactic and therapeutic treatment of diseases mediated, directly or indirectly, by a component of the alternative complement pathway, and/or by a factor generated following activation of the alternative complement pathway.
  • the present invention can provide methods of inhibiting the adverse effects of Properdin-dependent complement activation.
  • Anti-properdin inhibitory agents can be administered in an amount effective to inhibit properdin dependent complement activation in a living subject.
  • representative properdin inhibitory agents can include anti-properdin antibodies that can prevent binding of properdin to C5 and C5b, and can prevent production of C3a, C5a and C5b-9 by inhibition of the C5 association with properdin.
  • the properdin inhibitory agents can be used alone as a primary therapy or in combination with other methods as complement to enhance the benefits of other treatments.
  • the inhibitory agents can be small molecules, aptamers, DNA fragments, small peptides representing CDR domains, and/or SiRNA. These inhibitory agents inhibit properdin binding to C5, C9, and C3b associated with C5.
  • Aptamers can be produced that bind properdin with high affinity and are single- stranded oligonucleotides that fold in specific well-defined, three-dimensional shapes, which allow them to interact with a folded, three-dimensional protein target. Unlike monoclonal antibodies, aptamers have not been observed to be immunogenic. Since nucleic acids are not typically recognized by the human immune system as foreign agents, aptamers do not generally trigger an antibody response. The three-dimensional structure of aptamers creates a large surface area of interaction between an aptamer and its target protein, making aptamers ideally suited for blocking protein-protein interactions.
  • aptamers interact with proteins found on the surface of and outside cells, aptamers do not have to cross the cell membrane, which can make it easier to deliver an effective quantity of aptamer to the target.
  • Aptamers are chemically stable and can be designed to resist metabolic degradation in the human body. Using standard, defined chemical modifications and conjugations, aptamers can be specifically engineered to have an optimal half-life, or the ability to maintain effective concentration. Aptamers are chemically synthesized allowing for rapid, scalable and reproducible production at lower costs.
  • the properdin inhibitory agent can comprise an anti-properdin antibody that selectively inhibits the alternative pathway by inhibiting properdin binding to C5 and C5b.
  • Such antibodies can include polyclonal, monoclonal or recombinant antibodies derived from any antibody-producing mammal and may be multispecific, chimeric, humanized, anti-idiotype, and antibody fragments.
  • Antibody fragments can include Fab, Fab', F(ab) 2 , F(ab') 2 , Fv fragments, scFv fragments and single- chain antibodies as further described herein.
  • the antibodies described in this invention are those that can inhibit properdin binding to C5, C5b and C9. Production of Anti-Properdin Antibodies
  • Production of anti properdin antibodies can be completed by utilizing intact properdin, properdin polypeptides, and/or using antigenic properdin epitope-bearing peptides, for example, a portion of the properdin polypeptide. It is possible to isolate the properdin peptides and polypeptides used to raise antibodies as natural polypeptides, recombinant or synthetic peptides, and catalytically inactive recombinant polypeptides. This embodiment of the present invention can provide anti-properdin antibodies obtained using a transgenic mouse strain. Antigens useful for producing anti properdin antibodies also include fusion polypeptides.
  • polyclonal antibodies against properdin can be prepared by immunizing an animal with properdin polypeptide or an immunogenic portion thereof to generate polyclonal antibodies.
  • Polyclonal antibodies are typically raised in animals such as dogs, goats, chickens, rats, mice, horses, cows, rabbits, guinea pigs, or sheep.
  • an anti-properdin antibody of the present invention can also be derived from a subhuman primate and/or produced by technologies sold by epitomics or by cell DNA/RNA methodologies. Sera containing immunologically active antibodies are then produced from the blood of such immunized animals using standard procedures.
  • the properdin inhibitory agent can be a highly specific anti-properdin monoclonal antibody being directed against an epitope.
  • the modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogenous population of antibodies.
  • Monoclonal antibodies can be obtained using any technique that provides for the production of antibody molecules by continuous cell lines in culture, such as a hybridoma method.
  • Human monoclonal antibodies can be obtained using transgenic mice that have been engineered to produce specific human antibodies in response to antigenic challenge.
  • the anti-properdin monoclonal antibodies useful for the methods of the present invention can bind to properdin with a binding affinity of ⁇ 100 pM, preferably ⁇ 10 pM and most preferably ⁇ 2 pM.
  • Chimeric antibodies are humanized forms of non-human for example, murine, antibodies, which contain minimal sequence derived from non-human immunoglobulin.
  • Humanized monoclonal antibodies are produced by transferring the non-human animal, for example, a mouse, CDRs from the heavy and light variable chains of the mouse
  • the humanized antibodies of the present invention can include properdin binding to a CDR3 region.
  • the Fc portions of the anti-proeprdin antibody of the present invention can be replaced to produce IgA or IgM as well as human IgG antibodies.
  • Anti-Properdin antibodies can also be made using recombinant methods.
  • human antibodies can be made using human immunoglobulin expression libraries (available for example, from Stratagene, Corp., La Jolla, Calif or Bioatla, San Diego, CA) to produce fragments of human antibodies (V H , V L , FV, Fd, Fab or F(ab') 2 ), which are then used to construct whole human antibodies using techniques similar to those for producing chimeric antibodies.
  • Properdin inhibitory agents useful in the method of the present invention can encompass intact immunoglobulin molecules as well as the relatively well known fragments including Fab, Fab', F(ab).sub.2, F(ab').sub.2 and Fv fragments, scFv fragments, diabodies, linear antibodies, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
  • Proteolytic hydrolysis such as by pepsin or papain digestion of whole antibodies by conventional methods, can obtain antibody fragments.
  • antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide F(ab') 2 . This fragment can be further cleaved using a thiol reducing agent to produce Fab' monovalent fragments.
  • the cleavage reaction can be performed using a blocking group for the sulfhydryl groups that result from cleavage of disulfide linkages.
  • an enzymatic cleavage using pepsin produces two monovalent Fab fragments and an Fc fragment directly.
  • the use of antibody fragments lacking the Fc region can be preferably used to avoid activation of the classical complement pathway, which is initiated upon binding Fc to the Fey receptor.
  • the Fc region of a monoclonal antibody can be removed chemically using partial digestion by proteolytic enzymes (such as ficin digestion), thereby generating, for example, antigen-binding antibody fragments such as Fab or F(ab) 2 .
  • the human j4 IgG isotype which does not bind Fc ⁇ receptors, can be used during the construction of a humanized antibody as described herein.
  • Antibodies, single chain antibodies and antigen-binding domains, that lack the Fc domain can also be engineered using recombinant techniques described herein.
  • a single peptide chain can be created that can bind molecules specific for properdin in which the heavy and light chain Fv regions are connected.
  • the Fv fragments can be connected by a peptide linker to form a single chain antigen binding protein (scFv).
  • compositions and methods comprising properdin inhibitory agents can comprise one or more additional therapeutic agents. These additional agents can augment the activity of the properdin inhibitory agent or that provide related therapeutic functions in an additive or synergistic fashion.
  • one or more properdin inhibitory agents can be administered in combination with one or more anti-inflammatory and/or analgesic agents.
  • Antibodies in accordance with the present invention can be prepared in an animal, for example a mouse, using standard methods well known in the art.
  • the monoclonal antibody of the present invention can be converted into a humanized version for therapeutic use.
  • Fully human antibodies can also be generated by methods well known in art.
  • the antibody can be made into a humanized, fully human, humaneered, chimeric, recombinant either by contract or in house for therapeutic applications.
  • Cell lines of particular preference are selected through determining which cell lines have high expression levels and produce antibodies with constitutive properdin binding properties.
  • the antibodies of the present invention can also be generated using properdin knockout rodents, for example, mice, to generate effective blocking antibodies. Since these rodents do not contain the properdin gene, the rodents would see the injection of properdin as an immunogenic antigen, rather than a normal protein present in the system. Based on this recognition of the injected properdin as an antigen, the rodent will generate antibodies against it.
  • properdin knockout rodents allows for increased probability for the generation of an antibody that is anti-rat, anti-mouse and anti-any other species, depending on the rodent being used.
  • Antibodies can be expressed as tetramers containing two light and two heavy chains, as separate heavy chains, light chains, as Fab, Fab', F(ab')2, and Fv, or as single chain antibodies in which heavy and light chain variable domains are linked through a spacer.
  • non-IgG antibodies can be useful.
  • IgM and IgA antibodies can be used.
  • Chimeric, humanized and human antibodies are typically produced by recombinant expression.
  • antibody coding sequences can be incorporated in transgenes for introduction into the genome of a transgenic animal and subsequent expression in the transgenic animal with methods well known in the art.
  • the recombinant antibody can be of the murine class IgGi, IgG 2a , IgG 2b , IgM, IgA, IgD or IgE, the human classes IgGi, IgG 2 , IgG 3 , IgG 4 , IgM, IgA], IgA 2 , IgD or IgE, or combinations or fragments thereof.
  • the chimeric antibody library is composed of primarily IgG antibodies or Fab antibody fragments.
  • the methods of the present invention can generally involve the steps of:
  • a subject antibody for methods of reducing the level of a polypeptide generated following activation of the alternative complement pathway; reducing the level of C5b-9 or membrane attack complex (MAC); reducing the level of an
  • an "effective amount” or “therapeutically effective amount” of a subject antibody is an amount that is effective to reduce the production and/or level of a polypeptide generated following activation of the alternative complement pathway by at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or more.
  • the anti-properdin antibody can be administered to an individual in a formulation with a pharmaceutically acceptable excipient(s).
  • a subject antibody can be administered to the host using any convenient means capable of resulting in the desired therapeutic effect.
  • the antibody can be incorporated into a variety of formulations for therapeutic administration.
  • a subject antibody can be formulated into pharmaceutical compositions by combination with appropriate, pharmaceutically acceptable carriers or diluents, and can be formulated into preparations in solid, semi-solid, liquid or gaseous forms, such as tablets, capsules, powders, granules, ointments, solutions, suppositories, injections, inhalants and aerosols.
  • administration of a subject antibody can be achieved in various administrations, including oral, buccal, rectal, parenteral, intraperitoneal, intradermal, subcutaneous, intramuscular, transdermal, intranasal, pulmonary, intratracheal, etc administrations.
  • the agents can be administered in the form of their pharmaceutically acceptable salts, or they can also be administered independently or in appropriate association, as well as in combination, with other pharmaceutically active compounds.
  • the following methods and excipients are merely exemplary and are in no way limiting.
  • Unit dosage forms for injection or intravenous administration can comprise the inhibitor(s) in a composition as a solution in sterile water, normal saline or another pharmaceutically acceptable carrier.
  • An antibody of the present invention can be administered to an individual with a certain frequency and for a period of time so as to achieve the desired therapeutic effect.
  • an antibody of the present invention can be administered, for example, once per month, twice per month, three times per month, every other week (qow), once per week (qw), twice per week (biw), three times per week (tiw), four times per week, five times per week, six times per week, every other day (qod), daily (qd), twice a day (qid), or three times a day (tid), or substantially continuously, or continuously, over a period of time ranging from about one day to about one week, from about two weeks to about four weeks, from about one month to about two months, from about two months to about four months, from about four months to about six months, or longer.
  • the anti-properdin antibody can, in some embodiments, be administered in an effective amount in combination therapy with a second therapeutic agent.
