WO2011060144A2 - Compositions and methods to protect cells by blocking entry of pathogen proteins - Google Patents

Compositions and methods to protect cells by blocking entry of pathogen proteins Download PDF

Info

Publication number
WO2011060144A2
WO2011060144A2 PCT/US2010/056351 US2010056351W WO2011060144A2 WO 2011060144 A2 WO2011060144 A2 WO 2011060144A2 US 2010056351 W US2010056351 W US 2010056351W WO 2011060144 A2 WO2011060144 A2 WO 2011060144A2
Authority
WO
WIPO (PCT)
Prior art keywords
species
cell
proteins
phytophthora
binding
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/056351
Other languages
French (fr)
Other versions
WO2011060144A3 (en
Inventor
Brett Tyler
Shiv Kale
Vincenzo Antignani
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Virginia Tech Intellectual Properties Inc
Original Assignee
Virginia Tech Intellectual Properties Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Virginia Tech Intellectual Properties Inc filed Critical Virginia Tech Intellectual Properties Inc
Publication of WO2011060144A2 publication Critical patent/WO2011060144A2/en
Publication of WO2011060144A3 publication Critical patent/WO2011060144A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1019Tetrapeptides with the first amino acid being basic
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/66Phosphorus compounds
    • A61K31/683Diesters of a phosphorus acid with two hydroxy compounds, e.g. phosphatidylinositols
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/465Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/08Tripeptides
    • C07K5/0819Tripeptides with the first amino acid being acidic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1002Tetrapeptides with the first amino acid being neutral
    • C07K5/1016Tetrapeptides with the first amino acid being neutral and aromatic or cycloaliphatic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1021Tetrapeptides with the first amino acid being acidic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1024Tetrapeptides with the first amino acid being heterocyclic
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/92Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving lipids, e.g. cholesterol, lipoproteins, or their receptors
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2410/00Assays, e.g. immunoassays or enzyme assays, involving peptides of less than 20 animo acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/02Screening involving studying the effect of compounds C on the interaction between interacting molecules A and B (e.g. A = enzyme and B = substrate for A, or A = receptor and B = ligand for the receptor)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/10Screening for compounds of potential therapeutic value involving cells

Definitions

  • the present invention generally relates to prevention of microbial, especially oomycete or fungal , disease and, more particul arly, to cel lular targets for blocking entry of pathogen effector proteins into plant or animal cell s.
  • the invention also prov ides compositi ons and methods for identifying compounds that block entry of pathogen effector proteins into cell s, and treatments using such compounds.
  • Fungi and parasites such as Plasmodium are eukaryotes, which are organisms that have comp lex internal cell structures (bacteria and viruses have simpler structures and are excluded). Infections by parasites and fungi are especial ly difficult to develop drugs for because humans are also eukaryotes, so many drugs toxic to these organisms are also toxic to humans.
  • Plasmodium other eukaryotic pathogens of humans include the parasites Schistosoma, Onchocerca, Trypanosoma , and Leishmania, fungi that afflict AIDS patients such as Candida, Histoplasma, Cryptococcus and Aspergillus, and the Valley Fever fungus,
  • Coccidioides that affects healthy people in the Southwest. Fungal spores are also responsible for allergies, asthma and mold-related i l lnesses.
  • Eukaryoti c pathogens of plants are also a major problem in agriculture, horti culture and forestry, and include fungi and fungal-like organisms related to marine al gae called oomycetes. These diseases cause bill ions o f doll ars in losses each year.
  • Some fungal p lant pathogens include rust fungi, such as the new virulent wheat rust fungus, Ug99, that is sweeping through Africa and the middle east, and the rice blast fungus which causes maj or losses to the US and Asian rice crop each year.
  • Oomycete pathogens include the late blight pathogen of potato ⁇ Phytophthora infestans) that causes the Irish potato famine and sti ll causes $ 5 bi llion in losses worldwide annually, Phytophthora ramorum that causes Sudden Oak Death in
  • Eukaryotic pathogens of both humans and plants release protein toxins called effectors that have the abi lity to infiltrate inside host cells, across the membrane barrier that normally surrounds the host cells . Once the effectors enter the host cell, they reprogram the cells to suppress or block the immune responses of the host and to make the host tissue more congenial for reproduction and spread of the pathogen . Therefore, drugs that could block the entry of effector proteins into host cells would potential ly suppress infection by a broad range of eukaryotic pathogens important to medicine and agriculture.
  • plants have evolved defense mechanisms that afford some protection from pathogens. Constitutive defenses include structures such as the cuticle and preformed anti -m icrobial chemicals. Plants have also evo lved an active defense response that i s induced by detection of an attacking pathogen. The response includes rapid synthesi s of anti-microbial chemicals and proteins, and a programmed cell death (PCD) response, called the hypersensitive response (HR).
  • PCD programmed cell death
  • the abili ty of plants to detect and respond to pathogens is mediated by various receptors and si gnal transducti on pathways that have close similarities to the innate immunity mechanisms of ani mals.
  • pathogens of both plants and animals have evolved mechani sms to avoid or suppress host defenses, thereby retaining the ability to cause many destructive diseases affecting crops and forests.
  • Oomycetes are fungus-like organisms many of which are pathogens. For examp le, most o f the more than 80 species of the oomycete genus Phytoph thora are destructive pathogens, including the potato late bli ght pathogen, Phytophthora infestans, which caused the Irish potato famine in the 1 8th century, the soybean root and stem rot pathogen P. sojae, and Phytophthora ramorum, the causative agent of Sudden Oak Death that is currently ravishing oak forests in Californi a.
  • the closely related oomycete genus Pythium contains more than 100 species, most of which are also pathogens .
  • the oomycetes also inc lude a number of commercially important and diverse downy mildew pathogens that are obligate parasites, often with narrow host ranges.
  • effector proteins which are secreted by plant pathogens and have the abi lity to enter plant cells, have been documented for many classes of plant pathogens, includi ng bacteria, fungi, oomycetes and nematodes. Once inside a host cell, the maj or function of an effector protein is to suppress the signal transduction pathways that mediate plants defense responses, and many effector proteins also suppress host programmed cel l death.
