WO2011104696A1 - Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies - Google Patents

Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies Download PDF

Info

Publication number
WO2011104696A1
WO2011104696A1 PCT/IB2011/050826 IB2011050826W WO2011104696A1 WO 2011104696 A1 WO2011104696 A1 WO 2011104696A1 IB 2011050826 W IB2011050826 W IB 2011050826W WO 2011104696 A1 WO2011104696 A1 WO 2011104696A1
Authority
WO
WIPO (PCT)
Prior art keywords
ser
synuclein
cdr
seq
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2011/050826
Other languages
French (fr)
Inventor
Eva NORDSTRÖM
Alex Kasrayan
Monica Ekberg
Valentina Screpanti Sundquist
Lars Lannfelt
Mats Holmquist
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bioarctic AB
Original Assignee
Bioarctic Neuroscience AB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2012554464A priority Critical patent/JP5894939B2/en
Priority to SM20180044T priority patent/SMT201800044T1/en
Priority to CA2789963A priority patent/CA2789963C/en
Priority to US13/578,710 priority patent/US8632776B2/en
Priority to DK11713058.3T priority patent/DK2539366T3/en
Priority to AU2011219414A priority patent/AU2011219414B2/en
Priority to CN201910950804.0A priority patent/CN110655573B/en
Priority to ES11713058.3T priority patent/ES2661925T3/en
Priority to HRP20180230TT priority patent/HRP20180230T8/en
Priority to PL11713058T priority patent/PL2539366T3/en
Priority to CN201180011363.XA priority patent/CN102869680B/en
Priority to LTEP11713058.3T priority patent/LT2539366T/en
Priority to EP11713058.3A priority patent/EP2539366B1/en
Priority to RU2012140954/10A priority patent/RU2555526C2/en
Application filed by Bioarctic Neuroscience AB filed Critical Bioarctic Neuroscience AB
Priority to NO11713058A priority patent/NO2539366T3/no
Priority to SI201131419T priority patent/SI2539366T1/en
Priority to RS20180129A priority patent/RS57029B1/en
Publication of WO2011104696A1 publication Critical patent/WO2011104696A1/en
Anticipated expiration legal-status Critical
Priority to US13/957,239 priority patent/US8859501B2/en
Priority to US14/472,036 priority patent/US8968734B2/en
Priority to US14/611,690 priority patent/US9084832B2/en
Priority to CY20181100140T priority patent/CY1120014T1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1018Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/0004Screening or testing of compounds for diagnosis of disorders, assessment of conditions, e.g. renal clearance, gastric emptying, testing for diabetes, allergy, rheuma, pancreas functions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/18Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/543Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
    • G01N33/54306Solid-phase reaction mechanisms
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2814Dementia; Cognitive disorders
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2814Dementia; Cognitive disorders
    • G01N2800/2821Alzheimer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2835Movement disorders, e.g. Parkinson, Huntington, Tourette
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/30Psychoses; Psychiatry
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/30Psychoses; Psychiatry
    • G01N2800/302Schizophrenia
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/38Pediatrics
    • G01N2800/385Congenital anomalies
    • G01N2800/387Down syndrome; Trisomy 18; Trisomy 13