  • the antibodies of the present invention can be used to inhibit complement activation via the alternative pathway in vivo in subjects, including humans, suffering from an acute or chronic pathological injury.
  • the present invention can be used in conjunction with the following diseases, disorders, injuries, and treatments, including but not limited to:
  • Extracorporeal circulation diseases and disorders Post-cardiopulmonary bypass inflammation, post-operative pulmonary dysfunction, cardiopulmonary bypass, hemodialysis, leukopheresis, plasmapheresis, plateletpheresis, heparin-induced extracorporeal LDL precipitation (HELP), postperfusion syndrome, extracorporeal membrane oxygenation (ECMO), cardiopulmonary bypass (CPB), post-perfusion syndrome, systemic inflammatory response, and multiple organ failure.
  • HELP heparin-induced extracorporeal LDL precipitation
  • ECMO extracorporeal membrane oxygenation
  • CPB cardiopulmonary bypass
  • post-perfusion syndrome systemic inflammatory response, and multiple organ failure.
  • Cardiovascular diseases and disorders acute coronary syndromes, Kawaski disease (arteritis), Takayasu's arteritis, Henoch-Schonlein purpura nephritis, vascular leakage syndrome, percutaneous coronary intervention (PCI), myocardial infarction, ischemia- reperfusion injury following acute myocardial infarction, atherosclerosis, vasculitis, immune complex vasculitis, vasculitis associated with rheumatoid arthritis (also called malignant rheumatoid arthritis), systemic lupus erythematosus-associated vasculitis, sepsis, arteritis, aneurysm, cardiomyopathy, dilated cardiomyopathy, cardiac surgery, peripheral vascular conditions, renovascular conditions, cardiovascular conditions, cerebrovascular conditions, mesenteric/enteric vascular conditions, diabetic angiopathy, venous gas embolus (VGE), Wegener's granulomatosis,
  • PCI per
  • Bone/Musculoskeletal diseases and disorders arthritis, inflammatory arthritis, non-inflammatory arthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, systemic juvenile rheumatoid arthritis, osteoarthritis, osteoporosis, systemic lupus erythematosus (SLE), Behcet's syndrome, and Sjogren's syndrome.
  • Transplantation diseases and disorders transplant rejection, xenograft rejection, graft versus host disease, xenotransplantation of organs or grafts, allotransplantation of organs or grafts, and hyperacute rejection.
  • ATD choroidal neurovascularization
  • CNV choroidal neurovascularization
  • retinal damage diabetic retinopathy, diabetic retinal microangiopathy, histoplasmosis of the eye, uveitis, diabetic macular edema, diabetic retinopathy, diabetic retinal microangiopathy, pathological myopia, central retinal vein occlusion (CRVO), corneal neovascularization, retinal neovascularization, retinal pigment epithelium (RPE), histoplasmosis of the eye, and Purtscher's retinopathy.
  • AMD choroidal neurovascularization
  • CNV choroidal neurovascularization
  • retinal damage diabetic retinopathy, diabetic retinal microangiopathy, histoplasmosis of the eye, uveitis, diabetic macular edema, diabetic retinopathy, diabetic retinal microangiopathy, pathological myopia, central retinal vein occlusion (CRVO), corneal neovascularization
  • Hemolytic/Blood diseases and disorders sepsis, systemic inflammatory response syndrome" (SIRS), hemorrhagic shock, acute respiratory distress syndrome (ARDS), catastrophic anti-phospholipid syndrome (CAPS), cold agglutinin disease (CAD), autoimmune thrombotic thrombocytopenic purpura (TTP), endo toxemia, hemolytic uremic syndrome (HUS), atypical hemolytic uremic syndrome (aHUS), paroxysmal nocturnal hemoglobinuria (PNH), sepsis, septic shock, sickle cell anemia, hemolytic anemia, hypereosinophilic syndrome, and anti-phospholipid syndrome (APLS).
  • SIRS systemic inflammatory response syndrome
  • ARDS acute respiratory distress syndrome
  • CAPS catastrophic anti-phospholipid syndrome
  • TTP cold agglutinin disease
  • TTP cold agglutinin disease
  • HUS hemolytic uremic syndrome
  • aHUS atypical hemolytic uremic syndrome
  • granulomatosis transfusion-related acute lung injury (TRALI), antiglomerular basement membrane disease (Goodpasture's disease), eosinophilic pneumonia, hypersensitivity pneumonia, allergic bronchitis bronchiecstasis, reactive airway disease syndrome, respiratory syncytial virus (RSV) infection, parainfluenza virus infection, rhinovirus infection, adenovirus infection, allergic bronchopulmonary aspergillosis (ABPA), tuberculosis, parasitic lung disease, adult respiratory distress syndrome, chronic obstructive pulmonary disease (COPD), sarcoidosis, emphysema, bronchitis, cystic fibrosis, interstitial lung disease, acute respiratory distress syndrome (ARDS), transfusion-related acute lung injury, ischemia/reperfusion acute lung injury, byssinosis, heparin-induced extracorporeal membrane oxygenation, anaphylactic shock, and asbestos-induced inflammation.
  • TRALI transfusion-related acute lung injury
  • TRALI trans
  • Trauma-induced injuries and disorders hemorrhagic shock, hypovolemic shock, spinal cord injury, neuronal injury, cerebral trauma, cerebral ischemia reperfusion, crush injury, wound healing, severe burns, and frostbite.
  • Renal diseases and disorders renal reperfusion injury, poststreptococcal glomerulonephritis (PSGN), Goodpasture's disease, membranous nephritis, Berger's
  • Reproduction and urogenital diseases and disorders painful bladder diseases and disorders, sensory bladder diseases and disorders, spontaneous abortion, male and female diseases from infertility, diseases from pregnancy, fetomaternal tolerance, pre-eclampsia, urogenital inflammatory diseases, diseases and disorders from placental dysfunction, diseases and disorders from miscarriage, chronic abacterial cystitis, and interstitial cystitis.
  • Skin/Dermatologic diseases and disorders burn injuries, psoriasis, atopic dermatitis (AD), eosinophilic spongiosis, urticaria, thermal injuries, pemphigoid, epidermolysis bullosa acquisita, autoimmune bullous dermatoses, bullous pemphigoid, scleroderma, angioedema, hereditary angioneurotic edema (HAE), erythema multiforme, herpes gestationis, Sjogren's syndrome, dermatomyositis, and dermatitis herpetiformis.
  • Gastrointestinal diseases and disorders Crohn's disease, Celiac Disease/ gluten- sensitive enteropathy, Whipple's disease, intestinal ischemia, inflammatory bowel disease, and ulcerative colitis.
  • Endocrine diseases and disorders Hashimoto's thyroiditis, juvenile lymphocytic thyroiditis, stress anxiety, and other diseases affecting prolactin, growth or insulin-like growth factor, adrenocorticotropin release, pancreatitis, Addison's disease, diabetic conditions including, but not limited to, type 1 and type 2 diabetes, type I diabetes mellitus, sarcoidosis, diabetic retinal microangiopathy, non-obese diabetes (IDDM), angiopathy, neuropathy or retinopathy complications of IDDM or Type-2 diabetes, and insulin resistance.
  • IDDM non-obese diabetes
  • Anti-properdin antibodies that was generated at NovelMed Thrapeutics and the corresponding cell lines have been stored at the ATCC.
  • F(ab)2 and Fab were generated using appropriate enzymatic methods and verified for purity using gel electrophoresis.
  • Properdin binds to complement proteins C3b, C5/C5b, and C9
  • Properdin is known to bind C3b with high affinity.
  • properdin binds C5/C5b and C9 with high affinity and a minimal or no binding of properdin to C6, C7, and C8.
  • Both C3 and C5 exist as intact proteins, however, when substrate-bound, they are converted into C3b and C5b, respectively.
  • No published reports thus far have demonstrtaed the binding of properdin to C5 and or C5b.
  • Polystyrene microtiter plates were coated with human C3, C5, C6, C7, C8, and C9 at 2.0 ⁇ g/50 ⁇ per well in phosphate buffered saline (PBS) overnight at 4°C. After aspirating the protein solution, the wells were blocked with PBS containing 1% bovine serum albumin (BSA) for 2 hours at room temperature. Wells without complement protein coating served as background controls. Aliquots of the properdin at varying concentration in blocking solution were added and plates were allowed to incubate for 1 hour.
  • PBS phosphate buffered saline
  • Properdin bound to the C3b, C5/C5b, C6, C7, C8, and C9 was measured by adding detection antibody goat anti-human properdin polyclonal antibody at 1:2000 dilutions in blocking solution. The plate was allowed to incubate for 1 hour at room temperature. After washing the plates with PBS, a peroxidase-conjugated rabbit anti-goat antibody (1:2000 dilution in blocking solution) was added and allowed to incubate for 1 hour. The plate was again rinsed thoroughly with PBS, and 100 ⁇ of 3,3',5,5'-tetramethyl benzidine (TMB) substrate was added.
  • TMB 3,3',5,5'-tetramethyl benzidine
  • This erythrocyte lysis assay is based on the formation of a terminal complement complex on the surface of the rRBC. As a result, the rRBCs are lysed. The progressive decrease in light scatter at 700 nm is a direct measure of erythrocyte lysis.
  • rRBC(s) are incubated in normal human serum in gelatin veronal buffer containing 5mM MgCl 2 - Under these conditions, the surface of rRBC triggers the activation of the alternative pathway in normal human serum. The alternative pathway activation leads to the formation of C5b-9 complex on the surface of the rRBC(s). Agents that inhibit the formation of C5b-9 complexes are expected to inhibit cellular lysis.
  • IgG and F(ab) 2 inhibit AP dependent hemolysis of rRBC in normal human serum with an IC 50 of 10 nM inhibiting erythrocyte lysis.
  • the antibodies are able to inhibit lysis with an IC 50 of approximately 10 nM.
  • Anti-properdin monoclonal antibodies do not inhibit classical pathway activation
  • Monoclonal antibodies of the present invention do not inhibit the classical pathway, which is required for proper function of host defense.
  • Antibody sensitized sheep erythrocytes were incubated with 1% or 10% normal human serum in gelatin veronal buffer containing calcium (5 mM CaCl 2 /MgCl 2 ) buffer.
  • Antibody sensitized sheep cells activate the classical pathway.
  • C5b-9 is formed on the surface of the erythrocyte and causes cell lysis.
  • NM9401 inhibited erythrocyte lysis.
  • erythrocytes are incubated in 1 /10 normal human serum in CP buffer to allow complement activation to occur.
  • the affinity of anti-properdin IgG and F(ab)2 to human properdin is in the range of low pM range.
  • the antibody and its fragments bind properdin with similar affinities.
  • Polystyrene microtiter plates were coated with human (2.0 ⁇ g/50 ⁇ per well) properdin in phosphate buffered saline (PBS) overnight at 4°C. After aspirating the properdin solution, the wells were blocked with PBS containing 1% bovine serum albumin (BSA) (Sigma-Aldrich, St. Louis, Mo.) for 1 hour at room temperature. Wells without peptide or properdin coating served as background controls. Aliquots of monoclonal anti-properdin antibody IgG, Fab2, and Fab in blocking solution were added to the properdin coated wells and allowed to incubate for 1 hour to allow for binding to occur. Following the 1 hour incubation at room temperature, the plate was rinsed with PBS five times and incubated with 1:2000 diluted detection peroxidase-conjugated goat anti-mouse monoclonal antibody.
  • BSA bovine serum albumin
  • Anti-properdin Fab2 inhibits properdin interaction with C5/C5b and C9
  • Properdin bound to C5/C5b and C9 was measured by adding detection antibody goat anti -human properdin polyclonal antibody at 1 :2000 dilutions in blocking solution. The plate was allowed to incubate for 1 hour at room temperature. After washing the plates with PBS, a peroxidase-conjugated rabbit anti-goat antibody (1 :2000 dilution in blocking solution) was added and allowed to incubate for 1 hour. The plate was again rinsed thoroughly with PBS, and 100 ⁇ of 3,3',5,5'-tetramethyl benzidine (TMB) substrate was added.
  • TMB 3,3',5,5'-tetramethyl benzidine
  • Anti properdin IgG and fragments thereof inhibit the formation of C3 convertase (PC3bBb) of alternative complement pathway as measured by the deposition of properdin, C3b, Bb, C9, C9, and C5b-9.
  • polystyrene microtiter plate wells were coated with LPS (Lipopolysaccharide from Salmonella Typhosa) at 2 ⁇ g/50 ⁇ in PBS overnight.
  • LPS Lipopolysaccharide from Salmonella Typhosa
  • the wells were incubated with 1% BSA in PBS to block the unoccupied sites in the wells.
  • normal human serum (10%) in AP buffer was mixed with varying concentrations of the antibody and fragments thereof. The mixture was incubated onto LPS coated wells. The plate was incubated for 2 hours 37°C to allow complement AP activation to occur.
  • Fig. 12 demonstrates a dose dependent deposition of C5b-9 deposition by anti-properdin antibodies.
  • the immunoglobulin specific mRNAs contained in cell line 14G11 were analyzed by RT-PCR and DNA sequencing. The results demonstrate that the cell line transcribed an IgGl Kappa antibody. In addition to the major transcripts, two variant non- translated kappa transcripts (pseudogenes) were obtained.
  • RT-PCR - cDNA was created from the RNA by reverse-transcription with an oligo(dT) primer. PCR reactions were set up to isolate and amplify both the variable and constant heavy and light regions of the cell line and utilized oligo-dT primers for the constant heavy regions and full-length light chains and specific primers for the variable heavy and variable light regions.
  • the cDNA reactions were tailed with TdT in order to permit an oligo dT specific primer to be used to generate fully- extended (at the 5' end) clones.
  • the purified inserts were cloned into pBluescript and the clones were picked from each reaction. Miniprep DNA was isolated, restriction mapped and the positive clones were analyzed through sequencing. The resulting sequencing data can be seen below.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Neurosurgery (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