  • the activities of fungal effector proteins are known to include chitin-bind ing, cytotoxi city, metal loprotease activity, and protease inhibition.
  • Pathogen effectors may also reprogram the plant cell to promote nutrition of the pathogen.
  • R resistance
  • pathogen genes encoding effectors are referred to as avi rulence (Avr) genes, because, i n practice, they actually prevent infection of host plants whi ch contain cognate receptor proteins by binding to the receptor, thereby alerti ng the plant to their presence, and initiating an anti-pathogen response.
  • Avr avi rulence
  • genes encoding plant effectors for which cognate plant receptors do not exist are referred to as viru lence genes.
  • Genetic mapping of oomycete Avr genes led to the cloning of the first four effector genes: Avrlb-1 from P. sojae (Shan, W., Cao, M., Leung, D. & Tyler, B. M.
  • the Avrlb locus of Phytophthora sojae encodes an elicitor and a regulator required for avirulence on soybean plants carrying resistance gene Rpslb. Mol. Plant Microbe Interact 17, 394-403 (2004); Avr3a from P. infestans (Armstrong, M. R. et al.
  • An ancestral oomycete locus contains late blight avirulence gene Avr3a, encoding a protein that is recognized in the host cytoplasm. Proc Natl Acad Sci U S A 102, 7766- 71 (2005); and ATR1 (Rehmany, A.P., Gordon, A., Rose, L.E., Allen, R.L.,
  • the present invention provides methods to block the entry of pathogen effector proteins into host cells (e.g. , "translocation"), thereby preventi ng host cell infection.
  • the methods are based on the discovery that binding of polar lipi ds such as phosphatidyI-inositol-3 -phosphate (PI-3 -P) and/or phosphatidyl-inositol- 4-phosphate (PI-4-P) and/or phosphatidic acid to effector molecules via a virulence motif is a prerequisite to translocation of the effector into a host cell, and that when binding is blocked, translocation, and hence infection of the cell, does n ot occur.
  • polar lipi ds such as phosphatidyI-inositol-3 -phosphate (PI-3 -P) and/or phosphatidyl-inositol- 4-phosphate (PI-4-P) and/or phosphatidic acid to effector molecules via a virulence motif
  • the BXZ motif encompasses a fami ly of motifs, which frequently occur at or near the N-terminus of an effector protein, examples of which include but are not limited to RxLR (which may function in concert with a dEER moti f), Pexel, RYWT, RIYER, RSLR, RRLLR, RRFLR, and RFYR, and others, all of which may collectively be referred to herein as "virulence motifs.
  • Binding may be prevented by any of several strategies including but not limited to i) blocking the effector motif itself, and ii) blocking the lipids of the cell to which the motif binds.
  • the moti f itself may be blocked by e.g. inositol 1 , 4-diphosphate, or by other inositol containing phosphatidic acids, phospholipids and sphingolipids, or any other compound which binds to one or the virulence motif.
  • Blocking of the lipid generally at or on the celt surface
  • PI-3-P phosphatidyl- inositol-3-phosphate
  • PI-4-P phosphatidyl-inositol- 4-phosphate
  • phosphatidic acid and/or any other polar lipid that is bound by an effector thereby preventing effector binding to a moti f.
  • the entry of effector protei ns from oomycetes, fungi, and other types of pathogens, including human pathogens (e.g. Plasmodium) may be blocked.
  • Plasmodium effector proteins include a Pexel motif which i s selectively bound as a prerequi site for translocation .
  • Blocki ng of effector entry prevents the pathogen from inhibiting host cell defense mechanisms and allows the host to mount an effective response to the pathogen.
  • the invention al so provides elucidation of the structural requirements of the virulence motifs in oomycetes and fungi, and of the sequences which flank the motifs, leading to the ability to predict which genes in the genome of a pathogen are likely to encode effector molecules.
  • translocation of an effector protein from a pathogen such as a bacteria, fungus, oomycete, protozoa or nematode, into a host including ani mal s (including humans) and plants i s prevented by selectively binding a blocking compound to one or more BXZ virulence motifs of the effector protein.
  • translocation of an effector protein from a pathogen is prevented by selectively binding a blocking compound to one or more pol ar lipi ds which would otherwise bind an effector motif.
  • the host cell defense mechanisms are permitted to mount an effective defense against the pathogen (it being recognized that after entry, the effector protein would compromise the host cel l defense mechanisms).
  • the invention provides a mechanism to avoid the adverse outcomes attributed to pathogenic effector proteins, and it is applicable in promoting the health and viabi lity of both pl ants and animals.
  • Another embodiment of the invention pertains to i denti fying compounds which are suitable for use in protecting cells (animal and plant) from pathogenic effector proteins.
  • an assay is used to determine whether or not a compound binds to one or more moti fs of an effector protein which are bound by phosphoinositides or another polar lipid as a prerequisite for translocation .
  • the assay may include pathogenic effector proteins which include a BXZ motif (e .g.
  • RxLRPexel, RYWT, RIYER, RSLR, RRLLR, RRFLR, and RFYR or simi lar motifs may include protein substrates which present one or more BXZ motifs in a manner which can be bound by a candidate compound.
  • an assay may include one or more polar lipids which bind to the motifs, in order to identi fy compounds which bind and thus would block moti f binding.
  • Such assays may include competition assays between candidate compounds and compounds (e.g. peptides or proteins) which contain the moti f(s) .
  • the assay may be in the solid or liquid phase and may employ fluorescent, phosphorescent, chemi luminescent, col orimetric, or other suitable labels to indicate binding of a candidate compound to one or more motifs which are required to be bound by phosphoinositi des or another po lar lipid as a prerequisite for translocation .
  • Yet another embodiment of the invention pertains to a methodology of identifying whether an amino acid sequence of a protein in a pathogen is part of an effector protein.
  • hidden Markov modeling HMM is used to compare flanking sequences of a BXZ sequence (e.g. of an RxLR sequence) to determine whether the structural features for the moti f are present.