Definitions

  • the present invention is directed to antibodies or fragments thereof having high affinity for human a-synuclein protofibrils and low binding of a-synuclein monomers, wherein the antibodies or fragments have specified Complementarity Determining Region (CDR) sequences.
  • CDR Complementarity Determining Region
  • the present invention is also directed to compositions comprising such an antibody or fragment and to methods of detecting ⁇ -synuclein protofibrils using such an antibody or fragment.
  • the invention is directed to methods of preventing, delaying onset of or treating a neurodegenerative disorder with a-synuclein pathology by administering such an antibody or fragment, and to use of such an antibody or fragment in the manufacture of a pharmaceutical composition for treatment of a
  • the invention is also directed to use of such an antibody or fragment in the diagnosis or monitoring of the development of a neurodegenerative disorder with ⁇ -synuclein pathology, and to methods for reducing or inhibiting ⁇ -synuclein aggregation by administration of such an antibody or fragment.
  • Parkinson's disease (PD) and dementia with Lewy bodies (DLB) are the two most prevalent examples of neurodegenerative disorders with ⁇ -synuclein brain pathology.
  • PD is the most common movement disorder and is characterized by rigidity, hypokinesia, tremor and postural instability.
  • PD is believed to affect approximately four to six million people worldwide.
  • DLB represents 5-15 % of all dementia. In addition to forgetfulness and other dementing symptoms that often fluctuate, DLB patients typically suffer from recurrent falls and visual hallucinations.
  • Lewy bodies round eosinophilic hyaline 10-20 ⁇ large inclusions, or Lewy neurites, elongated thread-like dystrophic axons and dendrites.
  • Lewy neurites elongated thread-like dystrophic axons and dendrites.
  • deposition of Lewy bodies and Lewy neurites are mostly limited to neurons connecting striatum with substantia nigra. These cells are crucial for the execution of movement and postural functions, explaining the nature of PD symptoms.
  • DLB brain widespread depositions of Lewy bodies and Lewy neurites are found both in midbrain and cortical areas.
  • Alpha-synuclein is a protein which is mainly found intraneuronally. Within the neuron, a-synuclein is predominantly located presynaptically and it has therefore been speculated that it plays a role in the regulation of synaptic activity. Three main isoforms of a- synuclein have been identified, of which the longest and most common form comprises 140 amino acids. This isoform has been used and alpha-synuclein (a-synuclein) related characteristics of antibodies according to the invention refer to this isoform of a-synuclein.
  • HNE 4-hydroxy-2-nonenal
  • Qin et al. 2007
  • HNE 4-hydroxy-2-nonenal
  • Qin et al. 2007
  • HNE 4-hydroxy-2-nonenal
  • Qin et al. 2007
  • HNE 4-hydroxy-2-nonenal
  • Qin et al. 2007
  • HNE 4-hydroxy-2-nonenal
  • Qin et al. 2007
  • HNE 4-hydroxy-2-nonenal
  • Qin et al. an ⁇ , ⁇ -unsaturated hydroxyalkenal
  • HNE has been shown in vitro that HNE can modify ⁇ -synuclein and thereby facilitate a- synuclein oligomerization.
  • HNE has been shown to increase and stabilize the formation of protofibrils, i.e. soluble larger oligomeric forms of ⁇ -synuclein ⁇ Qin et al., 2007; WO 2009/133521, incorporated herein by
  • Oxidative stress has been implicated in a number of neurodegenerative disorders characterized by the pathological accumulation of misfolded ⁇ -synuclein.
  • Various reactive oxygen species can induce peroxidation of lipids such as cellular membranes or lipoproteins and also result in the generation of highly reactive aldehydes from poly-unsaturated fatty acids (Yoritaka et al, 1996).
  • AD Alzheimer's disease
  • amyloid plaques and neurofibrillary tangles are seen in approximately 50% of cases with DLB. It is unclear whether the existence of parallel pathologies implies two different diseases or just represents a variant of each respective disorder. Sometimes the cases with co-pathology are described as having a Lewy body variant of AD ⁇ Hansen et al., 1990).
  • HNE reacts and modifies side chains of cysteine, histidine and lysine, substantially altering the structure and physical properties of these side chains.
  • HNE can either react with the C-3 carbon or with the aldehyde group or by combinations thereof.
  • HNE can covalently modify proteins, either inter- or intramolecularly.
  • Rare dominantly inherited forms of PD and DLB can be caused by point mutations or duplications of the a-synuclein gene.
  • the pathogenic mutations A30P and A53T ⁇ Kruger et al. , 1998) ⁇ Polymeropoulos et al., 1998) and duplication of the gene ⁇ Chartier-Harlin et al. 2004) have been described to cause familial PD, whereas one other ⁇ -synuclein mutation, E46K ⁇ Zarranz et al, 2004) as well as triplication of the ⁇ -synuclein gene ⁇ Singleton et al, 2003) have been reported to cause either PD or DLB.
  • ⁇ -synuclein aggregation cascade begins. Possibly, an altered conformation of monomeric ⁇ -synuclein initiates formation of dimers and trimers, which continue to form higher soluble oligomers, including protofibrils, before these intermediately sized species are deposited as insoluble fibrils in Lewy bodies. It is also conceivable that the ⁇ -synuclein oligomers, once they are formed, can bind new monomers and/or smaller multimers of ⁇ -synuclein and hence accelerate the fibril formation process. Such seeding effects can possibly also occur in the extracellular space as recent evidence suggests that ⁇ -synuclein pathology may propagate from neuron to neuron in the diseased brain.
  • ⁇ -synuclein intraneuronally.
  • the identification of ⁇ -synuclein in both plasma and cerebrospinal fluid illustrates that the protein is not exclusively found within neurons. Reducing such extracellular ⁇ -synuclein may shift the equilibrium between the intracellular and extracellular protein pools and result also in decreased intracellular a- synuclein.
  • Evidence suggests that ⁇ -synuclein in solution can penetrate lipid bilayers in cellular membranes and thereby become internalized or exported out of the cell.
  • Recent findings demonstrate that ⁇ -synuclein exerts toxic effects in the extracellular space, thus providing a plausible explanation for how ⁇ -synuclein pathology spreads throughout the brain as the disease progresses.
  • the present invention is directed to improved antibodies and fragments thereof having high affinity for human ⁇ -synuclein protofibrils and low binding of a-synuclein monomers.
  • the present invention is also directed to compositions comprising such an antibody or fragment and to methods of detecting ⁇ -synuclein protofibrils using such an antibody or fragment.
  • the invention is directed to methods of preventing, delaying onset of or treating a neurodegenerative disorder with a-synuclein pathology by administering such an antibody or fragment, and to use of such an antibody or fragment in manufacture of a pharmaceutical composition for treatment of a
  • the invention is also directed to use of such an antibody or fragment in the diagnosis or monitoring of the development of a neurodegenerative disorder with ⁇ -synuclein pathology, and to methods for reducing or inhibiting ⁇ -synuclein aggregation by administration of such an antibody or fragment.
  • the antibody or fragment thereof has high affinity for human ⁇ -synuclein protofibrils and low binding of ⁇ -synuclein monomers, and has three variable heavy (VH) CDR sequences (VH-CDR-1, VH-CDR-2, and VH-CDR-3) and three variable light (VL) CDR sequences (VL-CDR-1, VL-CDR-2, and VL-CDR-3), wherein the six CDR sequences of the antibody or fragment thereof are selected from the following respective groups:
  • VH-CDR-1 SEQ ID NOS: 22, 23, 24, 25, 26 or 27
  • VH-CDR-2 SEQ ID NOS: 28, 29, 30, 31, 32, 33 or 34
  • VL-CDR-1 SEQ ID NOS: 41, 42, 43, 44, 45 or 46
  • VL-CDR-3 SEQ ID NOS: 50, 51, 52, 53, 54 or 55.
  • the antibody or fragment thereof has high affinity for human a-synuclein protofibrils and low binding of a-synuclein monomers, and has three variable heavy (VH) CDR sequences (VH-CDR-1, VH-CDR-2, and VH-CDR-3) and three variable light (VL) CDR sequences (VL-CDR-1, VL-CDR-2, and VL-CDR-3), wherein the six CDR sequences of the antibody or fragment thereof are selected from the following respective groups, and sequences having greater than 70, 80, 90, 95 or 98% similarity with any of said sequences of the respective groups:
  • VH-CDR-1 SEQ ID NOS: 22, 23, 24, 25, 26 or 27
  • VH-CDR-2 SEQ ID NOS: 28, 29, 30, 31, 32, 33 or 34
  • VL-CDR-1 SEQ ID NOS: 41, 42, 43, 44, 45 or 46
  • VL-CDR-3 SEQ ID NOS: 50, 51, 52, 53, 54 or 55, and wherein the antibody or fragment thereof binds to an epitope within the amino acid region 113-140, e.g. 113-131, and in particular the epitopes 125-131, 121-124, 121-127, 121-131, 113-123 or 136-140, of immobilized linear ⁇ -synuclein in a model system comprising 15-mer alpha- synuclein peptides with 11 amino acids overlap.
  • the antibodies, fragments, compositions and methods according to the invention provide improvements in the diagnosis, monitoring, prevention, delay of onset and/or treatment of neurodegenerative disorders with a-synuclein pathology in individuals having and/or at risk of developing such disorders.
  • Fig. 1 shows the performance of protofibril specific monoclonal antibodies as determined by a competition ELISA. The assay was performed with HNE-stabilized a- synuclein protofibrils as described in Example 4.
  • Figs. 2A and 2B show the performance of protofibril specific antibody mAb49/G analyzed by a competition ELISA as described in Example 4.
  • Fig. 2A shows protofibril specific monoclonal antibody mAb49/G binds with high affinity to human a-synuclein protofibrils stabilized by either HNE or ONE.
  • Fig. 2B shows the monoclonal antibody also binds with high affinity to HNE-stabilized protofibrils of human mutated forms of a- synuclein, A30P and A53T.
  • Figs. 3A-3C show the performance of protofibril specific antibodies analyzed by a competition ELISA as described in Example 4.
  • the protofibril specific monoclonal antibodies bind with high affinity to wild type human ⁇ -synuclein protofibrils stabilized by either HNE (PF-HNE) or ONE (PF-ONE).
  • the monoclonal antibodies also bind with high affinity to HNE-stabilized protofibrils of human mutated forms of ⁇ -synuclein, A30P (A30P-HNE) and A53T (A30P-HNE).
  • Figs. 4A and 4B are directed to the quantification of ⁇ -synuclein protofibrils by sandwich ELISA as described in Example 5.
  • Fig. 4A shows a schematic of the protofibril specific antibody mAb49/G used as both the capturing antibody and the detection antibody.
  • Figs. 5A and 5B show the results of the analysis of diseased (DLB) and control human brain extracts with a-synuclein protofibril specific sandwich ELISA as described in Example 6.
  • FIG. 6 shows analysis of brain extracts of control mice (ntg, non transgenic) and 5 month old mice from the Khale transgenic (tg) mouse PD model as described in Example 7.
  • Brain tissue was extracted with tris buffered saline (TBS) and with TBS in the presence of Triton. Analysis was performed with ⁇ -synuclein protofibril sandwich ELISA as described in Example 5.
  • Protofibril specific antibody mAb49/G was used as both the capturing antibody and the detection antibody.
  • the y axis represents the absorbance at OD450.
  • Figs. 7A-7F show immunohistochemical (IHC) analysis of tissues as described in Example 8.
  • Fig. 7A shows 38E2/7 binding of Lewy bodies and neurites in PD substantia nigra and a positive ⁇ - ⁇ -synuclein control.
  • Fig. 7B shows 38E2/7 binding of Lewy bodies and neurites in DLB cortex and substantia nigra and a positive ⁇ - ⁇ -synuclein control.
  • Fig. 7C shows various antibodies binding Lewy bodies and neurites in DLB cortex and substantia nigra and a negative control.
  • Fig. 1A shows 38E2/7 binding of Lewy bodies and neurites in PD substantia nigra and a positive ⁇ - ⁇ -synuclein control.
  • Fig. 7B shows 38E2/7 binding of Lewy bodies and neurites in DLB cortex and substantia nigra and a positive
  • FIG. 7D shows various antibodies binding Lewy bodies and neurites in PD substantia nigra and a negative control.
  • Fig. 7E shows no binding of 38E2/7 in non-disease related substantia nigra and a positive ⁇ - ⁇ -synuclein control.
  • Fig. 7F shows a comparison of 38E2/7 binding and a positive ⁇ - ⁇ control in cortex of an Alzheimer's disease patient.
  • Figs. 8A and 8B show the immunoprecipitation of human brain extracts with protofibril selective monoclonal antibody 38E2/7 using a brain extraction protocol as described in Example 9.
  • Figs. 9A and 9B show fluorescence data measured using an Axiovert200 microscope equipped with a FITC epifluorescence filter as described in Example 10.
  • Fig. 9A shows treated cells while Fig. 9B shows data calculated as relative % decrease in fluorescence intensity compared to antibody untreated alpha-synuclein over expressing cells, which was set to 100 %.
  • the present invention is directed to improved antibodies and fragments thereof having high affinity for human a-synuclein protofibrils and low binding of a-synuclein monomers.
  • the antibodies are of class IgG or mutations thereof.
  • the high affinity for human a-synuclein protofibrils means that the antibodies or fragments exhibit a dissociation constant 3 ⁇ 4 less than 10 "7 M for human ⁇ -synuclein protofibrils.
  • protofibrils are soluble oligomers of ⁇ -synuclein.
  • Typical protofibrils have a molecular weight in a range of from about 1000 to about 5000 kDa, suitably measured using size exclusion chromatography with globular proteins used as references, but the invention is not limited to such typical protofibrils.
  • the low binding of a-synuclein monomers means that the binding of an antibody or fragment according to the invention to a- synuclein monomers is at least 100 times less than that to ⁇ -synuclein protofibrils.
  • these binding affinities are measured according to competition ELISA, for example, as described in Example 4.
  • the invention further relates to methods and uses of such antibodies and fragments for improvements in preventing, delaying onset of, treating, monitoring and/or diagnosing of neurodegenerative disorders with a-synuclein pathology, including, but not limited to, Parkinson's disease (PD), dementia with Lewy bodies (DLB), the Lewy body variant of Alzheimer's disease, multiple system atrophy, psychosis, schizophrenia, and Creutzfeldt- Jakob disease.
  • PD Parkinson's disease
  • DLB dementia with Lewy bodies
  • the Lewy body variant of Alzheimer's disease multiple system atrophy
  • psychosis schizophrenia
  • Creutzfeldt- Jakob disease Creutzfeldt- Jakob disease.
  • aggregated a-synuclein as Lewy bodies and Lewy neurites accumulate in the brain and, in some indications, also in other organs.
  • antibodies according to the invention have been developed by classical hybridoma techniques.
  • the antibodies may be polyclonal or monoclonal.
  • the antibodies are monoclonal.
  • the present disclosure refers in many instances to antibodies and fragments thereof, for purposes of convenience, the term "antibody” in the present disclosure includes fragments thereof, meaning active fragments thereof, i.e. fragments having the same characteristics that are used for definition of an antibody according to the invention, namely high affinity for a-synuclein
  • the antibodies and fragments thereof exhibit high efficiency in clearance of pathogenic forms of a-synuclein.
  • the invented antibodies bind aggregated forms, in particular protofibrils, comprising ⁇ -synuclein that is either unmodified or conjugated, for example, conjugated to 4- hydroxy-2-nonenal (HNE) or 4-oxo-2-nonenal (ONE), or other a, ⁇ -unsaturated
  • ⁇ -synuclein epitope Said epitope or epitopes are present on conformationally altered or modified ⁇ -synuclein, i.e. a-synuclein protofibrils and oligomers which are present in human brain from patients with a-synucleinopathies, such as, but not limited to, Parkinson's disease, DLB, etc.
  • the invented antibodies also bind the pathogenic protofibril/oligomeric structures formed by a-synuclein mutants, e.g.
  • monoclonal antibodies are provided for differentiating, diagnosing, identifying risk for developing, and/or treating a- synucleinopathology related disorders, including, but not limited to, e.g. Parkinson's disease, dementia with Lewy bodies, Lewy body variant of Alzheimer's disease, Alzheimer's disease, Down's syndrome, multiple system atrophy, psychosis, schizophrenia, Creutzfeldt-Jakob disease and other neurodegenerative disorders.
  • Parkinson's disease dementia with Lewy bodies, Lewy body variant of Alzheimer's disease, Alzheimer's disease, Down's syndrome, multiple system atrophy, psychosis, schizophrenia, Creutzfeldt-Jakob disease and other neurodegenerative disorders.
  • the antibodies and fragments of the invention comprise defined amino acid sequences of the CDRl-3 regions on the variable light (VL) and variable heavy (VH) chains from antibodies having high affinity for soluble ⁇ -synuclein protofibrils containing the "PD and or DLB disease epitope.”
  • the CDR regions are combined with modifications of the Fc region to modulate effector functions such as, but not limited to, Fc receptor binding, complement factor Clq binding, effecting half-life, complement activation and inflammation processes .
  • the constant region of an antibody has many important functions notably binding Fc -receptors and complement factor Clq. The latter function can be inactivated to avoid inflammatory reactions.
  • inventive antibodies and fragments having high affinity for a-synuclein protofibrils and low binding to ⁇ -synuclein monomers have the following distinct advantages as compared to other known immunotherapeutic treatment modalities: 1) The inventive antibodies and fragments target and inactivate or at least reduce disease causing a-synuclein protofibrils, e.g. by inhibition of oligomerization (see Example 10) or by other mechanisms.
  • inventive antibodies and fragments provide a modality for accurate dosing in
  • the antibodies and fragments reduce the risk for inflammatory side-effects, e.g.
  • One aspect of the invention is the discovery of the antibody amino acid sequences of the CDR regions that play an important role for binding of human wild type and mutant a- synuclein protofibrils.
  • Antibodies having binding sites (CDR regions) according to the invention are characterized by high affinity for wild-type human a-synuclein
  • oligomers/protofibrils for use as therapeutics or diagnostics.
  • the basic structure of an immunoglobulin (IgG) molecule comprises two identical light chains and two identical heavy chains linked together by disulphide bridges.
  • the light chain which is either lambda or kappa, has a variable region (VL) and a constant region (CL) of approximately 110 amino acid residues each.
  • the heavy chain has a variable region (VH) of about 110 amino acid residues, but a much larger constant region (CH) of 300-400 amino acid residues, comprising CHyl, CHy 2 and CHy3 regions or domains.
  • the constant region (Fc) activates the complement system and binds to Fc receptors on macrophages, microglia and neutrophiles, which ingest and destroy infecting microorganisms or foreign/non-self antigens. This function is important since it is part of the therapeutic principle of the antibody, i.e. Fc receptor mediated microglial phagocytosis and clearance of ⁇ -synuclein protofibrils. Clearance of ⁇ -synuclein oligomeric intermediates via the lysosomal degradation pathway has been demonstrated ⁇ Lee et ai, 2004).
  • This process involves receptor-dependent or receptor-independent endocytosis of antibody/protofibril complexes, followed by fusion with lysosomes where the ⁇ -synuclein protofibrils are degraded (Masliah et ah, 2005).
  • Receptors that have been suggested to control this process include the Thy 1.1 receptor and the lipoprotein receptor-related protein (LPR).
  • ⁇ -synuclein protofibrils are considered highly neurotoxic, initiating and driving the disease process. Clearance of ⁇ -synuclein protofibrils in the brain is of significant clinical value.
  • ⁇ -synuclein protofibrils In addition to clearance of ⁇ -synuclein protofibrils, other a-synuclein aggregated forms including ⁇ -synuclein fibrils, will be reduced indirectly via removal of the precursor forms to ⁇ -synuclein fibrils such as ⁇ -synuclein protofibrils, dimers, trimers, tetramers and higher oligomeric forms. Different ⁇ -synuclein forms including protofibrils and fibrils, are in equilibrium.
  • the respective variable regions of the heavy and light chains contain three hyper variable regions called complementarity determining regions or CDRs.
  • the CDR regions are short stretches of about 7-23, e.g.13-23, amino acids, located in the VL and VH regions.
  • CDR-sequences are used in the literature.
  • SEQ ID NOS: 1-21 define the inventive CDR-sequences using a first identification system, and the thus identified CDR- sequences are shown in VL and VH in monoclonal antibodies specific for human wild-type and mutant a-synuclein protofibrils in Table 1 (see Example 2) by the underlined regions.
  • SEQ ID NOS: 22-55 identify the inventive CDR-sequences using the known Kabat system, and the thus identified Kabat CDR-sequences are shown in VL and VH in antibodies specific for human wild-type and mutant a-synuclein protofibrils in Table 2 (see Example 2) by the underlined regions.
  • the identification of the inventive CDR-sequences according to Kabat are used in the present disclosure.
  • an antibody according to the invention is characterized by having the six CDR sequences (VH-CDR-1, VH-CDR-2, VH-CDR-3, VL-CDR-1, VL- CDR-2, and VL-CDR-3) selected from each of the following respective groups of CDR sequences, in any combination.
  • GFTFNTYAM SEQ ID NO: 1 GFTFNTYAMN SEQ ID NO: 22
  • GFTFSNYAM SEQ ID NO: 2
  • GFTFSNYAMS SEQ ID NO: 23
  • GFTFSSYAM SEQ ID NO: 3
  • GFTFSSYAMS SEQ ID NO: 24
  • GDSFTSGYW SEQ ID NO: 4 GDSFTSGYWN SEQ ID NO: 25
  • VH CDR-3 sequence with five amino acids exposed by this antibody. Therefore, it is concluded that the VH CDR-3 sequence needs to be more than 5 amino acids. In specific embodiments, the VH CDR-3 sequence is 9, 10, 11 or 12 amino acids.
  • the antibodies and fragments according to the invention have the six CDR sequences selected from the following combinations:
  • antibodies providing desirable specificity for a-synuclein protofibrils while fulfilling other important characteristics defined herein have the six CDR sequences of the antibody or fragment selected from the following respective groups:
  • VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
  • VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
  • VL CDR-1 SEQ ID NOS: 42, 43, 44 or 45
  • VL CDR-2 SEQ ID NOS : 47 or 48
  • VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
  • VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
  • VL CDR-2 SEQ ID NOS : 47 or 48
  • VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
  • VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
  • VL CDR-1 SEQ ID NOS: 42, 43, 44 or 45
  • VL CDR-2 SEQ ID NOS : 47 or 48
  • VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
  • VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
  • VL CDR-2 SEQ ID NOS : 47 or 48
  • the a-synuclein protofibril binding antibodies and fragments according to the invention are characterized by high affinity for the target.
  • the high affinity expressed as the dissociation constant 3 ⁇ 4 is less than 10 ⁇ 7 M.
  • the dissociation constant 3 ⁇ 4 for human a-synuclein protofibrils is less than 10 ⁇ 8 M, less than 10 ⁇ 9 M, less than 10 "10 M, or even less than 10 "11 M.
  • the antibodies and fragments exhibit low binding to ⁇ -synuclein monomers, and optionally low binding to ⁇ -synuclein fibrils.
  • the low binding to ⁇ -synuclein monomers means that the binding of an antibody or fragment according to the invention to a-synuclein monomers is at least 100 times less than that to ⁇ -synuclein protofibrils.
  • the binding of an antibody or fragment according to the invention to a- synuclein protofibrils is more than 500 times or even more than 1000 times greater than that to ⁇ -synuclein monomers.
  • the antibodies and fragments exhibit low binding to a- synuclein fibrils.
  • the binding of an antibody or fragment according to the invention to ⁇ -synuclein protofibrils is more than 100 times, more than 500 times, or even more than 1000 times, greater than that to ⁇ -synuclein fibrils.
  • the antibodies and fragments exhibit low binding to beta amyloid ( ⁇ ) protofibrils (e.g. 3 ⁇ 4>10 "5 M) and beta amyloid monomers (e.g. 3 ⁇ 4>10- 5 ⁇ ).
  • the antibodies and fragments exhibit low binding to ⁇ -synuclein monomer, ⁇ -synuclein monomer, IAPP (islet amyloid
  • the binding of the antibodies and fragments is at least 100 times less to one or more of these peptides/proteins than that to the human a- synuclein protofibrils.
  • the antibody or fragment according to the present invention can be defined by the binding in a model system to a linear epitope in a-synuclein within the amino acid (aa) region 113-140, e.g. aa region 113-131, with aa 125-131, 121-124, 121-127, 121-131, 113-123 and 136-140 as examples of specific epitopes.
  • a-synuclein within the amino acid (aa) region 113-140, e.g. aa region 113-131, with aa 125-131, 121-124, 121-127, 121-131, 113-123 and 136-140 as examples of specific epitopes.
  • 15-mer a-synuclein peptides with an 11 amino acid sequence overlap are used (see Example 3 below).
  • an antibody or fragment having high affinity for human ⁇ -synuclein protofibrils and low binding of a- synuclein monomers, and comprising a combination of one CDR-sequence selected from each of the six CDR sequence groups of SEQ ID NOS: 22-27, 28-34, 35-40, 41-46, 47-49 and 50- 52, and sequences having greater than 70, 80, 90, 95 or 98% similarity with any of said sequences in each respective group.
  • the antibody or fragment binds to an epitope within the amino acid (aa) region 113-140, e.g.