A method of inhibiting the alternative complement pathway activation in a subject mammal includes administering an amount of an antibody and/or fragment thereof that specifically binds to properdin and inhibit properdin binding to a complement protein, for example, C5, to inhibit the alternative complement pathway in the subject mammal.

Description

A METHOD FOR INHIBITING ALTERNATIVE PATHWAY MEDIATED DISORDERS WITH ANTI-PROPERDIN ANTIBODIES THAT INHIBIT C5
INTERACTIONS WITH PROPERDIN
RELATED APPLICATION
[0001] This application claims priority from U.S. Provisional Application No.
61/309,705, filed March 2, 2010, the subject matter, which is incorporated herein by reference in its entirety.
FIELD OF THE INVENTION
[0002] The present invention relates to anti-properdin antibody agents that inhibit properdin binding to a complement protein, for example, C5 or C5b, and the use of such antibodies to selectively inhibit alternative complement pathway function in mammals in prophylactic and therapeutic settings to prevent, halt or reverse the disease process.
BACKGROUND OF THE INVENTION
[0003] The complement system is important for host defense against pathogens and is involved in clearance of, for example, pathogens, bacterial cells, foreign antigens, and tumor cells. The alternative complement pathway (AP) is activated as a result of both pathological inflammation and autoimmune diseases. Elevated levels of C3a, C5a, and C5b-9 have been found to be associated with several acute and chronic diseases. Therefore, inhibition of disease-induced AP activation is important for clinical benefit in the diseases where complement activation plays a role in disease pathology.
[0004] The complement system is activated via three distinct complement pathways; the classical, the lectin and the alternative pathways. The classical pathway is activated via antigen-antibody complexes and is required for host defense. The lectin pathway is a variation of the classical pathway. The alternative pathway is activated by foreign material, artificial surfaces, dead tissues, bacteria, and dead yeast cells. Therapeutic strategies that selectively inhibit activation of the alternative pathway without affecting the classical pathway are of disease relevance to treating diseases and disorders acsccoiated with AP activation. Under pathological conditions, activation of the alternative pathway generates anaphylatoxins, including C3a, C5a and the tissue damaging C5b-9 molecule also known as MAC. These molecules mediate inflammation and tissue damage via cellular activation, release of inflammatory mediators, and deposition of C5b-9. Cellular leukocyte chemotaxis and activation of macrophages, neutrophils, platelets, mast cells and endothelial cells provide evidence for the inflammatory response. Additionally, vascular permeability, cytolysis, and tissue injury processes also occur during inflammation. Activated cells release inflammatory mediators such as TNF-a, IL-Ιβ, IL-6, IL-8, VEGF, neutrophil elastase, and peroxide.
[0005] It is known that properdin is required for the initiation of the alternative complement pathway, since its binding to C3b constitutes the necessary first step in AP activation. Properdin binds C3b with high affinity. Properdin-bound C3b subsequently binds with factor B to form the PC3bB complex, which is then cleaved by factor D to form the PC3bBb complex, where Ba is released. As additional molecules of C3b and Bb are produced, their assembly into the PC3bBb complex forms C5 convertase, which cleaves C5 into C5a and C5b. The so-formed C5 represents an anchor protein that forms the C5b-9 complex upon association with C6, C7, C8, and C9. Properdin concentration in blood is nearly 5 μg/mL, and, thus, it is the only non-protease molecule present at a much lower concentration than Factor D.
[0006] Properdin is an alternative pathway specific molecule, whose presence and function are required for the propagation of the alternative pathway. Thus, inhibition of AP activation without inhibiting the classical complement pathway appears to be an important therapeutic strategy to inhibit the disease-induced activation of the AP. Hence, blocking, inhibiting or preventing AP activation via depleting properdin, neutralizing properdin or inactivating properdin remains potentially important therapeutic strategies.
[0007] No anti-properdin antibodies that bind to C5 or C5b have previously been discovered. The antibodies of the present invention can inhibit properdin binding to C5 or C5b, and thus prevent the formation of C3a, C3b, C5a, C5b, and C5b-9. Similarly, anti-C5 antibodies can be generated that would inhibit properdin interaction to C5/C5b and prevent the formation of C3a, C3b, C5a, C5b, and C5b-9.
[0008] Since the binding affinity of properdin to C5 is weaker than the binding affinity of the antibodies of the present invention to properdin, the antibodies of the present invention can inhibit the binding of C5 molecules to properdin and can provide a therapeutic benefit by preventing AP activation in a setting where the binding of properdin to C5 is preexisting. Treatment with anti-properdin antibodies that specifically prevent the binding of properdin to C5 can provide significant therapeutic benefit in pathological conditions where alternative complement pathway is activated. SUMMARY OF THE INVENTION
[0009] Antibodies that can inhibit the binding of properdin to C3b have been developed, and those that de -polymerize polymeric properdin have been discussed. These antibodies can inhibit the formation of C3a, C5a, and C5b-9.
[0010] The present invention relates to a method of inhibiting alternative complement pathway activation in a mammal. The method includes the step of administering to the mammal a therapeutically effective amount of an anti-properdin agent that specifically binds to properdin and prevents properdin binding to at least one complement protein, for example C5, C5b, or C9.
[0011 ] The present invention also relates antibodies that inhibit properdin binding to, for example, C5 or C5b and, as a result, the formation of C3a, C3b, C5a, C5b, and C5b-9.
[0012] In one aspect of the invention, the anti-properdin agent can bind to at least one complement protein, including, but not limited to, C5/C5b, C6, C7, C8, or C9.
[0013] In another aspect of the invention, the anti-properdin agent can be selected from the following group including, but not limited to: synthetic small molecules, aptamers of DNA, DNA fragments, SiRNA, monoclonal and polyclonal antibodies, and derivatives of the monoclonal and or polyclonal antibodies that block the binding of properdin to at least one of C5/C5b, C6, C7, C8, or C9, or any portion of the peptide similar to that found in at least one of C5/C5b, C6, C7, C8, or C9.
[0014] In a further aspect of the invention, the anti-properdin agent can be an anti- properdin antibody that is registered as PTA-9641 (14G11).
[0015] Anti properdin monoclonal antibody 14G11 of the present invention binds the N terminal domain of SEQ ID NO: 15 AFAYQKRSGGLCQPCRSPRWSLWS. Such antibodies inhibit properdin binding to C5b and prevent AP activation.
[0016] In another aspect of the invention, the anti-properdin agent can be administered in vivo or ex vivo to a mammal, including a human.
[0017] In yet another aspect of the invention, the anti-properdin antibody can be a monoclonal, polyclonal, chimeric, recombinant, humanized, de-immunized, Humaneered™ or a fully human antibody. [0018] In one aspect of the invention, the anti-properdin antibody can also be an antibody fragment, such as a single chain antibody, IgG, F(ab')2, F(ab), F(ab') fragment, or truncated antibody, for example, an Fc truncated antibody.
[0019] In another aspect of the invention, the ratio of binding of the anti-properdin agent to properdin can be about 0.2:1 to about 1.5:1.
[0020] In a further aspect of the invention, the prevention of properdin binding to at least one complement protein can allow for the inhibition of the alternative complement pathway in the mammal without affecting classical pathway activation.
[0021 ] In yet another aspect of the invention, the anti-properdin agent reduces the level of free properdin in a mammal.
[0022] In one aspect of the invention, the anti-properdin agent specifically binds properdin to prevent the binding of properdin to C5. The antibody can bind to an epitope on the properdin monomer at its C5 binding site and prevents the formation of Olimers of Properdin and C3b shown in Figure 2.
[0023] In another aspect of the invention, the anti-properdin agent specifically binds properdin to prevent the binding properdin to C6, C7, C8, or C9.
[0024] In a further aspect of the invention, an anti-properdin antibody generated in a mouse can be prepared with a characteristic CDR(s) region that binds and inhibits properdin binding to C5 and C9.
[0025] In yet another aspect of the invention, the anti-properdin antibody can inhibit the formation of the C5b-9 complex, also known as MAC.
[0026] In one aspect of the invention, the invention provides a method to ameliorate a disease or condition associated with excessive or uncontrolled alternative pathway complement activation by administering a therapeutically effective amount of an anti- properdin agent that specifically binds to properdin to inhibit the binding of properdin to C5.
[0027] In another aspect of the invention, the antibody can be produced in a cell or mammal or it can be genetically engineered in a mammal, phage display or from a recombinant or natural antibody library.
[0028] In a further aspect of the invention, administration of the anti-properdin antibody of and antigen binding fragment to a subject can result in at least one of the following: inhibition of properdin binding to C5, inhibition of properdin binding to C5b, inhibition of properdin binding to C9, reduction in the formation of C3bBb, reduction in the production of C3a and C5a, reduction in the formation of C5b-9 complex, reduction in the activation of neutrophils, reduction in the activation of monocytes reduction in the activation of platelets, reduction in the formation of leukocyte-platelet conjugates, reduction in TNF- alpha production, and the reduction in production of neutrophil elastase. Consequently, the antibody or fragment thereof can also inhibit the alternative pathway dependent rabbit erythrocyte lysis in human serum/plasma.
[0029] In one aspect of the invention, the invention relates to a method of inhibiting alternative complement pathway activation in a mammalian host that includes the administration of a therapeutically effective amount of an anti-properdin monoclonal antibody that specifically binds to an epitope on properdin, where the epitope is involved in C5, C5b or C9 binding.
[0030] In another aspect, the invention relates to a method of inhibiting alternative complement pathway activation without inhibiting the classical pathway activation in a mammal by administering in a mammal a therapeutically effective amount of an antibody that specifically binds to an epitope of properdin, which blocks the alternative pathway activation via the inhibition of properdin and C5 interaction without affecting the classical pathway activation.
[0031 ] In a further aspect, the present invention relates to a method of inhibiting alternative complement pathway activation without inhibiting the classical pathway activation in a mammal. The method includes the step of administering to a mammal a therapeutically effective amount of an antibody that specifically binds to properdin and inhibits deposition of C5b-9, which blocks the alternative pathway activation via the inhibition of properdin and C5 interaction without affecting the classical pathway activation.
[0032] In another aspect, the present invention relates to a method of inhibiting alternative complement pathway activation, including the step of administering to a mammal a therapeutically effective amount of an antibody blocks the formation of the PC3b complex, the PC3bB complex, and the PC3bBb complex via the inhibition of properdin and C5 interaction without affecting the classical pathway activation.
[0033] In yet another aspect, the present invention can provide a method of inhibiting activation of the alternative complement pathway in an individual who is at risk of developing a disease or a condition in which activation of the alternative complement pathway contributes to the disease pathology, exacerbates the disease, or causes the disease, via the administration of any specific antibodies of the present invention or antigen-binding fragments thereof disclosed herein to an individual in need.
[0034] In a further aspect, the present invention can relate to a method of treating alternative pathway activation mediated by disease-related or pathological conditions including the step of administering to a mammal a therapeutically effective amount of an antibody or fragment thereof that specifically binds to properdin and blocks the initiation of C9 assembly and prevents the formation of C5b-9 complex formation at the site of pathology.
[0035] In another aspect of the invention, the present invention provides an anti- properdin agent in a pharmaceutically acceptable carrier which is selected from the group comprising: a dry, dispersible powder; anhydrous ethanol; small capsules; liposomes; a nebulized spray; and an injectable excipient.
[0036] In a further aspect of the invention, the anti-properdin antibody can specifically bind to an epitope on the properdin monomer at its C5 binding site and can prevent the formation of polymers of Properdin and C3b.
[0037] In one aspect of the invention, the present invention relates to a method of making a rat or mouse anti-properdin monoclonal antibodies in a properdin-knockout mice or other rodent. The method includes the step of administering to a mouse or other rodent an effective amount of properdin or fragment thereof to the properdin knockout an effective amount of the properdin or fragment thereof that causes the knockout rodent to produce antibodies against properdin. The mouse or other rodent can include human immunoglobulin genes. The fragment includes a peptide having a C5 binding domain.
[0038] In another aspect of the invention, the present invention also relates to an isolated antibody or antigen binding portion thereof that binds to human properdin and blocks C5 or C5b binding to properdin. The antibody or antigen binding portion thereof comprises of a heavy chain variable domain that includes the amino acid sequences of the three CDRs (SEQID NO: 1) and a light chain variable domain that includes the amino acid sequences of the three CDRs (SEQ ID NO: 2).
[0039] In a further aspect of the invention, the anti-properdin antibody or antigen binding fragment thereof can comprise the heavy chain variable regions and the light chain variable regions of an antibody produced by the hybridoma cell line deposited under ATCC Accession Number PTA-9641. [0040] In one aspect of the invention, the present invention further relates to an isolated antibody or antigen binding portion thereof that binds to human properdin. The antibody or antigen binding fragment thereof comprises of a heavy chain variable domain containing the amino acid sequences of the three CDRs in SEQ ID NO: 1.
[0041 ] In another aspect of the invention, the present invention further relates to an isolated antibody or antigen binding portion thereof that binds to human properdin. The antibody or antigen binding fragment thereof comprises of a light chain variable domain comprising the amino acid sequences of the three CDRs in SEQ ID NO: 2.
[0042] In yet another aspect of the invention, the anti-properdin antibody or antigen binding fragment thereof can also inhibit alternative pathway dependent rabbit erythrocyte lysis in human serum/plasma.
[0043] In one aspect of the invention, the present invention relates to a method of inhibiting alternative pathway complement activation in a mammal by the administration of a therapeutically effective amount of an anti-properdin antibody or antigen binding portion thereof to the mammal that specifically binds to properdin to inhibit alternative pathway complement activation, at a molar ratio of antibody to properdin monomer of about 0.2:1.
[0044] In another aspect of the invention, the antibody of the present invention can be administered in vivo or ex vivo.
[0045] In a further aspect of the invention, the antibody or antigen binding portion thereof can specifically bind to an epitope on properdin and, consequently, inhibit the alternative complement pathway in the mammal.
[0046] In another aspect, the present invention can provide a method of treating a disease or disorder in which the AP activation plays a role. The treatment comprises of the step of administering an anti properdin antibody or antigen-binding fragment thereof derived from murine monoclonal antibody (ATCC PTA-9641) to a mammal that selectively binds to properdin at the binding site of C5or C5b and inhibits formation of the C3bBb complex, the PC3bBb complex, the PC5 complex, the PC9 complex, and the PC3b complex. The anti- properdin antibody or antigen-binding fragment thereof can have an equilibrium dissociation constant between about 1 nM to about 1 pM. The antibodies of the present invention can be administered to a mammal that has, or is at risk of developing a disease or disorder in which AP activation plays a role. In certain embodiments, the disease or disorder is selected from the group of multiple diseases, described herein, where alternative pathway plays a pathological role in the disease.
BRIEF DESCRIPTION OF THE DRAWINGS
[0047] FIG. 1 illustrates the schematics of the hypothetical role of properdin in the assembly and formation of C5b-9.
[0048] FIG. 2 shows the formation of PC5bC3bBb convertase where if properdin can exist as a trimer.
[0049] FIG. 3 shows the binding affinity of properdin to C3b, C5/C5b, and C9
[0050] FIG. 4 shows the anti-properdin agent of the present invention can inhibit the hemolysis of rRBC.
[0051 ] FIG. 5 shows that both anti properdin IgG and F(ab')2 bind properdin with high affinity.
[0052] FIG. 6 shows the inhibition of properdin binding to C5b and C9 by the anti- properdin antibody.
[0053] FIG. 7 shows the inhibition of AP-dependent formation of newly formed C3b in normal human serum.
[0054] FIG. 8 shows the inhibition of AP-dependent formation of PC3b complex in normal human serum.
[0055] FIG. 9 shows the inhibition of AP-dependent Bb formation in normal human serum.
[0056] FIG. 10 shows the inhibition of AP-dependent C5 formation in normal human serum.