  • HMM hidden Markov modeling
  • FIG. 1A-E RxLR and dEER motifs are required for Avrlb function in P. sojae transformants.
  • A Sequences of mutations in the RxLRl, RxLR2 and dEER motifs. Bold indicates amino acids of the RxLR motifs and the alanines used to replace them in the mutations. Italics indicate the dEER motif and the alanines used to replace it in the mutant.
  • B Pst I restriction analysis of PCR products amplified from Avrlb- 1 transformants using primers specific for the HAM34 promoter and terminator regions. Pst I restriction profiles of Avrlb(RxLRl AAAA ), Avrlb(RxLR2 AAAA ),
  • Avrlb(RxLRl AAAA , 2 AAAA ), Avi b(dEER A6 ) and wild type (WT) Avrlb are distinguished from each other because the mutations introduce a Pst I site.
  • Avrlb(dEER Af ')-9 was confirmed by sequencing the PCR product.
  • C Detection of Avrlb mRNA in P. sojae stable transformants by RT-PCR. Upper panel shows amplification with primers internal to the Avrlb C-terminus. Lower panel shows amplification with P. sojae actin primers. P. sojae stable transformants were the same as for (B) except that an amplification reaction is also shown from RNA from a P. sojae transformant containing a ⁇ -glucuronidase gene (GUS). No amplification was observed when reverse transcriptase was omitted from the reactions.
  • GUS ⁇ -glucuronidase gene
  • Soybean leaves were bombarded using a double-barreled device that delivered Avrlb- 1 DNA-bearing particles to one side of the leaf and control (empty vector) DNA to the other; both sides received GUS DNA. Ratio of blue spots in the presence of Avrlb-1 compared to the control.
  • sAvrlb indicates a gene encoding secretory Avrlb and mAvrlb indicates one encoding mature Avrlb (lacking the secretory leader).
  • WT indicates wild-type RxLR motif
  • RxLR2 AAAA indicates the four alanine replacement of the RxLR2 motif
  • dEERA6 indicates the six alanine replacement of the dEER motif. Averages and standard errors are from 16 pairs of shots, p values comparing results from cultivars with Rpslb (L77-1863) or without (rps; Williams) were calculated using the Wilcoxon rank sum test.
  • FIG. 3A-D P. sojae stable trans formants show that two other Avh proteins can replace the RxLR and dEER region of Avrlb.
  • A Sequences of the N-termini of wild type and mutant Avrlb proteins, and of fusions with two other Avh proteins.
  • FIG. 4A and B Functional replacement of Avrlb host targeting signal with protein transduction motifs and Plasmodium host targeting signals
  • FIG. 1 Summary of Avrlb-1 mutations and their phenotypes in P. sojae stable transformants and soybean transient expression assays.
  • Y significantly fewer blue (GUS-positive) tissue patches from GUS expression resulting from Avr lb-induced cell death; N, not significantly fewer blue tissue patches;
  • Figures 6A-H Binding of oomycete effector proteins to phosphoinositides. a-c, Filter- binding assays, d-f, Liposome binding assays. RxLR and dEER mutations are described in Figure 6G and H.
  • N-GFP indicates a fusion of the N-terminal domain to GFP.
  • FL)-GST indicates a fusion of the full length effector proteins (without signal peptide) to GST.
  • PI-3-P phosphatidyl inositol-3-phosphate
  • PI-4-P phosphatidyl inositol-4-phosphate
  • PI phosphatidyl inositol
  • PA phosphatide acid
  • PS phosphatidyl serine
  • PE phosphatidyl ethanolamine
  • PC phosphatidyl choline. No mutant proteins bound to PI-5-P, PI, PA, PS, PE or PC (not shown).
  • FIG. 7A-C Identification of host-targeting signals in fungal effectors
  • AvrL567, AvrM and AvrPi-ta were fused to the secretory leader (s) and C-terminal domain of Avrl b.
  • AvrL567-Avr lb fusions lacking the secretory leader (m) or with mutations in the putative RxLR and dEER motif (rfyr- de-) were also assayed.
  • Effector re-entry resulting in cell killing was measured by double-barreled particle bombardment in which parallel bombardments with a beta- glucuronidase (GUS) reporter gene, with and without the Avrl b fusion, were compared in the presence of resistance gene Rps l b (cultivar L77- 1 863) or in its absence (rps; cultivar Wil liams). Averages and standard errors shown are from 14- 1 6 pairs of bombardments . P values were calculated using the Wilcoxon rank sum test, b, N-terminal sequences of effectors tested in a, with RXLR-like motifs shaded and dEER-like moti fs underlined.
  • GUS beta- glucuronidase
  • Avr l b C-terminal domain used for all fusi ons is boxed.
  • Three sequences containing potential moti fs from AvrPi-ta and one from AvrL567 were inserted into Avr l b in place o f the RFLR motif.
  • Cell entry activity of each sequence is given as relative ablation.
  • Ablation [ 1 - (GUS+ spots on Rps l b)/(GUS+ spots on rps)] .
  • Relative ablation ablation of construct/ablation of wild-type Avrl b .
  • dashes indicate identi cal residues, periods i ndicate gaps in the alignment and * ⁇ * indicates Avr l b sequences.
  • Figu res 9A-D Modulation o f effector entry i nto root cells by phosphoinosi tides a, Stimulation of Avrl b(N)-GFP entry by PI-4-P and inhibition by IP2. b, Stimulation of AvrL567(N)-GFP entry by PI-4-P and inhibition by IP2. c, Entry of Arg9-GFP is not stimulated by PI-4-P nor inhibited by IP2. In each case, 1 mg/m l protein was incubated with soybean root tips for 9 hr or 12 hr then washed and photographed.
  • Figu res 10A-E Effector entry into human cells and inhibition by inositol
  • Figu res 1 1 A-B Description of plasmi ds used in Example 1 .
  • Figu res 12A-B Ol igonucleotides used for lasmid construction . Uppercase letters indicate bases that match the initial template. Lower case letters indi cate mutations or 5 ' extensions that do not match the initial template. Restricti on sites introduced into the amplicon are underl ined.