  • the high affinity a- synuclein protofibril binding antibodies can reduce or inhibit a-synuclein aggregation, thereby reducing levels of soluble oligomeric ⁇ -synuclein forms in the brain.
  • the high affinity a- synuclein protofibril binding antibodies can bind ⁇ -synuclein oligomers/protofibrils outside the CNS as well, thereby shifting the equilibrium of said ⁇ -synuclein forms over the blood brain barrier in such a way as to lower CNS levels of said ⁇ -synuclein forms (drainage).
  • the antibodies are of IgG class, suitable for therapeutic use which can pass over the blood brain barrier.
  • the high affinity ⁇ -synuclein protofibril binding IgG antibodies may be engineered to reduce complement factor Clq binding to the CH2 domain of IgGl and reduce complement activation and risk of inflammation. This modification can be done in several different ways. One way is to make a chimeric antibody where the CHy2 domain of the IgGl constant region has been deleted and exchanged for the corresponding domain from IgG4 or part of the domain that confers Clq binding. It is well established that IgG4 does not bind Clq and hence does not activate the complement cascade.
  • the constant region of the heavy chain (CH) is engineered is such a way as to combine the high affinity Fc-receptor domain (CHy3) on IgGl with the IgG4 domain (CHy2) which has no binding for the complement factor Clq.
  • This new antibody containing the chimeric constant heavy chain (IgGl :CHyl, CFty2:IgG4, CFty3:IgGl) has the important properties of both efficient clearance of ⁇ -synuclein protofibrils through Fc-receptor mediated phagocytosis and reduced risk for side-effects, i.e., inflammation such as meningioencephalitis.
  • oligosaccharide structure of the antibody which will reduce complement factor Clq binding and complement activation.
  • Thirty different structures of the complex biantennary oligosaccharides at Asn-297 in human IgGl have been described.
  • the absence of CH2 associated carbohydrates is believed to cause a conformational change in the "hinge" region of the antibody, reducing interaction efficacies with effector molecules and loss of complement activation function and Clq binding.
  • aglycosylated protofibril binding antibodies can be achieved by culturing cells expressing antibodies in the presence of tunicamycin, which inhibits glycosylation. These antibodies will have altered complement activating activity as well as altered Fc-receptor function (Leatherbarrow et al. 1985). Screening of clones expressing antibodies with low complement activation and high Fc-receptor binding will generate protofibril binding antibodies that exhibit high Fc-mediated clearance of a- synuclein protofibrils and low Clq binding.
  • the high affinity human a-synuclein protofibril binding antibody is of IgG subclass, e.g. IgGl or IgG4, where the complement factor Clq binding site has been modified, i.e. Pro331>Ser331 (Xu et al. 1994), in such a way as to reduce or inhibit binding of complement factor Clq.
  • Such antibodies are particularly suitable for administration, i.e., for the treatment, prevention or delaying onset of a neurodegenerative disorder with a-synuclein pathology, in an individual with such a disorder or at risk of developing such a disorder, for example, but not limited to, an individual having or at risk of developing PD.
  • the proline residue at position 331 in human IgGl can also be changed to a threonine or glycine or any other polar amino acid. This modification can be achieved by standard molecular biology techniques such as site-directed mutagenesis or DNA deletions.
  • Yet another aspect of the invention is the use of high affinity human a-synuclein protofibril binding antibodies to specifically determine protofibril levels in human or animal tissues, for example, in cerebrospinal fluid (CSF), blood, urine, saliva, or brain tissue, as a diagnostic tool or biomarker for, or for monitoring, a neurodegenerative disorder with a- synuclein pathology.
  • CSF cerebrospinal fluid
  • PD dementia with Lewy bodies
  • the Lewy body variant of Alzheimer's disease multiple system atrophy
  • psychosis is a neurodegenerative disorder with a- synuclein pathology.
  • schizophrenia, and Creutzfeldt-Jakob disease are exemplary only of such neurodegenerative disorders with ⁇ -synuclein pathology.
  • levels of human ⁇ -synuclein protofibrils in CSF or blood of a PD patient are likely to be different as compared to a matched elderly control group not having Parkinson's disease or any other a-synucleinopathy.
  • a person who is developing Parkinson's disease or any other ⁇ -synucleinopathy is likely to have altered levels of ⁇ -synuclein protofibril levels in CSF or blood compared to control subjects.
  • ⁇ -synuclein protofibril levels in CSF or blood can provide an early diagnosis of the disease.
  • This is possible to achieve with the new high affinity ⁇ -synuclein protofibril binding antibodies according to the invention and, in a specific embodiment, may be achieved in combination with a sandwich ELISA method (see Example 5), where a-synuclein protofibrils have been determined down to 9 pM level. Interference of other a-synuclein forms, particualrly a-synuclein monomers, and optionally a-synuclein fibrils and a-synuclein fragments in the assay, is negligible.
  • Examples of suitable methods for assaying ⁇ -synuclein protofibrils in these tissues as well as in cell cultures using an anti-a-synuclein protofibril antibody comprise
  • immunoassays such as ELISA, RIA, Western blotting or dot blotting. These methods are suitable to follow treatment efficacy as measured by protofibril reduction in clinical trials and/or as a diagnostic test. Since ⁇ -synuclein protofibrils levels are very low in CSF and blood, the high affinity ⁇ -synuclein protofibril binding antibody of the invention is advantageous for a diagnostic test, for example, based on an ELISA method, to allow measurement of low levels of ⁇ -synuclein protofibrils.
  • the antibody or fragment according to the invention is added to a biological sample comprising or suspected of comprising ⁇ -synuclein protofibrils, and the presence of a complex formed between ⁇ -synuclein protofibril and the antibody or fragment is detected.
  • the complex may be detected qualitatively, i.e., the presence of the complex is detected, or quantitatively, i.e., a concentration of the complex or a threshold concentration of the complex, may be detected, as desired.
  • the invention includes the use of the high affinity protofibril specific antibodies and fragments in imaging for detection, localization and quantitation of ⁇ -synuclein protofibrils in human and animal tissues.
  • the antibody or fragment may be labelled with a detectable label, for example, a radioactive ligand such as I 131 , C 14 , H 3 or Gallium 68 , but not limited to these radioisotopes, and contacted with a sample or administered for detection purposes.
  • Such methods are suitable as a diagnostic tool for neurodegenerative disorders with ⁇ -synuclein pathology, including, but not limited to, Parkinson's disease, dementia with Lewy bodies and other ⁇ -synuclein related neurodegenerative disorders.
  • such methods may be conducted to monitor the development of an a-synuclein related disease in a subject without or under medication or other possible treatment.
  • the antibodies are added to a biological sample comprising or suspected of comprising a-synuclein protofibrils, the concentration of the complex formed between said protofibril and said antibody is measured for detection and/or quantification of protofibrils in the sample.
  • the detection methods include immunoassay and proximity ligation assay.
  • the biological sample may be an in vitro sample taken from a subject as well as an in vivo liquid volume.
  • Yet another aspect of the invention is to make the antibody species specific for use in veterinary medicine.
  • the diagnostic methods outlined are also suitable for veterinary use.
  • Another aspect of the invention is the humanization of said antibodies to avoid side-effect, i.e. to avoid an immunoresponse against the antibodies in humans when used as a therapeutic or diagnostic agent.
  • Such humanization techniques are within the ability of one of ordinary skill in the art.
  • compositions according to the invention comprise an antibody or fragment as described herein, and a pharmaceutically acceptable carrier.
  • the compositions are physiologically acceptable formulations comprising a therapeutically active amount of an antibody or fragment according to the invention in a physiological buffer, for example, but not limited to, PBS, suitable for administration to humans and/or animals.
  • the antibody or fragment can be freeze dried for better stability.
  • the freeze dried formulation may contain any suitable conventional excipients, including stabilizers, lyoprotectants, buffers, and the like, such as, but not limited to, mannitol, for protecting and/or stabilizing the product during and/or after freeze drying and/or subsequent storage.
  • the antibody formulation may contain an antibacterial agent or other preservative or additive which does not interfere with the function or efficacy of the protofibril binding antibody or fragment.
  • mice are utilized.
  • antigen HNE stabilized ⁇ -synuclein protofibrils are used. These are produced as previously described (WO
  • mice are injected with HNE stabilized ⁇ -synuclein protofibrils and adjuvant (e.g. 3-6 times).
  • HNE-modified ⁇ -synuclein protofibrils was carried out prior to the mice being sacrificed.
  • Blood from immunized mice was analyzed for reactivity toward a-synuclein protofibrils and ⁇ -synuclein monomers. The specificity of the polyclonal antibody response was analyzed by a direct ELISA.
  • a flat bottom high binding 96-well polystyrene microtiter plate is coated with monomeric ⁇ -synuclein (unmodified or modified with HNE or other aldehydes), protofibrils/oligomeric ⁇ -synuclein (unmodified or modified with HNE or other aldehydes) or fibrillar ⁇ -synuclein, at a final concentration of 400 ng/well.
  • the wells are blocked with 2% BSA, washed with 0.05% Tween-20/ PBS and cell media supernatants (undiluted or diluted 1 : 1 with phosphate-buffered saline) from investigated polyclonal antibodies are added to the wells as primary antibodies.
  • Alkaline phosphatase - conjugated goat anti-mouse mouse IgG/IgM antibody (Pierce Biotechnology, Rockford, IL, USA) is used as the secondary antibody at a dilution of 1/1000. Immunoreactivity is visualized using p-nitrophenyl-phosphate (Sigma- Aldrich, MO, USA).
  • the negative control represents a non-immunized mouse.
  • Mouse B-cell hybridomas were used to produced monoclonal a-synuclein protofibril binding antibodies.
  • Spleen cells are isolated and ground in sterile phosphate- buffered saline (PBS) and centrifuged at 1200xg for 10 min to collect a cell-rich pellet. The cells are further washed with PBS and centrifuged at 1200xg for 10 min. The cell pellet is resuspended in Dulbecco's minimum essential medium (DMEM, Invitrogen, La Jolla, CA, USA) supplemented with 1% antibiotics.
  • DMEM Dulbecco's minimum essential medium
  • Spleen cells are mixed at 1 : 1 ratio with Sp2/0 cells (mouse myeloma cell line) in DMEM.
  • oligomeric/protofibrillar ⁇ -synuclein (unmodified or modified with HNE or other aldehydes) or fibrillar ⁇ -synuclein.
  • the wells are blocked with 1% BSA, washed with PBS-Tween 20 (0.05%) and cell media supernatants (undiluted or diluted 1 :2 or 1 :5 with PBS-Tween 20 (0.05%)) from investigated hybridoma are added to the wells as primary antibodies.
  • Horse radish peroxidase-conjugated HRP-coupled goat anti mouse Ig (Southern Biotechnology, prod. No.1010-05) is used as the secondary antibody at a dilution of 1/5000.
  • VH variable regions of heavy chain
  • variable regions of heavy chain (VH) and light chain (VL), including the CDR regions of the antibodies were determined by RT PCR of mRNA template, followed by DNA sequencing.
  • the amino acid sequences of the variable heavy chain region (VH) and the variable light chain region (VL) for selected antibodies are shown in Table 1.
  • the positions of the CDR regions 1-3 are underlined and shown.
  • the amino acid sequences of the CDR regions form the structural basis for binding human wild type and mutant ⁇ -synuclein protofibrils constituting the "pathogenic epitope" of a-synuclein protofibrils.
  • the combined amino acid sequences of the CDRl-3 regions of the VH and VL chains create the molecular "pocket” which binds human a-synuclein wild-type protofibrils with high affinity and specificity.
  • This "pocket” forms the structural basis of the "PD/DLB epitope”.
  • Variations in the CDR amino acid sequence length are observed in both the VH chain and the VL chain and are compatible with binding to human ⁇ -synuclein protofibrils.
  • a shorter CDR region provides a more restricted three dimensional structure of the binding pocket of the antibody, whereas a longer CDR region is more flexible.
  • the CDR sequences as shown in Tables 1 and 2 are embodiments of the present invention, as are the amino acid sequences in the "mouse framework" regions of the VH and VL chains, i.e., outside the CDR regions, as well as the human VL and VH framework regions for protofibril specific antibodies as, but not limited to, those.
  • VH variable regions of heavy chain
  • VL/Vkappa variable regions of heavy chain
  • VL/Vkappa variable regions of heavy chain
  • Antibodies BA1-BA4 are examples of high affinity protofibril specific antibodies according to the invention.
  • VH-BA1 49/G (SEQ ID NO: 56)
  • VH-BA2 38E2/7 (SEQ ID NO: 57)
  • VH-BA3 38Fl l/2_8 (SEQ ID NO: 58)
  • VH-BA4 48B11/8 (SEQ ID NO: 59)
  • Vkappa-BAl 49/G (SEQ ID NO: 60)
  • Vkappa-BA2: 38E2/7 (SEQ ID NO: 61)
  • Vkappa-BA3 38Fl l/2_8 (SEQ ID NO: 62)
  • Table 2 Amino acid sequences of variable regions of heavy chain and light chain from eight different antibodies specific for human wild-type and mutant a-synuclein protofibrils. Positions of the various CDR-regions according to the Kabat system are marked.
  • the antibodies are examples of high affinity protofibril specific antibodies according to the invention.
  • the Heavy Chains are respectively SEQ ID NOS: 64-71 and the Light Chains are respectively SEQ ID NOS: 72-79.
  • the length and precise position of the epitope depends on the method used for determination.
  • This example shows four antibodies (mAb49/G, mAb38E2/7, mAb38Fl l/2_8 and mAb48B l l/8). These antibodies show high affinity to ⁇ -synuclein protofibrils and low cross- reactivity (binding) to ⁇ -synuclein monomers, as measured by means of the competition ELISA assay described below. Briefly, the anti-a-synuclein antibody to be tested is allowed to interact in solution with ⁇ -synuclein monomers or protofibrils and thereafter the mix is added to a microtiter plate precoated with ⁇ -synuclein protofibrils.
  • ALP alkaline phosphates enzyme
  • a high-binding ELISA microtiter plate was coated with 100 ⁇ /well of 1 ⁇ g/ml of a-synuclein protofibril, diluted in lxPBS, sealed with adhesive sealer and incubated overnight at +4 ° C. Then, the coating solution was discarded and the residual binding capacity of the plate was blocked by adding 200 ⁇ /well of PBS-Tween 20 (0.05%). The sealed plate was incubated for 60 min at room temperature ( .T.) by shaking at 900 rpm.
  • peptide solution was prepared in lx PBS-Tween 20 (0.05%) by diluting a-synuclein monomers or protofibril to a concentration of 140 nM.
  • a 10-step 3x dilution series of ⁇ -synuclein monomers and protofibrils was performed in a volume of 50 ⁇ in a round bottomed, low protein binding microtiter plate.
  • 50 ⁇ of the tested antibody diluted in PBS-Tween 20 (0.05%) to a concentration of 100 ng/ml was added and allowed to interact for 60 min at R.T. by shaking at 900 rpm.
  • ELISA plate was washed to remove unbound antibodies and 100 ⁇ of ALP-substrate were added to each well. The plate was kept dark during incubation at R.T. until a yellow color developed. Absorbance values were measured on continuous mode at a wavelength of 405 nm every 15 minutes up to 120 minutes. Measurements were used for IC50 determinations only if there was linearity between time and absorbance. [0090] IC50 values were calculated as the concentration of either monomers or protofibrils needed to quench half of the signal in the ELISA.
  • Fig. 1 shows the absorbance at 450 nm for the four protofibril specific monoclonal antibodies as determined by the described competition ELISA. The assay was performed with HNE-stabilized ⁇ -synuclein protofibrils.
  • Figs. 2A and 2B show the results of the protofibril specific antibody mAb49/G analysed by a competition ELISA.
  • Protofibril specific monoclonal antibody mAb49/G binds with high affinity to human ⁇ -synuclein protofibrils stabilized by either HNE or ONE (Fig. 2A).
  • the monoclonal antibody also binds with high affinity to HNE-stabilized protofibrils of human mutated forms of ⁇ -synuclein, A30P and A53T (Fig. 2B).
  • Figs. 3A-3C show the results of additional protofibril specific antibodies 38E2/7, 38F11/2_8 and 48B11/8, analysed by a competition ELISA.
  • the protofibril specific monoclonal antibodies bind with high affinity to wild type human a- synuclein protofibrils stabilized by either HNE (PF-HNE) or ONE (PF-ONE).
  • the monoclonal antibodies also bind with high affinity to HNE-stabilized protofibrils of human mutated forms of alpha synuclein, A30P (A30P-HNE) and A53T (A30P-HNE).
  • the concentration in pM is based on the molecular weight of one ⁇ -synuclein monomer (14,000 g/mol). Because the molecular weight of a protofibril has been estimated, by size exclusion chromatogarphy, to be at least 1,000,000 g/mol, the limit of detection calculated as molar ⁇ -synuclein protofibrils could be as low as
  • ⁇ -synuclein protofibrils stabilized by HNE and monomeric ⁇ -synuclein were used to validate the conformation specificity of the ELISA.
  • An ELISA composed of two identical antibodies requires at least a dimer of a protein to produce a signal.
  • a large excess of monomeric ⁇ -synuclein which may naturally occur in biological samples, could interfere with the ⁇ -synuclein protofibril analysis by occupying binding sites of the capture antibody coat, thus inhibiting the protofibrils from binding.
  • This problem was investigated by adding an increasing excess of a-synuclein monomer to a fixed concentration of ⁇ -synuclein protofibrils (500 pM, expressed as monomer units) and analyzing it with the mAb49/G ELISA.
  • Fig. 4A shows a schematic illustration of the ELISA binding for quantification of a-synuclein protofibrils by sandwich ELISA.
  • TBS extract Frig. 5A, white bar
  • Triton extract Fig. 5A, striped bar
  • SDS extract Fig. 5B, black bar
  • Brain extracts were analyzed from a patient diagnosed with the a- synucleinopathy dementia with lewy bodies (DLB). Brain tissue from cortex and substantia nigra was analyzed.
  • Figs.5A and 5B show the results of the analysis of diseased and control human brain extracts with ⁇ -synuclein protofibril specific sandwich ELISA.
  • Brain extract samples from transgenic mice over-expressing human a-synuclein A53T mutant were compared with samples from wild type mice. Brains were homogenized in TBS or TBS+tween and centrifuged prior to analysis in order to recover the soluble a- synuclein fraction. Measurements of ⁇ -synuclein protofibril levels in the TBS-soluble fractions of non-transgenic mouse brain homogenates were compared to transgenic mice (Kahle model) (Fig. 6). To ensure that all ⁇ -synuclein measured in this assay was in a soluble state, all samples were centrifuged for 5 min at 16000 x g before analysis. Levels of a- synuclein protofibrils were measured in brains from 5 month old transgenic mice with a- synuclein pathology.
  • FIG. 6 shows the results of the analysis of brain extracts of control mice (ntg, non transgenic) and 5 month old mice from Khale transgenic (tg) mouse PD model in which the y axis represents the absorbance at OD450.
  • Cortex and substantia nigra from PD and DLB patients was used to perform immunohistochemical (IHC) analysis as described (Oinas et al. 2010).
  • IHC immunohistochemical
  • cortex and substantia nigra from age-matched non-diseased patients was used.
  • Positive antibody control for ⁇ -synuclein was a mouse anti- ⁇ -synuclein mAb (BD 610787).
  • Binding to ⁇ plaques was evaluated as follows: two consecutive slides from the cortex of an AD patient were treated to display antigens and incubated with either a positive anti- ⁇ mAb (mAbl58, BioArctic) or with each one of the candidate antibodies. The bound antibody was detected by a secondary anti-species specific antibody coupled to horse radish peroxidase (HRP). The conjugate was then incubated with the HRP substrate DAB, generating a colored precipitate which was detected by light microscopy. The region in which ⁇ plaques were detected by means of a colored precipitation in the positive control was analyzed in the co respective area in the slides treated with the candidate antibody. The lack of a colored precipitation was evaluated visually and interpreted as a lack of binding to ⁇ plaques by the candidate antibodies.
  • HRP horse radish peroxidase
  • Fig. 7A shows 38E2/7 binding of Lewy bodies and neurites in PD substantia nigra and a positive ⁇ - ⁇ -synuclein control.
  • Fig. 7B shows 38E2/7 binding of Lewy bodies and neurites in DLB cortex and substantia nigra and a positive ⁇ - ⁇ -synuclein control.
  • Fig. 7C shows various antibodies binding Lewy bodies and neurites in DLB cortex and substantia nigra and a negative control.
  • Fig. 7D shows various antibodies binding Lewy bodies and neurites in PD substantia nigra and a negative control.
  • Fig. 7A shows 38E2/7 binding of Lewy bodies and neurites in PD substantia nigra and a positive ⁇ - ⁇ -synuclein control.
  • Fig. 7B shows 38E2/7 binding of Lewy bodies and neurites in DLB cortex and substanti
  • FIG. 7E shows no binding of 38E2/7 in non-disease related substantia nigra and a positive ⁇ - ⁇ -synuclein control.
  • Fig. 7F shows a comparison of 38E2/7 binding and a positive ⁇ - ⁇ control in cortex of an Alzheimer's disease patient.
  • IP immunoprecipitation
  • TBS extract comprising extracellular and cytosolic a-synuclein species
  • Triton extract comprising membrane-associated a-synuclein species
  • SDS extract comprising SDS-soluble a-synuclein species
  • FA extract comprising insoluble ⁇ -synuclein.
  • Fig. 8A shows SDS extract of substantia nigra of the DLB patient while Fig. 8B shows Triton extract of substantia nigra of the DLB patient. As seen, in Figs.
  • mAb 38E2/7 only captures ⁇ -synuclein protofibrils from DLB substantia nigra, both in the Triton and in the SDS extracts, whereas mAb 15 captures a- synuclein monomers in all extracts.
  • This example shows the antibody mAb49/G inhibits the oligomerization of a- synuclein monomers using an in vitro method in which neuronal cells are transfected with 2 vectors, both containing one copy of ⁇ -synuclein (aa 1-140) fused with either the N-terminal or the C-terminal fragment of GFP. Only those cells, in which ⁇ -synuclein has oligomerized, bringing both fragments of GFP together, will generate a green fluorescent color that can be detected with fluorescent microscopy. The presence of an antibody that can inhibit and/or disrupt oligomerization can be evaluated by comparing the fluorescence in these cultures, compared to a control to which no antibody as been added.
  • H4 neuroglioma cells were transfected with equimolar ratios of DNA-constructs containing either ⁇ -synuclein (aa 1-140) fused with a N-terminal fragment of Green Fluorescent protein (GFP) (aa 1-155) or ⁇ -synuclein (aa 1-140) fused with a C-terminal fragment of GFP (aa 156-238) using the FuGENE 6 transfection reagent (Roche Diagnostics, Basel, Switzerland).
  • GFP Green Fluorescent protein
  • a control anti-a-synuclein monoclonal antibody (mAb5C2, Santa Cruz Bio) and mAb49/G were extracellularly added to the cells with a final concentration of 1 ⁇ g/ml.
  • the cells were incubated for 24 hours in 37 ° C in 5% CO 2 . After 24 hours, the cells were moved to 30 ° C for complete reconstitution of the GFP-flourophore and incubated for an additional time of 24 hours. Fluorescence was measured using an
  • Fig. 9A As seen in the Fig. 9A, treatment with mAb49/G showed a significant (*p ⁇ 0.05) reduction (42 % decrease in fluorescence intensity compared to untreated cells) in a-synuclein oligomerization.
  • Fig. 9B shows the results graphically as a percent fluorescence intensity compared to untreated ⁇ -synuclein overexpressing cells, which was set ot 100%.
  • alpha-Synuclein pathology in the spinal cord autonomic nuclei associates with alpha-synuclein pathology in the brain: a population-based Vantaa 85+ study. Acta Neuropathol. 119, 715-722.
  • Arg lie Arg Thr Lys Ser Asn Asp Tyr Ala Thr Tyr Tyr Ala Asp Ser 1 5 10 15

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Urology & Nephrology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Hematology (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Analytical Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Cell Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Psychiatry (AREA)
  • Toxicology (AREA)
  • Diabetes (AREA)
  • Endocrinology (AREA)
  • Gastroenterology & Hepatology (AREA)

Abstract

Antibodies and fragments thereof have high affinity for human α-synuclein protofibrils and low binding of α-synuclein monomers, wherein the antibodies or fragments have specified Complementarity Determining Region (CDR) sequences. Compositions comprise such an antibody or fragment and methods of detecting α-synuclein protofibrils use such an antibody or fragment. In further embodiments, methods of preventing, delaying onset of or treating a neurodegenerative disorder with α-synuclein pathology comprise administering such an antibody or fragment, and such an antibody or fragment is used in the manufacture of a pharmaceutical composition for treatment of a neurodegenerative disorder with α-synuclein pathology. Such an antibody or fragment is used in the diagnosis or monitoring of the development of a neurodegenerative disorder with α-synuclein pathology, and in methods for reducing or inhibiting α-synuclein aggregation by administration of such an antibody or fragment.