[0057] FIG. 11 shows the inhibition of AP-dependent C9 formation in normal human serum.
[0058] FIG. 12 shows inhibition of AP-dependent C5b-9 formation in normal human serum.
[0059] FIG. 13 shows SEQ ID NOs: 1-6.
[0060] FIG. 14 shows SEQ ID NOs: 7-8.
[0061] FIG. 15 shows SEQ ID NOs: 9-10.
[0062] FIG. 16 shows SEQ ID NOs: 11-12.
[0063] FIG. 17 shows SEQ ID NOs: 13-14. [0064] FIG. 18 shows SEQ ID NO: 15.
DETAILED DESCRIPTION
[0065] As used here, the term "antibody" or "antibody fragments thereof" refer to an intact antibody, or a binding fragment thereof that competes with the intact antibody for specific binding sites. The binding fragments include Fab, Fab', F(ab')2, Fv, and single-chain antibodies.
[0066] As used herein, the term "anti-properdin agent" refers to small molecules, DNA fragments, SiRNA, aptamers of DNA, monoclonal and polyclonal antibodies, and derivatives of the monoclonal and or polyclonal antibodies that block the binding of properdin to C5 or any portion of the peptide similar to that found in C5.
[0067] As used herein, the term "complementary determining region (CDR)" refers to regions on the antibody where a specific antibody can bind to.
[0068] As used herein, the term "conservative sequence modifications" refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Conservative modifications can include amino acid substitutions, additions and deletions.
[0069] As used herein, the term "epitope" refers to a group of three dimensional structures on the antigen where the monoclonal antibody and fragments thereof would bind.
[0070] As used herein, the term "monoclonal" refers to an antibody that binds to a sequence of amino acids and has a single specific epitope on its target antigen.
[0071 ] Properdin is known to bind C3b with high affinity. It was discovered that the properdin binding to C5 and C5b is important for properdin functions and that monoclonal antibodies, which specifically inhibit properdin binding to C5 or C5b, inhibit properdin function via the inhibition of C5b-9 formation and inhibition of C3b formation. One embodiment of the present invention relates to anti-properdin antibodies that can bind to properdin and inhibit properdin binding to C5 or C5b.
[0072] Properdin binds to C9 with high affinity, which suggests a role for properdin in MAC assembly. The antibodies of the present invention can inhibit: a) AP activation and b) AP induced formation of C5b-9. The prevention of properdin binding to C5/C9 can allow for the inhibition of the alternative complement pathway in the mammal without affecting classical pathway activation. The ratio of binding of the antibody to properdin can be about 0.2:1 to about 1.5:1. The anti-properdin agent can prevent and/or reverse the binding of properdin to C5 and C9.
[0073] One embodiment of the present invention therefore relates to anti-properdin antibodies that can bind to properdin and inhibit properdin binding to C5 or C5b required for its function. By inhibiting the binding of properdin to C5/C5b, the anti-properdin antibody can inhibit the formation of the C5b-9 complex, also known as MAC.
[0074] Properdin can also exist as a polymer, for example, a dimer, a trimer, or atetramer. Properdin binds to C3b, and antibodies that inhibit properdin binding to C3b have been developed. The present invention can include antibodies that can inhibit properdin binding to C5b and C9. C5 provides an anchor to the formation of C5b-9 complexes and C9 is responsible for the formation of part of the C5b-9 complex. The antibodies of the present invention can inhibit MAC assembly and provides a mechanism by which MAC is formed at the site of C3 convertase formation.
[0075] In one example, properdin can exist as a trimer. A trimer with three properdin molecule can include two sites that can be occupied by C5b. One site would be occupied by C3b as per the formula: (P)x(C5b)y(C3b)z(Bb)w in which χ= γ+ζ, z = w.- PC3bBb is a pure C3 convertase. P(C5b)C3bBb is also a convertase with C5b bound to it. This molecule can cleave C3 and C5, generating moles of C5b. As the pathway proceeds to making MAC, properdin- bound C3b could be replaced with C5b. Properdin bound C5b participates in the formation of C5b-9. Properdin also binds C9 with high affinity, which could further stabilize the formation of functional polymeric C9 molecule.
[0076] Another embodiment of the present invention relates to antibodies that specifically bind to properdin, for example an anti-properdin antibody, and the use of such antibodies to inhibit alternative complement pathway activation via the inhibition of properdin binding to C5 or C5b. The anti-properdin antibodies of the present invention are directed to or specifically bind to domains on properdin that are involved in controlling properdin function. The anti-properdin antibodies or fragments thereof of the present invention can inhibit AP activation without inhibiting or effecting the classical complement pathway by several methods including, but not limited to selectively inhibiting the binding of properdin to C5 or C5b, reducing the formation of membrane attack complex C5b-9, reducing the formation of anaphylatoxins, for example C3a and/or C5a, reducing the formation of C3b, reducing the activation of neutrophils, monocytes and platelets, and/or reducing leukocyte aggregate formation.
[0077] The amino acid sequences of mammalian properdin are known. For example, the amino acid sequence of human properdin is disclosed in the GenBank database under Accession No. AAA36489. Human properdin is a 469 amino acid protein that includes a signal peptide (amino acids 1-28), and six, non-identical thrombo spondin type 1 repeats (TSR) of about 60 amino acids each, as follows: amino acids 80-134 (TSR1), amino acids 139-191 (TSR2), amino acids 196-255 (TSR3), amino acids 260-313 (TSR4), amino acids 318-377 (TSR5), and amino acids 382-462 (TSR6).
[0078] Anti-properdin antibodies can be selected based on their ability to inhibit properdin binding to C5 and then selected based on AP dependent hemolysis of rRBC (rabbit erythrocytes). These antibodies can bind to properdin in about a 0.2:1 stoichiometric ratio. Inhibition of alternative pathway (AP) complement activation can cause reduced levels of C3a, C5a, and C5b-9, inhibit the activation of monocytes, inhibit the formation of monocyte - platelets, and inhibit neutrophil-platelet aggregates.
[0079] In another embodiment of the invention, the anti-properdin antibody can inhibit the binding of properdin to C5. In a further embodiment of the invention, the anti-properdin antibody can inhibit the binding of properdin to C5b. In yet another embodiment of the invention, the anti-properdin antibody can inhibit the binding of properdin to C9. In these embodiments, the anti-properdin antibody can affect the binding in about a 0.2: 1 molar ratio of antibody to properdin, an about 1:1 molar ratio of antibody to properdin, an about 1.5:1 ratio of antibody to properdin and with a maximum of about 10:1 antibody to properdin.
[0080] In a further embodiment of the invention, the anti-properdin antibody can bind properdin with high affinity, can inhibit C5 binding, can inhibit C3a, C5a, and C5b-9 formation, can inhibit neutrophil, monocyte and platelet activation, can inhibit leukocyte platelet conjugate formation, and can prevent alternative complement pathway activation.
[0081 ] In yet another embodiment of the invention, the antibodies of the present invention can have no effect on classical pathway activation. Thus, the monoclonal antibodies of the present invention may not inhibit the classical pathway. Moclonal antibodies of the present invention can bind to a region on properdin that is only involved in AP activation via its binding to the C5 or C5b complement proteins. [0082] In another embodiment of the invention, the antibodies of the present invention can comprise heavy chains and light chains of CDR1, CDR2 and CDR3 of mAb, or combinations thereof. The amino acid sequences of the variable heavy chain are shown in SEQ ID NO: 1 (CDR1), SEQ ID NO: 2 (CDR2), and SEQ ID NO: 3 (CDR3). The variable light chain CDRs are shown SEQ ID NO: 4 (CDR1), SEQ ID NO: 5 (CDR2), and SEQ ID NO: 6 (CDR3). Accordingly, in another embodiment, the present invention can provide an isolated monoclonal antibody, or antigen binding portion thereof comprising the CDR regions that can bind to human properdin.
[0083] Accordingly, in yet another embodiment of the invention, the present invention can provide an isolated monoclonal antibody, or antigen binding portion thereof comprising: (a) a heavy chain variable region comprising of CDR1, CDR2, and CDR3 which include the amino acid sequences of SEQ ID NOs: 1, 2, and 3, respectively; and (b) a light chain variable region comprising CDR1, CDR2, and CDR3 which include the amino acid sequences of SEQ ID NOs: 4, 5, and 6, respectively; wherein the antibody specifically binds human properdin.
[0084] In another embodiment, an antibody of the present invention can comprise heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences of the preferred antibodies described herein, and wherein the antibodies retain the desired functional properties of the anti-properdin antibodies of the invention. For example, the invention can provide an isolated monoclonal antibody, or antigen binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein: (a) the heavy chain variable region comprises an amino acid sequence that is at least 80% homologous to the amino acid sequence of SEQ ID NO: 1; (b) the light chain variable region comprises an amino acid sequence that is at least 80% homologous to the amino acid sequence of SEQ ID NO: 9; and (c) the antibody specifically binds to human properdin.
[0085] In various embodiments of the present invention, the anti-properdin antibody can be, for example, a chimeric antibody, humanized antibody, human antibody, a humanized antibody or a chimeric antibody.
[0086] In yet other embodiments of the present invention, the V# and/or VL amino acid sequences of the antibodies of the present invention may be 85%, 90%, 95%, 96%, 97%, 98% or 99% homologous to the sequences set forth herein. An antibody having V# and VL regions having high homology, for example, 80% or greater, to the V# and VL regions of the sequences set forth above, can be obtained by mutagenesis.
[0087] In other embodiments, an antibody of the present invention can include a heavy chain variable region comprising heavy chain CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising of the light chain CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the preferred antibodies described herein, for example, NM4540, or conservative modifications thereof, and wherein the antibodies retain the desired functional properties of the anti-properdin antibodies of the invention
[0088] In another embodiment of the invention, one example of an anti-properdin monoclonal antibody can be labeled as 14G11. The anti-properdin antibody 14G11 can bind properdin and can inhibit: properdin binding to C5 and C9, C3a, C5a, and C5b-9 formation, AP C3 convertase formation, and cellular activation. Properdin binds to C5 and can guide the formation of C5b-9 complex at the site of pathology. The anti-properdin agents of the present invention can bind to properdin and inhibit the binding of properdin to C5 or C5b and, thus, can prevent AP activation.
[0089] The anti-properdin monoclonal antibody 14G11 of the present invention can bind to the N- terminal domain of SEQ ID NO: 15. Such antibodies can inhibit the binding of properdin to C5b and thus can prevent AP activation.
[0090] The antibody of the present invention can be a monoclonal, polyclonal, chimeric, recombinant, humanized, de-immunized, Humaneered™ or fully human antibody. The antibody can also be an antibody fragment, such as a single chain antibody, IgG, F(ab')2, F(ab), F(ab') fragment, or truncated antibody (e.g., Fc truncated antibody). The antibody can be produced in a cell or mammal or it can be genetically engineered in a mammal, phage display or from a recombinant or natural antibody library. The antibody can be administered in vivo or ex vivo. The antibody can lack the ability to activate Fey receptors as well as lack immunogenicity in humans.
[0091 ] The administration of the neutralizing antibody of the present invention and antigen binding fragment to the subject can result in at least one of the following: inhibition of properdin binding to C5, inhibition of properdin binding to C5b, inhibition of properdin binding to C9, reduction in the formation of C3b, reduction in the formation of C3bBb, reduction in the production of C3a and C5a, reduction in the formation of C5b-9 complex, reduction in the activation of neutrophils, reduction in the activation of monocytes reduction in the activation of platelets, reduction in the formation of leukocyte -platelet conjugates, reduction in TNF-alpha production, and the reduction in production of neutrophil elastase. Consequently, the antibody or fragment thereof can also inhibit the alternative pathway dependent rabbit erythrocyte lysis in human serum/plasma.
[0092] The humanized monoclonal anti-properdin antibodies listed in sequences SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, and SEQ ID NO: 14 can contain at least one of the CDR sequences listed above. Additionally, the humanized monoclonal anti-properdin antibodies can contain any combination of at least one of the CDR sequences of the present invention.
Therapeutic Antibodies
[0093] Currently accepted therapeutic antibodies comprise murine, chimeric, primatized, and humanized antibodies. Antigen binding fragments usually are considered single chain, variable region of the antibody, Fab, Fab2', truncated in the Fc domain, and scFv. Chimeric and humanized fragments derived from such proteins contain CDRs which are the main peptide segments for binding. Homologies in the CDRs across various antibodies that can bind the same target can range from 50-70%, 70-80%, and 80-95%, or 100% in some examples of the CDRs. These antibodies can be produced by various technologies such as CDR grafting, generating human antibodies in non-human primates, generating human antibodies in mouse, knockout mouse techniques as well as other methods can be employed to produce such antibodies.
[0094] Furthermore, human antibodies or antibodies from other species can be generated through display-type technologies, including, without limitation, phage display, retroviral display, ribosomal display, and other such techniques. The resulting molecules can be subjected to additional maturation, such as affinity maturation, as such techniques are well known.
[0095] The anti-properdin antibody or fragments thereof can be used in therapeutic methods for the prophylactic and therapeutic treatment of diseases mediated, directly or indirectly, by a component of the alternative complement pathway, and/or by a factor generated following activation of the alternative complement pathway, described herein. Additional Criteria for Antibody Therapeutics
[0096] The functional activity of the present invention can be measured by the ability of the monoclonal antibody to inhibit the alternative complement pathway. For example, an anti-properdin antibody of the present invention can exhibit one or more of the following properties: (1) inhibits properdin binding to C5 (or C5b); (2) reduces PC3bBb formation/ or C3bBb formation, (3) reduces the concentration of free properdin, (4) reduces formation of C3b, (5) reduces formation of C3a, C5a and C5b-9, (6) reduces monocytes CDllb expression, (7) reduces neutrophil CDl lb expression, (8) reduces platelet CD62 P expression, (9) reduces leukocyte-platelet conjugate formation, (10) reduces tumor necrosis factor alpha (TNF-a), and (11) reduces neutrophil elastase formation.
[0097] Bispecific antibodies, immunotoxins, radiolabeled therapeutics, generation of peptide therapeutics, gene therapies, particularly intrabodies, antisense therapeutics, and small molecules can be covered under this invention. Bispecific antibodies can be generated that comprise, for example, (i) two antibodies, one with a specificity to properdin and the other to a second molecule that are conjugated together, (ii) a single antibody that has one chain specific to properdin and a second chain specific to a second molecule, or (iii) a single chain antibody that has specificity to properdin and the other molecules. Such bi-specific antibodies can be generated using techniques that are well known in the art.
[0098] The anti-properdin antibody or fragments thereof of the present invention can be used in therapeutic methods for the prophylactic and therapeutic treatment of diseases mediated, directly or indirectly, by a component of the alternative complement pathway, and/or by a factor generated following activation of the alternative complement pathway.
Anti-Properdin A2ents
[0099] In another embodiment, the present invention can provide methods of inhibiting the adverse effects of Properdin-dependent complement activation. Anti-properdin inhibitory agents can be administered in an amount effective to inhibit properdin dependent complement activation in a living subject. In the practice of this aspect of the invention, representative properdin inhibitory agents can include anti-properdin antibodies that can prevent binding of properdin to C5 and C5b, and can prevent production of C3a, C5a and C5b-9 by inhibition of the C5 association with properdin. The properdin inhibitory agents can be used alone as a primary therapy or in combination with other methods as complement to enhance the benefits of other treatments.
[00100] The inhibitory agents can be small molecules, aptamers, DNA fragments, small peptides representing CDR domains, and/or SiRNA. These inhibitory agents inhibit properdin binding to C5, C9, and C3b associated with C5.
Aptamers
[00101 ] Aptamers can be produced that bind properdin with high affinity and are single- stranded oligonucleotides that fold in specific well-defined, three-dimensional shapes, which allow them to interact with a folded, three-dimensional protein target. Unlike monoclonal antibodies, aptamers have not been observed to be immunogenic. Since nucleic acids are not typically recognized by the human immune system as foreign agents, aptamers do not generally trigger an antibody response. The three-dimensional structure of aptamers creates a large surface area of interaction between an aptamer and its target protein, making aptamers ideally suited for blocking protein-protein interactions. Furthermore, since aptamers interact with proteins found on the surface of and outside cells, aptamers do not have to cross the cell membrane, which can make it easier to deliver an effective quantity of aptamer to the target. Aptamers are chemically stable and can be designed to resist metabolic degradation in the human body. Using standard, defined chemical modifications and conjugations, aptamers can be specifically engineered to have an optimal half-life, or the ability to maintain effective concentration. Aptamers are chemically synthesized allowing for rapid, scalable and reproducible production at lower costs.