  • ) indicates the boundary between Avrl b- 1 sequences and fused sequences (Avh, GFP or P lasmodium RXLX motif) in the fusion oligonucleotides.
  • FIG. 14A-F Oligonucleotides used. Restriction sites are in bold. Mutations created by the primers are in lower case.
  • FIG. 15 Binding of fungal effector proteins to phosphatidic acid shown in tabular form. Fi lter-binding assay were used to test which pol ar lipids were bound bind by the indicated fungal effector protei ns. The N-terminus of each fungal effector
  • Figu re 16A-D Effectors from non-haustorial fungal pathogens enter vi a RXLR- mediated P1-3-P binding.
  • Figu re 1 7A and B Binding of three fungal effectors to phosphoinositides.
  • A N- terminal seq uences of effector-like proteins Af2 from Aspergillus fumigatus (AO; XPschreib 752996. 1 ), CNg2 from Cryptococcus neoform ans (Cng2 ; AAW43853. 1 ) and AvrLm4/7 from Leptosphaeria maculans.
  • Candi date RXLR-like motifs are boxed.
  • B Sequences shown in A were fused to GFP and the expressed proteins tested for l ipi d bindi ng using filter-b inding assays as described in Figure 16D.
  • P I-3 -P is located on the surface of root cells and epithelial cells, but not erythrocytes
  • B. Binding of biosensors to root cel ls . Fusion proteins were incub ated with soybean root cell s for 12 hr then washed for 2 hr. Pairs of fluorescence and light micrographs are shown. Bars 50 ⁇ or 100 ⁇ .
  • C Binding of biosensors to epithelial cells. Fusion proteins were incubated with cells for 2 hr then washed for 30 min.
  • FIG. 20A-C PI-3-P binding proteins and inositol diphosphate b lock effector entry
  • B Binding of biosensors to epithelial cells. Fusion proteins were incubated with cells for 2 hr then washed for 30 min. Inositol 1 ,4 diphosphate (500 ⁇ ) was preincubated with the fusion proteins for 30 min. 5 mg/ml VAMp7 PX proteins was preincubated with the cells for 2 hr.
  • proteins in this fami ly use the N-terminal motifs RxLR and dEER to cross the host plasm a cell membrane autonomously, i.e. no other proteins are necessary to effect thi s translocation. Once inside the host cell, the proteins suppress host defense signal ing.
  • This effector family i s underlined by the fact that plants have evolved intracellular defense receptors to detect the effectors and trigger a rapid counter-attack.
  • the present invention establishes that effectors of fungal plant pathogens contain virulence motifs with consensus sequence BXZ, where B is R, K or H; X is any amino acid and may be absent; and Z is a hydrophobic amino acid, generally L, M, I, W, Y or F.
  • the sequence BXZ represents three contiguous amino acids, or two contiguous amino acids is X is absent.
  • the BXZ family of motifs includes exemplary motifs such as RxLR (which may function with a dEER motif, an exemplary RxLR moti f being RSLR) and related functional variants thereof (e.g.
  • RRLLR RRFLR
  • the virulence motifs are responsible for bin ding of the pathogen effector proteins to polar lipids (e. g.
  • phosphatidyl-inositol-3- phosphate PI-3-P
  • phosphatidyl-inositol-4-phosphate PI-4-P
  • phosphatidic acid at or near the surface of a host cell .
  • Stimulation of host cel l entry by, for example, PI-4-P, and inhibition by inositol 1 , 4 diphosphate suggests that the binding of effectors to polar lipids (such as phosphoinosi tides, phospholipids and sphi ngolipids) mediates cell entry of the effectors .
  • the i nvention also identifies the sequence requirements for the function of the virulence motifs and/or domains. With respect to the BXZ motif, it has been determined that general l y only the presence of arginine, lysine or histidine at the fi rst positi on and the presence of leucine, isoleucine, methionine, tyrosine, phenylalanine or tryptophan at the third position are required to enable function. However, in some embodiments, methionine or leucine at the second position may allow function if none of leucine, isol eucine, methionine, tyrosine, phenylalanine or tryptophan are present at the third position.
  • the sequences flanking the motifs are required for function.
  • domain refers to a region or regions of the primary sequence of an effector protein containing more than one virulence motif, e .g. both the RxLR and dEER moti fs, or one or more analogous virulence motifs as described herein.
  • the sequence requirements can be defined by a hidden m arkov m odel . For example, mutational analysis of the RxLR motif shows that, in some embodiments, the requirement for the first and third positions are quite strict.
  • the invention provides methods to inhibit the entry, into a host cel l, of effector proteins expressed by pathogens and containing the virulence motifs.
  • the method is carried out by blocking the interaction, for ex ample, by the binding o f the motifs to a natural ligand such as a polar lipid, exemplified by phospho lipids (e.g. phosphoinositides) and/or sphigolipids .
  • Blocking may be accomplished by any of several means, for example, by exposing one or more virulence motifs to one or more molecules or molecular species which are capable of binding to or otherwise interacting with the virulence motifs, thus preventing the polar lipid (e.g.
  • phosphoi nositide phospholipid or sphingolipid
  • mo lecular species such as phosphoinositides, phospholipids and/or sphigolipids which, in nature, bind to one or more motifs of an effector molecule as described herein, causing the effector protein to translocate into the targeted host cell, may be referred to as "natural molecules” or "natural ligands" of the motif.
  • the motifs disclosed herein may be considered “natural l igands" of the polar lipids to which they bind.
  • the blocking molecules of the invention are added exogenously to cells and used to prevent binding o f the natural ligands to the motifs, thereby preventing translocation of the effector protein into the cell .
  • the blocking molecules may or may not be molecules that occur in nature, but if they are, then when used in the present invention, they are i solated or substantially purified, or chemically synthesized.
  • Blocking molecules of choice include but are not lim ited to lipid-derived molecules which bind to the motif but not in a manner that results in entry of the effector protein into the cell, e.g. molecules that are sterically related to natural ligands but which do not comprise all requisi te properties for enabling translocation of the effector.