Description

PROTOFIBRIL-BINDING ANTIBODIES AND THEIR USE IN THERAPEUTIC AND DIAGNOSTIC METHODS FOR PARKINSON'S DISEASE, DEMENTIA WITH LEWY BODIES AND OTHER oc-SYNUCLEINOPATHIES
FIELD OF THE INVENTION
[0001] The present invention is directed to antibodies or fragments thereof having high affinity for human a-synuclein protofibrils and low binding of a-synuclein monomers, wherein the antibodies or fragments have specified Complementarity Determining Region (CDR) sequences. The present invention is also directed to compositions comprising such an antibody or fragment and to methods of detecting α-synuclein protofibrils using such an antibody or fragment. In further embodiments, the invention is directed to methods of preventing, delaying onset of or treating a neurodegenerative disorder with a-synuclein pathology by administering such an antibody or fragment, and to use of such an antibody or fragment in the manufacture of a pharmaceutical composition for treatment of a
neurodegenerative disorder with α-synuclein pathology. The invention is also directed to use of such an antibody or fragment in the diagnosis or monitoring of the development of a neurodegenerative disorder with α-synuclein pathology, and to methods for reducing or inhibiting α-synuclein aggregation by administration of such an antibody or fragment.
BACKGROUND OF THE INVENTION
[0002] Parkinson's disease (PD) and dementia with Lewy bodies (DLB) are the two most prevalent examples of neurodegenerative disorders with α-synuclein brain pathology. PD is the most common movement disorder and is characterized by rigidity, hypokinesia, tremor and postural instability. PD is believed to affect approximately four to six million people worldwide. DLB represents 5-15 % of all dementia. In addition to forgetfulness and other dementing symptoms that often fluctuate, DLB patients typically suffer from recurrent falls and visual hallucinations.
[0003] Intraneuronal accumulation of a-synuclein either results in the formation of Lewy bodies, round eosinophilic hyaline 10-20 μιη large inclusions, or Lewy neurites, elongated thread-like dystrophic axons and dendrites. In the PD brain, deposition of Lewy bodies and Lewy neurites are mostly limited to neurons connecting striatum with substantia nigra. These cells are crucial for the execution of movement and postural functions, explaining the nature of PD symptoms. In the DLB brain, widespread depositions of Lewy bodies and Lewy neurites are found both in midbrain and cortical areas.
[0004] Alpha-synuclein is a protein which is mainly found intraneuronally. Within the neuron, a-synuclein is predominantly located presynaptically and it has therefore been speculated that it plays a role in the regulation of synaptic activity. Three main isoforms of a- synuclein have been identified, of which the longest and most common form comprises 140 amino acids. This isoform has been used and alpha-synuclein (a-synuclein) related characteristics of antibodies according to the invention refer to this isoform of a-synuclein.
[0005] In addition to α-synuclein, Lewy bodies consist of a wide range of molecules, one of which is 4-hydroxy-2-nonenal (HNE), an α,β-unsaturated hydroxyalkenal (Qin et al., 2007). It has been shown in vitro that HNE can modify α-synuclein and thereby facilitate a- synuclein oligomerization. In particular, HNE has been shown to increase and stabilize the formation of protofibrils, i.e. soluble larger oligomeric forms of α-synuclein {Qin et al., 2007; WO 2009/133521, incorporated herein by reference).
[0006] Oxidative stress has been implicated in a number of neurodegenerative disorders characterized by the pathological accumulation of misfolded α-synuclein. Various reactive oxygen species can induce peroxidation of lipids such as cellular membranes or lipoproteins and also result in the generation of highly reactive aldehydes from poly-unsaturated fatty acids (Yoritaka et al, 1996).
[0007] Brain pathology indicative of Alzheimer's disease (AD), i.e. amyloid plaques and neurofibrillary tangles, are seen in approximately 50% of cases with DLB. It is unclear whether the existence of parallel pathologies implies two different diseases or just represents a variant of each respective disorder. Sometimes the cases with co-pathology are described as having a Lewy body variant of AD {Hansen et al., 1990).
[0008] Recent research has implicated a role of a-synuclein in AD and Down's syndrome, as the a-synuclein protein has been demonstrated to accumulate in the limbic region in these disorders {Crews et al., 2009).
[0009] HNE reacts and modifies side chains of cysteine, histidine and lysine, substantially altering the structure and physical properties of these side chains. Hence, HNE can either react with the C-3 carbon or with the aldehyde group or by combinations thereof. Hence, HNE can covalently modify proteins, either inter- or intramolecularly.
Genetics of Parkinson 's disease and Dementia with Lewy Bodies
[0010] Rare dominantly inherited forms of PD and DLB can be caused by point mutations or duplications of the a-synuclein gene. The pathogenic mutations A30P and A53T {Kruger et al. , 1998) {Polymeropoulos et al., 1998) and duplication of the gene {Chartier-Harlin et al. 2004) have been described to cause familial PD, whereas one other α-synuclein mutation, E46K {Zarranz et al, 2004) as well as triplication of the α-synuclein gene {Singleton et al, 2003) have been reported to cause either PD or DLB.
[0011] The pathogenic consequences of the α-synuclein mutations are only partly understood. However, in vitro data have shown that the A30P and A53T mutations increase the rate of aggregation {Conway et al , 2000). A broad range of differently composed a- synuclein species (monomers, dimers, oligomers, including protofibrils) are involved in the aggregation process, all of which may have different toxic properties. It is not clear which molecular species exert toxic effects in the brain. However, recent research suggests that oligomeric forms of α-synuclein are particularly neurotoxic. Additional evidence for the role of oligomers is given by the observation that certain α-synuclein mutations (A30P and A53T) causing hereditary Parkinson's disease, lead to an increased rate of oligomerization.
[0012] It is not completely known how the α-synuclein aggregation cascade begins. Possibly, an altered conformation of monomeric α-synuclein initiates formation of dimers and trimers, which continue to form higher soluble oligomers, including protofibrils, before these intermediately sized species are deposited as insoluble fibrils in Lewy bodies. It is also conceivable that the α-synuclein oligomers, once they are formed, can bind new monomers and/or smaller multimers of α-synuclein and hence accelerate the fibril formation process. Such seeding effects can possibly also occur in the extracellular space as recent evidence suggests that α-synuclein pathology may propagate from neuron to neuron in the diseased brain.
[0013] Apart from the neuropathological changes in a-synucleinopathies, levels of a- synuclein protein are generally increased in affected brain regions (Klucken et ai, 2006).
[0014] The major pathology in a-synucleinopathies is intracellular, which poses a challenge to the immune therapeutic approach. However, it is likely that a fraction of actively induced or passively administrated antibodies can bind their target antigens also
intraneuronally. Moreover, the identification of α-synuclein in both plasma and cerebrospinal fluid (El-Agnaf et al, 2006) illustrates that the protein is not exclusively found within neurons. Reducing such extracellular α-synuclein may shift the equilibrium between the intracellular and extracellular protein pools and result also in decreased intracellular a- synuclein. Evidence suggests that α-synuclein in solution can penetrate lipid bilayers in cellular membranes and thereby become internalized or exported out of the cell. Recent findings demonstrate that α-synuclein exerts toxic effects in the extracellular space, thus providing a plausible explanation for how α-synuclein pathology spreads throughout the brain as the disease progresses. Studies showed that Lewy pathology was transmitted to grafted neurons in transplanted PD patients (Li et al. 2008). Furthermore, α-synuclein is transmitted via endocytocis to neighboring neurons, and cell-to-cell transmission of a-synuclein aggregates has been linked to neuronal cell death and pathological progression in PD and other a-synucleinopathies (Desplats et al. 2009).
Diagnosis ofPD and DLB
[0015] There is a need for improved diagnostic tools and methods to identify a risk for a neurodegenerative disease with α-synuclein pathology. Today, no biochemical method can aid the clinician to diagnose the patient clinical symptoms in the early stages of the disease, before substantial damage to the brain has already occurred.
[0016] The importance of accurate diagnostic assays will become even greater as new therapeutic possibilities emerge. As of today, only symptomatic treatment (by substituting the loss of active dopamine in the brain) is available for PD patients. For DLB, even less therapeutic options are available. Nevertheless, clinicians are frequently evaluating possible beneficial effects on DLB patients with the standard treatment for AD, i.e. cholinesterase inhibitors. In either way, none of the existing treatment strategies for a-synucleinopathies are directed against the underlying disease processes. In addition, there is also a need for monitoring the disease progression and the treatment effect. For a review on different approaches aimed at altering the progression of Parkinson's disease, see George et al. 2009. [0017] In view of the above-mentioned involvement of a-synuclein in several neurodegenerative disorders, there is a need for novel treatments that can eliminate or reduce the effect of toxic α-synuclein species, as well as a need for good biomarkers to monitor new interventions and provide good prognostic specificity.
SUMMARY OF THE INVENTION
[0018] The present invention is directed to improved antibodies and fragments thereof having high affinity for human α-synuclein protofibrils and low binding of a-synuclein monomers. The present invention is also directed to compositions comprising such an antibody or fragment and to methods of detecting α-synuclein protofibrils using such an antibody or fragment. In further embodiments, the invention is directed to methods of preventing, delaying onset of or treating a neurodegenerative disorder with a-synuclein pathology by administering such an antibody or fragment, and to use of such an antibody or fragment in manufacture of a pharmaceutical composition for treatment of a
neurodegenerative disorder with a -synuclein pathology. The invention is also directed to use of such an antibody or fragment in the diagnosis or monitoring of the development of a neurodegenerative disorder with α-synuclein pathology, and to methods for reducing or inhibiting α-synuclein aggregation by administration of such an antibody or fragment.
[0019] In one embodiment, the antibody or fragment thereof has high affinity for human α-synuclein protofibrils and low binding of α-synuclein monomers, and has three variable heavy (VH) CDR sequences (VH-CDR-1, VH-CDR-2, and VH-CDR-3) and three variable light (VL) CDR sequences (VL-CDR-1, VL-CDR-2, and VL-CDR-3), wherein the six CDR sequences of the antibody or fragment thereof are selected from the following respective groups:
VH-CDR-1 SEQ ID NOS: 22, 23, 24, 25, 26 or 27 VH-CDR-2 SEQ ID NOS: 28, 29, 30, 31, 32, 33 or 34
VH-CDR-3 SEQ ID NOS: 35, 36, 37, 38, 39 or 40
VL-CDR-1 SEQ ID NOS: 41, 42, 43, 44, 45 or 46
VL-CDR-2 SEQ ID NOS: 47, 48 or 49
VL-CDR-3 SEQ ID NOS: 50, 51, 52, 53, 54 or 55.
[0020] In another embodiment, the antibody or fragment thereof has high affinity for human a-synuclein protofibrils and low binding of a-synuclein monomers, and has three variable heavy (VH) CDR sequences (VH-CDR-1, VH-CDR-2, and VH-CDR-3) and three variable light (VL) CDR sequences (VL-CDR-1, VL-CDR-2, and VL-CDR-3), wherein the six CDR sequences of the antibody or fragment thereof are selected from the following respective groups, and sequences having greater than 70, 80, 90, 95 or 98% similarity with any of said sequences of the respective groups:
VH-CDR-1 SEQ ID NOS: 22, 23, 24, 25, 26 or 27
VH-CDR-2 SEQ ID NOS: 28, 29, 30, 31, 32, 33 or 34
VH-CDR-3 SEQ ID NOS: 35, 36, 37, 38, 39 or 40
VL-CDR-1 SEQ ID NOS: 41, 42, 43, 44, 45 or 46
VL-CDR-2 SEQ ID NOS: 47, 48 or 49
VL-CDR-3 SEQ ID NOS: 50, 51, 52, 53, 54 or 55, and wherein the antibody or fragment thereof binds to an epitope within the amino acid region 113-140, e.g. 113-131, and in particular the epitopes 125-131, 121-124, 121-127, 121-131, 113-123 or 136-140, of immobilized linear α-synuclein in a model system comprising 15-mer alpha- synuclein peptides with 11 amino acids overlap.
[0021] The antibodies, fragments, compositions and methods according to the invention provide improvements in the diagnosis, monitoring, prevention, delay of onset and/or treatment of neurodegenerative disorders with a-synuclein pathology in individuals having and/or at risk of developing such disorders.
[0022] Additional aspects, embodiments and advantages of the various embodiments of the present invention will be more apparent in view of the detailed description.
BRIEF DESCRIPTION OF THE DRAWING
[0023] The detailed description will be more fully understood in view of the Drawings, in which:
[0024] Fig. 1 shows the performance of protofibril specific monoclonal antibodies as determined by a competition ELISA. The assay was performed with HNE-stabilized a- synuclein protofibrils as described in Example 4.
[0025] Figs. 2A and 2B show the performance of protofibril specific antibody mAb49/G analyzed by a competition ELISA as described in Example 4. Fig. 2A shows protofibril specific monoclonal antibody mAb49/G binds with high affinity to human a-synuclein protofibrils stabilized by either HNE or ONE. Fig. 2B shows the monoclonal antibody also binds with high affinity to HNE-stabilized protofibrils of human mutated forms of a- synuclein, A30P and A53T.
[0026] Figs. 3A-3C show the performance of protofibril specific antibodies analyzed by a competition ELISA as described in Example 4. The protofibril specific monoclonal antibodies bind with high affinity to wild type human α-synuclein protofibrils stabilized by either HNE (PF-HNE) or ONE (PF-ONE). The monoclonal antibodies also bind with high affinity to HNE-stabilized protofibrils of human mutated forms of α-synuclein, A30P (A30P-HNE) and A53T (A30P-HNE).
[0027] Figs. 4A and 4B are directed to the quantification of α-synuclein protofibrils by sandwich ELISA as described in Example 5. Fig. 4A shows a schematic of the protofibril specific antibody mAb49/G used as both the capturing antibody and the detection antibody. Fig. 4B shows the standard curve generated with HNE-stabilized a-synuclein protofibrils. Assay performance reached a limit of quantification LOQ=9 pM.
[0028] Figs. 5A and 5B show the results of the analysis of diseased (DLB) and control human brain extracts with a-synuclein protofibril specific sandwich ELISA as described in Example 6.
[0029] Fig. 6 shows analysis of brain extracts of control mice (ntg, non transgenic) and 5 month old mice from the Khale transgenic (tg) mouse PD model as described in Example 7. Brain tissue was extracted with tris buffered saline (TBS) and with TBS in the presence of Triton. Analysis was performed with α-synuclein protofibril sandwich ELISA as described in Example 5. Protofibril specific antibody mAb49/G was used as both the capturing antibody and the detection antibody. In the graph, the y axis represents the absorbance at OD450.
[0030] Figs. 7A-7F show immunohistochemical (IHC) analysis of tissues as described in Example 8. Fig. 7A shows 38E2/7 binding of Lewy bodies and neurites in PD substantia nigra and a positive α-α-synuclein control. Fig. 7B shows 38E2/7 binding of Lewy bodies and neurites in DLB cortex and substantia nigra and a positive α-α-synuclein control. Fig. 7C shows various antibodies binding Lewy bodies and neurites in DLB cortex and substantia nigra and a negative control. Fig. 7D shows various antibodies binding Lewy bodies and neurites in PD substantia nigra and a negative control. Fig. 7E shows no binding of 38E2/7 in non-disease related substantia nigra and a positive α-α-synuclein control. Fig. 7F shows a comparison of 38E2/7 binding and a positive α-Αβ control in cortex of an Alzheimer's disease patient. [0031] Figs. 8A and 8B show the immunoprecipitation of human brain extracts with protofibril selective monoclonal antibody 38E2/7 using a brain extraction protocol as described in Example 9.
[0032] Figs. 9A and 9B show fluorescence data measured using an Axiovert200 microscope equipped with a FITC epifluorescence filter as described in Example 10. Fig. 9A shows treated cells while Fig. 9B shows data calculated as relative % decrease in fluorescence intensity compared to antibody untreated alpha-synuclein over expressing cells, which was set to 100 %.
[0033] The various figures will be more fully understood in view of the Examples set forth below.
DETAILED DESCRIPTION
[0034] In a first embodiment, the present invention is directed to improved antibodies and fragments thereof having high affinity for human a-synuclein protofibrils and low binding of a-synuclein monomers. In a specific embodiment, the antibodies are of class IgG or mutations thereof. Within the present disclosure, the high affinity for human a-synuclein protofibrils means that the antibodies or fragments exhibit a dissociation constant ¾ less than 10"7 M for human α-synuclein protofibrils. As is known in the art, protofibrils are soluble oligomers of α-synuclein. Typical protofibrils have a molecular weight in a range of from about 1000 to about 5000 kDa, suitably measured using size exclusion chromatography with globular proteins used as references, but the invention is not limited to such typical protofibrils. In addition, within the present disclosure, the low binding of a-synuclein monomers means that the binding of an antibody or fragment according to the invention to a- synuclein monomers is at least 100 times less than that to α-synuclein protofibrils. In a specific embodiment, these binding affinities are measured according to competition ELISA, for example, as described in Example 4.
[0035] The invention further relates to methods and uses of such antibodies and fragments for improvements in preventing, delaying onset of, treating, monitoring and/or diagnosing of neurodegenerative disorders with a-synuclein pathology, including, but not limited to, Parkinson's disease (PD), dementia with Lewy bodies (DLB), the Lewy body variant of Alzheimer's disease, multiple system atrophy, psychosis, schizophrenia, and Creutzfeldt- Jakob disease. In a-synucleinopathies, aggregated a-synuclein as Lewy bodies and Lewy neurites accumulate in the brain and, in some indications, also in other organs.
[0036] Examples of antibodies according to the invention have been developed by classical hybridoma techniques. The antibodies may be polyclonal or monoclonal. In a specific embodiment, the antibodies are monoclonal. While the present disclosure refers in many instances to antibodies and fragments thereof, for purposes of convenience, the term "antibody" in the present disclosure includes fragments thereof, meaning active fragments thereof, i.e. fragments having the same characteristics that are used for definition of an antibody according to the invention, namely high affinity for a-synuclein
oligomers/protofibrils and low binding of α-synuclein monomers. The antibodies and fragments thereof exhibit high efficiency in clearance of pathogenic forms of a-synuclein.
[0037] The invented antibodies bind aggregated forms, in particular protofibrils, comprising α-synuclein that is either unmodified or conjugated, for example, conjugated to 4- hydroxy-2-nonenal (HNE) or 4-oxo-2-nonenal (ONE), or other a, β-unsaturated
hydroxy alkenals, or poly-unsaturated fatty acids, that stabilize a pathogenic
protofibril/oligomeric α-synuclein epitope. Said epitope or epitopes are present on conformationally altered or modified α-synuclein, i.e. a-synuclein protofibrils and oligomers which are present in human brain from patients with a-synucleinopathies, such as, but not limited to, Parkinson's disease, DLB, etc. The invented antibodies also bind the pathogenic protofibril/oligomeric structures formed by a-synuclein mutants, e.g. A30P and A53T {Kruger et al., 1998) (Polymeropoulos et ai, 1997) that have been described to cause familial PD. Another example of such targets for antibodies of the invention are protofibrils formed by the mutant α-synuclein E46K, causing PD or DLB.
[0038] In one specific embodiment of the invention, monoclonal antibodies are provided for differentiating, diagnosing, identifying risk for developing, and/or treating a- synucleinopathology related disorders, including, but not limited to, e.g. Parkinson's disease, dementia with Lewy bodies, Lewy body variant of Alzheimer's disease, Alzheimer's disease, Down's syndrome, multiple system atrophy, psychosis, schizophrenia, Creutzfeldt-Jakob disease and other neurodegenerative disorders.
[0039] The antibodies and fragments of the invention comprise defined amino acid sequences of the CDRl-3 regions on the variable light (VL) and variable heavy (VH) chains from antibodies having high affinity for soluble α-synuclein protofibrils containing the "PD and or DLB disease epitope." In specific embodiments, the CDR regions are combined with modifications of the Fc region to modulate effector functions such as, but not limited to, Fc receptor binding, complement factor Clq binding, effecting half-life, complement activation and inflammation processes . The constant region of an antibody has many important functions notably binding Fc -receptors and complement factor Clq. The latter function can be inactivated to avoid inflammatory reactions.
[0040] The inventive antibodies and fragments having high affinity for a-synuclein protofibrils and low binding to α-synuclein monomers have the following distinct advantages as compared to other known immunotherapeutic treatment modalities: 1) The inventive antibodies and fragments target and inactivate or at least reduce disease causing a-synuclein protofibrils, e.g. by inhibition of oligomerization (see Example 10) or by other mechanisms.
2) The high affinity for a-synuclein protofibrils exhibited by the inventive antibodies and fragments reduces the clinical dose needed for an effective treatment.
3) The inventive antibodies and fragments provide a modality for accurate dosing in
elderly patients compared to an active immunization strategy, such as vaccine.
4) The low binding to α-synuclein monomers in the periphery/systemically thus allow more antibodies/fragments to be available for binding and elimination of a-synuclein oligomeric forms in the brain.
5) The antibodies and fragments reduce the risk for inflammatory side-effects, e.g.
meningioencephalitis, by low or no binding to complement factor Clq.
[0041] One aspect of the invention is the discovery of the antibody amino acid sequences of the CDR regions that play an important role for binding of human wild type and mutant a- synuclein protofibrils. Antibodies having binding sites (CDR regions) according to the invention are characterized by high affinity for wild-type human a-synuclein
oligomers/protofibrils, for use as therapeutics or diagnostics.
[0042] The basic structure of an immunoglobulin (IgG) molecule comprises two identical light chains and two identical heavy chains linked together by disulphide bridges. The light chain, which is either lambda or kappa, has a variable region (VL) and a constant region (CL) of approximately 110 amino acid residues each. The heavy chain has a variable region (VH) of about 110 amino acid residues, but a much larger constant region (CH) of 300-400 amino acid residues, comprising CHyl, CHy 2 and CHy3 regions or domains. [0043] The constant region (Fc) activates the complement system and binds to Fc receptors on macrophages, microglia and neutrophiles, which ingest and destroy infecting microorganisms or foreign/non-self antigens. This function is important since it is part of the therapeutic principle of the antibody, i.e. Fc receptor mediated microglial phagocytosis and clearance of α-synuclein protofibrils. Clearance of α-synuclein oligomeric intermediates via the lysosomal degradation pathway has been demonstrated {Lee et ai, 2004). This process involves receptor-dependent or receptor-independent endocytosis of antibody/protofibril complexes, followed by fusion with lysosomes where the α-synuclein protofibrils are degraded (Masliah et ah, 2005). Receptors that have been suggested to control this process include the Thy 1.1 receptor and the lipoprotein receptor-related protein (LPR).
[0044] Other anti- α-synuclein clearance mechanisms are likely to operate as well. The clearance of soluble α-synuclein protofibrils is a central mechanism of the treatment according to the invention, α-synuclein protofibrils are considered highly neurotoxic, initiating and driving the disease process. Clearance of α-synuclein protofibrils in the brain is of significant clinical value. In addition to clearance of α-synuclein protofibrils, other a-synuclein aggregated forms including α-synuclein fibrils, will be reduced indirectly via removal of the precursor forms to α-synuclein fibrils such as α-synuclein protofibrils, dimers, trimers, tetramers and higher oligomeric forms. Different α-synuclein forms including protofibrils and fibrils, are in equilibrium. Treatment with a high affinity protofibril binding antibody and clearance of α-synuclein protofibrils by said antibody will also have the advantage to indirectly reduce other α-synuclein aggregated or oligomeric forms. Yet another mechanism of action of the antibodies would be to block or inhibit α-synuclein toxicity by binding to toxic a-synuclein species and prevent their interactions with neurons. [0045] The respective variable regions of the heavy and light chains contain three hyper variable regions called complementarity determining regions or CDRs. The CDR regions are short stretches of about 7-23, e.g.13-23, amino acids, located in the VL and VH regions. The six CDRs regions on one "arm" of the antibody form the "pocket" that binds the antigen. Several definitions of CDR-sequences are used in the literature. SEQ ID NOS: 1-21 define the inventive CDR-sequences using a first identification system, and the thus identified CDR- sequences are shown in VL and VH in monoclonal antibodies specific for human wild-type and mutant a-synuclein protofibrils in Table 1 (see Example 2) by the underlined regions. SEQ ID NOS: 22-55 identify the inventive CDR-sequences using the known Kabat system, and the thus identified Kabat CDR-sequences are shown in VL and VH in antibodies specific for human wild-type and mutant a-synuclein protofibrils in Table 2 (see Example 2) by the underlined regions. The identification of the inventive CDR-sequences according to Kabat (SEQ ID NOS: 22-55) are used in the present disclosure.
[0046] Thus, in one embodiment, an antibody according to the invention is characterized by having the six CDR sequences (VH-CDR-1, VH-CDR-2, VH-CDR-3, VL-CDR-1, VL- CDR-2, and VL-CDR-3) selected from each of the following respective groups of CDR sequences, in any combination.
VH CDR-1
GFTFNTYAM SEQ ID NO: 1 GFTFNTYAMN SEQ ID NO: 22
GFTFSNYAM SEQ ID NO: 2 GFTFSNYAMS SEQ ID NO: 23
GFTFSSYAM SEQ ID NO: 3 GFTFSSYAMS SEQ ID NO: 24
GDSFTSGYW SEQ ID NO: 4 GDSFTSGYWN SEQ ID NO: 25
GFSLTSYGVH SEQ ID NO: 26
GFTFTDYYMS SEQ ID NO: 27
VH CDR-2
RIRTKSNDYATYYADSVKG SEQ ID NO: 5 RIRTKSNDYATYYADSV SEQ ID NO: 28
TVTSGGSYTYYPDSVRG SEQ ID NO: 6
TVTSGGSYTYYPDSV SEQ ID NO: 29
TISNGGS YT Y YPD S VKG SEQ ID NO: 7
TISNGGS YT Y YPD S V SEQ ID NO: 30
YIRYSGNTYYNPSLKS SEQ ID NO: 8
YIRYSGNTYYNPSL SEQ ID NO: 31
VIWRGGSTDYSAAF SEQ ID NO: 32
TISTGGSYTYYPDSV SEQ ID NO: 33
FIRNKANGYTTEYSASV SEQ ID NO: 34
VH CDR-3
VGYRPYAMDY SEQ ID NO: 9 (SEQ ID NO: 35)
QNFGSRGWYFDV SEQ ID NO: 10 (SEQ ID NO: 36)
HSDYSGAWFAY SEQ ID NO: 11 (SEQ ID NO: 37)
SYYDYDRAWFAY SEQ ID NO: 12 (SEQ ID NO: 38)
LLRSVGGFAD SEQ ID NO: 39
DYGNYAMDY SEQ ID NO: 40
VL CDR-1
RSSQNIVHSNGNTYLE SEQ ID NO: 13 (SEQ ID NO: 41)
RSSQSIVNSNGNTYLE SEQ ID NO: 14 (SEQ ID NO: 42)
SASSSVSYMY SEQ ID NO: 15 (SEQ ID NO: 43)
RSSQSLVHSNGNTYLH SEQ ID NO: 16 (SEQ ID NO: 44)
RSSQTIVHNNGNTYLE SEQ ID NO: 45
KSSQSLLYSSNQKNYLA SEQ ID NO: 46
VL CDR-2 KVSNRFS SEQ ID NO: 17 (SEQ ID NO: 47)
RTSNLAS SEQ ID NO: 18 (SEQ ID NO: 48)
WASTRES SEQ ID NO: 49
VL CDR-3
FQGSHVPLT SEQ ID NO: 19 (SEQ ID NO: 50)
QQYHSYPYT SEQ ID NO: 20 (SEQ ID NO: 51)
SQSTHVPWT SEQ ID NO: 21 (SEQ ID NO: 52)
FQGSHVPFT SEQ ID NO: 53
QQFHSYPYT SEQ ID NO: 54
QQYYSYPYT SEQ ID NO: 55
[0047] One of the antibodies that was initially selected for certain interesting characteristics was rejected as it did not fulfil the criteria defining an antibody according to the present invention. An important parameter for this rejection was the comparatively short
VH CDR-3 sequence with five amino acids exposed by this antibody. Therefore, it is concluded that the VH CDR-3 sequence needs to be more than 5 amino acids. In specific embodiments, the VH CDR-3 sequence is 9, 10, 11 or 12 amino acids.
[0048] In specific embodiments, the antibodies and fragments according to the invention have the six CDR sequences selected from the following combinations:
SEQ ID NOS: 22, 28, 35, 41, 47 and 50,
SEQ ID NOS: 23, 29, 36, 42, 47 and 50,
SEQ ID NOS: 24, 30, 37, 43, 48 and 51,
SEQ ID NOS: 25, 31, 38, 44, 47 and 52,
SEQ ID NOS: 26, 32, 39, 45, 47 and 53,
SEQ ID NOS: 23, 33, 37, 43, 48 and 54, and
SEQ ID NOS: 27, 34, 40, 46, 49 and 55.
[0049] In additional specific embodiments, antibodies providing desirable specificity for a-synuclein protofibrils while fulfilling other important characteristics defined herein have the six CDR sequences of the antibody or fragment selected from the following respective groups:
VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
VH CDR-3 SEQ ID NO: 36
VL CDR-1 SEQ ID NOS: 42, 43, 44 or 45
VL CDR-2 SEQ ID NOS : 47 or 48
VL CDR-3 SEQ ID NOS: 50, 51 , 52 or 53 or selected from the following respective groups:
VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
VH CDR-3 SEQ ID NO: 37
VL CDR- 1 SEQ ID NOS : 42, 43 , 44 or 45
VL CDR-2 SEQ ID NOS : 47 or 48
VL CDR-3 SEQ ID NOS: 50, 51, 52 or 53 or selected from the following respective groups:
VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
VH CDR-3 SEQ ID NO: 38
VL CDR-1 SEQ ID NOS: 42, 43, 44 or 45
VL CDR-2 SEQ ID NOS : 47 or 48
VL CDR-3 SEQ ID NOS: 50, 51 , 52 or 53 or selected from the following respective groups:
VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
VH CDR-3 SEQ ID NO: 39
VL CDR- 1 SEQ ID NOS : 42, 43 , 44 or 45
VL CDR-2 SEQ ID NOS : 47 or 48
VL CDR-3 SEQ ID NOS: 50, 51, 52 or 53. [0050] As noted previously, the a-synuclein protofibril binding antibodies and fragments according to the invention are characterized by high affinity for the target. The high affinity, expressed as the dissociation constant ¾, is less than 10~7 M. In additional embodiments, the dissociation constant ¾ for human a-synuclein protofibrils is less than 10~8 M, less than 10~9 M, less than 10"10 M, or even less than 10"11 M. These antibodies and fragments have the advantage that they can be administered at lower doses compared to antibodies with affinities around 10~6 M or higher. This has a significant clinical advantage as these high affinity antibodies, which can be administered by injection, can be given subcutaneously since only a low amount of the antibody is needed to achieve efficacy. Administration modalities are not limited to subcutaneous or intravenous injections. Furthermore, the lower doses needed for efficacy will reduce cost of goods for production of the antibody.