Anti-Properdin Antibodies
[00102] In some embodiments of the present invention, the properdin inhibitory agent can comprise an anti-properdin antibody that selectively inhibits the alternative pathway by inhibiting properdin binding to C5 and C5b. Such antibodies can include polyclonal, monoclonal or recombinant antibodies derived from any antibody-producing mammal and may be multispecific, chimeric, humanized, anti-idiotype, and antibody fragments. Antibody fragments can include Fab, Fab', F(ab)2, F(ab')2, Fv fragments, scFv fragments and single- chain antibodies as further described herein. The antibodies described in this invention are those that can inhibit properdin binding to C5, C5b and C9. Production of Anti-Properdin Antibodies
[00103] Production of anti properdin antibodies can be completed by utilizing intact properdin, properdin polypeptides, and/or using antigenic properdin epitope-bearing peptides, for example, a portion of the properdin polypeptide. It is possible to isolate the properdin peptides and polypeptides used to raise antibodies as natural polypeptides, recombinant or synthetic peptides, and catalytically inactive recombinant polypeptides. This embodiment of the present invention can provide anti-properdin antibodies obtained using a transgenic mouse strain. Antigens useful for producing anti properdin antibodies also include fusion polypeptides.
Polyclonal Antibodies
[00104] Using well-known methods, polyclonal antibodies against properdin can be prepared by immunizing an animal with properdin polypeptide or an immunogenic portion thereof to generate polyclonal antibodies. Polyclonal antibodies are typically raised in animals such as dogs, goats, chickens, rats, mice, horses, cows, rabbits, guinea pigs, or sheep. Alternatively, an anti-properdin antibody of the present invention can also be derived from a subhuman primate and/or produced by technologies sold by epitomics or by cell DNA/RNA methodologies. Sera containing immunologically active antibodies are then produced from the blood of such immunized animals using standard procedures.
Monoclonal Antibodies
[00105] In some embodiments of the present invention, the properdin inhibitory agent can be a highly specific anti-properdin monoclonal antibody being directed against an epitope. As used herein, the modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogenous population of antibodies. Monoclonal antibodies can be obtained using any technique that provides for the production of antibody molecules by continuous cell lines in culture, such as a hybridoma method.
[00106] Human monoclonal antibodies can be obtained using transgenic mice that have been engineered to produce specific human antibodies in response to antigenic challenge.
[00107] In one embodiment of the invention, the anti-properdin monoclonal antibodies useful for the methods of the present invention can bind to properdin with a binding affinity of < 100 pM, preferably <10 pM and most preferably <2 pM. Chimeric/Humanized Antibodies
[00108] Chimeric antibodies are humanized forms of non-human for example, murine, antibodies, which contain minimal sequence derived from non-human immunoglobulin. Humanized monoclonal antibodies are produced by transferring the non-human animal, for example, a mouse, CDRs from the heavy and light variable chains of the mouse
immunoglobulin into a human variable domain. Typically, residues of human antibodies are then substituted in the framework regions of the non-human counterparts. The humanized antibodies of the present invention can include properdin binding to a CDR3 region. In addition, the Fc portions of the anti-proeprdin antibody of the present invention can be replaced to produce IgA or IgM as well as human IgG antibodies.
Recombinant Antibodies
[00109] Anti-Properdin antibodies can also be made using recombinant methods. For example, human antibodies can be made using human immunoglobulin expression libraries (available for example, from Stratagene, Corp., La Jolla, Calif or Bioatla, San Diego, CA) to produce fragments of human antibodies (VH, VL, FV, Fd, Fab or F(ab')2), which are then used to construct whole human antibodies using techniques similar to those for producing chimeric antibodies.
Immunoglobulin Fragments
[00110] The Properdin inhibitory agents useful in the method of the present invention can encompass intact immunoglobulin molecules as well as the relatively well known fragments including Fab, Fab', F(ab).sub.2, F(ab').sub.2 and Fv fragments, scFv fragments, diabodies, linear antibodies, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
[00111 ] Proteolytic hydrolysis, such as by pepsin or papain digestion of whole antibodies by conventional methods, can obtain antibody fragments. For example, antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide F(ab')2. This fragment can be further cleaved using a thiol reducing agent to produce Fab' monovalent fragments. In another example, the cleavage reaction can be performed using a blocking group for the sulfhydryl groups that result from cleavage of disulfide linkages. In yet another example, an enzymatic cleavage using pepsin produces two monovalent Fab fragments and an Fc fragment directly.
[00112] In some embodiments of the present invention, the use of antibody fragments lacking the Fc region can be preferably used to avoid activation of the classical complement pathway, which is initiated upon binding Fc to the Fey receptor. One can produce a MoAb that avoids Fc γ receptor interactions by several methods. For example, the Fc region of a monoclonal antibody can be removed chemically using partial digestion by proteolytic enzymes (such as ficin digestion), thereby generating, for example, antigen-binding antibody fragments such as Fab or F(ab)2. In another example, the human j4 IgG isotype, which does not bind Fc γ receptors, can be used during the construction of a humanized antibody as described herein. Antibodies, single chain antibodies and antigen-binding domains, that lack the Fc domain can also be engineered using recombinant techniques described herein.
[00113] In addition, a single peptide chain can be created that can bind molecules specific for properdin in which the heavy and light chain Fv regions are connected. The Fv fragments can be connected by a peptide linker to form a single chain antigen binding protein (scFv).
Additional A2ents
[00114] The compositions and methods comprising properdin inhibitory agents can comprise one or more additional therapeutic agents. These additional agents can augment the activity of the properdin inhibitory agent or that provide related therapeutic functions in an additive or synergistic fashion. For example, one or more properdin inhibitory agents can be administered in combination with one or more anti-inflammatory and/or analgesic agents.
Preparation of Antibodies
[00115] Antibodies in accordance with the present invention can be prepared in an animal, for example a mouse, using standard methods well known in the art. The monoclonal antibody of the present invention can be converted into a humanized version for therapeutic use. Fully human antibodies can also be generated by methods well known in art. The antibody can be made into a humanized, fully human, humaneered, chimeric, recombinant either by contract or in house for therapeutic applications. Cell lines of particular preference are selected through determining which cell lines have high expression levels and produce antibodies with constitutive properdin binding properties.
[00116] The antibodies of the present invention can also be generated using properdin knockout rodents, for example, mice, to generate effective blocking antibodies. Since these rodents do not contain the properdin gene, the rodents would see the injection of properdin as an immunogenic antigen, rather than a normal protein present in the system. Based on this recognition of the injected properdin as an antigen, the rodent will generate antibodies against it. The benefit of using a knockout rodent allows for increased probability for the generation of an antibody that is anti-rat, anti-mouse and anti-any other species, depending on the rodent being used.
[00117] Antibodies can be expressed as tetramers containing two light and two heavy chains, as separate heavy chains, light chains, as Fab, Fab', F(ab')2, and Fv, or as single chain antibodies in which heavy and light chain variable domains are linked through a spacer.
[00118] For some applications, non-IgG antibodies can be useful. For example, where multivalent antibody complexes are desired, IgM and IgA antibodies can be used. Chimeric, humanized and human antibodies are typically produced by recombinant expression.
[00119] Alternatively, antibody coding sequences can be incorporated in transgenes for introduction into the genome of a transgenic animal and subsequent expression in the transgenic animal with methods well known in the art.
[00120] The recombinant antibody can be of the murine class IgGi, IgG2a, IgG2b, IgM, IgA, IgD or IgE, the human classes IgGi, IgG2, IgG3, IgG4, IgM, IgA], IgA2, IgD or IgE, or combinations or fragments thereof. In one example, the chimeric antibody library is composed of primarily IgG antibodies or Fab antibody fragments.
Treatment Methods
[00121 ] The methods of the present invention can generally involve the steps of:
administering to a mammalian subject in need thereof of an effective amount or
therapeutically effective amount of a subject antibody for methods of reducing the level of a polypeptide generated following activation of the alternative complement pathway; reducing the level of C5b-9 or membrane attack complex (MAC); reducing the level of an
anaphylatoxin; methods of reducing the level of newly formed C3b, P, Bb, and C5b-9; and treating a disease or disorder mediated by the alternative complement pathway. [00122] An "effective amount" or "therapeutically effective amount" of a subject antibody is an amount that is effective to reduce the production and/or level of a polypeptide generated following activation of the alternative complement pathway by at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or more.
[00123] The anti-properdin antibody can be administered to an individual in a formulation with a pharmaceutically acceptable excipient(s). A wide variety of
pharmaceutically acceptable excipients is known in the art and need not be discussed in detail herein.
[00124] In the methods provided by the present invention, a subject antibody can be administered to the host using any convenient means capable of resulting in the desired therapeutic effect. Thus, the antibody can be incorporated into a variety of formulations for therapeutic administration. In one example, a subject antibody can be formulated into pharmaceutical compositions by combination with appropriate, pharmaceutically acceptable carriers or diluents, and can be formulated into preparations in solid, semi-solid, liquid or gaseous forms, such as tablets, capsules, powders, granules, ointments, solutions, suppositories, injections, inhalants and aerosols.
[00125] As such, administration of a subject antibody can be achieved in various administrations, including oral, buccal, rectal, parenteral, intraperitoneal, intradermal, subcutaneous, intramuscular, transdermal, intranasal, pulmonary, intratracheal, etc administrations.
[00126] In pharmaceutical dosage forms, the agents can be administered in the form of their pharmaceutically acceptable salts, or they can also be administered independently or in appropriate association, as well as in combination, with other pharmaceutically active compounds. The following methods and excipients are merely exemplary and are in no way limiting.
[00127] Unit dosage forms for injection or intravenous administration can comprise the inhibitor(s) in a composition as a solution in sterile water, normal saline or another pharmaceutically acceptable carrier.
[00128] An antibody of the present invention can be administered to an individual with a certain frequency and for a period of time so as to achieve the desired therapeutic effect. For example, an antibody of the present invention can be administered, for example, once per month, twice per month, three times per month, every other week (qow), once per week (qw), twice per week (biw), three times per week (tiw), four times per week, five times per week, six times per week, every other day (qod), daily (qd), twice a day (qid), or three times a day (tid), or substantially continuously, or continuously, over a period of time ranging from about one day to about one week, from about two weeks to about four weeks, from about one month to about two months, from about two months to about four months, from about four months to about six months, or longer.
Combination Therapy
[00129] The anti-properdin antibody can, in some embodiments, be administered in an effective amount in combination therapy with a second therapeutic agent.
Disease Conditions
[00130] In another aspect of the invention, the antibodies of the present invention can be used to inhibit complement activation via the alternative pathway in vivo in subjects, including humans, suffering from an acute or chronic pathological injury. The present invention can be used in conjunction with the following diseases, disorders, injuries, and treatments, including but not limited to:
[00131 ] Extracorporeal circulation diseases and disorders: Post-cardiopulmonary bypass inflammation, post-operative pulmonary dysfunction, cardiopulmonary bypass, hemodialysis, leukopheresis, plasmapheresis, plateletpheresis, heparin-induced extracorporeal LDL precipitation (HELP), postperfusion syndrome, extracorporeal membrane oxygenation (ECMO), cardiopulmonary bypass (CPB), post-perfusion syndrome, systemic inflammatory response, and multiple organ failure.
[00132] Cardiovascular diseases and disorders: acute coronary syndromes, Kawaski disease (arteritis), Takayasu's arteritis, Henoch-Schonlein purpura nephritis, vascular leakage syndrome, percutaneous coronary intervention (PCI), myocardial infarction, ischemia- reperfusion injury following acute myocardial infarction, atherosclerosis, vasculitis, immune complex vasculitis, vasculitis associated with rheumatoid arthritis (also called malignant rheumatoid arthritis), systemic lupus erythematosus-associated vasculitis, sepsis, arteritis, aneurysm, cardiomyopathy, dilated cardiomyopathy, cardiac surgery, peripheral vascular conditions, renovascular conditions, cardiovascular conditions, cerebrovascular conditions, mesenteric/enteric vascular conditions, diabetic angiopathy, venous gas embolus (VGE), Wegener's granulomatosis, heparin-induced extracorporeal membrane oxygenation, and Behcet's syndrome.
[00133] Bone/Musculoskeletal diseases and disorders: arthritis, inflammatory arthritis, non-inflammatory arthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, systemic juvenile rheumatoid arthritis, osteoarthritis, osteoporosis, systemic lupus erythematosus (SLE), Behcet's syndrome, and Sjogren's syndrome.
[00134] Transplantation diseases and disorders: transplant rejection, xenograft rejection, graft versus host disease, xenotransplantation of organs or grafts, allotransplantation of organs or grafts, and hyperacute rejection.
[00135] Eye/Ocular diseases and disorders: wet and dry age-related macular
degeneration (AMD), choroidal neurovascularization (CNV), retinal damage, diabetic retinopathy, diabetic retinal microangiopathy, histoplasmosis of the eye, uveitis, diabetic macular edema, diabetic retinopathy, diabetic retinal microangiopathy, pathological myopia, central retinal vein occlusion (CRVO), corneal neovascularization, retinal neovascularization, retinal pigment epithelium (RPE), histoplasmosis of the eye, and Purtscher's retinopathy.
[00136] Hemolytic/Blood diseases and disorders: sepsis, systemic inflammatory response syndrome" (SIRS), hemorrhagic shock, acute respiratory distress syndrome (ARDS), catastrophic anti-phospholipid syndrome (CAPS), cold agglutinin disease (CAD), autoimmune thrombotic thrombocytopenic purpura (TTP), endo toxemia, hemolytic uremic syndrome (HUS), atypical hemolytic uremic syndrome (aHUS), paroxysmal nocturnal hemoglobinuria (PNH), sepsis, septic shock, sickle cell anemia, hemolytic anemia, hypereosinophilic syndrome, and anti-phospholipid syndrome (APLS).
[00137] Respiratory/Pulmonary diseases and disorders: asthma, Wegener's
granulomatosis, transfusion-related acute lung injury (TRALI), antiglomerular basement membrane disease (Goodpasture's disease), eosinophilic pneumonia, hypersensitivity pneumonia, allergic bronchitis bronchiecstasis, reactive airway disease syndrome, respiratory syncytial virus (RSV) infection, parainfluenza virus infection, rhinovirus infection, adenovirus infection, allergic bronchopulmonary aspergillosis (ABPA), tuberculosis, parasitic lung disease, adult respiratory distress syndrome, chronic obstructive pulmonary disease (COPD), sarcoidosis, emphysema, bronchitis, cystic fibrosis, interstitial lung disease, acute respiratory distress syndrome (ARDS), transfusion-related acute lung injury, ischemia/reperfusion acute lung injury, byssinosis, heparin-induced extracorporeal membrane oxygenation, anaphylactic shock, and asbestos-induced inflammation.
[00138] Central and Peripheral Nervous System/Neurological diseases and disorders: multiple sclerosis (MS), myasthenia gravis (MG), myasthenia gravis, multiple sclerosis, Guillain Barre syndrome, Miller- Fisher syndrome, stroke, reperfusion following stroke, Alzheimer's disease, multifocal motor neuropathy (MMN), demyelination, Huntington's disease, amyotrophic lateral sclerosis (ALS), Parkinson's disease, degenerative disc disease (DDD), meningitis, cranial nerve damage from meningitis, variant Creutzfeldt- Jakob Disease (vCJD), idiopathic polyneuropathy, brain/cerebral trauma (including, but not limited to, hemorrhage, inflammation, and edema), and neuropathic pain.
[00139] Trauma-induced injuries and disorders: hemorrhagic shock, hypovolemic shock, spinal cord injury, neuronal injury, cerebral trauma, cerebral ischemia reperfusion, crush injury, wound healing, severe burns, and frostbite.