  • the blocking molecules are inositol or i nositol derivatives (e. g.
  • various phosphorylated inositols such as inosito l monophosphate, various inositol diphosphates such as inositol 1 , 4 diphosphate, and other similar molecules); or peptides that bind to the moti f and block access to the motif by natural ligands; or pepti des that bind to the motif and target the effector for protease degradati on; or peptides that bind to the motif and anchor the effector to an external structure such as a cell wall or cell matrix such that the effector cannot enter the cell ; or molecules that bind to the moti f and cause chemical modification of the effector so that it can no longer enter cells ; or other "small molecule" compounds that possess the geometric and charge requisites for binding to one or more of the motifs, thereby blocki ng the binding of the natural ligand that is responsible for effector translocation.
  • the blocking molecule is a peptide, in parti cular a peptide with an amino acid primary sequence that is designed to include amino ac id residues with charges suitable for interacting with and/or binding to the charged res idues of the moti f.
  • the amino acid sequence is designed so that charged atoms or groups (especially of the side chains) are spatially arranged in a manner that allows, for example, negatively charged side chains to be within bonding distance of positi vely charged side chains of e.g. R residues of the moti f, or for aliphatic side chains of the peptide to interact with aliphati c side chains of the motif, etc.
  • the binding or interaction of the blocking molecule(s) may be of any suitable type, and wi ll, depend on the nature of the blocking molecule.
  • the bind ing may be covalent and hence essentially irreversibl e.
  • the blocking molecule is one that, upon contact with one or more chemically reactive functional onal groups of the motif or polar lipid, forms a covalent bond wi th the one or more functional groups that participate in binding, or with functional groups of adj acent portions of the molecule (e.g. adjacent residues of and effector p rotein) in a manner that blocks access to the motif (e.g. by phospholipids and/or sphingolipids that are natural ligands of the moti f) and/or to the polar lipid, which would otherwise permit translocation of the effector into the host cell that the pathogen is trying to infect.
  • one or more chemically reactive function onal groups of the motif or polar lipid forms a covalent bond wi th the one or more functional groups that participate in binding, or with functional groups of adj acent portions of the molecule (e.g. adjacent residues of and effector p rotein) in a manner that blocks access to the motif (e.g. by phospholipids and/or
  • the binding is non-covalent and comprises, for ex ample, electrostatic and/or charge interacti ons, hydrophobic i nteractions, van der Waal s interactions, etc .
  • Motifs to which natural Iigand binding is blocked include BXZ moti fs as described herein, as well as RxLR moti fs, dEER motifs, the Pexel motif, and the RYWT, RIYER, RSLR, RRLLR, RRFLR, and RFYR moti fs.
  • Those of skill in the art wi l l recognize that many effector proteins contain both an RxLR moti f and a dEER moti f, or one or more virulence motifs as described herei n.
  • a blocking mo lecule which in some embodiments may be a natural ligand such as a phospholipid or sphingolipid
  • one or more e. g. either one or the other, or both, of the RxLR and dEER moti fs
  • blocking occurs in a manner that prevents the effector protein that bears the moti f(s) from entering the host cel l.
  • the binding of a natural ligand to a Pexel moti f is blocked, and blocking occurs i n a m anner that prevents the effector protein that bears the motif from entering a host cell.
  • the bi nding of a natural ligand to a RYWT, RIYER, RS LR, RRLLR, RRFLR, and/or RFYR moti f is blocked, and blocking occurs i n a manner that prevents the effector protei n that bears the moti f from entering a host cell .
  • the b locking molecule binds to or interacts directly with residues of one or more of the virulence moti fs, i f two or more virulence motifs are present in an effector.
  • thi s need not always be the case, as binding to a single moti f may be sufficient.
  • the blocking mo lecule (or molecules) binds to or i nteracts with adj acent residues. "Adjacent residues" may, but need not necessari ly be, adjacent in primary sequence to the motif. They may also be in proximity due to the secondary or terti ary structure of the effector molecule.
  • the effector protein compri ses an RXLR motif fol lowed by at least one aspartate or one glutam ate resi due wi thin a 60 amino aci d carboxy terminal flanking sequence.
  • the sequence which is attached directly to the carboxy terminus of the RxLR motif (which, in primary sequence, follows immediately after the carboxyl terminal R of the moti f) contains at least one aspartate residue and/or at least one glutamate residue within the first 60 amino acids of the sequence.
  • RxLR motifs that are targeted for blocking by the methods of the invention include but are not limited to those which compri se at least one of a two or three am ino acid sequence selected from the group consisting of: arginine, any amino acid, leucine; histidine, any amino acid, leucine; lysine, any amino acid, leucine; arginine, any amino acid, isoleucine; histidine, any amino acid, isoleuciiie; lysine, any amino acid, isoleucine; arginine, any amino acid, methionine; histidine, any ami no acid, methionine; lysine, any amino acid, methionine; arginine, any amino acid, tyrosine ; histidine, any amino acid, tyrosine; lysine, any amino acid, tyrosine; argin i ne, any amino aci d, phenylalani ne; histidine
  • the R of the RxLR moti f is preceded by R, i .e. the motif is RRxLR, with "x" being any amino acid, or in particular L or F.
  • RxLR any amino acid
  • p articular sequence may be represented by standard conventions using the single letter abbreviation for the amino acid and an "x" for the variable residue, e.g. as RXL for "arginine, any amino acid, leucine".
  • blocking may be accomplished by exposing one or more of the pol ar lipids to which the motifs bind (i.e. "target lipids") to one or more molecules or mol ecular species which are capable of binding to or otherwise interacting with the targeted polar lipid, thus preventing the motif (and hence the effector molecule) from binding to the polar lipid.
  • blocking molecules include but are not limited to : peptides, proteins, and other molecules which bind the polar lipid(s), for example, peptide mimetics of one or more effector motifs, small molecules or drugs which bind the polar lipids, v arious charged species which bind to the polar lipids, etc .