[0051] In addition to the high affinity of the antibodies for α-synuclein protofibrils, the antibodies and fragments exhibit low binding to α-synuclein monomers, and optionally low binding to α-synuclein fibrils. As noted above, the low binding to α-synuclein monomers means that the binding of an antibody or fragment according to the invention to a-synuclein monomers is at least 100 times less than that to α-synuclein protofibrils. In more specific embodiments, the binding of an antibody or fragment according to the invention to a- synuclein protofibrils is more than 500 times or even more than 1000 times greater than that to α-synuclein monomers.
[0052] In another embodiment, the antibodies and fragments exhibit low binding to a- synuclein fibrils. In more specific embodiments, the binding of an antibody or fragment according to the invention to α-synuclein protofibrils is more than 100 times, more than 500 times, or even more than 1000 times, greater than that to α-synuclein fibrils. [0053] In yet another embodiment of the invention, the antibodies and fragments exhibit low binding to beta amyloid (Αβ) protofibrils (e.g. ¾>10"5 M) and beta amyloid monomers (e.g. ¾>10-5 Μ).
[0054] In yet another embodiment of the invention, the antibodies and fragments exhibit low binding to β-synuclein monomer, γ-synuclein monomer, IAPP (islet amyloid
polypeptide), and/or the Medin polypeptide, e.g. the binding of the antibodies and fragments is at least 100 times less to one or more of these peptides/proteins than that to the human a- synuclein protofibrils.
[0055] According to another embodiment of the invention, the antibody or fragment according to the present invention can be defined by the binding in a model system to a linear epitope in a-synuclein within the amino acid (aa) region 113-140, e.g. aa region 113-131, with aa 125-131, 121-124, 121-127, 121-131, 113-123 and 136-140 as examples of specific epitopes. In this model system, 15-mer a-synuclein peptides with an 11 amino acid sequence overlap are used (see Example 3 below).
[0056] According to an additional embodiment of the invention, an antibody or fragment is provided, having high affinity for human α-synuclein protofibrils and low binding of a- synuclein monomers, and comprising a combination of one CDR-sequence selected from each of the six CDR sequence groups of SEQ ID NOS: 22-27, 28-34, 35-40, 41-46, 47-49 and 50- 52, and sequences having greater than 70, 80, 90, 95 or 98% similarity with any of said sequences in each respective group. The antibody or fragment binds to an epitope within the amino acid (aa) region 113-140, e.g. aa region 113-131, and in particular the epitopes aa 125- 131, 121-124, 121-127, 121-131, 113-123 or 136-140, of immobilized linear α-synuclein in a model system comprising 15-mer α-synuclein peptides with 11 amino acids overlap. [0057] According to another specific embodiment of the invention, the high affinity a- synuclein protofibril binding antibodies can reduce or inhibit a-synuclein aggregation, thereby reducing levels of soluble oligomeric α-synuclein forms in the brain.
[0058] According to another specific embodiment of the invention, the high affinity a- synuclein protofibril binding antibodies can bind α-synuclein oligomers/protofibrils outside the CNS as well, thereby shifting the equilibrium of said α-synuclein forms over the blood brain barrier in such a way as to lower CNS levels of said α-synuclein forms (drainage).
[0059] According to another specific embodiment of the invention, the antibodies are of IgG class, suitable for therapeutic use which can pass over the blood brain barrier. The high affinity α-synuclein protofibril binding IgG antibodies may be engineered to reduce complement factor Clq binding to the CH2 domain of IgGl and reduce complement activation and risk of inflammation. This modification can be done in several different ways. One way is to make a chimeric antibody where the CHy2 domain of the IgGl constant region has been deleted and exchanged for the corresponding domain from IgG4 or part of the domain that confers Clq binding. It is well established that IgG4 does not bind Clq and hence does not activate the complement cascade. To achieve this, the constant region of the heavy chain (CH) is engineered is such a way as to combine the high affinity Fc-receptor domain (CHy3) on IgGl with the IgG4 domain (CHy2) which has no binding for the complement factor Clq. This new antibody containing the chimeric constant heavy chain (IgGl :CHyl, CFty2:IgG4, CFty3:IgGl) has the important properties of both efficient clearance of α-synuclein protofibrils through Fc-receptor mediated phagocytosis and reduced risk for side-effects, i.e., inflammation such as meningioencephalitis.
[0060] Yet another way of reducing the risk of inflammation is to alter the
oligosaccharide structure of the antibody which will reduce complement factor Clq binding and complement activation. Thirty different structures of the complex biantennary oligosaccharides at Asn-297 in human IgGl have been described. The absence of CH2 associated carbohydrates is believed to cause a conformational change in the "hinge" region of the antibody, reducing interaction efficacies with effector molecules and loss of complement activation function and Clq binding.
[0061] The modification of a high affinity human a-synuclein protofibril binding antibody by site-directed mutagenesis of Asn-297 to any other amino acid will generate an antibody of retained Fc-receptor binding with less Clq binding and hence reduced risk of inflammation, in particular at the blood brain barrier. An alternative to modify the glycosylation on the antibody is to express the antibody in a cell type where the enzyme N-acteylglucosaminyl- transferase I has been inactivated. This will yield an antibody with altered carbohydrate structure at Asn-297. A structure of Man5GlcNAc2, but not limited to this structure, is formed. This carbohydrate modification will reduce complement factor Clq binding and inhibit inflammation (Wright et al. 1998). Alternatively, aglycosylated protofibril binding antibodies can be achieved by culturing cells expressing antibodies in the presence of tunicamycin, which inhibits glycosylation. These antibodies will have altered complement activating activity as well as altered Fc-receptor function (Leatherbarrow et al. 1985). Screening of clones expressing antibodies with low complement activation and high Fc-receptor binding will generate protofibril binding antibodies that exhibit high Fc-mediated clearance of a- synuclein protofibrils and low Clq binding.
[0062] In another embodiment, the high affinity human a-synuclein protofibril binding antibody is of IgG subclass, e.g. IgGl or IgG4, where the complement factor Clq binding site has been modified, i.e. Pro331>Ser331 (Xu et al. 1994), in such a way as to reduce or inhibit binding of complement factor Clq. Such antibodies are particularly suitable for administration, i.e., for the treatment, prevention or delaying onset of a neurodegenerative disorder with a-synuclein pathology, in an individual with such a disorder or at risk of developing such a disorder, for example, but not limited to, an individual having or at risk of developing PD. The proline residue at position 331 in human IgGl can also be changed to a threonine or glycine or any other polar amino acid. This modification can be achieved by standard molecular biology techniques such as site-directed mutagenesis or DNA deletions.
[0063] Yet another aspect of the invention is the use of high affinity human a-synuclein protofibril binding antibodies to specifically determine protofibril levels in human or animal tissues, for example, in cerebrospinal fluid (CSF), blood, urine, saliva, or brain tissue, as a diagnostic tool or biomarker for, or for monitoring, a neurodegenerative disorder with a- synuclein pathology. Parkinson's disease (PD), dementia with Lewy bodies (DLB), the Lewy body variant of Alzheimer's disease, multiple system atrophy, psychosis,
schizophrenia, and Creutzfeldt-Jakob disease are exemplary only of such neurodegenerative disorders with α-synuclein pathology. For example, levels of human α-synuclein protofibrils in CSF or blood of a PD patient are likely to be different as compared to a matched elderly control group not having Parkinson's disease or any other a-synucleinopathy. A person who is developing Parkinson's disease or any other α-synucleinopathy is likely to have altered levels of α-synuclein protofibril levels in CSF or blood compared to control subjects. Hence, determination of α-synuclein protofibril levels in CSF or blood can provide an early diagnosis of the disease. This is possible to achieve with the new high affinity α-synuclein protofibril binding antibodies according to the invention and, in a specific embodiment, may be achieved in combination with a sandwich ELISA method (see Example 5), where a-synuclein protofibrils have been determined down to 9 pM level. Interference of other a-synuclein forms, particualrly a-synuclein monomers, and optionally a-synuclein fibrils and a-synuclein fragments in the assay, is negligible.
[0064] Examples of suitable methods for assaying α-synuclein protofibrils in these tissues as well as in cell cultures using an anti-a-synuclein protofibril antibody comprise
immunoassays such as ELISA, RIA, Western blotting or dot blotting. These methods are suitable to follow treatment efficacy as measured by protofibril reduction in clinical trials and/or as a diagnostic test. Since α-synuclein protofibrils levels are very low in CSF and blood, the high affinity α-synuclein protofibril binding antibody of the invention is advantageous for a diagnostic test, for example, based on an ELISA method, to allow measurement of low levels of α-synuclein protofibrils.
[0065] According to such methods, the antibody or fragment according to the invention is added to a biological sample comprising or suspected of comprising α-synuclein protofibrils, and the presence of a complex formed between α-synuclein protofibril and the antibody or fragment is detected. The complex may be detected qualitatively, i.e., the presence of the complex is detected, or quantitatively, i.e., a concentration of the complex or a threshold concentration of the complex, may be detected, as desired.
[0066] In additional embodiments, the invention includes the use of the high affinity protofibril specific antibodies and fragments in imaging for detection, localization and quantitation of α-synuclein protofibrils in human and animal tissues. The antibody or fragment may be labelled with a detectable label, for example, a radioactive ligand such as I131, C14, H3 or Gallium68, but not limited to these radioisotopes, and contacted with a sample or administered for detection purposes. Such methods are suitable as a diagnostic tool for neurodegenerative disorders with α-synuclein pathology, including, but not limited to, Parkinson's disease, dementia with Lewy bodies and other α-synuclein related neurodegenerative disorders. In a specific embodiment, such methods may be conducted to monitor the development of an a-synuclein related disease in a subject without or under medication or other possible treatment.
[0067] Therefore, in one aspect of the invention the antibodies are added to a biological sample comprising or suspected of comprising a-synuclein protofibrils, the concentration of the complex formed between said protofibril and said antibody is measured for detection and/or quantification of protofibrils in the sample. In specific embodiments, the detection methods include immunoassay and proximity ligation assay. The biological sample may be an in vitro sample taken from a subject as well as an in vivo liquid volume.
[0068] Yet another aspect of the invention is to make the antibody species specific for use in veterinary medicine. The diagnostic methods outlined are also suitable for veterinary use.
[0069] Another aspect of the invention is the humanization of said antibodies to avoid side-effect, i.e. to avoid an immunoresponse against the antibodies in humans when used as a therapeutic or diagnostic agent. Such humanization techniques are within the ability of one of ordinary skill in the art.
[0070] The pharmaceutical compositions according to the invention comprise an antibody or fragment as described herein, and a pharmaceutically acceptable carrier. In a specific embodiment for therapeutic use, the compositions are physiologically acceptable formulations comprising a therapeutically active amount of an antibody or fragment according to the invention in a physiological buffer, for example, but not limited to, PBS, suitable for administration to humans and/or animals. The antibody or fragment can be freeze dried for better stability. The freeze dried formulation may contain any suitable conventional excipients, including stabilizers, lyoprotectants, buffers, and the like, such as, but not limited to, mannitol, for protecting and/or stabilizing the product during and/or after freeze drying and/or subsequent storage.
[0071] Optionally, the antibody formulation may contain an antibacterial agent or other preservative or additive which does not interfere with the function or efficacy of the protofibril binding antibody or fragment.
EXAMPLES
[0072] The following examples are provided for illustration and are not intended to limit the invention to these specific examples.
Example 1
α-synuclein protofibril antibodies
Immunization/Poly clonal antibodies
[0073] In the immunization scheme, Balb/C mice are utilized. As antigen, HNE stabilized α-synuclein protofibrils are used. These are produced as previously described (WO
2009/133521, incorporated herein by reference), with the following exception: a 60: 1 ratio between HNE and α-synuclein is used. For immunization, mice are injected with HNE stabilized α-synuclein protofibrils and adjuvant (e.g. 3-6 times). One booster injection containing HNE-modified α-synuclein protofibrils was carried out prior to the mice being sacrificed. Blood from immunized mice was analyzed for reactivity toward a-synuclein protofibrils and α-synuclein monomers. The specificity of the polyclonal antibody response was analyzed by a direct ELISA. In a typical experiment, a flat bottom high binding 96-well polystyrene microtiter plate is coated with monomeric α-synuclein (unmodified or modified with HNE or other aldehydes), protofibrils/oligomeric α-synuclein (unmodified or modified with HNE or other aldehydes) or fibrillar α-synuclein, at a final concentration of 400 ng/well.
The wells are blocked with 2% BSA, washed with 0.05% Tween-20/ PBS and cell media supernatants (undiluted or diluted 1 : 1 with phosphate-buffered saline) from investigated polyclonal antibodies are added to the wells as primary antibodies. Alkaline phosphatase - conjugated goat anti-mouse mouse IgG/IgM antibody (Pierce Biotechnology, Rockford, IL, USA) is used as the secondary antibody at a dilution of 1/1000. Immunoreactivity is visualized using p-nitrophenyl-phosphate (Sigma- Aldrich, MO, USA).
[0074] In the serum, antibodies that specifically recognize a-synuclein
protofibrils/oligomers are detected. In addition, antibodies that recognize a-synuclein monomers can be found. The negative control represents a non-immunized mouse.
Hybridoma/monoclonal antibodies
[0075] Mouse B-cell hybridomas were used to produced monoclonal a-synuclein protofibril binding antibodies. Spleen cells are isolated and ground in sterile phosphate- buffered saline (PBS) and centrifuged at 1200xg for 10 min to collect a cell-rich pellet. The cells are further washed with PBS and centrifuged at 1200xg for 10 min. The cell pellet is resuspended in Dulbecco's minimum essential medium (DMEM, Invitrogen, La Jolla, CA, USA) supplemented with 1% antibiotics. Spleen cells are mixed at 1 : 1 ratio with Sp2/0 cells (mouse myeloma cell line) in DMEM. To facilitate cell fusion, 1 ml of polyethylene glycol (Sigma-Aldrich, St. Louis, MO, USA) is added to the cell mixture and the reaction is stopped with the addition of DMEM. Cells are harvested and the pellet is resuspended in DMEM supplemented with 10% (v/v) fetal bovine serum (Cambrex, Charles City, IA, USA) and also containing 1% (v/v) sodium pyruvate (Cambrex, Charles City, IA, USA), 1% (v/v) antibiotics (Sigma-Aldrich, St. Louis, MO, USA) and 1% (v/v) L-glutamine (Cambrex, Charles City, IA, USA), 5% (v/v) BM condition media (Roche Diagnostics Scandinavia, Bromma, Sweden) and 2% (v/v) HAT media supplement (Sigma-Aldrich, St. Louis, MO, USA). Cells are plated on 96 well cell culturing plates and allowed to rest and grow for 2 weeks. [0076] Hybridoma cell supernatants are analysed in a direct ELISA. In a typical experiment, a flat bottom high binding 96 well polystyrene microtiter plate is coated with monomeric a-synuclein (unmodified or modified with HNE or other aldehydes),
oligomeric/protofibrillar α-synuclein (unmodified or modified with HNE or other aldehydes) or fibrillar α-synuclein. The wells are blocked with 1% BSA, washed with PBS-Tween 20 (0.05%) and cell media supernatants (undiluted or diluted 1 :2 or 1 :5 with PBS-Tween 20 (0.05%)) from investigated hybridoma are added to the wells as primary antibodies. Horse radish peroxidase-conjugated HRP-coupled goat anti mouse Ig (Southern Biotechnology, prod. No.1010-05) is used as the secondary antibody at a dilution of 1/5000.
Immunoreactivity is visualized using K-Blue Aqueous TMB substrate (Neogen Corp. prod. No. 331177).
Example 2
Amino acid sequence of variable regions of heavy chain (VH) and light chain
(VL/Vkappa) monoclonal antibodies specific for α-synuclein protofibrils
[0077] The amino acid sequences of the variable regions of heavy chain (VH) and light chain (VL), including the CDR regions of the antibodies were determined by RT PCR of mRNA template, followed by DNA sequencing. The amino acid sequences of the variable heavy chain region (VH) and the variable light chain region (VL) for selected antibodies are shown in Table 1. The positions of the CDR regions 1-3 are underlined and shown. The amino acid sequences of the CDR regions form the structural basis for binding human wild type and mutant α-synuclein protofibrils constituting the "pathogenic epitope" of a-synuclein protofibrils.
[0078] The amino acid sequences of the CDR regions 1-3 of the respective VL and VH chains for protofibril specific antibodies according to the invention are shown in Table 1. In Table 2 CDR-sequences of a series of additional antibodies according to the invention are included.
[0079] The combined amino acid sequences of the CDRl-3 regions of the VH and VL chains create the molecular "pocket" which binds human a-synuclein wild-type protofibrils with high affinity and specificity. This "pocket" forms the structural basis of the "PD/DLB epitope". Variations in the CDR amino acid sequence length are observed in both the VH chain and the VL chain and are compatible with binding to human α-synuclein protofibrils. A shorter CDR region provides a more restricted three dimensional structure of the binding pocket of the antibody, whereas a longer CDR region is more flexible.
[0080] The CDR sequences as shown in Tables 1 and 2 are embodiments of the present invention, as are the amino acid sequences in the "mouse framework" regions of the VH and VL chains, i.e., outside the CDR regions, as well as the human VL and VH framework regions for protofibril specific antibodies as, but not limited to, those.
[0081] Other amino acid substitutions in the CDR regions than what are shown in Tables 1 and 2 are compatible with high affinity and high specificity binding to human a-synuclein protofibrils. Where a polar amino acid is present in a particular position in a CDR region that particular amino acid can be substituted by another polar amino acid, with retained or improved high affinity and specificity binding to α-synuclein protofibrils. Likewise, if a non- polar or negatively or positively charged amino acid is present at a certain position, that amino acid can be substituted by a similar amino acid from the same polarity group.
[0082] As a particular amino acid or amino acids may exchanged in any position in the CDR regions by functional equivalents that confer substantially the same function and structure to the antibody with regard to affinity for α-synuclein protofibrils, such constructs are of course within the scope of the present invention. In this regard, antibodies and fragments having greater than 70, 80, 90, 95 or 98% similarity with one of the previously indicated VH CDR and VL CDR sequences of the respective groups, with the maintained epitope binding as described herein, are within the scope of the present invention.
Table 1. Amino acid sequence of variable regions of heavy chain (VH) and light chain (VL/Vkappa) from four different monoclonal antibodies specific for human wild-type and mutant a-synuclein protofibrils. Positions of the various CDR regions 3) are underlined in VL and VH. Antibodies BA1-BA4 are examples of high affinity protofibril specific antibodies according to the invention.
VH-BA1 : 49/G (SEQ ID NO: 56)
EVQLVETGGGLVQPKGSLKLSCATSGFTFNTYAMNWVRQAPGKGLEWV/^RIRTKSNDYATYYADSVKGRITISRDDSQSMLYLQMNNLKTEDTAMYYCVRVGYRPYAMDYWGQGTSVTVSS
VH-BA2: 38E2/7 (SEQ ID NO: 57)
EVQLVESGGDLVKPGGSLKFSCAASGFTFSNYAMSWRQTPDKRLEWATVTSGGSYTYYPDSVRGRFTISRDNAKNTLYLQLSSLKSEDTAMYFCARQNFGSRGWYFDVWGAGTTVTVSS
VH-BA3: 38Fl l/2_8 (SEQ ID NO: 58)
EVMLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISNGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCARHSDYSGAWFAYWGQGTLVTVSA
VH-BA4: 48B11/8 (SEQ ID NO: 59)
EVQLQESGPSLVKPSQTLSLTCSVTGDSFTSGYWNWIRKFPGNKLEYMGYIRYSGNTYYNPSLKSRISITRDTSKNQYYLQLISVTTEDTATFYCARSYYDYDRAWFAYWGQGALVTVSA
Vkappa-BAl : 49/G (SEQ ID NO: 60)
DVLMTQTPLSLPVSLGDQASISCRSSQNIVHSNGNTYLEWYLQKPGQSPTLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELK
Vkappa-BA2: 38E2/7 (SEQ ID NO: 61)
DVLMTQTPLSLPVSLGDQASISCRSSQSIVNSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTTLELK
Vkappa-BA3: 38Fl l/2_8 (SEQ ID NO: 62)
QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQQKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQYHSYPYTFGGGTKLEIK
Vkappa-BA4: 48B 11/8 (SEQ ID NO: 63)
DWMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK
Table 2: Amino acid sequences of variable regions of heavy chain and light chain from eight different antibodies specific for human wild-type and mutant a-synuclein protofibrils. Positions of the various CDR-regions according to the Kabat system are marked. The antibodies are examples of high affinity protofibril specific antibodies according to the invention. The Heavy Chains are respectively SEQ ID NOS: 64-71 and the Light Chains are respectively SEQ ID NOS: 72-79.
Heavy Chains
VS S VS S VSA VSA VSA VSA VSA VS S t
Figure imgf000034_0001
Example 3
Epitope mapping of a-synuclein protofibril specific monoclonal antibodies
[0083] Epitope mappings of the antibodies were performed by immunoblotting on
PepSpots membrane. Synthetic peptides spanning the entire sequence (amino acids 1-140) of human a-synuclein were custom synthesized by JPT Peptide Technologies (a subsidiary of
Sigma Aldrich, UK) and immobilized on the PepSpots membrane. The 33 synthesised 15-mer peptides were designed with 11 amino acid sequence overlap. The peptides were covalently bound to a Whatman 50 cellulose membrane (Whatman, England) by the C-terminus and have usually an acetylated N-terminus due to a higher stability to degradation. The uncharged N-ac better represents the region in the native antigen then a charged NH3+-group. The results are set forth in Table 3.
Table 3:
Antibody Epitope Amino acid residue
49/G YEMPSEE 125-131
38E2/7 DNEAYEM 121-127
38Fll/2_8 LEDMPVDPDNE 113-123
48B11/8 DNEA 121-124
47E7/3_47 DNEAYEM 121-127
37D2/14 LEDMPVDPDNE 113-123
43B9/1_4 YEPEA 136-140
38E10/13_6_4 DNEAYEMPSEE 121-131
Human α-synuclein (SEQ ID NO: 80)
I 1 0 20 3 0 4 0 5 0
I I I I I ]
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGWH
5 1 6 0 70 8 0 90 1 0 0
I I I I I I
GVATVAEKTKEQVT VGGAWTGVTAVAQKTVEGAGSIAAATGFVKKDQL
10 1 11 0 12 0 13 0 140
I I I I I
GKNEEGAPQEGILEDMPVDPD EAYEMPSEEGYQDYEPEA [0084] Alternatively, epitope mapping of the antibodies were performed by
immunoblotting on PepSpots membrane (Sigma Aldrich) as follows: Synthetic peptides spanning the C-terminal sequence of human a-synuclein from amino acid 100 to 140 were custom synthesized and immobilized on the PepSpots membrane (Sigma Aldrich). The 30 synthesised 10-mer peptides were designed with 9 amino acid overlap. The results are shown in Table 4.
Table 4:
Antibody Epitope Amino acid residue numbers of SEQ ID NO: 80
38E2/7 EAYEMP 123-128
47E7/3_47 NEAY 122-125
[0085] Accordingly, the length and precise position of the epitope depends on the method used for determination.
Example 4
Characterization of high-affinity human a-synuclein protofibril binding monoclonal antibodies by competition ELISA
[0086] This example shows four antibodies (mAb49/G, mAb38E2/7, mAb38Fl l/2_8 and mAb48B l l/8). These antibodies show high affinity to α-synuclein protofibrils and low cross- reactivity (binding) to α-synuclein monomers, as measured by means of the competition ELISA assay described below. Briefly, the anti-a-synuclein antibody to be tested is allowed to interact in solution with α-synuclein monomers or protofibrils and thereafter the mix is added to a microtiter plate precoated with α-synuclein protofibrils. If the antibody binds to the antigen in the pre-incubation step, fewer antibodies will bind to the immobilized antigen on the microtiter plate. Antibody bound to the immobilized antigen is detected by an alkaline phosphates enzyme (ALP) conjugated secondary antibody. The conjugate is incubated with ALP substrate (pNPP) generating a yellow color that can be detected in a microtiter plate reader at 405 nm. Consequently, a low OD value reflects a high affinity of the antibody to the antigen in solution.
[0087] Specifically, a high-binding ELISA microtiter plate was coated with 100 μΐ/well of 1 μg/ml of a-synuclein protofibril, diluted in lxPBS, sealed with adhesive sealer and incubated overnight at +4°C. Then, the coating solution was discarded and the residual binding capacity of the plate was blocked by adding 200 μΐ/well of PBS-Tween 20 (0.05%). The sealed plate was incubated for 60 min at room temperature ( .T.) by shaking at 900 rpm.
[0088] Meanwhile, peptide solution was prepared in lx PBS-Tween 20 (0.05%) by diluting a-synuclein monomers or protofibril to a concentration of 140 nM. A 10-step 3x dilution series of α-synuclein monomers and protofibrils was performed in a volume of 50 μΐ in a round bottomed, low protein binding microtiter plate. To this solution, 50 μΐ of the tested antibody diluted in PBS-Tween 20 (0.05%) to a concentration of 100 ng/ml was added and allowed to interact for 60 min at R.T. by shaking at 900 rpm. Sub sequentially, these pre- incubated samples were added to the washed (3x wash) coated high-binding plate and allowed to incubate for 15 min at R.T. without shaking. The ELISA plate was then washed to remove unbound antibodies. Bound antibodies were detected with 100 μΐ of ALP-coupled anti-mouse- IgG (Mabtech, Sweden 3310-4) in diluted 1/1000 in PBS-Tween 20 (0.05%) incubated for 60 min at R.T. by shaking at 900 rpm.
[0089] Finally, the ELISA plate was washed to remove unbound antibodies and 100 μΐ of ALP-substrate were added to each well. The plate was kept dark during incubation at R.T. until a yellow color developed. Absorbance values were measured on continuous mode at a wavelength of 405 nm every 15 minutes up to 120 minutes. Measurements were used for IC50 determinations only if there was linearity between time and absorbance. [0090] IC50 values were calculated as the concentration of either monomers or protofibrils needed to quench half of the signal in the ELISA. The concentration of either a- synuclein monomers or protofibrils used in this method was determined by means UV-SEC, using a commercial a-synuclein standard as reference (cat. S-1001-1, rPeptide, USA, 0.5 mg as determined with BCA). Fig. 1 shows the absorbance at 450 nm for the four protofibril specific monoclonal antibodies as determined by the described competition ELISA. The assay was performed with HNE-stabilized α-synuclein protofibrils.
[0091] Further ELISA experiments show that the candidate antibodies display the same affinity for human α-synuclein protofibrils stabilized by HNE or ONE. The antibodies also bind α-synuclein protofibrils/aggregates composed of A30P or A53T α-synuclein mutants stabilised by HNE as demonstrated by means of competition ELISA.
[0092] Specifically, Figs. 2A and 2B show the results of the protofibril specific antibody mAb49/G analysed by a competition ELISA. Protofibril specific monoclonal antibody mAb49/G binds with high affinity to human α-synuclein protofibrils stabilized by either HNE or ONE (Fig. 2A). The monoclonal antibody also binds with high affinity to HNE-stabilized protofibrils of human mutated forms of α-synuclein, A30P and A53T (Fig. 2B). Aggregation of α-synuclein monomers with ONE generates two distinct populations of complexes, as defined by size exclusion chromatography. These two distinct peaks were separately eluted and labelled as FP-ONE_large and FP-ONE_small.
[0093] Additionally, Figs. 3A-3C show the results of additional protofibril specific antibodies 38E2/7, 38F11/2_8 and 48B11/8, analysed by a competition ELISA. The protofibril specific monoclonal antibodies bind with high affinity to wild type human a- synuclein protofibrils stabilized by either HNE (PF-HNE) or ONE (PF-ONE). The monoclonal antibodies also bind with high affinity to HNE-stabilized protofibrils of human mutated forms of alpha synuclein, A30P (A30P-HNE) and A53T (A30P-HNE).
Example 5
Establishment of an a-synuclein protofibril specific sandwich ELISA
[0094] To enable measurements of α-synuclein protofibrils in biological samples, a sandwich ELISA with mAb49/G as both the capturing antibody and the detecting antibody was established. This assay measures α-synuclein protofibrils with limit of quantification
LOQ=9 pM (see Fig. 4B). Due to uncertainties concerning the size of the a-synuclein protofibrils used in the standard curve, the concentration in pM is based on the molecular weight of one α-synuclein monomer (14,000 g/mol). Because the molecular weight of a protofibril has been estimated, by size exclusion chromatogarphy, to be at least 1,000,000 g/mol, the limit of detection calculated as molar α-synuclein protofibrils could be as low as
0.13 pM .
[0095] α-synuclein protofibrils stabilized by HNE and monomeric α-synuclein were used to validate the conformation specificity of the ELISA.
[0096] An ELISA composed of two identical antibodies requires at least a dimer of a protein to produce a signal. However, a large excess of monomeric α-synuclein, which may naturally occur in biological samples, could interfere with the α-synuclein protofibril analysis by occupying binding sites of the capture antibody coat, thus inhibiting the protofibrils from binding. This problem was investigated by adding an increasing excess of a-synuclein monomer to a fixed concentration of α-synuclein protofibrils (500 pM, expressed as monomer units) and analyzing it with the mAb49/G ELISA. A 30 000- fold molar excess of a-synuclein monomer (15 μΜ), as compared to α-synuclein protofibrils (500 pM), did not disturb the measurements with the mAb49/G sandwich ELISA, as expected since α-synuclein monomer binds poorly to the capture antibody. [0097] Fig. 4A shows a schematic illustration of the ELISA binding for quantification of a-synuclein protofibrils by sandwich ELISA. Fig. 4B shows the standard curve generated with HNE- stabilized α-synuclein protofibrils. The assay performance reached a limit of quantification, LOQ=9 pM.
Example 6
Analysis of diseased and control human brain extracts with α-synuclein protofibril specific sandwich ELISA