[00140] Renal diseases and disorders: renal reperfusion injury, poststreptococcal glomerulonephritis (PSGN), Goodpasture's disease, membranous nephritis, Berger's
Disease/IgA nephropathy, mesangioproliferative glomerulonephritis, membranous glomerulonephritis, membranoproliferative glomerulonephritis (mesangiocapillary glomerulonephritis), acute postinfectious glomerulonephritis, cryoglobulinemic
glomerulonephritis, lupus nephritis, Henoch-Schonlein purpura nephritis, and renal cortical necrosis (RCN).
[00141 ] Reperfusion injuries and disorders of organs: including but not limited to heart, brain, kidney, and liver.
[00142] Reproduction and urogenital diseases and disorders: painful bladder diseases and disorders, sensory bladder diseases and disorders, spontaneous abortion, male and female diseases from infertility, diseases from pregnancy, fetomaternal tolerance, pre-eclampsia, urogenital inflammatory diseases, diseases and disorders from placental dysfunction, diseases and disorders from miscarriage, chronic abacterial cystitis, and interstitial cystitis.
[00143] Skin/Dermatologic diseases and disorders: burn injuries, psoriasis, atopic dermatitis (AD), eosinophilic spongiosis, urticaria, thermal injuries, pemphigoid, epidermolysis bullosa acquisita, autoimmune bullous dermatoses, bullous pemphigoid, scleroderma, angioedema, hereditary angioneurotic edema (HAE), erythema multiforme, herpes gestationis, Sjogren's syndrome, dermatomyositis, and dermatitis herpetiformis. [00144] Gastrointestinal diseases and disorders: Crohn's disease, Celiac Disease/ gluten- sensitive enteropathy, Whipple's disease, intestinal ischemia, inflammatory bowel disease, and ulcerative colitis.
[00145] Endocrine diseases and disorders: Hashimoto's thyroiditis, juvenile lymphocytic thyroiditis, stress anxiety, and other diseases affecting prolactin, growth or insulin-like growth factor, adrenocorticotropin release, pancreatitis, Addison's disease, diabetic conditions including, but not limited to, type 1 and type 2 diabetes, type I diabetes mellitus, sarcoidosis, diabetic retinal microangiopathy, non-obese diabetes (IDDM), angiopathy, neuropathy or retinopathy complications of IDDM or Type-2 diabetes, and insulin resistance.
[00146] Treatment of Malignancies: diseases and disorders arising from
chemotherapeutics and radiation therapy.
Incorporation by Reference
[00147] All references cited herein, including patents, patent applications, papers, textbooks, and the like, and the references cited therein, to the extent that they are not already, are hereby incorporated herein by reference in their entirety. In addition, the following references are also incorporated by reference herein in their entirety, including the references cited in such references:
[00148] The foregoing description and Examples detail certain preferred embodiments of the invention and describe the best modes of usage as contemplated by the inventors. It will be appreciated, however, that no matter how detailed the foregoing may appear in text, the invention may be practiced in many ways and the invention should be construed in accordance with the appended claims and any equivalents thereof.
EXAMPLES
[00149] Unless stated otherwise all reagents were of highest grade available. All complement proteins, alternative and classical pathway buffers, detection antibodies, and erythrocytes were from Complement Technologies (Tyler, TX) or Quidel Corporation (San Diego, CA). Flow cytometry antibodies were from BD Biosciences, San Jose, CA.TMB substrate was from Kirkegaard & Perry Limited, Gaithersberg, MD. All secondary antibodies were from American Qualex, San Clemente, CA, BSA and other reagents were all from Sigma- Aldrich, St Louise, MO. [00150] ELISA plate readers (SpectraMax 190 and 250) were from Molecular Devices, and Flow Cytometer was FACS Calibur. Varity 3D program was used for data analyses, Curve fittings were done using MicroCal Origin program. Hemolysis kinetic assay was run using SectraMax, Molecular Devices., ELISA plates were from Corning Costar, Lowell, MA.
[00151 ] Anti-properdin antibodies that was generated at NovelMed Thrapeutics and the corresponding cell lines have been stored at the ATCC. F(ab)2 and Fab were generated using appropriate enzymatic methods and verified for purity using gel electrophoresis.
Example 1
Properdin binds to complement proteins C3b, C5/C5b, and C9
[00152] Properdin is known to bind C3b with high affinity. We demonstrate that properdin binds C5/C5b and C9 with high affinity and a minimal or no binding of properdin to C6, C7, and C8. Both C3 and C5 exist as intact proteins, however, when substrate-bound, they are converted into C3b and C5b, respectively. No published reports thus far have demonstrtaed the binding of properdin to C5 and or C5b. By inhibiting the binding of properdin to C5/C5b, we demonstrate that activation of the alternative pathway is blocked. Polystyrene microtiter plates were coated with human C3, C5, C6, C7, C8, and C9 at 2.0 μg/50 μΐ per well in phosphate buffered saline (PBS) overnight at 4°C. After aspirating the protein solution, the wells were blocked with PBS containing 1% bovine serum albumin (BSA) for 2 hours at room temperature. Wells without complement protein coating served as background controls. Aliquots of the properdin at varying concentration in blocking solution were added and plates were allowed to incubate for 1 hour. Properdin bound to the C3b, C5/C5b, C6, C7, C8, and C9 was measured by adding detection antibody goat anti-human properdin polyclonal antibody at 1:2000 dilutions in blocking solution. The plate was allowed to incubate for 1 hour at room temperature. After washing the plates with PBS, a peroxidase-conjugated rabbit anti-goat antibody (1:2000 dilution in blocking solution) was added and allowed to incubate for 1 hour. The plate was again rinsed thoroughly with PBS, and 100 μΐ of 3,3',5,5'-tetramethyl benzidine (TMB) substrate was added. After incubation for 30 minutes at 25°C, the reaction of TMB was quenched by the addition of 100 μΐ of phosphoric acid, and the plate was read at 450 nm in a microplate reader. As shown in Fig. 3, properdin binds to substrate bound C3b, C5/C5b, and C9 with high affinity values of 2.6, 6.2, and 15.9 nM, respectively. No or minimal binding was observed with C6, C7, and C8 proteins.
Example 2
Anti -properdin IgG and F(ab')? Inhibit alternative pathway (AP) dependent rabbit red blood celUrRBC) Lysis
[00153] This erythrocyte lysis assay is based on the formation of a terminal complement complex on the surface of the rRBC. As a result, the rRBCs are lysed. The progressive decrease in light scatter at 700 nm is a direct measure of erythrocyte lysis. Typically, rRBC(s) are incubated in normal human serum in gelatin veronal buffer containing 5mM MgCl2- Under these conditions, the surface of rRBC triggers the activation of the alternative pathway in normal human serum. The alternative pathway activation leads to the formation of C5b-9 complex on the surface of the rRBC(s). Agents that inhibit the formation of C5b-9 complexes are expected to inhibit cellular lysis. To evaluate the effect of anti-properdin antibody and fragments thereof, various concentrations of IgG, F(ab')2, and Fab were incubated with normal human serum (10% NHS) in AP buffer at 37°C with a fixed concentration of rabbit erythrocytes in a temperature controlled ELISA plate reader capable of reading at 700 nm. A progressive decrease in light scatter (due to lysis of intact cells) was measured at 700 nm as a function of time. The data were recorded and analyzed with a SpectraMax 190 plate reader and SoftMax software. Total inhibition was calculated at each concentration of the IgG, F(ab')2, and fab and the results were expressed as a percent of unlysed controls. Data at each concentration was plotted in a sigmoidal plot with MicroCal Origin Software. As shown in Fig.4, IgG and F(ab)2 inhibit AP dependent hemolysis of rRBC in normal human serum with an IC50 of 10 nM inhibiting erythrocyte lysis. The antibodies are able to inhibit lysis with an IC50 of approximately 10 nM.
Anti-properdin monoclonal antibodies do not inhibit classical pathway activation
[00154] Monoclonal antibodies of the present invention do not inhibit the classical pathway, which is required for proper function of host defense. Antibody sensitized sheep erythrocytes were incubated with 1% or 10% normal human serum in gelatin veronal buffer containing calcium (5 mM CaCl2/MgCl2) buffer. Antibody sensitized sheep cells activate the classical pathway. As a result, C5b-9 is formed on the surface of the erythrocyte and causes cell lysis. We tested the antibody in 1% and 10% normal human serum. Under both conditions, NM9401 inhibited erythrocyte lysis. In a typical assay, erythrocytes are incubated in 1 /10 normal human serum in CP buffer to allow complement activation to occur. As a result of CP activation, C5b-9 is formed on the surface of erythrocytes causing cellular lysis. The progressive decrease in light scattering due to cellular lysis is measured at 700 nm as a function of time. The anti properdin IgG does not inhibit the lysis of the antibody sensitized sheep cells at 1% and 10% serum concentration. The no serum control showed no effect on cell lysis, as expected. These results suggest that anti-properdin antibodies are capable of selectively inhibiting the alternative complement pathway without affecting the classical pathway activation.
Example 3
Anti-properdin IgG and F(ab')2 Bind Human Properdin with High Affinity
[00155] The affinity of anti-properdin IgG and F(ab)2 to human properdin is in the range of low pM range. The antibody and its fragments bind properdin with similar affinities.
[00156] Polystyrene microtiter plates were coated with human (2.0 μg/50 μΐ per well) properdin in phosphate buffered saline (PBS) overnight at 4°C. After aspirating the properdin solution, the wells were blocked with PBS containing 1% bovine serum albumin (BSA) (Sigma-Aldrich, St. Louis, Mo.) for 1 hour at room temperature. Wells without peptide or properdin coating served as background controls. Aliquots of monoclonal anti-properdin antibody IgG, Fab2, and Fab in blocking solution were added to the properdin coated wells and allowed to incubate for 1 hour to allow for binding to occur. Following the 1 hour incubation at room temperature, the plate was rinsed with PBS five times and incubated with 1:2000 diluted detection peroxidase-conjugated goat anti-mouse monoclonal antibody.
Following this incubation, the plate was rinsed and the bound peroxidase was identified using TMB reagent. As shown in Fig.5, Both, IgG and F(ab)2 bind properdin with high affinity.
Example 5
Anti-properdin Fab2 inhibits properdin interaction with C5/C5b and C9
[00157] We demonstrated that properdin binds C5/C5b and C9 with high affinity. In this experiment we demonstrate that anti-properdin F(ab')2 inhibits properdin interaction with C5/C5b and C9 with an affinity of 8 to 20 nM. Polystyrene microtiter plates were coated with human C5 and C9 at 2.0 μg/50 μΐ per well in phosphate buffered saline (PBS) overnight at 4°C. After aspirating the protein solution, the wells were blocked with PBS containing 1% bovine serum albumin (BSA) for 2 hours at room temperature. Wells without complement protein coating served as background controls. Aliquots of properdin at 50 nM were incubated with various concentrations of anti -properdin F(ab')2 in blocking solution onto C5 and C9 coated plates and these plates were allowed to incubate for 1 hour at room
temperature. Properdin bound to C5/C5b and C9 was measured by adding detection antibody goat anti -human properdin polyclonal antibody at 1 :2000 dilutions in blocking solution. The plate was allowed to incubate for 1 hour at room temperature. After washing the plates with PBS, a peroxidase-conjugated rabbit anti-goat antibody (1 :2000 dilution in blocking solution) was added and allowed to incubate for 1 hour. The plate was again rinsed thoroughly with PBS, and 100 μΐ of 3,3',5,5'-tetramethyl benzidine (TMB) substrate was added. After incubation for 30 minutes at 25°C, the reaction of TMB was quenched by the addition of 100 μΐ of phosphoric acid, and the plate was read at 450 nm in a microplate reader. As shown in Fig. 6, anti-properdin Fab2 inhibits properdin interaction with C5 and C9, suggesting that properdin interaction with C5 and C9 are important for the inhibition of the alternative pathway. Complete inhibition was observed at around 20 nM of anti-properdin suggesting the ratio of 0.2: 1 for antibody to properdin.
Example 6
[00158] Anti properdin IgG and fragments thereof inhibit the formation of C3 convertase (PC3bBb) of alternative complement pathway as measured by the deposition of properdin, C3b, Bb, C9, C9, and C5b-9.
[00159] Alternative complement pathway is activated in Normal human serum by lipopolysaccharide from Salmonella Typhosa. We have utilized this paradigm to demonstrate whether anti-properdin antibody of this invention would inhibit the formation of PC3bBb. We measured the deposition of factor P, C3b, Bb, C5b, C9, and C5b-9 in the presence and absence the anti-properdin antibody and fragments thereof. The formation of C3 and C5 convertases were detected with appropriate antibodies. In the presence of anti-properdin antibodies, a dose dependent inhibition of C3 and C5 convertase formation was noticed. In a typical assay, polystyrene microtiter plate wells were coated with LPS (Lipopolysaccharide from Salmonella Typhosa) at 2 μg/50 μΐ in PBS overnight. The wells were incubated with 1% BSA in PBS to block the unoccupied sites in the wells. Following a 2-hour blocking at room temperature and rinsing with PBS, normal human serum (10%) in AP buffer was mixed with varying concentrations of the antibody and fragments thereof. The mixture was incubated onto LPS coated wells. The plate was incubated for 2 hours 37°C to allow complement AP activation to occur. Following incubation, the plates were extensively washed with PBS, and components of the C3 convertase were detected with the appropriate antibodies. We detected C3b with rabbit anti-human C3c at 1:2000 in blocking s0lution, goat anti-human P at 1:2000 in blocking solution and goat anti -human factor Bb at 1:500 in blocking solution and HRPO conjugated anti-human C5b-9 at 1:2000 in blocking solution. Plates were incubated with their respective antibodies for 1-hour at room temperature.
Following the incubation, the plates were rinsed with PBS and the bound antibodies were detected with peroxidase labeled goat anti-rabbit at 1:2000 for C3b and peroxidase labeled rabbit anti-goat at 1:2000 in blocking solution for properdin detection. All plates were developed with TMB following extensive washing with PBS. The blue color was quenched with 1 M ortho-phosphoric acid. The presence of C3b (Figure 7), factor P (Figure 8), Bb (Figure 9), C5b (Figure 10), and C9 (Figure 11) and MAC (Figure 12) together are indicative of AP C3 convertase formation. Fig. 8 demonstrates a dose dependent inhibition of factor P deposition, Fig. 9 demonstrates a dose dependent deposition of Bb, Fig. 7 demonstrates a dose dependent deposition of C3b formation, and Fig. 12 demonstrates a dose dependent deposition of C5b-9 deposition by anti-properdin antibodies. These data provide direct evidence that anti-properdin monoclonal antibodies prevented convertase formation and inhibited AP activation.
Example 7
DNA cloning and sequencing of a murine monoclonal antibody designated anti
properdinl4Gll
[00160] The immunoglobulin specific mRNAs contained in cell line 14G11 were analyzed by RT-PCR and DNA sequencing. The results demonstrate that the cell line transcribed an IgGl Kappa antibody. In addition to the major transcripts, two variant non- translated kappa transcripts (pseudogenes) were obtained. RT-PCR - cDNA was created from the RNA by reverse-transcription with an oligo(dT) primer. PCR reactions were set up to isolate and amplify both the variable and constant heavy and light regions of the cell line and utilized oligo-dT primers for the constant heavy regions and full-length light chains and specific primers for the variable heavy and variable light regions. The cDNA reactions were tailed with TdT in order to permit an oligo dT specific primer to be used to generate fully- extended (at the 5' end) clones. The purified inserts were cloned into pBluescript and the clones were picked from each reaction. Miniprep DNA was isolated, restriction mapped and the positive clones were analyzed through sequencing. The resulting sequencing data can be seen below.
Results of Sequencing of NM14G11.9
14G11.9 Heavy Chain Results - Nucleotide sequence of Heavy chain variable region NM14G11.9
[00161 ] GACAAGTGTGCAGCCATGGGCAGGCTTACTTCTTCATTCCTGCTACT
GATTGTCCCTGCATATGTCCTGTCCCAGGTTACTCTGAAAGAGTCTGGCCCTGGG
ATATTGCAGCCCTCCCAGACCCTCAGTCTGACTTGTTCTTTCTCTGGGTTTTCACT
GAGCACTTCTGGTATGGGTGTAGGCTGGATTCGTCAGCCATCAGGGAAGGGTCTG
GAGTGGCTGGCACACATTTGGTGGGATGATGTCAAGAGCTATAACCCAGCCCTG
AAGAGCCGACTGACTATCTCCAAGGATACCTCCAGTAGCCAGGTATTCCTCAGGA
TCGCCAGTGTGGACACTGCAGATACTGCCACATACTACTGTGCTCGAATTGGAGA
TGGTTATTACTCTTTTGACTATTGGGGCCAAGGCACCACTCTCACAGTCTCCTCAG
CCAAAACGACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAAC
TAACTCCATGGTGACCCTGGGATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTG
ACAGTGACCTGGAACTCT
Amino Acid Sequence of NovelMed Heavy chain variable region NM14G11.9
[00162] MGRLTS SFLLLI VP A Y VLS Q VTLKES GPGILQPSQTLS LT( \Sl\SGl 'SLSTSC i MG VGW [RQPSGKGI Λ WI -ΛΙ IIWWI )DVKS ΥΝΡΛΙ .KSRI .TISKDTSSSQVFLRIASVDT ADTATYYGARICiDCiYYSl 'DYWCiQCiTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTL GCLVKGYFPEPVTVTWN (The highlighted regions relate respectively to CDR 2, CDR3, and CDR 4).
Nucleotide sequence of NovelMed kappa chain variable region NM14G11.9
[00163] GGAAATGCATCACACCAGCATGGGCATCAAAATGGAGTCACAGATT
CAGGTCTTTGTATTCGTGTTTCTCTGGTTGTCTGGTGTTGACGGAGACATTGTGAT
GACCCAGTCTCACAAATTCATGTCCACATCAGTAGGAGACAGGGTCAGCATCTCC TGCAAGGCCAGTCAGGATGTGAGTGATGCTGTAGCCTGGTTTCAACAGAAACCG GGACAATCTCCTAAACTACTGATTTACTCGCCATCCTACCGGTACACTGGGGTCC CTGATCGCTTCACTGGCAGTGGATCTGGGACGGATTTCACTTTCACCATCAGCAG TGTGCAGGCTGAAGACCTGGCAGTTTATTACTGTCAGCAACATTATAGTACTCCG TGGACGTTCGGTGGAGGCACCAAACTGGAGATCAAACGGGCTGATGCTGCACCA ACTGTATCC
Amino acid sequence of the Kappa light chain
[00164] MHHTSMGIKMESQIQVFVFVFLWLSGVDGDIVMTQSHKFMSTSVGDRV SISCKASQDVSnAVAWl 'QQKPGQSPKLLIYSPSYRY I'GVPDRFTGSGSGTDFTFTISSV QAEDLAVYYC 'QQI IYS'I'PW'I FX iTKLEIKRADAAPTV (The highlighted regions relate respectively to CDR 1, CDR2, and CDR3).