  • the blocking mo lecul e may bind to the natural target lipid (e.g. phosphoinositide, phospholipid, sphingolipid or other polar lipid) in order to block the binding of the effector to its target.
  • the blocking molecule may be a naturally occurring protein that binds to the target lipid, such as a protein containing, for example, a C I , C2, PH, FYVE, PX, ENTH, ANTH, BAR, FERM, PDZ, and tubby domains (Stahelin, R.V. (2009). Lipid binding domains : more than simple lipid effectors. .! Lipid Res 50 Suppl , S299-304) .
  • the blocking molecule may be a peptide with an amino acid primary sequence that is designed to include amino acid residues with charges suitable for interacting with and/or binding to the target phosphoinosi tide, phospholipid or sphingolipid.
  • the blocki ng molecule may be a polypeptide (e.g. a peptide, polypepti de, etc.) which includes one or more moti f sequences and/or is a mimeti c of one or more moti f sequ ences.
  • B locking molecules that target the polar lipid li gands of the motif may bind to any portion of the lipid that prevents effector binding, or even to adj acent molecules or cellular components that sterically interfere with motif-lipid binding.
  • the host cells that are protected from effector protein invasion include m any species of plant and animal cells, including human cel ls .
  • plant cel ls that can benefit from the practice of the invention include but are not limited to: wheat, maize, rice, sorghum, barley, oats, millet, soybean , common bean (e. g.
  • animal cells that may benefit from the practice of the invention include but are not limited to : h umans, cattle, sheep, pigs, goats, horses, cats, dogs, chickens, turkeys, bees, salmon, trout, bass, catfish, shell fish, crayfish, lobsters, shrimp, crabs, etc .
  • pathogens may be targeted and their effector proteins prevented from entering host cel ls by the methods of the invention.
  • pathogens include but are not limited to: any Phytophthora species, e.g. Phylophthora infestans, Phytophthora sojae, Phytophthora ramorutn , Phytophthora parasitica, Phytophthora capsici, Phytophthora nicotianae, Phytophthora cinnamomi,
  • Phytophthora cambivora Phytophthora citrophthora, Phytophthora citricola, Phytophthora megasperma, Phytophthora palmivora, Phytoph thora megakarya, Phytophthora boehmeriae, Phytophthora kemoviae, Phytophthora erythroseptica, Phytophthora fragariae, Phytophthora heveae, Phytophthora lateralis, Phytophthora syringae; any Pyth ium species, e. g. Pythium ultimum , Pythium aphan idermatum, Pythium irregulare, Pythium graininicola, Pythium arrhenomanes, Pythium
  • any downy mildew species any Peronospora species, e. g. Peronospora tabacina, Peronospora destructor, Peronospora sparsa , Peronospora viciae; any Bremia species, e.g. Bremia lactucae; any Plasmopora species, e.g. Plasmopora viticola, Plasmopara halstedii; any Pseudoperonospora species, e. g.
  • Pseudoperonospora cubensis Pseudoperonospora humuli; any Sclerospora species e.g. Sclerospora graininicola; any Peronosclerospora species, e.g. Peronosclerospora philippinesis, Peronosclerospora sorgh i, Peronosclerospora sacchari; any
  • Sclerophthora species e.g. Sclerophthora rayssiae, Sclerophthora macrospora
  • any A lbugo species e.g. Albugo Candida
  • any Aphanomyces species e.g. Aphanomyces cochlioides, Aphanomyces euteiches, Aphanomyces invadans
  • any Saprolegnia species e. g.
  • Saprolegn ia parasitica any Achlya species ; any rust fungi; any smut fungi; any bunt fungi ; any powdery mildew fungi ; any Puccinia species, Puccinia striiformis, Puccin ia graminis, Puccinia triticina (syn. Puccinia recondita), Puccinia sorghi, Puccinia schedonnardii, Puccinia cacabata; any Phakopsora species, e. g. Phakopsora pachyrhizi, Phakopsora gossypii; any Phoma species, e.g.
  • any Ascochyta species e.g. Ascochyta gossypii
  • any Cryphonectria species e.g. Cryphonectria parasitica
  • any Magnaporthe species e.g. Magnaporthe oryzae
  • any Gaeumannomyces species e.g. Gaeumannomyces graminis
  • any Ascochyta species e.g. Ascochyta gossypii
  • any Cryphonectria species e.g. Cryphonectria parasitica
  • any Magnaporthe species e.g. Magnaporthe oryzae
  • any Gaeumannomyces species e.g. Gaeumannomyces graminis
  • any Gaeumannomyces species e.g. Gaeumannomyces graminis
  • Synchytrium species e.g. Synchytrium endobioticum
  • any Ustilago species e.g.
  • Ustilago maydis, Ustilago tritici, Ustilaginoidea virens; any Tilletia species, e. g. Tilletia indica , Tilletia caries, Tilletia foetida, Tilletia barclayana; any Erysiphe species, e.g. Erysiphe necator (formerly Uncinula necator) ; any Blumeria speci es, e.g. Blumeria graminis; Podosphaera oxyacanthae; any Alternaria species, e.g. Alternaria alternatel y any Botrytis species, e.g. Botrytis cinerea; any Diaporthe species, e.g.
  • Diaporthe phaseo!orum any Fusarium species, e. g. Fusarium graminearum , Fusarium oxysporum (e.g. f. sp. lycopersici), Fusarium mon iliforme, Fusarium solani; any Leptosphaeria speci es, e.g. Leptosphaeria maculans, Leptosphaeria maydis; any Macrophomina species, e. g. Macrophomina phaseolina ; any Monilinia species, e.g. Monilinia fructicola ; any Mycosphaerella speci es, e.g.
  • Verticillium dahliae Verticillium albo-atrum, Rhizoctonia solani
  • Ophiostoma ulmi (syn. Ceratocystis ulmi), Ophiostoma novo-ulmi
  • any Septovia species e.g. Septoria avenue
  • any Pyrenophora species e.g.