[0098] A brain extraction protocol using different detergents was performed, generating three different extracts: TBS extract (Frig. 5A, white bar) comprising extracellular and cytosolic α-synuclein species; Triton extract (Fig. 5A, striped bar) comprising membrane- associated α-synuclein species; and SDS extract (Fig. 5B, black bar), comprising SDS-soluble α-synuclein species. Brain extracts were analyzed from a patient diagnosed with the a- synucleinopathy dementia with lewy bodies (DLB). Brain tissue from cortex and substantia nigra was analyzed. As a control, brain tissue from cortex of a subject without detectable immunohistochemical Lewy body pathology was also analyzed. The sandwich ELISA was based on the α-synuclein protofibril specific mAb49/G as both the capturing antibody and the detection antibody. Figs.5A and 5B show the results of the analysis of diseased and control human brain extracts with α-synuclein protofibril specific sandwich ELISA. The assay allows for the quantification of protofibrils at levels > 9 pM (limit of quantification; LOQ=9 pM).
Example 7
Measurement of α-synuclein protofibrils in brain extract from a PD transgenic mouse model
[0099] The presence of α-synuclein protofibrils in cell and mouse models have been suggested, though until now there has been no method for direct assaying of a-synuclein protofibrils in biological samples. The mAb49/G sandwich ELISA therefore provides the first opportunity to measure a-synuclein protofibril levels in biological samples and mouse models of a-synucleinopathies, characterised by the accumulation of aggregated a-synuclein.
[00100] Brain extract samples from transgenic mice over-expressing human a-synuclein A53T mutant were compared with samples from wild type mice. Brains were homogenized in TBS or TBS+tween and centrifuged prior to analysis in order to recover the soluble a- synuclein fraction. Measurements of α-synuclein protofibril levels in the TBS-soluble fractions of non-transgenic mouse brain homogenates were compared to transgenic mice (Kahle model) (Fig. 6). To ensure that all α-synuclein measured in this assay was in a soluble state, all samples were centrifuged for 5 min at 16000 x g before analysis. Levels of a- synuclein protofibrils were measured in brains from 5 month old transgenic mice with a- synuclein pathology.
[00101] Fig. 6 shows the results of the analysis of brain extracts of control mice (ntg, non transgenic) and 5 month old mice from Khale transgenic (tg) mouse PD model in which the y axis represents the absorbance at OD450.
Example 8
Immunohistochemical (IHC) analysis of human brain tissue
[00102] Cortex and substantia nigra from PD and DLB patients was used to perform immunohistochemical (IHC) analysis as described (Oinas et al. 2010). As control, cortex and substantia nigra from age-matched non-diseased patients was used. Positive antibody control for α-synuclein was a mouse anti- α-synuclein mAb (BD 610787).
[00103] Binding to Αβ plaques was evaluated as follows: two consecutive slides from the cortex of an AD patient were treated to display antigens and incubated with either a positive anti-Αβ mAb (mAbl58, BioArctic) or with each one of the candidate antibodies. The bound antibody was detected by a secondary anti-species specific antibody coupled to horse radish peroxidase (HRP). The conjugate was then incubated with the HRP substrate DAB, generating a colored precipitate which was detected by light microscopy. The region in which Αβ plaques were detected by means of a colored precipitation in the positive control was analyzed in the co respective area in the slides treated with the candidate antibody. The lack of a colored precipitation was evaluated visually and interpreted as a lack of binding to Αβ plaques by the candidate antibodies.
[00104] Fig. 7A shows 38E2/7 binding of Lewy bodies and neurites in PD substantia nigra and a positive α-α-synuclein control. Fig. 7B shows 38E2/7 binding of Lewy bodies and neurites in DLB cortex and substantia nigra and a positive α-α-synuclein control. Fig. 7C shows various antibodies binding Lewy bodies and neurites in DLB cortex and substantia nigra and a negative control. Fig. 7D shows various antibodies binding Lewy bodies and neurites in PD substantia nigra and a negative control. Fig. 7E shows no binding of 38E2/7 in non-disease related substantia nigra and a positive α-α-synuclein control. Fig. 7F shows a comparison of 38E2/7 binding and a positive α-Αβ control in cortex of an Alzheimer's disease patient.
Example 9
Analysis of human brain extracts with immunoprecipitation (IP) and western blot
[00105] Immunoprecipitation of human brain extracts with protofibril binding monoclonal antibody 38E2/7 was conducted using western blot. A brain extraction protocol using different detergents was performed, generating four different extracts: TBS extract, comprising extracellular and cytosolic a-synuclein species; Triton extract, comprising membrane-associated a-synuclein species, SDS extract, comprising SDS-soluble a-synuclein species and FA extract, comprising insoluble α-synuclein. These extracts were
immunoprecipitated with magnetic beads, to which antibody 38E2/7 or control antibody 15P were coupled. Antibody 15P can bind to α-synuclein protofibrils and monomers equally well and is expected to pull down all species presents. Fig. 8A shows SDS extract of substantia nigra of the DLB patient while Fig. 8B shows Triton extract of substantia nigra of the DLB patient. As seen, in Figs. 8A and 8B, mAb 38E2/7 only captures α-synuclein protofibrils from DLB substantia nigra, both in the Triton and in the SDS extracts, whereas mAb 15 captures a- synuclein monomers in all extracts.
Example 10
Analysis of α-synuclein oligomerization inhibition
[00106] This example shows the antibody mAb49/G inhibits the oligomerization of a- synuclein monomers using an in vitro method in which neuronal cells are transfected with 2 vectors, both containing one copy of α-synuclein (aa 1-140) fused with either the N-terminal or the C-terminal fragment of GFP. Only those cells, in which α-synuclein has oligomerized, bringing both fragments of GFP together, will generate a green fluorescent color that can be detected with fluorescent microscopy. The presence of an antibody that can inhibit and/or disrupt oligomerization can be evaluated by comparing the fluorescence in these cultures, compared to a control to which no antibody as been added.
[00107] Specifically, H4 neuroglioma cells were transfected with equimolar ratios of DNA-constructs containing either α-synuclein (aa 1-140) fused with a N-terminal fragment of Green Fluorescent protein (GFP) (aa 1-155) or α-synuclein (aa 1-140) fused with a C-terminal fragment of GFP (aa 156-238) using the FuGENE 6 transfection reagent (Roche Diagnostics, Basel, Switzerland). Simultaneously, a control anti-a-synuclein monoclonal antibody (mAb5C2, Santa Cruz Bio) and mAb49/G were extracellularly added to the cells with a final concentration of 1 μg/ml. The cells were incubated for 24 hours in 37 °C in 5% CO2. After 24 hours, the cells were moved to 30 °C for complete reconstitution of the GFP-flourophore and incubated for an additional time of 24 hours. Fluorescence was measured using an
Axiovert200 microscope equipped with a FITC epifluorescence filter. All data was calculated as relative % fluorescence intensity compared to antibody untreated a-synuclein over expressing cells, which was set to 100 %.
[00108] As seen in the Fig. 9A, treatment with mAb49/G showed a significant (*p< 0.05) reduction (42 % decrease in fluorescence intensity compared to untreated cells) in a-synuclein oligomerization. Fig. 9B shows the results graphically as a percent fluorescence intensity compared to untreated α-synuclein overexpressing cells, which was set ot 100%.
[00109] The specific examples and embodiments described herein are exemplary only in nature and are not intended to be limiting of the invention defined by the claims. Further embodiments and examples, and advantages thereof, will be apparent to one of ordinary skill in the art in view of this specification and are within the scope of the claimed invention.
REFERENCES
Chartier-Harlin, MC, et al. 2004. Alpha-synuclein locus duplication as a cause of familial Parkinson's disease. Lancet 1, 364,1167-1169.
Conway, K., et al., 2000. Acceleration of oligomerization, not fibrillization, is a shared property of both a-synuclein mutations linked to early-onset Parkinson's disease: Implications for pathogenesis and therapy. Proc Natl Acad Sci USA 97, 571-576.
Crews, L., et al., 2009. Role of synucleins in Alzheimer's disease. Neurotox Res. 16, 306-317.
Desplats, P., et al., 2009. Inclusion formation and neuronal cell death through neuron-to- neuron transmission of alpha-synuclein. Proc Natl Acad Sci U S A. 4, 106, 13010-13015. Erratum in: Proc Natl Acad Sci U S A. 2009, 106, 17606. Comment in: Proc Natl Acad Sci U S A. 2009, 106, 12571-12572. El-Agnaf, O. M., et al., 2006. Detection of oligomeric forms of a-synuclein protein in human plasma as a potential biomarker for Parkinson's disease. Faseb J 20, 419-425.
George, J. L., et al. 2009. Targeting the progression of Parkinson's disease. Curr
Neuropharmacol. 7, 9-36.
Hansen, L, et al., 1990. The Lewy body variant of Alzheimer's disease. A clinical and pathologic entity. Neurology 40, 1-8.
Klucken, J., et al., 2006. Clinical and biochemical correlates of insoluble α-synuclein in dementia with Lewy bodies. Acta Neuropathol (Berl) 111, 101-108.
Kruger, R., et al., 1998. Ala30Pro mutation in the gene encoding α-synuclein in Parkinson's disease. Nat Genet 18, 106-108.
Leatherbarrow, R.J., et al. 1985. Effector functions of a monoclonal aglycosylated mouse IgG2a: binding and activation of complement component CI and interaction with human monocyte Fc receptor. Mol Immunol 22, 407-415.
Lee, H-J., et al. 2004. Clearance of a-synuclein oligomeric intermediates via the lysosomal degradation pathway. Journal of Neuroscience 24, 1888-1896.
LiJ.Y., et al Li et al. 2008. Lewy bodies in grafted neurons in subjects with Parkinson's disease suggest host-to-graft disease propagationNature Med., 14, 501-503.
Masliah, E., et al. 2005. Effects of alpha-synuclein immunization in a mouse model of Parkinson's disease. Neuron. 46, 857-868.
Oinas, M., et al. 2010. alpha-Synuclein pathology in the spinal cord autonomic nuclei associates with alpha-synuclein pathology in the brain: a population-based Vantaa 85+ study. Acta Neuropathol. 119, 715-722.
Polymeropoulos, M.H., et al., 1997. Mutation in the oc-Synuclein Gene Identified inFamilies with Parkinson's Disease. Science 276, 2045-2047. Qin, Z., et al., 2007. Effect of 4 -hydroxy-2-nonenal modification on a -synuclein aggregation. J Biol Chem 282, 5862-5870.
Singleton, AB., et al., 2003. alpha-Synuclein locus triplication causes Parkinson's disease. Science 302:841.
Wrigth, A., 1998. Effect of C2-associated carbohydrate structure on Ig effector function: studies with chimeric mouse-human IgGl antibodies in glycosylation mutants of Chinese hamster ovary cells. J Immunol 160, 3393-3402.
Xu, Y., et al. 1994. Residue at position 331 in the IgGl and IgG4 CH2 domains contributes to their differential ability to bind and activate complement. J Biol Chem. 269, 3469-3474.
Yoritaka, A., et al., 1996. Immunohistochemical detection of 4-hydroxynonenal protein adducts in Parkinson disease. Proc Natl Acad Sci USA 93, 2696-2701.
Zarranz, J., et al., 2004. The new mutation, E46K, of a-synuclein causes Parkinson and Lewy body dementia. Ann Neurol. 55, 164-173.
SEQUENCE LISTING
<110> Bio Arctic Neuroscience AB
Nordstrom, Eva
<120> PROTOFIBRIL-BINDING ANTIBODIES AND THEIR USE IN THERAPEUTIC AND DIAGNOSTIC METHODS FOR PARKINSON'S DISEASE, DEMENTIA WITH LEWY BODIES AND OTHER ALPHA-SYNUCLEINOPATHIES
<130> 4007579-182517
<150> US 61/406,260
<151> 2010-10-25
<150> US 61/308,638
<151> 2010-02-26
<160> 80
<170> Patentln version 3.5
<210> 1 <211> 9
<212> PRT
<213> Homo sapiens
<400> 1
Gly Phe Thr Phe Asn Thr Tyr Ala Met 1 5
<210> 2
<2U> 9
<212> PRT
<213> Homo sapiens
<400> 2
Gly Phe Thr Phe Ser Asn Tyr Ala Met 1 5
<210> 3
<211> 9
<212> PRT
<213> Homo sapiens
<400> 3
Gly Phe Thr Phe Ser Ser Tyr Ala Met 1 5
<210> 4
<211> 9
<212> PRT
<213> Homo sapiens
<400> 4
Gly Asp Ser Phe Thr Ser Gly Tyr Tip 1 5
<210> 5
<211> 19
<212> PRT
<213> Homo sapiens <400> 5
Arg lie Arg Thr Lys Ser Asn Asp Tyr Ala Thr Tyr Tyr Ala Asp Ser 1 5 10 15
Val Lys Gly
<210> 6
<2U> 17
<212> PRT
<213> Homo sapiens
<400> 6
Thr Val Thr Ser Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val Arg 1 5 10 15
Gly
<210> 7
<2U> 17
<212> PRT
<213> Homo sapiens
<400> 7
Thr He Ser Asn Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val Lys 1 5 10 15
Gly
<210> 8
<211> 16
<212> PRT
<213> Homo sapiens
<400> 8
Tyr He Arg Tyr Ser Gly Asn Thr Tyr Tyr Asn Pro Ser Leu Lys Ser 1 5 10 15
<210> 9
<211> 10
<212> PRT <213> Homo sapiens
<400> 9
Val Gly Tyr Arg Pro Tyr Ala Met Asp Tyr 1 5 10
<210> 10
<2U> 12
<212> PRT
<213> Homo sapiens
<400> 10
Gin Asn Phe Gly Ser Arg Gly Trp Tyr Phe Asp Val 1 5 10
<210> 11
<2U> 11
<212> PRT
<213> Homo sapiens
<400> 11
His Ser Asp Tyr Ser Gly Ala Trp Phe Ala Tyr 1 5 10
<210> 12
<211> 12
<212> PRT
<213> Homo sapiens
<400> 12
Ser Tyr Tyr Asp Tyr Asp Arg Ala Tip Phe Ala Tyr 1 5 10
<210> 13
<211> 16
<212> PRT
<213> Homo sapiens
<400> 13 Arg Ser Ser Gin Asn He Val His Ser Asn Gly Asn Thr Tyr Leu Glu 1 5 10 15
<210> 14
<2U> 16
<212> PRT
<213> Homo sapiens
<400> 14
Arg Ser Ser Gin Ser He Val Asn Ser Asn Gly Asn Thr Tyr Leu Glu 1 5 10 15
<210> 15
<2U> 10
<212> PRT
<213> Homo sapiens
<400> 15
Ser Ala Ser Ser Ser Val Ser Tyr Met Tyr
1 5 10
<210> 16
<211> 16
<212> PRT
<213> Homo sapiens
<400> 16
Arg Ser Ser Gin Ser Leu Val His Ser Asn Gly Asn Thr Tyr Leu His 1 5 10 15
<210> 17
<211> 7
<212> PRT
<213> Homo sapiens
<400> 17
Lys Val Ser Asn Arg Phe Ser
1 5 <210> 18
<211> 7
<212> PRT
<213> Homo sapiens
<400> 18
Thr Ser Asn Leu Ala Ser
5
<210> 19
<211> 9
<212> PRT
<213> Homo sapiens
<400> 19
Phe Gin Gly Ser His Val Pro Leu Thr 1 5
<210> 20
<211> 9
<212> PRT
<213> Homo sapiens
<400> 20
Gin Gin Tyr His Ser Tyr Pro Tyr Thr 1 5
<210> 21
<211> 9
<212> PRT
<213> Homo sapiens
<400> 21
Ser Gin Ser Thr His Val Pro Tip Thr 1 5
<210> 22
<211> 10
<212> PRT
<213> Homo sapiens <400> 22
Gly Phe Thr Phe Asn Thr Tyr Ala Met Asn 1 5 10
<210> 23
<2U> 10
<212> PRT
<213> Homo sapiens
<400> 23
Gly Phe Thr Phe Ser Asn Tyr Ala Met Ser 1 5 10
<210> 24
<2U> 10
<212> PRT
<213> Homo sapiens
<400> 24
Gly Phe Thr Phe Ser Ser Tyr Ala Met Ser 1 5 10
<210> 25
<211> 10
<212> PRT
<213> Homo sapiens
<400> 25
Gly Asp Ser Phe Thr Ser Gly Tyr Trp Asn 1 5 10
<210> 26
<211> 10
<212> PRT
<213> Homo sapiens
<400> 26
Gly Phe Ser Leu Thr Ser Tyr Gly Val His 10
<210> 27
<211> 10
<212> PRT
<213> Homo sapiens
<400> 27
Gly Phe Thr Phe Thr Asp Tyr Tyr Met Ser
1 5 10
<210> 28
<2U> 17
<212> PRT
<213> Homo sapiens
<400> 28
Arg He Arg Thr Lys Ser Asn Asp Tyr Ala Thr Tyr Tyr Ala Asp Ser 1 5 10 15
Val
<210> 29
<211> 15
<212> PRT
<213> Homo sapiens
<400> 29
Thr Val Thr Ser Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val 1 5 10 15
<210> 30
<211> 15
<212> PRT
<213> Homo sapiens
<400> 30
Thr He Ser Asn Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val 1 5 10 15 <210> 31
<211> 14
<212> PRT
<213> Homo sapiens
<400> 31
Tyr He Arg Tyr Ser Gly Asn Thr Tyr Tyr Asn Pro Ser Leu 1 5 10
<210> 32
<2U> 14
<212> PRT
<213> Homo sapiens
<400> 32
Val He Trp Arg Gly Gly Ser Thr Asp Tyr Ser Ala Ala Phe 1 5 10
<210> 33
<211> 15
<212> PRT
<213> Homo sapiens
<400> 33
Tin- He Ser Thr Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val 1 5 10 15
<210> 34
<211> 17
<212> PRT
<213> Homo sapiens
<400> 34
Phe He Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala Ser 1 5 10 15
Val <210> 35
<211> 10
<212> PRT
<213> Homo sapiens
<400> 35
Val Gly Tyr Arg Pro Tyr Ala Met Asp Tyr 1 5 10
<210> 36
<211> 12
<212> PRT
<213> Homo sapiens
<400> 36
Gin Asn Phe Gly Ser Arg Gly Trp Tyr Phe Asp Val 1 5 10
<210> 37
<211> 11
<212> PRT
<213> Homo sapiens
<400> 37
His Ser Asp Tyr Ser Gly Ala Trp Phe Ala Tyr 1 5 10
<210> 38
<211> 12
<212> PRT
<213> Homo sapiens
<400> 38
Ser Tyr Tyr Asp Tyr Asp Arg Ala Trp Phe Ala Tyr 1 5 10
<210> 39
<211> 10
<212> PRT
<213> Homo sapiens <400> 39
Leu Leu Arg Ser Val Gly Gly Phe Ala Asp
1 5 10
<210> 40
<2U> 9
<212> PRT
<213> Homo sapiens
<400> 40
Asp Tyr Gly Asn Tyr Ala Met Asp Tyr
1 5
<210> 41
<2U> 16
<212> PRT
<213> Homo sapiens
<400> 41
Arg Ser Ser Gin Asn He Val His Ser Asn Gly Asn Thr Tyr Leu Glu 1 5 10 15
<210> 42
<211> 16
<212> PRT
<213> Homo sapiens
<400> 42
Arg Ser Ser Gin Ser He Val Asn Ser Asn Gly Asn Thr Tyr Leu Glu 1 5 10 15
<210> 43
<211> 10
<212> PRT
<213> Homo sapiens
<400> 43
Ser Ala Ser Ser Ser Val Ser Tyr Met Tyr 10
<210> 44
<2U> 16
<212> PRT
<213> Homo sapiens
<400> 44
Arg Ser Ser Gin Ser Leu Val His Ser Asn Gly Asn Thr Tyr Leu His 1 5 10 15
<210> 45
<2U> 16
<212> PRT
<213> Homo sapiens
<400> 45
Arg Ser Ser Gin Thr He Val His Asn Asn Gly Asn Thr Tyr Leu Glu 1 5 10 15
<210> 46
<211> 17
<212> PRT
<213> Homo sapiens
<400> 46
Lys Ser Ser Gin Ser Leu Leu Tyr Ser Ser Asn Gin Lys Asn Tyr Leu 1 5 10 15
Ala
<210> 47
<211> 7
<212> PRT
<213> Homo sapiens
<400> 47
Lys Val Ser Asn Arg Phe Ser
1 5 <210> 48
<211> 7
<212> PRT
<213> Homo sapiens
<400> 48
Thr Ser Asn Leu Ala Ser
5
<210> 49
<2U> 7
<212> PRT
<213> Homo sapiens
<400> 49
Trp Ala Ser Thr Arg Glu Ser 1 5
<210> 50
<2U> 9
<212> PRT
<213> Homo sapiens
<400> 50
Phe Gin Gly Ser His Val Pro Leu Thr 1 5
<210> 51
<2U> 9
<212> PRT
<213> Homo sapiens
<400> 51
Gin Gin Tyr His Ser Tyr Pro Tyr Thr 1 5
<210> 52
<211> 9
<212> PRT <213> Homo sapiens
<400> 52
Ser Gin Ser Thr His Val Pro Trp Thr 1 5
<210> 53
<2U> 9
<212> PRT
<213> Homo sapiens
<400> 53
Phe Gin Gly Ser His Val Pro Phe Thr 1 5
<210> 54
<2U> 9
<212> PRT
<213> Homo sapiens
<400> 54
Gin Gin Phe His Ser Tyr Pro Tyr Thr 1 5
<210> 55
<211> 9
<212> PRT
<213> Homo sapiens
<400> 55
Gin Gin Tyr Tyr Ser Tyr Pro Tyr Thr 1 5
<210> 56
<211> 121
<212> PRT
<213> Homo sapiens
<400> 56 Glu Val Gin Leu Val Glu Thr Gly Gly Gly Leu Val Gin Pro Lys Gly 1 5 10 15
Ser Leu Lys Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Asn Thr Tyr
20 25 30
Ala Met Asn Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45
Ala Arg He Arg Thr Lys Ser Asn Asp Tyr Ala Thr Tyr Tyr Ala Asp 50 55 60
Ser Val Lys Gly Arg He Thr He Ser Arg Asp Asp Ser Gin Ser Met 65 70 75 80
Leu Tyr Leu Gin Met Asn Asn Leu Lys Thr Glu Asp Thr Ala Met Tyr
85 90 95
Tyr Cys Val Arg Val Gly Tyr Arg Pro Tyr Ala Met Asp Tyr Trp Gly
100 105 110
Gin Gly Thr Ser Val Thr Val Ser Ser
115 120
<210> 57
<2U> 121
<212> PRT
<213> Homo sapiens
<400> 57
Glu Val Gin Leu Val Glu Ser Gly Gly Asp Leu Val Lys Pro Gly Gly 1 5 10 15
Ser Leu Lys Phe Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr
20 25 30
Ala Met Ser Trp Val Arg Gin Thr Pro Asp Lys Arg Leu Glu Trp Val 35 40 45
Ala Thr Val Thr Ser Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val 50 55 60
Arg Gly Arg Phe Thr He Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr 65 70 75 80
Leu Gin Leu Ser Ser Leu Lys Ser Glu Asp Thr Ala Met Tyr Phe Cys Ala Arg Gin Asn Phe Gly Ser Arg Gly Trp Tyr Phe Asp Val Trp Gly 100 105 110
Ala Gly Thr Thr Val Thr Val Ser Ser
115 120
<210> 58
<2U> 120
<212> PRT
<213> Homo sapiens
<400> 58
Glu Val Met Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly 1 5 10 15
Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gin Thr Pro Glu Lys Arg Leu Glu Trp Val 35 40 45
Ala Thr He Ser Asn Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr He Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr 65 70 75 80
Leu Gin Met Ser Ser Leu Arg Ser Glu Asp Thr Ala Met Tyr Tyr Cys
85 90 95
Ala Arg His Ser Asp Tyr Ser Gly Ala Trp Phe Ala Tyr Trp Gly Gin
100 105 110
Gly Thr Leu Val Thr Val Ser Ala
115 120
<210> 59
<2U> 120
<212> PRT
<213> Homo sapiens
<400> 59
59 Glu Val Gin Leu Gin Glu Ser Gly Pro Ser Leu Val Lys Pro Ser Gin 1 5 10 15
Thr Leu Ser Leu Thr Cys Ser Val Thr Gly Asp Ser Phe Thr Ser Gly
20 25 30
Tyr Trp Asn Trp He Arg Lys Phe Pro Gly Asn Lys Leu Glu Tyr Met 35 40 45
Gly Tyr He Arg Tyr Ser Gly Asn Thr Tyr Tyr Asn Pro Ser Leu Lys 50 55 60
Ser Arg He Ser He Thr Arg Asp Thr Ser Lys Asn Gin Tyr Tyr Leu 65 70 75 80
Gin Leu He Ser Val Thr Thr Glu Asp Thr Ala Thr Phe Tyr Cys Ala
85 90 95
Arg Ser Tyr Tyr Asp Tyr Asp Arg Ala Trp Phe Ala Tyr Trp Gly Gin
100 105 110
Gly Ala Leu Val Thr Val Ser Ala
115 120
<210> 60
<2U> 112
<212> PRT
<213> Homo sapiens
<400> 60
Asp Val Leu Met Thr Gin Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15
Asp Gin Ala Ser He Ser Cys Arg Ser Ser Gin Asn He Val His Ser
20 25 30
Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45
Pro Thr Leu Leu He Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys He 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gin Gly 85 90 95
Ser His Val Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
100 105 110
<210> 61
<2U> 112
<212> PRT
<213> Homo sapiens
<400> 61
Asp Val Leu Met Thr Gin Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15
Asp Gin Ala Ser He Ser Cys Arg Ser Ser Gin Ser He Val Asn Ser
20 25 30
Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45
Pro Lys Leu Leu He Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys He 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gin Gly
85 90 95
Ser His Val Pro Leu Thr Phe Gly Ala Gly Thr Thr Leu Glu Leu Lys
100 105 110
<210> 62
<2U> 106
<212> PRT
<213> Homo sapiens
<400> 62
Gin He Val Leu Thr Gin Ser Pro Ala He Met Ser Ala Ser Pro Gly 1 5 10 15
Glu Lys Val Thr He Ser Cys Ser Ala Ser Ser Ser Val Ser Tyr Met
20 25 30 Tyr Trp Tyr Gin Gin Lys Pro Gly Ser Ser Pro Lys Pro Trp He Tyr 35 40 45
Arg Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser 50 55 60
Gly Ser Gly Thr Ser Tyr Ser Leu Thr He Ser Ser Met Glu Ala Glu 65 70 75 80
Asp Ala Ala Thr Tyr Tyr Cys Gin Gin Tyr His Ser Tyr Pro Tyr Thr
85 90 95
Phe Gly Gly Gly Thr Lys Leu Glu He Lys
100 105
<210> 63
<2U> 112
<212> PRT
<213> Homo sapiens
<400> 63
Asp Val Val Met Thr Gin Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15
Asp Gin Ala Ser He Ser Cys Arg Ser Ser Gin Ser Leu Val His Ser
20 25 30
Asn Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin Ser
35 40 45
Pro Lys Leu Leu He Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys He 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Phe Cys Ser Gin Ser
85 90 95
Thr His Val Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu He Lys
100 105 110
<210> 64
<2U> 121
<212> PRT <213> Homo sapiens
<400> 64
Glu Val Gin Leu Val Glu Thr Gly Gly Gly Leu Val Gin Pro Lys Gly 1 5 10 15
Ser Leu Lys Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Asn Thr Tyr
20 25 30
Ala Met Asn Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45
Ala Arg He Arg Thr Lys Ser Asn Asp Tyr Ala Thr Tyr Tyr Ala Asp 50 55 60
Ser Val Lys Gly Arg He Thr He Ser Arg Asp Asp Ser Gin Ser Met 65 70 75 80
Leu Tyr Leu Gin Met Asn Asn Leu Lys Thr Glu Asp Thr Ala Met Tyr
85 90 95
Tyr Cys Val Arg Val Gly Tyr Arg Pro Tyr Ala Met Asp Tyr Trp Gly
100 105 110
Gin Gly Thr Ser Val Thr Val Ser Ser
115 120
<210> 65
<2U> 121
<212> PRT
<213> Homo sapiens
<400> 65
Glu Val Gin Leu Val Glu Ser Gly Gly Asp Leu Val Lys Pro Gly Gly 1 5 10 15
Ser Leu Lys Phe Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr
20 25 30
Ala Met Ser Trp Val Arg Gin Thr Pro Asp Lys Arg Leu Glu Trp Val 35 40 45
Ala Thr Val Thr Ser Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val 50 55 60 Arg Gly Arg Phe Thr He Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr 65 70 75 80
Leu Gin Leu Ser Ser Leu Lys Ser Glu Asp Thr Ala Met Tyr Phe Cys
85 90 95
Ala Arg Gin Asn Phe Gly Ser Arg Gly Trp Tyr Phe Asp Val Trp Gly
100 105 110
Ala Gly Thr Thr Val Thr Val Ser Ser
115 120
<210> 66
<2U> 120
<212> PRT
<213> Homo sapiens
<400> 66
Glu Val Met Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly 1 5 10 15
Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gin Thr Pro Glu Lys Arg Leu Glu Trp Val 35 40 45
Ala Thr He Ser Asn Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr He Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr 65 70 75 80
Leu Gin Met Ser Ser Leu Arg Ser Glu Asp Thr Ala Met Tyr Tyr Cys
85 90 95
Ala Arg His Ser Asp Tyr Ser Gly Ala Trp Phe Ala Tyr Trp Gly Gin
100 105 110
Gly Thr Leu Val Thr Val Ser Ala
115 120
<210> 67
<2U> 120
<212> PRT <213> Homo sapiens
<400> 67
Glu Val Gin Leu Gin Glu Ser Gly Pro Ser Leu Val Lys Pro Ser Gin 1 5 10 15
Thr Leu Ser Leu Thr Cys Ser Val Thr Gly Asp Ser Phe Thr Ser Gly
20 25 30
Tyr Trp Asn Trp He Arg Lys Phe Pro Gly Asn Lys Leu Glu Tyr Met 35 40 45
Gly Tyr He Arg Tyr Ser Gly Asn Thr Tyr Tyr Asn Pro Ser Leu Lys 50 55 60
Ser Arg He Ser He Thr Arg Asp Thr Ser Lys Asn Gin Tyr Tyr Leu 65 70 75 80
Gin Leu He Ser Val Thr Thr Glu Asp Thr Ala Thr Phe Tyr Cys Ala
85 90 95
Arg Ser Tyr Tyr Asp Tyr Asp Arg Ala Trp Phe Ala Tyr Trp Gly Gin
100 105 110
Gly Ala Leu Val Thr Val Ser Ala
115 120
<210> 68
<2U> 118
<212> PRT
<213> Homo sapiens
<400> 68
Gin Val Gin Leu Lys Gin Ser Gly Pro Ser Leu Val Gin Pro Ser Gin 1 5 10 15
Ser Leu Ser He Thr Cys Ser Val Ser Gly Phe Ser Leu Thr Ser Tyr
20 25 30
Gly Val His Trp Val Arg Leu Ser Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45
Gly Val He Trp Arg Gly Gly Ser Thr Asp Tyr Ser Ala Ala Phe Met 50 55 60 Ser Arg Leu Ser He Thr Lys Asp Asn Ser Lys Ser Gin Val Phe Phe 65 70 75 80
Lys Met Ser Ser Leu Gin Ala Asp Asp Thr Ala He Tyr Tyr Cys Ala
85 90 95
Lys Leu Leu Arg Ser Val Gly Gly Phe Ala Asp Trp Gly Gin Gly Thr
100 105 110
Leu Val Thr Val Ser Ala
115
<210> 69
<2U> 120
<212> PRT
<213> Homo sapiens
<400> 69
Glu Val Met Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly 1 5 10 15
Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr
20 25 30
Ala Met Ser Trp Val Arg Gin Thr Pro Glu Lys Arg Leu Glu Trp Val 35 40 45
Ala Thr He Ser Thr Gly Gly Ser Tyr Thr Tyr Tyr Pro Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr He Ser Arg Asp Asn Ala Asn Asn Ala Leu Tyr 65 70 75 80
Leu Gin Met Ser Ser Leu Arg Ser Glu Asp Thr Ala Met Tyr Tyr Cys
85 90 95
Ala Arg His Ser Asp Tyr Ser Gly Ala Trp Phe Ala Tyr Trp Gly Arg
100 105 110
Gly Thr Leu Val Thr Val Ser Ala
115 120
<210> 70
<2U> 120
<212> PRT <213> Homo sapiens
<400> 70
Glu Val Gin Leu Gin Glu Ser Gly Pro Ser Leu Val Lys Pro Ser Gin 1 5 10 15
Thr Leu Ser Leu Thr Cys Ser Val Thr Gly Asp Ser Phe Thr Ser Gly
20 25 30
Tyr Trp Asn Trp He Arg Lys Phe Pro Gly Asn Lys Leu Glu Tyr Met 35 40 45
Gly Tyr He Arg Tyr Ser Gly Asn Thr Tyr Tyr Asn Pro Ser Leu Lys 50 55 60
Ser Arg He Ser He Thr Arg Asp Thr Ser Lys Asn Gin Tyr Tyr Leu 65 70 75 80
Gin Leu He Ser Val Thr Thr Glu Asp Thr Ala Thr Phe Tyr Cys Ala
85 90 95
Arg Ser Tyr Tyr Asp Tyr Asp Arg Ala Trp Phe Ala Tyr Trp Gly Gin
100 105 110
Gly Ala Leu Val Thr Val Ser Ala
115 120
<210> 71
<2U> 120
<212> PRT
<213> Homo sapiens
<400> 71
Glu Val Lys Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Thr Asp Tyr
20 25 30
Tyr Met Ser Trp Val Arg Gin Pro Pro Gly Lys Ala Leu Glu Trp Leu 35 40 45
Gly Phe He Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr He Ser Arg Asp Asn Ser Gin Ser He 65 70 75 80
Leu Tyr Leu Gin Met Asn Thr Leu Arg Ala Glu Asp Ser Ala Thr Tyr
85 90 95
Tyr Cys Ala Arg Asp Tyr Gly Asn Tyr Ala Met Asp Tyr Trp Gly Gin
100 105 110
Gly Thr Ser Val Thr Val Ser Ser
115 120
<210> 72
<2U> 112
<212> PRT
<213> Homo sapiens
<400> 72
Asp Val Leu Met Thr Gin Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15
Asp Gin Ala Ser He Ser Cys Arg Ser Ser Gin Asn He Val His Ser
20 25 30
Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45
Pro Thr Leu Leu He Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys He 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gin Gly
85 90 95
Ser His Val Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
100 105 110
<210> 73
<2U> 112
<212> PRT
<213> Homo sapiens
<400> 73 Asp Val Leu Met Thr Gin Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15
Asp Gin Ala Ser He Ser Cys Arg Ser Ser Gin Ser He Val Asn Ser
20 25 30
Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gin Lys Pro Gly Gin Ser 35 40 45
Pro Lys Leu Leu He Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys He 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gin Gly
85 90 95
Ser His Val Pro Leu Thr Phe Gly Ala Gly Thr Thr Leu Glu Leu Lys
100 105 110
<210> 74
<2U> 106
<212> PRT
<213> Homo sapiens
<400> 74
Gin He Val Leu Thr Gin Ser Pro Ala He Met Ser Ala Ser Pro Gly 1 5 10 15
Glu Lys Val Thr He Ser Cys Ser Ala Ser Ser Ser Val Ser Tyr Met
20 25 30
Tyr Trp Tyr Gin Gin Lys Pro Gly Ser Ser Pro Lys Pro Trp He Tyr
35 40 45
Arg Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser 50 55 60
Gly Ser Gly Thr Ser Tyr Ser Leu Thr He Ser Ser Met Glu Ala Glu 65 70 75 80
Asp Ala Ala Thr Tyr Tyr Cys Gin Gin Tyr His Ser Tyr Pro Tyr Thr
85 90 95 Phe Gly Gly Gly Thr Lys Leu Glu He Lys
100 105
<210> 75
<2U> 112
<212> PRT
<213> Homo sapiens
<400> 75
Asp Val Val Met Thr Gin Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15
Asp Gin Ala Ser He Ser Cys Arg Ser Ser Gin Ser Leu Val His Ser
20 25 30
Asn Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin Ser
35 40 45
Pro Lys Leu Leu He Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys He 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Phe Cys Ser Gin Ser
85 90 95
Thr His Val Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu He Lys
100 105 110
<210> 76
<2U> 112
<212> PRT
<213> Homo sapiens
<400> 76
Asp Val Leu Met Thr Gin Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15
Asp Gin Ala Ser He Ser Cys Arg Ser Ser Gin Thr He Val His Asn
20 25 30
Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gin Lys Pro Gly Gin Ser
35 40 45 Pro Lys Leu Leu He Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys He 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gin Gly
85 90 95
Ser His Val Pro Phe Thr Phe Gly Ser Gly Thr Lys Leu Glu He Lys
100 105 110
<210> 77
<2U> 106
<212> PRT
<213> Homo sapiens
<400> 77
Gin He Val Leu Thr Gin Ser Pro Ala He Met Ser Ala Ser Pro Gly 1 5 10 15
Glu Lys Val Thr He Ser Cys Ser Ala Ser Ser Ser Val Ser Tyr Met
20 25 30
Tyr Trp Tyr Gin Gin Lys Pro Gly Ser Ser Pro Lys Pro Trp He Tyr 35 40 45
Arg Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser 50 55 60
Gly Ser Gly Thr Ser Tyr Ser Leu Thr He Ser Ser Met Glu Ala Glu 65 70 75 80
Asp Ala Ala Thr Tyr Tyr Cys Gin Gin Phe His Ser Tyr Pro Tyr Thr
85 90 95
Phe Gly Gly Gly Thr Lys Leu Glu He Lys
100 105
<210> 78
<2U> 112
<212> PRT
<213> Homo sapiens <400> 78
Asp Val Val Met Thr Gin Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15
Asp Gin Ala Ser He Ser Cys Arg Ser Ser Gin Ser Leu Val His Ser
20 25 30
Asn Gly Asn Thr Tyr Leu His Trp Tyr Leu Gin Lys Pro Gly Gin Ser
35 40 45
Pro Lys Leu Leu He Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys He 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Phe Cys Ser Gin Ser
85 90 95
Thr His Val Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu He Lys
100 105 110
<210> 79
<2U> 113
<212> PRT
<213> Homo sapiens
<400> 79
Asp He Val Met Ser Gin Ser Pro Ser Ser Leu Ala Val Ser Val Gly 1 5 10 15
Glu Lys Val Thr Met Ser Cys Lys Ser Ser Gin Ser Leu Leu Tyr Ser
20 25 30
Ser Asn Gin Lys Asn Tyr Leu Ala Trp Tyr Gin Gin Lys Pro Gly Gin 35 40 45
Ser Pro Lys Leu Leu He Tyr Trp Ala Ser Thr Arg Glu Ser Gly Val 50 55 60
Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80
He Ser Ser Val Lys Ala Glu Asp Leu Ala Val Tyr Tyr Cys Gin Gin
85 90 95 Tyr Tyr Ser Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu He 100 105 110
Lys
<210> 80
<2U> 140
<212> PRT
<213> Homo sapiens
<400> 80
Met Asp Val Phe Met Lys Gly Leu Ser Lys Ala Lys Glu Gly Val Val 1 5 10 15
Ala Ala Ala Glu Lys Thr Lys Gin Gly Val Ala Glu Ala Ala Gly Lys
20 25 30
Thr Lys Glu Gly Val Leu Tyr Val Gly Ser Lys Thr Lys Glu Gly Val
35 40 45
Val His Gly Val Ala Thr Val Ala Glu Lys Thr Lys Glu Gin Val Thr 50 55 60
Asn Val Gly Gly Ala Val Val Thr Gly Val Thr Ala Val Ala Gin Lys 65 70 75 80
Thr Val Glu Gly Ala Gly Ser He Ala Ala Ala Thr Gly Phe Val Lys
85 90 95
Lys Asp Gin Leu Gly Lys Asn Glu Glu Gly Ala Pro Gin Glu Gly He
100 105 110
Leu Glu Asp Met Pro Val Asp Pro Asp Asn Glu Ala Tyr Glu Met Pro 115 120 125
Ser Glu Glu Gly Tyr Gin Asp Tyr Glu Pro Glu Ala
130 135 140