Claims

Having described the invention, the following is claimed:
1. A method of inhibiting alternative complement pathway activation in a mammal, the method comprising the step of administering an anti-properdin agent or antigen binding fragment thereof to a mammal that specifically binds to properdin and inhibits the alternative complement pathway activation by inhibiting properdin binding to at least one complement protein.
2. The method of claim 1 , wherein the at least one complement protein is selected from the group comprising: C5/C5b, C6, C7, C8, or C9.
3. The method of claim 1, wherein the anti properdin- agent inhibits the formation of heteropolymers of P-C3bBb.
4. The method of claim 3 wherein the anti-properdin agent inhibits the formation of C3b formation, PC3b formation, PC3bB formation, PC3bBb formation, and PC5bC3bBb formation, where (P)x(C5b)y(C3b)z(Bb)w and x= Y+Zi z = w.
5. The method of claim 1, wherein the anti-properdin agent is a synthetic small molecule.
6. The method of claim 1 , wherein the anti-properdin agent is an aptamer or a DNA fragment.
7. The method of claim 1, wherein the anti-properdin agent is a siRNA.
8. The method of claim 1, wherein the anti-properdin agent is an anti-properdin antibody or an antigen-binding fragment thereof.
9. The method of claim 6, wherein the anti-properdin antibody can specifically bind to an epitope on properdin.
10. The method of claim 6, wherein the anti-properdin antibody is registered as PTA-9641 (14G11).
11. The method of claim 6, wherein the anti-properdin antibody is a chimeric, recombinant, humanized, de-immunized, humaneered or a fully human antibody.
12. The method of claim 6, wherein the anti-properdin antibody is an IgG or the antigen binding fragment Fab, Fab', Fab2, scFv, Fv, CDR1, CDR2, or CDR3.
13. The method of claim 1, wherein the anti-properdin agent is administered in a mammal in vivo or ex vivo.
14. The method of claim 10, wherein the mammal is a human.
15. The method of claim 1, wherein the ratio of anti-properdin agent or antigen- binding fragment thereof to properdin is about 0.2:1 to about 1.5: 1.
16. The method of claim 1, wherein the said anti-properdin agent inhibits the alternative pathway without inhibiting the classical pathway.
17. The method of claim 1, wherein the anti-properdin agent reduces the level of free properdin in a mammal.
18. The method of claim 1, wherein the anti-properdin agent is provided in a pharmaceutically acceptable carrier for administration to a mammal.
19. The method of claim 16, wherein the pharmaceutically acceptable carrier of the anti-properdin agent is selected from the group comprising: a dry, dispersible powder; anhydrous ethanol; small capsules; liposomes; a nebulized spray; or an injectable excipient.
20. A method of inhibiting alternative complement pathway activation in a mammal, the method comprising administering to a mammal an anti-properdin agent that specifically binds to properdin and inhibits the alternative complement pathway activation in the mammal by inhibiting the properdin binding to C5.
21. The method of claim 20, wherein the anti properdin- agent inhibits the formation of heteropolymers of P-C3bBb.
22. The method of claim 21, wherein the anti-properdin agent inhibits the formation of C3b formation, PC3b formation, PC3bB formation, PC3bBb formation, and PC5bC3bBb formation, where (P)x(C5b)y(C3b)z(Bb)w and X= Y+Z, z = w.
23. The method of claim 20, wherein the anti-properdin agent is a synthetic small molecule.
24. The method of claim 20, wherein the anti-properdin agent is an aptamer or a DNA fragment.
25. The method of claim 20, wherein the anti-properdin agent is a siRNA.
26. The method of claim 20, wherein the anti-properdin agent is an anti-properdin antibody or an antigen-binding fragment thereof.
27. The method of claim 26, wherein the anti-properdin agent can specifically bind to an epitope on properdin according to SEQ ID NO 15
(AFAYQKRSGGLCQPCRSPRWSLWS).
28. The method of claim 26, wherein the anti-properdin antibody is registered as PTA-9641 (14G11).
29. The method of claim 26, wherein the anti-properdin antibody is a chimeric, recombinant, humanized, de-immunized, humaneered or fully human antibody.
30. The method of claim 26, wherein the anti-properdin antibody is an IgG or the antigen binding fragment Fab, Fab', Fab2, scFv, Fv, CDR1, CDR2, or CDR3.
31. The method of claim 20, wherein the anti-properdin agent is administered in a mammal in vivo or ex vivo.
32. The method of claim 31, wherein the mammal is a human.
33. The method of claim 20, wherein the ratio of anti-properdin agent or antigen- binding fragment thereof to properdin is about 0.2:1 to about 1.5: 1.
34. The method of claim 20, wherein the anti-properdin agent inhibits alternative pathway without inhibiting the classical pathway.
35. The method of claim 20, wherein the anti-properdin agent reduces the level of free properdin in a mammal.
36. The method of claim 20, wherein the anti-properdin agent is provided in a pharmaceutically acceptable carrier for administration to a mammal.
37. The method of claim 36, wherein the pharmaceutically acceptable carrier of the anti-properdin agent is selected from the group comprising: a dry, dispersible powder; anhydrous ethanol; small capsules; liposomes; a nebulized spray; or an injectable excipient.
38. A method of inhibiting inflammatory response in a mammal, the method comprising administering an anti-properdin antibody or antigen binding fragment thereof, which specifically binds to properdin and inhibits the alternative complement pathway activation by inhibiting properdin binding to a complement protein selected from the group comprising: C6, C7, C8, and C9.
39. The method of claim 38, wherein the anti properdin- antibody or antigen- binding fragment thereof inhibits the formation of heteropolymers of P-C3bBb.
40. The method of claim 39, wherein the anti-properdin agent inhibits the formation of C3b formation, PC3b formation, PC3bB formation, PC3bBb formation, and PC5bC3bBb formation, where (P)x(C5b)y(C3b)z(Bb)w and X= Y+Z, z = w.
41. The method of claim 38, wherein the anti-properdin antibody can specifically bind to an epitope on properdin.
42. The method of claim 38, wherein the anti-properdin antibody is registered as PTA-9641 (14G11).
43. The method of claim 38, wherein the anti-properdin antibody is a chimeric, recombinant, humanized, de-immunized, humaneered or fully human antibody.
44. The method of claim 38, wherein the anti-properdin antibody is an IgG or the antigen binding fragment Fab, Fab', Fab2, scFv, Fv, CDR1, CDR2, or CDR3.
45. The method of claim 38, wherein the anti-properdin antibody is administered in a mammal in vivo or ex vivo.
46. The method of claim 45, wherein the mammal is a human.
47. The method of claim 38, wherein the ratio of antibody or antigen-binding fragment thereof to properdin is about 0.2: 1 to about 1.5:1.
48. The method of claim 38, wherein the antibody inhibits the alternative pathway without inhibiting the classical pathway.
49. The method of claim 38, wherein the anti-properdin agent reduces the level of free properdin in a mammal.
50. The method of claim 38, wherein the anti-properdin agent is provided in a pharmaceutically acceptable carrier for administration to a mammal.
51. The method of claim 50, wherein the pharmaceutically acceptable carrier of the anti-properdin agent is selected from the group comprising: a dry, dispersible powder; anhydrous ethanol; small capsules; liposomes; a nebulized spray; or an injectable excipient.
52. A method of ameliorating a disease or condition associated with excessive or uncontrolled alternative pathway complement activation, the method comprising the administration to a mammal of a therapeutically effective amount of an anti-properdin antibody or antigen binding portion thereof that specifically binds to properdin to inhibit properdin binding to C5 and inhibit alternative pathway activation.
53. The method of claim 52, wherein the anti properdin- agent inhibits the formation of heteropolymers of P-C3bBb.
54. The method of claim 53, wherein the anti-properdin agent inhibits the formation of C3b formation, PC3b formation, PC3bB formation, PC3bBb formation, and PC5bC3bBb formation, where (P)x(C5b)y(C3b)z(Bb)w and X= Y+Z, z = w.
55. The method of claim 52, wherein the anti-properdin antibody or antigen binding fragment thereof can specifically bind to an epitope on properdin.
56. The method of claim 52, wherein the anti-properdin antibody has been registered with the ATCC as PTA-9641.
57. The method of claim 52, wherein the anti-properdin antibody is a chimeric, recombinant, humanized, de-immunized, humaneered or fully human antibody.
58. The method of claim 52, wherein the anti-properdin antibody is an IgG or the antigen binding fragment Fab, Fab', Fab2, scFv, Fv, CDR1, CDR2, or CDR3.
59. The method of claim 52, wherein the anti-properdin antibody is administered to a mammal in vivo or ex vivo.
60. The method of claim 59, wherein the mammal is a human.
61. The method of claim 52, where in the ratio of anti-properdin antibody or antigen-binding fragment thereof to properdin is about 0.2:1 to about 1.5: 1.
62. The method of claim 52, wherein the antibody or antigen binding portion thereof specifically binds to properdin to inhibit the alternative complement pathway in the mammal.
63. The method of claim 52, wherein the anti-properdin antibody or antigen binding fragment thereof reduces the level of free properdin in a mammal.
64. The method of claim 52, wherein the anti-properdin antibody or antigen binding fragment thereof is provided in a pharmaceutically acceptable carrier for administration to a mammal.
65. The method of claim 64, wherein the pharmaceutically acceptable carrier of the anti-properdin agent is selected from the group comprising: a dry, dispersible powder; anhydrous ethanol; small capsules; liposomes; a nebulized spray; or an injectable excipient.
66. A mouse antibody comprising a heavy chain variable domain sequence of SEQ ID NO: 1.
67. A mouse antibody comprising a light chain variable domain sequence of SEQ ID NO: 2.
68. A murine antibody comprising the heavy chain variable domain sequence of comprising SEQ ID NO: 1 and the light chain variable domain sequence of SEQ ID NO: 2.
69. An antibody comprising SEQ ID NOs: 1, 2, 3, 4, 5, or 6.
70. A chimeric antibody comprising SEQ ID NO: 1 and SEQ ID NO: 2.
71. A humanized antibody comprising at least one of SEQ ID NO: 1, 2, 3, 4, 5, or
6.
72. A variable domain of a humanized antibody comprising a heavy chain variable domain amino acid sequence selected from the group comprising: SEQ ID NO: 1; SEQ ID NO: 2; and SEQ ID NO: 3.
73. A variable domain of a humanized antibody comprising a light chain variable domain amino acid sequence selected from the group comprising: SEQ ID NO: 4; SEQ ID NO: 5; and SEQ ID NO: 6.
74. A murine, chimeric or humanized anti-properdin antibody comprising the variable domain sequence of SEQ ID NO: 1, 2, 3, 4, 5, and 6 with greater than 50% homology.
75. A murine, chimeric or humanized anti-properdin antibody comprising the variable domain sequence of SEQ ID NO: 1, 2, 3, 4, 5, and 6 with greater than about 60% homology.
76. A murine, chimeric or humanized anti-properdin antibody comprising the variable domain sequence of SEQ ID NO: 1, 2, 3, 4, 5, and 6 with greater than about 70% homology.
77. A murine, chimeric or humanized anti-properdin antibody comprising the variable domain sequence of SEQ ID NO: 1, 2, 3, 4, 5, and 6 with greater than about 80% homology.
78. A murine, chimeric or humanized anti-properdin antibody comprising the variable domain sequence of SEQ ID NO: 1, 2, 3, 4, 5, and 6 with greater than about 95 % homology.
79. A polypeptide comprising the amino acid sequence or portion thereof comprising SEQ ID NOs: 1 and 2.
80. An antibody which competes with anti-properdin murine antibody clone 14G11 or humanized anti-properdin antibody.
PCT/US2011/026841 2007-03-23 2011-03-02 A method for inhibiting alternative pathway mediated disorders with anti-properdin antibodies that inhibit c5 interactions with properdin Ceased WO2011109494A2 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
CN201180022197.3A CN103068396B (en) 2010-03-02 2011-03-02 Use of an anti-properdin antibody inhibiting the interaction between C5 and properdin for the preparation of a medicament for inhibiting activation of the alternative pathway
CA2811091A CA2811091C (en) 2010-03-02 2011-03-02 A method for inhibiting alternative pathway mediated disorders with anti-properdin antibodies that inhibit c5 interactions with properdin
AU2011223660A AU2011223660B2 (en) 2010-03-02 2011-03-02 A method for inhibiting alternative pathway mediated disorders with anti-properdin antibodies that inhibit C5 interactions with properdin
EP11751270.7A EP2544694B1 (en) 2010-03-02 2011-03-02 A method for inhibiting alternative pathway mediated disorders with anti-properdin antibodies that inhibit c5 interactions with properdin
AU2011224224A AU2011224224B2 (en) 2010-03-10 2011-03-10 Humanized and chimeric anti-properdin antibodies
CN201180023582.XA CN103003302B (en) 2010-03-10 2011-03-10 Humanized and chimeric anti-properdin antibodies
EP11754104.5A EP2545075B1 (en) 2010-03-10 2011-03-10 Humanized and chimeric anti-properdin antibodies
PCT/US2011/027964 WO2011112850A2 (en) 2010-03-10 2011-03-10 Humanized and chimeric anti-properdin antibodies
US13/583,879 US8664362B2 (en) 2008-03-03 2011-03-10 Humanized and chimeric anti-properdin antibodies
CA2811221A CA2811221C (en) 2010-03-10 2011-03-10 Humanized and chimeric anti-properdin antibodies
US13/646,286 US9745367B2 (en) 2007-03-23 2012-10-05 Alternative pathway specific antibodies for treating arthritis
US14/863,301 US20160207987A1 (en) 2007-03-23 2015-09-23 Alternative pathway specific antibodies for treating arthritis