  • Pyrenophora tritici-repentis any Colletotrichum species, e. g. Colletotrichum graminicola; any Sclerotin ia species, e.g. Sclerotinia sclerotiorum ; any Sclerotium species, e. g Sclerotium rolfsii; any Thielaviopsis species, e. g Thielaviopsis basicola ; any Coccidioides species, e.g. Coccidioides immitus; any Paracoccidioides species, e.g. Paracoccidioides braziliensis; any Pneumocystis species, e. g.
  • Encephalitozoon species e.g. Encephalitozoon cuniculi, etc.
  • the host cell can mount a robust or normal immune response to the pathogen, and infection of the host organism is averted (prevented), or the degree of infection (i .e. the deleterious symptoms that typically accompany the presence of an infection by the pathogen) are el i minated or decreased.
  • some aspects of the invention also include methods of preventing or attenuating the symptoms of infection usually caused in a host organism by a patho gen which emp loys effector proteins comprising one or more virulence motifs as described herein to enter host cells.
  • the methods are used to prevent infection and/or symptoms of in fection .
  • infection may have already started but the methods of the invention can be used to curtai l the spread of the infection to other organisms, or to lessen the symptoms in an organism that is already afflicted. This is the case, in particular, with Plasmodium infections, where the methods o f the invention are especially useful in preventing the subsequent rounds of parasite multiplication after initial infection, or with other pathogens that multiply
  • the invention provides methods of maintaining a host cell ' s ability to mount an immune response to a pathogen, the pathogen being one that produces effector proteins that comprise one or more of the motifs described herein, and the method involving blocking the effector protein from entering the host cell by preventing the binding of its natural ligand .
  • the mode of admini stration of the blocking molecules of the invention wil l depend on several factors, including the nature of the molecul e and the host.
  • the blocking molecule will be in a composition or formulation suitable for administration.
  • application is generally in the form of a foliar spray or watering solution of e.g. an aqueous or oil solution that includes the blocking molecule in a concentration suffici ent to block effector molecu les of pathogens wh i ch are likely to attack the plant.
  • any suitable composition many of which are known in the art, may be employed, e.g. various pi l ls, powders, liquids, inj ectable formulations, etc.
  • any suitable means may be used, includi ng but not limited to by inj ection (e.g. subcutaneous or intramuscular), inhalation, orally, i ntranasally, by ingestion of a food product containing the protein, etc.
  • the compositions may include one or more than one blocking molecule.
  • a preparation for application to plants may include mo lecules that block the effector proteins of one or of several different types of pathogen.
  • the blocking molecules may be administered to plants in conjunction wi th other beneficiali al substances, such as fertil izers, various pesti ci des, growth factors, etc. The same is true for administration to animals, where on or more than one type of blocking molecule may be administered, and may be administered in conj unction with other remedii al substances such as chemotherapeutic agents that also have activity against the pathogen.
  • a combination of blocking agents is utilized, e.g. two or more agents that act on or effect the effector protein, or two or more agents that acts on or effect the lipid, or a mixture of blocking agents, one or more of which acts on the effector protein, and one or more of which acts on the lipid.
  • the invention provides elucidation of the structural requirements of the virulence motifs (e.g. BXZ motifs, such as RXLR, RYWT, RIYER and related or similarly functioning motifs) in oomycetes, fungi, and other pathogens, and of the sequences which flank the motifs, thereby al lowing, for example, the design of molecules to bind the motif.
  • BXZ motifs such as RXLR, RYWT, RIYER and related or similarly functioning motifs
  • the invention also provides methods to predict which genes in the genome of a pathogen are likely to encode effector mol ecul es.
  • the invention describes a non-random distribution of amino acid residues in the regions flanking the RXLR motif, represented by a position-weight matrix.
  • HMM hidden markov model
  • HMM hidden markov model
  • sequences surrounding RXLR2 (which was an authentic, functional motif) had a high score of 1 8.5 , representing an excellent match to the consensus flanking sequence, and very unlikely to have been found in a random sequence.
  • sequences surrounding RXLR 1 (a non-functional moti f) had a low, non-significant score o f 0.0.
  • sequences surrounding the RXLR motif of P. infestans Avr3a scored 1 0.9.
  • sequences surrounding the RXLR motifs of the H. parasitica Atrl and Atrl 3 proteins had scores of 9.8 and 6.3 respectively.
  • HMM scores of zero such as that of Avrl b RXLR1
  • HMM scores over 5.0 are characteristic of RXLR strings found at random, i. e. such sequences are not likely to represent true RXLR motifs .
  • HMM scores over 5.0 are characteristic of HMM scores of zero, such as that of Avrl b RXLR1 .
  • sphingolipid to promote or allow the translocation, into a host cell , of effector (avirulence) proteins in which they are located or of which they form a part.
  • HMM scores between 0 and 5 are equivocal and cannot be assigned to either category of protein (random RXLR strings vs authentic RXLR motifs). This methodology may also be applied to other virulence moti fs, e. g. RYWT, RIYER, etc .
  • the invention also provides a method for screening compounds to identify those that inhibit binding of phosphoinositides, phospholipids or sphingolipids (or other natural lipid ligands) to a BXZ moti f (e.g. to an RXLR moti f, and optional ly also to a dEER motif) in an effector protein, and which thus can inhibit translocation of effector proteins that have these motifs into cells.
  • the method involves exposing a candidate or putative blocking compound to one or more BXZ vi rulence motifs (e.g.
  • the screening is evaluated in that if the candi date compound is able to bind to one or more of the virulence motifs, and especially to two motifs when they are found to be present in a single effector (e.g.
  • the compound is selected as a compound that wi ll inhibit binding of the natural ligands to the motifs in an effector protein, and prevent entry of the effector protein into a cell. This is especially the case if the blocking compound is able to competitively bind to the motif in the presence of a natural ligand.
  • screening methods may be adapted and used to identify blocking compounds which bind to or otherwi se interfere with the polar lipid to which the motif binds.
  • Blocking of effector-lipid binding may also be prevented or attenuated using genetic engineering/molecular biology techniques.
  • S uch techniques may target one or both of the effector (e . g. the motif sequence) and the l ipid to which a motif binds.