Claims

WHAT IS CLAIMED IS:
1. An antibody or fragment thereof having high affinity for human a-synuclein protofibrils and low binding of a-synuclein monomers, the antibody or fragment having three variable heavy (VH) CDR sequences (VH-CDR-1, VH-CDR-2, and VH-CDR-3) and three variable light (VL) CDR sequences (VL-CDR-1, VL-CDR-2, and VL-CDR-3), and wherein the six CDR sequences of the antibody or fragment thereof are selected from the following respective groups:
VH-CDR-1 SEQ ID NOS: 22, 23, 24, 25, 26 or 27
VH-CDR-2 SEQ ID NOS: 28, 29, 30, 31, 32, 33 or 34
VH-CDR-3 SEQ ID NOS: 35, 36, 37, 38, 39 or 40
VL-CDR-1 SEQ ID NOS: 41, 42, 43, 44, 45 or 46
VL-CDR-2 SEQ ID NOS: 47, 48 or 49
VL-CDR-3 SEQ ID NOS: 50, 51, 52, 53, 54 or 55.
2. An antibody or fragment thereof according to claim 1, wherein the six CDR sequences of the antibody or fragment thereof are selected from the following respective groups:
VH CDR-1 SEQ ID NOS: 23, 24, 25 or 26
VH CDR-2 SEQ ID NOS: 29, 30, 31 or 32
VH CDR-3 SEQ ID NOS: 36, 37, 38 or 39
VL CDR- 1 SEQ ID NOS : 42, 43 , 44 or 45
VL CDR-2 SEQ ID NOS : 47 or 48
VL CDR-3 SEQ ID NOS: 50, 51, 52 or 53.
3. An antibody or fragment according to claim 1 having a CDR sequence combination selected from the following combinations:
SEQ ID NOS: 22, 28, 35, 41, 47 and 50, SEQ ID NOS: 23, 29, 36, 42, 47 and 50,
SEQ ID NOS: 24, 30, 37, 43, 48 and 51,
SEQ ID NOS: 25, 31, 38, 44, 47 and 52,
SEQ ID NOS: 26, 32, 39, 45, 47 and 53,
SEQ ID NOS: 23, 33, 37, 43, 48 and 54, and
SEQ ID NOS: 27, 34, 40, 46, 49 and 55.
4. An antibody or fragment thereof according to any one of claims 1-3, wherein the antibody or fragment thereof binds to an epitope within amino acid region 113-140, e.g. amino acid region 113-131, and in particular the epitopes amino acid 125-131, 121-124, 121- 127, 121-131, 113-123 or 136-140, of immobilized linear a-synuclein in a model system comprising 15-mer a-synuclein peptides with 11 amino acids overlap.
5. An antibody or fragment thereof having high affinity for human a-synuclein protofibrils and low binding of α-synuclein monomers, the antibody or fragment having three variable heavy (VH) CDR sequences (VH-CDR-1, VH-CDR-2, and VH-CDR-3) and three variable light (VL) CDR sequences (VL-CDR-1, VL-CDR-2, and VL-CDR-3), and wherein the six CDR sequences of the antibody or fragment thereof are selected from the following respective groups, and sequences having greater than 70, 80, 90, 95 or 98% similarity with any of said sequences of the respective groups:
VH-CDR-1 SEQ ID NOS: 22, 23, 24, 25, 26 or 27
VH-CDR-2 SEQ ID NOS: 28, 29, 30, 31, 32, 33 or 34
VH-CDR-3 SEQ ID NOS: 35, 36, 37, 38, 39 or 40
VL-CDR-1 SEQ ID NOS: 41, 42, 43, 44, 45 or 46
VL-CDR-2 SEQ ID NOS: 47, 48 or 49 VL-CDR-3 SEQ ID NOS: 50, 51, 52, 53, 54 or 55, and wherein the antibody or fragment thereof binds to an epitope within amino acid region 113-140, e.g. amino acid region 113-131, and in particular the epitopes amino acid 125-131, 121-124, 121-127, 121-131, 113-123 or 136-140, of immobilized linear a-synuclein in a model system comprising 15-mer a-synuclein peptides with 11 amino acids overlap.
6. A pharmaceutical composition comprising an antibody or fragment according to any one of claims 1-5, and a pharmaceutically acceptable carrier.
7. A method of detecting α-synuclein protofibrils, comprising the steps of
-adding the antibody or fragment according to any one of claims 1-5 to a biological sample comprising or suspected of comprising α-synuclein protofibrils, and
-detecting the presence of a complex formed between α-synuclein protofibril and said antibody or fragment.
8. A method of preventing, delaying onset of or treating a neurodegenerative disorder with α-synuclein pathology in an individual, comprising administration of an antibody or fragment according to any one of claims 1-5 or a composition according to claim 6 to the individual.
9. Method according to claim 8, wherein the neurodegenerative disorder is Parkinson's disease (PD), dementia with Lewy bodies (DLB), the Lewy body variant of Alzheimer's disease, Alzheimer's disease, Down's syndrome, multiple system atrophy, psychosis, schizophrenia or Creutzfeldt-Jakob disease.
10. Use of an antibody or fragment according to any one of claims 1-5 for the manufacture of a pharmaceutical composition for treatment of neurodegenerative disorders with a- synuclein pathology.
11. Use according to claim 10, wherein the neurodegenerative disorder is Parkinson's disease (PD), dementia with Lewy bodies (DLB), the Lewy body variant of Alzheimer's disease , Alzheimer's disease, Down's syndrome, multiple system atrophy, psychosis, schizophrenia or Creutzfeldt-Jakob disease.
12. Use of an antibody or fragment according to any one of claims 1-5 or a composition according to claim 6 for the diagnosis or monitoring of the development of a
neurodegenerative disorder with a-synuclein pathology.
13. Use according to claim 12 the diagnosis or monitoring of the development of Parkinson's disease (PD), dementia with Lewy bodies (DLB), the Lewy body variant of Alzheimer's disease, Down's syndrome, multiple system atrophy, psychosis, schizophrenia or Creutzfeldt-Jakob disease.
14. Method for reducing or inhibiting a-synuclein aggregation by administration of an antibody or fragment according to any one of claims 1-5 or a composition according to claim 6 to a sample comprising soluble a-syncuclein species.
PCT/IB2011/050826 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies Ceased WO2011104696A1 (en)

Priority Applications (21)

Application Number Priority Date Filing Date Title
EP11713058.3A EP2539366B1 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
CA2789963A CA2789963C (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
US13/578,710 US8632776B2 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for Parkinson's disease, dementia with lewy bodies and other α-synucleinopathies
DK11713058.3T DK2539366T3 (en) 2010-02-26 2011-02-25 PROTOFIBRIL-BINDING ANTIBODIES AND THEIR USE IN THERAPEUTIC AND DIAGNOSTIC PROCEDURES FOR PARKINSON'S DISEASE, DEMENS WITH LEWY BODY AND OTHER ALPHA SYNUCLEINOPATHIES
AU2011219414A AU2011219414B2 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for Parkinson's disease, dementia with Lewy bodies and other alpha-synucleinopathies
CN201910950804.0A CN110655573B (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in the treatment and diagnosis of Parkinson's disease, dementia with Lewy bodies and other alpha-synucleinopathies
ES11713058.3T ES2661925T3 (en) 2010-02-26 2011-02-25 Protofibril binding antibodies and their use in diagnostic therapeutic methods for Parkinson's disease, dementia with Lewy bodies and other alpha-synucleinopathies
HRP20180230TT HRP20180230T8 (en) 2010-02-26 2011-02-25 ANTIBODIES BINDING TO PROTOFIBRILS AND THEIR USE IN THERAPEUTIC AND DIAGNOSTIC PROCEDURES IN PARKINSON'S DISEASE, LEWY BODY DEMENTIA AND OTHER ALPHA SYNUCLEINOPATES
PL11713058T PL2539366T3 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
CN201180011363.XA CN102869680B (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in methods of treatment and diagnosis of Parkinson's disease, dementia with Lewy bodies, and other alpha-synucleinopathies
SM20180044T SMT201800044T1 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
JP2012554464A JP5894939B2 (en) 2010-02-26 2011-02-25 Protofibril binding antibodies and their use in methods of treatment and diagnosis of Parkinson's disease, Lewy body dementia and other alpha-synucleinopathies
LTEP11713058.3T LT2539366T (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson`s disease, dementia with lewy bodies and other alpha-synucleinopathies
RU2012140954/10A RU2555526C2 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and use thereof in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
NO11713058A NO2539366T3 (en) 2010-02-26 2011-02-25
SI201131419T SI2539366T1 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
RS20180129A RS57029B1 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
US13/957,239 US8859501B2 (en) 2010-02-26 2013-08-01 Protofibril-binding antibodies and their use in thereapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
US14/472,036 US8968734B2 (en) 2010-02-26 2014-08-28 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for Parkinson's disease, dementia with lewy bodies and other α-synucleinopathies
US14/611,690 US9084832B2 (en) 2010-02-26 2015-02-02 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other α-synucleinopathies
CY20181100140T CY1120014T1 (en) 2010-02-26 2018-02-05 PROTOTINIDE CONNECTION ANTIBODIES AND USE OF THESE IN THERAPEUTIC AND DIAGNOSTIC METHODS FOR PARKINSON'S DISEASE, WITH LEWY BODIES AND ALPHABES

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US30863810P 2010-02-26 2010-02-26
US61/308,638 2010-02-26
US40626010P 2010-10-25 2010-10-25
US61/406,260 2010-10-25

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/578,710 A-371-Of-International US8632776B2 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for Parkinson's disease, dementia with lewy bodies and other α-synucleinopathies
US13/957,239 Continuation US8859501B2 (en) 2010-02-26 2013-08-01 Protofibril-binding antibodies and their use in thereapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies

Publications (1)

Publication Number Publication Date
WO2011104696A1 true WO2011104696A1 (en) 2011-09-01

Family

ID=44227520

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2011/050826 Ceased WO2011104696A1 (en) 2010-02-26 2011-02-25 Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies

Country Status (20)

Country Link
US (4) US8632776B2 (en)
EP (1) EP2539366B1 (en)
JP (1) JP5894939B2 (en)
CN (3) CN110655573B (en)
AU (1) AU2011219414B2 (en)
CA (1) CA2789963C (en)
CY (1) CY1120014T1 (en)
DK (1) DK2539366T3 (en)
ES (1) ES2661925T3 (en)
HR (1) HRP20180230T8 (en)
HU (1) HUE038313T2 (en)
LT (1) LT2539366T (en)
NO (1) NO2539366T3 (en)
PL (1) PL2539366T3 (en)
PT (1) PT2539366T (en)
RS (1) RS57029B1 (en)
RU (1) RU2555526C2 (en)
SI (1) SI2539366T1 (en)
SM (1) SMT201800044T1 (en)
WO (1) WO2011104696A1 (en)

Cited By (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014132210A1 (en) 2013-02-28 2014-09-04 United Arab Emirates University Alpha-synuclein antibodies and uses thereof
WO2015075011A1 (en) 2013-11-21 2015-05-28 F. Hoffmann-La Roche Ag ANTI-alpha-SYNUCLEIN ANTIBODIES AND METHODS OF USE
WO2016061389A2 (en) 2014-10-16 2016-04-21 Genentech, Inc. Anti-alpha-synuclein antibodies and methods of use
EP3091087A1 (en) 2015-05-08 2016-11-09 Fundació Institut d'Investigació en Ciències de la Salut Germans Trias i Pujol Method for in vitro diagnosis of synucleinopathies using alpha-synuclein gene transcripts
WO2017013599A1 (en) 2015-07-21 2017-01-26 Bioarctic Neuroscience Ab Method for treatment of traumatic brain injury targeting aggregated peptides
TWI596112B (en) * 2012-01-20 2017-08-21 建新公司 Anti-cxcr3 antibodies
WO2017207739A1 (en) * 2016-06-02 2017-12-07 Medimmune Limited Antibodies to alpha-synuclein and uses thereof
WO2018011353A1 (en) 2016-07-14 2018-01-18 Bioarctic Ab Brain delivery protein
WO2018091444A1 (en) * 2016-11-15 2018-05-24 H. Lundbeck A/S Agents, uses and methods for the treatment of synucleinopathy
RU2657763C1 (en) * 2017-09-12 2018-06-15 федеральное государственное бюджетное образовательное учреждение высшего образования "Первый Санкт-Петербургский государственный медицинский университет имени академика И.П. Павлова" Министерства здравоохранения Российской Федерации Method for diagnostics of parkinson's disease
WO2018151821A1 (en) * 2017-02-17 2018-08-23 Bristol-Myers Squibb Company Antibodies to alpha-synuclein and uses thereof
EP2282758B1 (en) 2008-04-29 2018-11-21 BioArctic AB Antibodies and vaccines for use in therapeutic and diagnostic methods for alpha-synuclein-related disorders
WO2019115671A1 (en) * 2017-12-15 2019-06-20 Ucb Biopharma Sprl Anti-alpha synuclein antibodies
WO2019115674A1 (en) * 2017-12-15 2019-06-20 Ucb Biopharma Sprl Anti-alpha-synuclein antibodies
WO2019098763A3 (en) * 2017-11-17 2019-07-11 에이비엘바이오 주식회사 ANTIBODIES TO α-SYNUCLEIN AND USES THEREOF
US10358482B2 (en) 2015-07-13 2019-07-23 H. Lundbeck A/S Antibodies for the treatment of synucleinopathy
US10364286B2 (en) 2016-12-22 2019-07-30 H. Lundbeck A/S Monoclonal anti-alpha-synuclein antibodies for preventing tau aggregation
WO2020023530A2 (en) 2018-07-24 2020-01-30 Eisai R&D Management Co., Ltd. Methods of treatment and prevention of alzheimer's disease
WO2020123330A3 (en) * 2018-12-14 2020-07-23 Eli Lilly And Company Anti-alpha-synuclein antibodies and uses thereof
US10751382B2 (en) 2016-11-09 2020-08-25 The University Of British Columbia Anti-amyloid beta antibodies binding to a cyclic amyloid beta peptide
US10759837B2 (en) 2015-11-09 2020-09-01 The University Of British Columbia Anti-amyloid beta antibodies binding to a cyclic amyloid beta peptide
US10772969B2 (en) 2015-11-09 2020-09-15 The University Of British Columbia N-terminal epitopes in amyloid beta and conformationally-selective antibodies thereto
EP3672635A4 (en) * 2017-08-23 2021-05-12 The Trustees of The University of Pennsylvania MONOCLONAL ANTIBODIES AGAINST PATHOLOGICAL ALPHA-SYNUCLEIN, AND METHODS USING THEM
WO2021206561A1 (en) 2020-04-10 2021-10-14 Syngle Therapeutics B.V. Novel alpha-synuclein binding antibodies, or antigen binding portions thereof
WO2021260434A1 (en) 2020-06-26 2021-12-30 Bioarctic Ab α-SYNUCLEIN PROTOFIBRIL-BINDING ANTIBODIES
US11325968B2 (en) 2016-12-16 2022-05-10 H. Lundbeck A/S Alpha-synuclein antibodies
WO2023283650A1 (en) 2021-07-09 2023-01-12 Eisai R&D Management Co., Ltd. Biomarkers for alzheimer's disease treatment
WO2023034230A1 (en) 2021-08-30 2023-03-09 Eisai R&D Mangement Co., Ltd. Subcutaneous formulations of anti-abeta protofibril antibody and methods of use thereof
RU2798399C2 (en) * 2017-12-15 2023-06-22 Юсб Биофарма Срл Antibodies
WO2023149970A1 (en) 2022-02-02 2023-08-10 Eisai R&D Management Co., Ltd. Methods of treatment using p-tau181 level
US12049493B2 (en) 2017-01-06 2024-07-30 Abl Bio Inc. Anti-alpha-synuclein antibodies and uses thereof
US12071483B1 (en) 2017-12-14 2024-08-27 Abl Bio Inc. Bispecific antibody to alpha-synuclein/insulin-like growth factor 1 receptor and use thereof
US12071472B2 (en) 2016-07-18 2024-08-27 The University Of British Columbia Methods of reducing toxicity induced by Amyloid beta (A-beta) oligomers using antibodies specific to A-beta oligomers
US12286469B2 (en) 2017-07-18 2025-04-29 The University Of British Columbia Humanized antibodies binding to amyloid-beta (A-beta)
WO2026068513A1 (en) 2024-09-24 2026-04-02 Bioarctic Ab Bispecific binding molecule

Families Citing this family (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2789963C (en) 2010-02-26 2019-09-03 Bioarctic Neuroscience Ab Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
DK3252076T3 (en) 2011-01-14 2019-12-02 Univ California DIAGNOSTIC USE OF ANTIBODIES AGAINST ROR-1 PROTEIN
EP3166970B1 (en) * 2014-07-10 2021-03-10 BioArctic AB Improved a-beta protofibril binding antibodies
WO2016040905A1 (en) * 2014-09-11 2016-03-17 Board Of Regents Of The University Of Texas System Detection of misfolded alpha synuclein protein
US10494425B2 (en) 2015-02-24 2019-12-03 Rpeptide, Llc Anti-amyloid-beta antibodies
CA3004494A1 (en) 2015-11-09 2017-05-18 The University Of British Columiba Epitopes in amyloid beta mid-region and conformationally-selective antibodies thereto
WO2017152088A1 (en) 2016-03-04 2017-09-08 JN Biosciences, LLC Antibodies to tigit
CA3049110A1 (en) * 2017-01-06 2018-07-12 Abl Bio Inc. Anti-.alpha.-syn antibody and use thereof
EP3612566A4 (en) * 2017-04-21 2021-03-03 Implicit Bioscience Limited CD 14 ANTAGONIST ANTIBODIES FOR THE TREATMENT OF NEURODEGENERATIVE DISEASES
US11220538B2 (en) 2017-05-01 2022-01-11 The Trustees Of The University Of Pennsylvania Monoclonal antibodies against alpha-synuclein fibrils
TW201901153A (en) 2017-05-16 2019-01-01 美商安培恩股份有限公司 Detection of misfolded TAU proteins and detection of misaligned TAU protein sets
JP7204235B2 (en) 2017-08-02 2023-01-16 ストレスマーク・バイオサイエンシーズ・インコーポレイテッド Antibodies that bind to activated α-synuclein
ES2955992T3 (en) 2017-12-19 2023-12-11 Chase Therapeutics Corp Method to evaluate a synucleinopathy
WO2019121952A1 (en) * 2017-12-21 2019-06-27 H. Lundbeck A/S Assay, method and treatment of alpha-synucleinopathies
CN109957546A (en) * 2017-12-25 2019-07-02 深圳宾德生物技术有限公司 A kind of Chimeric antigen receptor T cell and its preparation method and application targeting CD317
CN109957547A (en) * 2017-12-25 2019-07-02 深圳宾德生物技术有限公司 A kind of Chimeric antigen receptor T cell and its preparation method and application targeting CD317
US12583894B2 (en) 2018-04-04 2026-03-24 University Of Florida Research Foundation, Incorporated Materials and methods for the treatment of Lewy body disorders
TW202003576A (en) * 2018-05-10 2020-01-16 美商艾博視訊有限公司 Monoclonal antibodies activating CD40 and uses thereof
WO2020009482A1 (en) * 2018-07-03 2020-01-09 에이비엘바이오 주식회사 Anti-alpha-synuclein antibody and use thereof
WO2020079113A1 (en) * 2018-10-19 2020-04-23 Janssen Vaccines & Prevention B.V. Anti-synuclein antibodies
KR20210104094A (en) * 2018-12-12 2021-08-24 우시 바이올로직스 아일랜드 리미티드 Anti-TIM-3 Antibodies and Uses Thereof
RU2703430C1 (en) * 2018-12-13 2019-10-16 Федеральное государственное бюджетное учреждение "Национальный медицинский исследовательский центр глазных болезней имени Гельмгольца" Министерства здравоохранения Российской Федерации (ФГБУ "НМИЦ ГБ им. Гельмгольца" Минздрава России) Method for prediction of developing neurodegenerative diseases, underlying the pathogenesis of which is gamma-synucleinopathy
EP3946266A4 (en) * 2019-03-28 2023-07-12 The Chinese University Of Hong Kong Sumo peptides for treating neurodegenerative diseases
CA3136679A1 (en) * 2019-04-30 2020-11-05 Chase Therapeutics Corporation Alpha-synuclein assays
US20220291240A1 (en) * 2019-08-27 2022-09-15 The Johns Hopkins University Biomarkers for neurodegenerative disorders
CA3163308A1 (en) 2019-12-31 2021-07-08 Thomas N. Chase Kinases as biomarkers for neurodegenerative conditions
CN111171152B (en) * 2020-01-15 2023-04-18 吉林医药学院 PCSK9 antibody, and preparation method and application thereof
BR112022024221A2 (en) 2020-06-02 2022-12-20 Arcus Biosciences Inc ANTIBODIES TO TIGIT
US20230365665A1 (en) 2020-09-17 2023-11-16 Qatar Foundation For Education, Science And Community Development ANTIBODY COMPOSITIONS TARGETING NON-PHOSPHORYLATED a-SYNUCLEIN AGGREGATES
JP2023132247A (en) * 2022-03-10 2023-09-22 公立大学法人大阪 Biomarkers for detecting synucleinopathy and their use
CN117430686B (en) * 2022-07-22 2025-07-01 深圳市安群生物工程有限公司 Alpha-synuclein epitope peptide, SNCA kit for determining saliva and application of SNCA kit in diagnosis of parkinsonism
CN116589567B (en) * 2022-11-30 2024-03-19 西南大学 Potato virus X monoclonal antibody PVX-2 and its application
WO2025245381A1 (en) 2024-05-23 2025-11-27 The Trustrees Of Dartmouth College Methods and compositions for enhancing the persistence of car expressing tregs in the cns and other tissues

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009133521A2 (en) 2008-04-29 2009-11-05 Bioartic Neuroscience Ab Antibodies and vaccines for use in therapeutic and diagnostic methods for alpha-synuclein-related disorders

Family Cites Families (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU754062B2 (en) 1998-07-03 2002-10-31 Innogenetics N.V. Differential diagnosis of neurodegeneration
UA81216C2 (en) 1999-06-01 2007-12-25 Prevention and treatment of amyloid disease
EP1309341A2 (en) 2000-07-07 2003-05-14 Lars Lannfelt Prevention and treatment of alzheimer's disease
US20060018918A1 (en) 2000-12-27 2006-01-26 Board Of Regents, The University Of Texas System Production of stabilized conformational isomers of disease associated proteins
TW200509968A (en) 2002-11-01 2005-03-16 Elan Pharm Inc Prevention and treatment of synucleinopathic disease
US8506959B2 (en) 2002-11-01 2013-08-13 Neotope Biosciences Limited Prevention and treatment of synucleinopathic and amyloidogenic disease
US20080014194A1 (en) 2003-10-31 2008-01-17 Elan Pharmaceuticals, Inc. Prevention and Treatment of Synucleinopathic and Amyloidogenic Disease
US7358331B2 (en) 2003-05-19 2008-04-15 Elan Pharmaceuticals, Inc. Truncated fragments of alpha-synuclein in Lewy body disease
MXPA06004853A (en) * 2003-11-07 2006-07-06 Immunex Corp Antibodies that bind interleukin-4 receptor.
WO2005047860A2 (en) 2003-11-08 2005-05-26 Elan Pharmaceuticals, Inc. Antibodies to alpha-synuclein
WO2005108423A1 (en) 2004-05-11 2005-11-17 Atgen Co., Ltd. Novel peptides conferring environmental stress resistance and fusion proteins including said peptides
SE0401601D0 (en) 2004-06-21 2004-06-21 Bioarctic Neuroscience Ab Protofibril specific antibodies and uses thereof
US7553639B2 (en) 2006-01-31 2009-06-30 Elan Pharma International Limited Alpha-synuclein kinase
RU2429244C2 (en) 2006-03-23 2011-09-20 Байоарктик Ньюросайенс Аб Improved protofibril-selective antibodies and use thereof
US8147833B2 (en) 2007-02-23 2012-04-03 Neotope Biosciences Limited Prevention and treatment of synucleinopathic and amyloidogenic disease
CN101161245B (en) * 2007-11-29 2011-11-09 首都医科大学宣武医院 Use of stilbene glycosides and derivatives thereof to inhibit overexpression of synuclein
PT2448968T (en) 2009-06-29 2021-04-30 Bioarctic Ab N-terminal truncated amyloid beta protofibrils/ oligomers for use in therapeutic and diagnostic methods for alzheimer`s disease
CA2789963C (en) 2010-02-26 2019-09-03 Bioarctic Neuroscience Ab Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009133521A2 (en) 2008-04-29 2009-11-05 Bioartic Neuroscience Ab Antibodies and vaccines for use in therapeutic and diagnostic methods for alpha-synuclein-related disorders

Non-Patent Citations (31)