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US30970510P 2010-03-02 2010-03-02
US61/309,705 2010-03-02

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/027964 Continuation-In-Part WO2011112850A2 (en) 2007-03-23 2011-03-10 Humanized and chimeric anti-properdin antibodies

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US13/646,286 Continuation-In-Part US9745367B2 (en) 2007-03-23 2012-10-05 Alternative pathway specific antibodies for treating arthritis

Publications (2)

Publication Number Publication Date
WO2011109494A2 true WO2011109494A2 (en) 2011-09-09
WO2011109494A3 WO2011109494A3 (en) 2012-01-19

Family

ID=44542818

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/026841 Ceased WO2011109494A2 (en) 2007-03-23 2011-03-02 A method for inhibiting alternative pathway mediated disorders with anti-properdin antibodies that inhibit c5 interactions with properdin

Country Status (5)

Country Link
EP (1) EP2544694B1 (en)
CN (1) CN103068396B (en)
AU (1) AU2011223660B2 (en)
CA (1) CA2811091C (en)
WO (1) WO2011109494A2 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013093762A1 (en) * 2011-12-21 2013-06-27 Novartis Ag Compositions and methods for antibodies targeting factor p
JP2015532303A (en) * 2012-10-04 2015-11-09 ノベルメド セラピューティクス,インコーポレーテッド Complement alternative pathway specific antibodies for the treatment of hemolytic diseases
WO2021140475A1 (en) * 2020-01-08 2021-07-15 Cadila Healthcare Limited Anti-properdin antibodies and preparation thereof
WO2024108529A1 (en) * 2022-11-25 2024-05-30 Linno Pharmaceuticals Inc. Properdin binding protein and use thereof
RU2830308C1 (en) * 2020-01-08 2024-11-18 Зидус Лайфсайенсиз Лимитед Properdin antibodies and production thereof
WO2025259636A1 (en) * 2024-06-10 2025-12-18 Baylor College Of Medicine Targeting p53 mutants

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11981727B2 (en) * 2021-08-31 2024-05-14 Novelmed Therapeutics, Inc Monospecific and bispecific antibodies and antigen binding fragments thereof

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009110918A1 (en) 2008-03-03 2009-09-11 Novelmed Therapeutics, Inc. Anti-properdin antibodies

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1007092B1 (en) * 1997-08-26 2006-08-09 Amgen Fremont Inc. A process for inhibiting complement activation via the alternative pathway
MXPA03001391A (en) * 2000-08-14 2004-05-04 Akzo Nobel Nv Use of antibodies against specific mhc-peptide complexes.
US7390885B2 (en) * 2001-11-26 2008-06-24 Cell Matrix, Inc. Humanized collagen antibodies and related methods
US7365167B2 (en) * 2001-11-26 2008-04-29 Cell Matrix, Inc. Humanized collagen antibodies and related methods
EP1601377A4 (en) * 2003-02-21 2009-07-15 Genentech Inc METHODS OF TREATING AND PREVENTING TISSUE LESIONS ASSOCIATED WITH ISCHEMIC REPERFUSION INJURIES
US8911733B2 (en) * 2005-05-26 2014-12-16 Musc Foundation For Research Development Inhibition of the alternative complement pathway for treatment of traumatic brain injury, spinal cord injury and related conditions
US8192742B2 (en) * 2007-03-23 2012-06-05 NovelMed Therapeutics Method of inhibiting complement activation with human anti-factor C3 antibodies and use thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009110918A1 (en) 2008-03-03 2009-09-11 Novelmed Therapeutics, Inc. Anti-properdin antibodies

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP2544694A4

Cited By (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9988440B2 (en) 2011-12-21 2018-06-05 Novartis Ag Compositions comprising antibodies targeting factor P
CN104114576A (en) * 2011-12-21 2014-10-22 诺华股份有限公司 Compositions and methods for antibody targeting of P factor
US9051365B2 (en) 2011-12-21 2015-06-09 Novartis Ag Antibodies that bind factor P
US10865237B2 (en) 2011-12-21 2020-12-15 Novartis Ag Nucleic acids encoding anti-Factor P antibodies
WO2013093762A1 (en) * 2011-12-21 2013-06-27 Novartis Ag Compositions and methods for antibodies targeting factor p
CN104114576B (en) * 2011-12-21 2017-04-05 诺华股份有限公司 Compositions and methods for antibody targeting of P factor
CN106831985A (en) * 2011-12-21 2017-06-13 诺华股份有限公司 The composition and method of the P factors are targeted for antibody
EP3330288A1 (en) * 2011-12-21 2018-06-06 Novartis AG Compositions and methods for antibodies targeting factor p
EP2904014A4 (en) * 2012-10-04 2016-09-28 Novelmed Therapeutics Inc Alternative pathway specific antibodies for treating hemolytic diseases
US9926366B2 (en) 2012-10-04 2018-03-27 Novelmed Therapeutics, Inc. Methods of treating a hemolytic disorder comprising administering anti-properdin antibodies
JP2015532303A (en) * 2012-10-04 2015-11-09 ノベルメド セラピューティクス,インコーポレーテッド Complement alternative pathway specific antibodies for the treatment of hemolytic diseases
WO2021140475A1 (en) * 2020-01-08 2021-07-15 Cadila Healthcare Limited Anti-properdin antibodies and preparation thereof
EP4087869A4 (en) * 2020-01-08 2024-03-06 Zydus Lifesciences Limited Anti-properdin antibodies and preparation thereof
RU2830308C1 (en) * 2020-01-08 2024-11-18 Зидус Лайфсайенсиз Лимитед Properdin antibodies and production thereof
US12570732B2 (en) 2020-01-08 2026-03-10 Zydus Lifesciences Limited Anti-properdin antibodies and preparation thereof
WO2024108529A1 (en) * 2022-11-25 2024-05-30 Linno Pharmaceuticals Inc. Properdin binding protein and use thereof
WO2025259636A1 (en) * 2024-06-10 2025-12-18 Baylor College Of Medicine Targeting p53 mutants

Also Published As

Publication number Publication date
EP2544694B1 (en) 2018-10-31
CA2811091C (en) 2017-07-25
EP2544694A2 (en) 2013-01-16
AU2011223660A1 (en) 2012-11-22
AU2011223660B2 (en) 2016-10-13
WO2011109494A3 (en) 2012-01-19
EP2544694A4 (en) 2014-03-05
CN103068396B (en) 2016-07-06
CN103068396A (en) 2013-04-24
CA2811091A1 (en) 2011-09-09

Similar Documents

Publication Publication Date Title
EP2834271B1 (en) Humanized and chimeric anti-factor bb antibodies and uses thereof
CA2869477C (en) Humanized and chimeric anti-factor c3 antibodies and uses thereof
DK2262831T3 (en) ANTI-Properdin ANTIBODIES
US8664362B2 (en) Humanized and chimeric anti-properdin antibodies
JP2017158564A (en) Human tissue factor antibody and use thereof
CA2811091C (en) A method for inhibiting alternative pathway mediated disorders with anti-properdin antibodies that inhibit c5 interactions with properdin
AU2011224224B2 (en) Humanized and chimeric anti-properdin antibodies
US20140186348A1 (en) Humanized and chimeric anti-properdin antibodies
US9676842B2 (en) Anti-properdin antibodies
CN118475605A (en) Monospecific and bispecific antibodies and antigen-binding fragments thereof

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201180022197.3

Country of ref document: CN

NENP Non-entry into the national phase in:

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2011751270

Country of ref document: EP

ENP Entry into the national phase in:

Ref document number: 2011223660

Country of ref document: AU

Date of ref document: 20110302

Kind code of ref document: A

ENP Entry into the national phase in:

Ref document number: 2811091

Country of ref document: CA