* Cited by examiner, † Cited by third party
Title
CHARTIER-HARLIN, MC. ET AL.: "Alpha-synuclein locus duplication as a cause of familial Parkinson's disease", LANCET, vol. 1, no. 364, 2004, pages 1167 - 1169
CONWAY, K. ET AL.: "Acceleration of oligomerization, not fibrillization, is a shared property of both a-synuclein mutations linked to early-onset Parkinson's disease: Implications for pathogenesis and therapy", PROC NATL ACAD SCI USA, vol. 97, 2000, pages 571 - 576
CREWS, L. ET AL.: "Role of synucleins in Alzheimer's disease", NEUROTOX RES., vol. 16, 2009, pages 306 - 317, XP055003485, DOI: doi:10.1007/s12640-009-9073-6
DESPLATS, P. ET AL.: "Inclusion formation and neuronal cell death through neuron-to- neuron transmission of alpha-synuclein", PROC NATL ACAD SCI U S A., vol. 4, no. 106, 2009, pages 13010 - 13015
EL-AGNAF, O. M. ET AL.: "Detection of oligomeric forms of a-synuclein protein in human plasma as a potential biomarker for Parkinson's disease", FASEB J, vol. 20, 2006, pages 419 - 425, XP009109458, DOI: doi:10.1096/fj.03-1449com
EMADI ET AL: "Isolation of a Human Single Chain Antibody Fragment Against Oligomeric alpha-Synuclein that Inhibits Aggregation and Prevents alpha-Synuclein-induced Toxicity", JOURNAL OF MOLECULAR BIOLOGY, LONDON, GB, vol. 368, no. 4, 17 April 2007 (2007-04-17), pages 1132 - 1144, XP022030022, ISSN: 0022-2836, DOI: DOI:10.1016/J.JMB.2007.02.089 *
EMADI SHARAREH ET AL: "Inhibiting aggregation of alpha-synuclein with human single chain antibody fragments", BIOCHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 43, no. 10, 16 March 2004 (2004-03-16), pages 2871 - 2878, XP002517647, ISSN: 0006-2960, [retrieved on 20040220], DOI: DOI:10.1021/BI036281F *
GEORGE, J. L. ET AL.: "Targeting the progression of Parkinson's disease", CURR NEUROPHARMACOL., vol. 7, 2009, pages 9 - 36
HANSEN, L ET AL.: "The Lewy body variant of Alzheimer's disease. A clinical and pathologic entity", NEUROLOGY, vol. 40, 1990, pages 1 - 8
KLUCKEN, J. ET AL.: "Clinical and biochemical correlates of insoluble a-synuclein in dementia with Lewy bodies", ACTA NEUROPATHOL (BERL), vol. 111, 2006, pages 101 - 108, XP019340860, DOI: doi:10.1007/s00401-005-0027-7
KRUGER, R. ET AL.: "Ala30Pro mutation in the gene encoding a-synuclein in Parkinson's disease", NAT GENET, vol. 18, 1998, pages 106 - 108, XP002921161, DOI: doi:10.1038/ng0298-106
LEATHERBARROW, R.J. ET AL.: "Effector functions of a monoclonal aglycosylated mouse IgG2a: binding and activation of complement component C and interaction with human monocyte Fc receptor", MOL IMMUNOL, vol. 22, 1985, pages 407 - 415, XP023852601, DOI: doi:10.1016/0161-5890(85)90125-7
LEE, H-J. ET AL.: "Clearance of a-synuclein oligomeric intermediates via the lysosomal degradation pathway", JOURNAL OF NEUROSCIENCE, vol. 24, 2004, pages 1888 - 1896, XP055305701, DOI: doi:10.1523/JNEUROSCI.3809-03.2004
LESLIE CREWS ET AL: "Role of Synucleins in Alzheimer's Disease", NEUROTOXICITY RESEARCH, vol. 16, no. 3, 1 October 2009 (2009-10-01), pages 306 - 317, XP055003485, ISSN: 1029-8428, DOI: 10.1007/s12640-009-9073-6 *
LI ET AL.: "Lewy bodies in grafted neurons in subjects with Parkinson's disease suggest host-to-graft disease propagation", NATURE MED., vol. 14, 2008, pages 501 - 503
MASLIAH E ET AL: "Effects of alpha-synuclein immunization in a mouse model of Parkinsons disease", NEURON, CELL PRESS, US, vol. 46, no. 6, 16 June 2005 (2005-06-16), pages 857 - 868, XP008091682, ISSN: 0896-6273, DOI: DOI:10.1016/J.NEURON.2005.05.010 *
MASLIAH, E. ET AL.: "Effects of alpha-synuclein immunization in a mouse model of Parkinson's disease", NEURON, vol. 46, 2005, pages 857 - 868, XP008091682, DOI: doi:10.1016/j.neuron.2005.05.010
NÄSSTRÖM TOMAS ET AL: "The lipid peroxidation metabolite 4-oxo-2-nonenal cross-links alpha-synuclein causing rapid formation of stable oligomers", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ACADEMIC PRESS INC. ORLANDO, FL, US, vol. 378, no. 4, 23 January 2009 (2009-01-23), pages 872 - 876, XP002546413, ISSN: 0006-291X, [retrieved on 20081212], DOI: DOI:10.1016/J.BBRC.2008.12.005 *
OINAS, M. ET AL.: "alpha-Synuclein pathology in the spinal cord autonomic nuclei associates with alpha-synuclein pathology in the brain: a population-based Vantaa 85+ study", ACTA NEUROPATHOL., vol. 119, 2010, pages 715 - 722
PAPACHRONI KATERINA K ET AL: "Autoantibodies to alpha-synuclein in inherited Parkinson's disease", JOURNAL OF NEUROCHEMISTRY, WILEY INTERSCIENCE, NEW YORK, NY, US, vol. 101, no. 3, 1 May 2007 (2007-05-01), pages 749 - 756, XP002530228, ISSN: 0022-3042, DOI: DOI:10.1111/J.1471-4159.2006.04365.X *
POLYMEROPOULOS, M.H. ET AL.: "Mutation in the a-Synuclein Gene Identified inFamilies with Parkinson's Disease", SCIENCE, vol. 276, 1997, pages 2045 - 2047, XP002083895, DOI: doi:10.1126/science.276.5321.2045
PROC NATL ACAD SCI U S A., vol. 106, 2009, pages 12571 - 12572
PROC NATL ACAD SCI USA., vol. 106, 2009, pages 17606
QIN ZHIJIE ET AL: "Effect of 4-hydroxy-2-nonenal modification on alpha-synuclein aggregation", JOURNAL OF BIOLOGICAL CHEMISTRY, THE AMERICAN SOCIETY OF BIOLOGICAL CHEMISTS, INC., BALTIMORE, MD, US, vol. 282, no. 8, 23 February 2007 (2007-02-23), pages 5862 - 5870, XP002546322, ISSN: 0021-9258, [retrieved on 20061214], DOI: DOI:10.1074/JBC.M608126200 *
QIN, Z. ET AL.: "Effect of 4 -hydroxy-2-nonenal modification on a -synuclein aggregation", J BIOL CHEM, vol. 282, 2007, pages 5862 - 5870, XP002546322, DOI: doi:10.1074/JBC.M608126200
RUDIKOFF S ET AL: "Single amino acid substitution altering antigen-binding specificity", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, WASHINGTON, DC; US, vol. 79, 1 March 1982 (1982-03-01), pages 1979 - 1983, XP007901436, ISSN: 0027-8424, DOI: DOI:10.1073/PNAS.79.6.1979 *
SINGLETON, AB. ET AL.: "alpha-Synuclein locus triplication causes Parkinson's disease", SCIENCE, vol. 302, 2003, pages 841, XP002382468, DOI: doi:10.1126/science.1090278
WRIGTH, A.: "Effect of C2-associated carbohydrate structure on Ig effector function: studies with chimeric mouse-human IgG antibodies in glycosylation mutants of Chinese hamster ovary cells", J IMMUNOL, vol. 160, 1998, pages 3393 - 3402, XP002443678
XU, Y. ET AL.: "Residue at position 331 in the IgG and IgG4 CH2 domains contributes to their differential ability to bind and activate complement", J BIOL CHEM., vol. 269, 1994, pages 3469 - 3474
YORITAKA, A. ET AL.: "Immunohistochemical detection of 4-hydroxynonenal protein adducts in Parkinson disease", PROC NATL ACAD SCI USA, vol. 93, 1996, pages 2696 - 2701
ZARRANZ, J. ET AL.: "The new mutation, E46K, of a-synuclein causes Parkinson and Lewy body dementia", ANN NEUROL., vol. 55, 2004, pages 164 - 173

Cited By (99)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2282758B1 (en) 2008-04-29 2018-11-21 BioArctic AB Antibodies and vaccines for use in therapeutic and diagnostic methods for alpha-synuclein-related disorders
TWI596112B (en) * 2012-01-20 2017-08-21 建新公司 Anti-cxcr3 antibodies
WO2014132210A1 (en) 2013-02-28 2014-09-04 United Arab Emirates University Alpha-synuclein antibodies and uses thereof
US9534044B2 (en) 2013-02-28 2017-01-03 United Arab Emirates University Alpha-synuclein antibodies and uses thereof
US10208111B2 (en) 2013-02-28 2019-02-19 United Arab Emirates University Alpha-synuclein antibodies and uses thereof
CN105121473A (en) * 2013-02-28 2015-12-02 阿联酋大学 Alpha-synuclein antibodies and uses thereof
CN105121473B (en) * 2013-02-28 2019-11-12 阿联酋大学 Alpha-synapse nucleoprotein antibody and application thereof
WO2015075011A1 (en) 2013-11-21 2015-05-28 F. Hoffmann-La Roche Ag ANTI-alpha-SYNUCLEIN ANTIBODIES AND METHODS OF USE
US9670274B2 (en) 2013-11-21 2017-06-06 Hoffmann-La Roche Inc. Anti-alpha-synuclein antibodies and methods of use
US9493553B2 (en) 2013-11-21 2016-11-15 Hoffmann-La Roche Inc. Anti-alpha-synuclein antibodies and methods of use
US10316082B2 (en) 2013-11-21 2019-06-11 Hoffmann-La Roche Inc. Anti-alpha-synuclein antibodies and methods of use
US9890209B2 (en) 2013-11-21 2018-02-13 Hoffmann-La Roche Inc. Anti-alpha-synuclein antibodies and methods of use
US9732148B2 (en) 2014-10-16 2017-08-15 Genentech, Inc. Anti-α-synuclein antibodies and methods of use
WO2016061389A2 (en) 2014-10-16 2016-04-21 Genentech, Inc. Anti-alpha-synuclein antibodies and methods of use
WO2016180726A1 (en) 2015-05-08 2016-11-17 Fundació Institut D'investigació En Ciències De La Salut Germans Trias I Pujol Method for in vitro diagnosis of dementia with lewy bodies using alphasynuclein gene transcripts
EP3091087A1 (en) 2015-05-08 2016-11-09 Fundació Institut d'Investigació en Ciències de la Salut Germans Trias i Pujol Method for in vitro diagnosis of synucleinopathies using alpha-synuclein gene transcripts
US11421024B2 (en) 2015-07-13 2022-08-23 H. Lundbeck A/S Agents, uses and methods for the treatment of synucleinopathy
US11524995B2 (en) 2015-07-13 2022-12-13 H. Lundbeck A/S Agents, uses and methods for the treatment of synucleinopathy
US10800836B2 (en) 2015-07-13 2020-10-13 H. Lundbeck A/S Agents, uses and methods for the treatment of synucleinopathy
US11542323B2 (en) 2015-07-13 2023-01-03 H. Lundbeck A/S Agents, uses and methods for the treatment of synucleinopathy
US10364285B2 (en) 2015-07-13 2019-07-30 H. Lundbeck A/S Antibodies for the treatment of synucleinopathy
US10358483B2 (en) 2015-07-13 2019-07-23 H. Lundbeck A/S Antibodies for the treatment of synucleinopathy
US10358484B2 (en) 2015-07-13 2019-07-23 H. Lundbeck A/S Antibodies for the treatment of synucleinopathy
US10358482B2 (en) 2015-07-13 2019-07-23 H. Lundbeck A/S Antibodies for the treatment of synucleinopathy
US11327080B2 (en) 2015-07-21 2022-05-10 BioArctic Neruoscience AB Method for treatment of traumatic brain injury targeting aggregated peptides
WO2017013599A1 (en) 2015-07-21 2017-01-26 Bioarctic Neuroscience Ab Method for treatment of traumatic brain injury targeting aggregated peptides
US10772969B2 (en) 2015-11-09 2020-09-15 The University Of British Columbia N-terminal epitopes in amyloid beta and conformationally-selective antibodies thereto
US12173055B2 (en) 2015-11-09 2024-12-24 The University Of British Columbia N-terminal epitopes in amyloid beta and conformationally-selective antibodies thereto
US10759837B2 (en) 2015-11-09 2020-09-01 The University Of British Columbia Anti-amyloid beta antibodies binding to a cyclic amyloid beta peptide
US11970522B2 (en) 2015-11-09 2024-04-30 The University Of British Columbia Cyclic compound/peptide comprising an A-beta15-18 peptide and a linker that is covalently coupled to the n-terminus residue and the c-terminus residue of the A-BETA15-18 peptide
US11560424B2 (en) 2016-06-02 2023-01-24 Medimmune Limited Antibodies to alpha-synuclein and uses thereof
US10889639B2 (en) 2016-06-02 2021-01-12 Medimmune Limited Antibodies to alpha-synuclein and uses thereof
AU2017272804B2 (en) * 2016-06-02 2023-11-23 Medimmune Limited Antibodies to alpha-synuclein and uses thereof
KR102499438B1 (en) 2016-06-02 2023-02-14 메디뮨 리미티드 Antibodies to alpha-synuclein and uses thereof
US10160800B2 (en) 2016-06-02 2018-12-25 Medimmune Limited Antibodies to α-synuclein and uses thereof
KR20190013923A (en) * 2016-06-02 2019-02-11 메디뮨 리미티드 Antibodies to alpha-synuclein and uses thereof
WO2017207739A1 (en) * 2016-06-02 2017-12-07 Medimmune Limited Antibodies to alpha-synuclein and uses thereof
EP4000632A1 (en) * 2016-06-02 2022-05-25 MedImmune Limited Antibodies to alpha-synuclein and uses thereof
EA038358B1 (en) * 2016-06-02 2021-08-13 Медиммун Лимитед Antibodies to alpha-synuclein and uses thereof
WO2018011353A1 (en) 2016-07-14 2018-01-18 Bioarctic Ab Brain delivery protein
EP3484918A1 (en) * 2016-07-14 2019-05-22 BioArctic Neuroscience AB Brain delivery protein
US12071472B2 (en) 2016-07-18 2024-08-27 The University Of British Columbia Methods of reducing toxicity induced by Amyloid beta (A-beta) oligomers using antibodies specific to A-beta oligomers
US10751382B2 (en) 2016-11-09 2020-08-25 The University Of British Columbia Anti-amyloid beta antibodies binding to a cyclic amyloid beta peptide
US11779629B2 (en) 2016-11-09 2023-10-10 The University Of British Columbia Compositions comprising cyclic peptides derived from an A-beta peptide
US12421303B2 (en) 2016-11-15 2025-09-23 H. Lundbeck A/S Agents, uses and methods for the treatment of synucleinopathy
US10889635B2 (en) 2016-11-15 2021-01-12 H. Lundbeck A/S Agents, uses and methods for the treatment of synucleinopathy
WO2018091444A1 (en) * 2016-11-15 2018-05-24 H. Lundbeck A/S Agents, uses and methods for the treatment of synucleinopathy
US11325968B2 (en) 2016-12-16 2022-05-10 H. Lundbeck A/S Alpha-synuclein antibodies
US10364286B2 (en) 2016-12-22 2019-07-30 H. Lundbeck A/S Monoclonal anti-alpha-synuclein antibodies for preventing tau aggregation
US12049493B2 (en) 2017-01-06 2024-07-30 Abl Bio Inc. Anti-alpha-synuclein antibodies and uses thereof
WO2018151821A1 (en) * 2017-02-17 2018-08-23 Bristol-Myers Squibb Company Antibodies to alpha-synuclein and uses thereof
KR102573778B1 (en) 2017-02-17 2023-08-31 브리스톨-마이어스 스큅 컴퍼니 Antibodies to alpha-synuclein and uses thereof
CN110506057B (en) * 2017-02-17 2023-09-29 百时美施贵宝公司 ALPHA synuclein antibody and application thereof
AU2018222743B2 (en) * 2017-02-17 2024-05-02 Bristol-Myers Squibb Company Antibodies to alpha-synuclein and uses thereof
US11142570B2 (en) 2017-02-17 2021-10-12 Bristol-Myers Squibb Company Antibodies to alpha-synuclein and uses thereof
US11827695B2 (en) 2017-02-17 2023-11-28 Bristol-Myers Squibb Company Antibodies to alpha-synuclein and uses thereof
KR20190117622A (en) * 2017-02-17 2019-10-16 브리스톨-마이어스 스큅 컴퍼니 Antibodies to Alpha-Synuclein and Their Uses
US12286469B2 (en) 2017-07-18 2025-04-29 The University Of British Columbia Humanized antibodies binding to amyloid-beta (A-beta)
EP3672635A4 (en) * 2017-08-23 2021-05-12 The Trustees of The University of Pennsylvania MONOCLONAL ANTIBODIES AGAINST PATHOLOGICAL ALPHA-SYNUCLEIN, AND METHODS USING THEM
US11155608B2 (en) 2017-08-23 2021-10-26 The Trustees Of The University Of Pennsylvania Monoclonal antibodies against pathological alpha-synuclein, and methods using same
RU2657763C1 (en) * 2017-09-12 2018-06-15 федеральное государственное бюджетное образовательное учреждение высшего образования "Первый Санкт-Петербургский государственный медицинский университет имени академика И.П. Павлова" Министерства здравоохранения Российской Федерации Method for diagnostics of parkinson's disease
AU2018370279B2 (en) * 2017-11-17 2022-11-03 Abl Bio Inc. Antibodies to a-synuclein and uses thereof
CN111356701A (en) * 2017-11-17 2020-06-30 Abl生物公司 Anti- α -synuclein antibodies and uses thereof
AU2022252753B2 (en) * 2017-11-17 2025-06-05 Abl Bio Inc. ANTIBODIES TO a-SYNUCLEIN AND USES THEREOF
WO2019098763A3 (en) * 2017-11-17 2019-07-11 에이비엘바이오 주식회사 ANTIBODIES TO α-SYNUCLEIN AND USES THEREOF
CN111356701B (en) * 2017-11-17 2023-11-21 Abl生物公司 Anti-alpha-synuclein antibodies and their uses
US12071483B1 (en) 2017-12-14 2024-08-27 Abl Bio Inc. Bispecific antibody to alpha-synuclein/insulin-like growth factor 1 receptor and use thereof
WO2019115671A1 (en) * 2017-12-15 2019-06-20 Ucb Biopharma Sprl Anti-alpha synuclein antibodies
WO2019115674A1 (en) * 2017-12-15 2019-06-20 Ucb Biopharma Sprl Anti-alpha-synuclein antibodies
IL275223B1 (en) * 2017-12-15 2023-07-01 UCB Biopharma SRL Anti-alpha synuclein antibodies
AU2018382527B2 (en) * 2017-12-15 2025-04-03 UCB Biopharma SRL Anti-alpha synuclein antibodies
RU2798399C2 (en) * 2017-12-15 2023-06-22 Юсб Биофарма Срл Antibodies
IL275223B2 (en) * 2017-12-15 2023-11-01 UCB Biopharma SRL Anti-alpha synuclein antibodies
US12545720B2 (en) 2017-12-15 2026-02-10 UCB Biopharma SRL Anti-alpha-synuclein antibodies
IL275187B1 (en) * 2017-12-15 2026-01-01 UCB Biopharma SRL Anti-alpha-synuclein antibodies
AU2018382530B2 (en) * 2017-12-15 2025-04-17 UCB Biopharma SRL Anti-alpha-synuclein antibodies
US12410244B2 (en) 2017-12-15 2025-09-09 UCB Biopharma SRL Anti-alpha-synuclein antibodies
US11292831B2 (en) 2017-12-15 2022-04-05 UCB Biopharma SRL Anti-alpha synuclein antibodies
US11261242B2 (en) 2017-12-15 2022-03-01 UCB Biopharma SRL Anti-alpha-synuclein antibodies
WO2020023530A2 (en) 2018-07-24 2020-01-30 Eisai R&D Management Co., Ltd. Methods of treatment and prevention of alzheimer's disease
TWI734279B (en) * 2018-12-14 2021-07-21 美商美國禮來大藥廠 Anti-alpha-synuclein antibodies and uses thereof
WO2020123330A3 (en) * 2018-12-14 2020-07-23 Eli Lilly And Company Anti-alpha-synuclein antibodies and uses thereof
US12459993B2 (en) 2018-12-14 2025-11-04 Eli Lilly And Company Anti-alpha-synuclein antibodies and uses thereof
AU2019395325B2 (en) * 2018-12-14 2023-06-29 Eli Lilly And Company Anti-Alpha-Synuclein Antibodies and Uses Thereof
WO2021206561A1 (en) 2020-04-10 2021-10-14 Syngle Therapeutics B.V. Novel alpha-synuclein binding antibodies, or antigen binding portions thereof
NL2025332B1 (en) * 2020-04-10 2021-10-26 Syngle Therapeutics B V Novel alpha-synuclein binding antibodies, or antigen binding portions thereof.
US12459998B2 (en) 2020-04-10 2025-11-04 Syngle Therapeutics B.V. Alpha-synuclein binding antibodies, or antigen binding portions thereof
IL298584B1 (en) * 2020-06-26 2024-06-01 Bioarctic Ab Antibodies against protofibril-binding alpha-synuclein
WO2021260434A1 (en) 2020-06-26 2021-12-30 Bioarctic Ab α-SYNUCLEIN PROTOFIBRIL-BINDING ANTIBODIES
EP4570315A2 (en) 2020-06-26 2025-06-18 BioArctic AB Alfa-synuclein protofibril-binding antibodies
IL298584B2 (en) * 2020-06-26 2024-10-01 Bioarctic Ab Antibodies against protofibril-binding alpha-synuclein
EP4570315A3 (en) * 2020-06-26 2025-09-17 BioArctic AB Alfa-synuclein protofibril-binding antibodies
RU2810587C1 (en) * 2020-06-26 2023-12-27 Биоарктик Аб ANTIBODIES THAT BIND TO α-SYNUCLEIN PROTOFIBRILS
US11339212B2 (en) 2020-06-26 2022-05-24 Bioarctic Ab α-synuclein protofibril-binding antibodies
TWI879983B (en) * 2020-06-26 2025-04-11 瑞典商生物極公司 α-YNUCLEIN PROTOFIBRIL-BINDING ANTIBODIES
WO2023283650A1 (en) 2021-07-09 2023-01-12 Eisai R&D Management Co., Ltd. Biomarkers for alzheimer's disease treatment
WO2023034230A1 (en) 2021-08-30 2023-03-09 Eisai R&D Mangement Co., Ltd. Subcutaneous formulations of anti-abeta protofibril antibody and methods of use thereof
WO2023149970A1 (en) 2022-02-02 2023-08-10 Eisai R&D Management Co., Ltd. Methods of treatment using p-tau181 level
WO2026068513A1 (en) 2024-09-24 2026-04-02 Bioarctic Ab Bispecific binding molecule

Also Published As

Publication number Publication date
ES2661925T3 (en) 2018-04-04
HRP20180230T8 (en) 2021-04-30
CA2789963A1 (en) 2011-09-01
JP5894939B2 (en) 2016-03-30
RU2012140954A (en) 2014-04-10
CN110655573B (en) 2023-07-18
PL2539366T3 (en) 2018-06-29
HRP20180230T1 (en) 2018-03-09
SI2539366T1 (en) 2018-05-31
AU2011219414A1 (en) 2012-09-06
DK2539366T3 (en) 2018-02-05
US20120308572A1 (en) 2012-12-06
US8632776B2 (en) 2014-01-21
CN110655573A (en) 2020-01-07
CY1120014T1 (en) 2018-12-12
CN106397588A (en) 2017-02-15
US8859501B2 (en) 2014-10-14
LT2539366T (en) 2018-04-25
RS57029B1 (en) 2018-05-31
CN102869680A (en) 2013-01-09
US8968734B2 (en) 2015-03-03
CN102869680B (en) 2016-10-05
PT2539366T (en) 2018-02-13
US20140363447A1 (en) 2014-12-11
US9084832B2 (en) 2015-07-21
JP2013525266A (en) 2013-06-20
US20130309251A1 (en) 2013-11-21
CA2789963C (en) 2019-09-03
EP2539366B1 (en) 2017-11-08
US20150139900A1 (en) 2015-05-21
SMT201800044T1 (en) 2018-05-02
CN106397588B (en) 2020-09-08
EP2539366A1 (en) 2013-01-02
HUE038313T2 (en) 2018-10-29
AU2011219414B2 (en) 2014-11-20
RU2555526C2 (en) 2015-07-10
NO2539366T3 (en) 2018-04-07

Similar Documents

Publication Publication Date Title
US8968734B2 (en) Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for Parkinson&#39;s disease, dementia with lewy bodies and other α-synucleinopathies
US10208111B2 (en) Alpha-synuclein antibodies and uses thereof
JP7159185B2 (en) Anti-PHF-tau antibody and uses thereof
EP2282758A2 (en) Antibodies and vaccines for use in therapeutic and diagnostic methods for alpha-synuclein-related disorders
JP2021507693A (en) Anti-alpha-synuclein antibody
JP2021509012A (en) Anti-alpha-synuclein antibody
TW202434629A (en) Methods of treating neurological disorders with anti-abeta antibodies
EA049614B1 (en) ANTI-PSF-TAU ANTIBODIES AND METHODS OF THEIR APPLICATION

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201180011363.X

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11713058

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 13578710

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 2011219414

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2789963

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2012554464

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2011219414

Country of ref document: AU

Date of ref document: 20110225

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2011713058

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012140954

Country of ref document: RU

Ref document number: 2011713058

Country of ref document: EP