  • host cells e.g. in plants
  • inhibitory RNA e.g. siRNA
  • host cells may be genetically engineered to produce peptides or proteins which contain one or more moti fs, in a manner that promotes expression of the peptides/proteins and their binding to at least one target lipid.
  • Other strategies will occur to those of skill in the art, and all such methods are encompassed by the invention.
  • the invention also provides methods for preventing pathogens from invading or infecting cells, by prophylactic al ly applying one or more of the blocki ng compounds described herei n to a substrate wi th whi ch a pathogen and a cell the pathogen might infect may come in contact.
  • the method inhibits entry, into the cell, of a pathogenic effector protein (entry of the pathogenic effector protein requiring binding of at least one motif of the effector protein as described herein to at least one polar lipid of the cell) and comprises the step of contacting a substrate which contains or is likely to contain a pathogen comprising the pathogenic effector protein with a blocking compound as described herein.
  • contacting is meant applying, permeating, coating or otherwise placing the blocking compound on the substrate.
  • the blocking compound i s capable of i) binding to at least one motif of the pathogenic effector protein ; or ii) binding to at least one pol ar lipid o f said cell (the polar lipid being the cellular ligand of the effector protein mot if). Binding of the blocking compound prevents entry of the pathogenic effector protein into said cell (and hence prevents infection of the cell by the pathogen), if the pathogen comes into contact with the substate.
  • the blocking agent may be applied to the substrate by any suitable means, e .g. by spraying, painting, coating, etc., or even by manufacturing the substrate to contain the blocking agent (e.g.
  • the substrate may be any suitable substrate that may be contacted by the pathogen, and which usually will be or may also come into contact with a cell which might be infected by the pathogen, or in some cases may be the cell or a collection of cel l s which may encounter or be exposed to the pathogen.
  • Exemplary substrates include but are not limited to : pl ants (e.g. to leaves, fruit, roots, etc .) for example, by spraying or otherwise placing the blocking agent, sometimes, though not always, on an exterior surface of the plant (e.g. mature plants, plants "in the field", plants in green houses, seedlings, seeds, sprouts, etc.); fabrics (e. g.
  • fabrics used for tents, mosqui to netting, clothing, etc. water (e.g. bodies of water, swamps, pools of standing water, wel ls, dri nking water, etc .); skin, h air and/or fur, eyes, ear and nasal passages, the mouth, etc. , e. g. of an animal (e. g. mammals such as humans, or other mammals, and also repti les, fish, birds, etc. i . e. veterinary applications are also contemplated).
  • application may be external by the application of e.g. lotions, sprays, rinses, mists, drops, washes, (e. g.
  • the substrate may also be an insect, e.g. an i nsect that is known or suspected of carrying the pathogen which comprises the effector protein, or is capab le of synthesizing the effector protein.
  • the invention is further i llustrated by the following Examples, which should not be interpreted as li miting the invention in any way.
  • EXAMPLE 1 RXLR-mediated entry of Phytophthora sojae effector Avrl b (SEQ ID NO : 2) into soybean cel ls does not require pathogen encoded machinery
  • Effector proteins secreted by oomycete and fungal p athogens have been inferred to enter host cel ls, where they interact with host resistance gene products.
  • Usi ng the effector protein Avrl b of Phytophthora sojae, an oomycete pathogen of soybean we show that a pair of sequence motifs, RXLR and dEER, plus surrounding sequences, (S EQ ID NO : 46) are both necessary and sufficient to deliver the protein into plant cells.
  • Particle bombardment experiments demonstrate that these motifs function in the absence of the pathogen, indicating that no additional pathogen encoded machinery is required for effector protein entry into host cells.
  • RXLR and dEER serve to transduce oomycete effectors into host cells indicates that the more than 370 RXLR and dEER containing proteins encoded in the genome sequence of P. sojae are candidate effectors.
  • RXLR and dEER motifs can be replaced by the closely related erythrocyte targeting signals found in effector proteins of Plasmodium, the protozoan that causes malaria in humans. Mutational analysis of the RXLR motif shows that the required residues are very similar in the motifs of
  • RXLR2 and dEER motifs of Avrlb are required for its virulence function in transgenic P. sojae lines
  • Wild-type Avrlb contains two RXLR motifs, RXLR1 and RXLR2 ( Figure 1A).
  • RXLR1 AAAA , RXLR2 AAAA double mutants ( Figure IE, Table 1) (SEQ ID NO: 5).
  • a mutation in the dEER motif (SEQ ID NO: 6) also abolished avirulence (in two independent transformants) indicating that this motif is also required for the function of the protein ( Figure IE, Table 1).
  • RXLR1 SEQ ID NO: 3
  • RXLR2 SEQ ID NO: 4
  • HMM hidden markov model
  • sequences surrounding RXLR1 (SEQ ID NO: 3) had a low, non-significant score of 0.0.
  • sequences surrounding the RXLR motif of P. infestans Avr3a scored 1 0.9.
  • sequences surrounding the RXLR motifs of the H. parasitica Atr l and Atr l 3 proteins had scores of 9.8 and 6.3 respectively.
  • the Phytophthora HMM was used to score the RXLR moti fs of 1240 RXLR-containing sequences identi fied from a pool of all putative secreted P. sojae and P. ramorum proteins by Jiang et al. (2008).
  • 639 RXLR-containing sequences were scored found after permuting the sequences of all the putative secreted P. sojae and P. ramorum proteins (Jiang et al. , 2008) .
  • HMM scores of zero such as that of Avr lb RXLR 1 (SEQ ID NO : 3 ), are characteristic o f RXLR strings found at random , while scores over 5.0 are characteristic of non-random occurrences of RXLR strings and of the RXLR strings of functional avirulence proteins. HMM scores between 0 and 5 are equivocal .
  • the curated Avh genes with a score of zero may represent pseudogenes as many of them were identifi ed principally by C-terminal sequence similarity.
  • a vrl b and the Rpsl b gene product occurs within host cells and does not require the RXLR and dEER motifs
  • FIG. 2 shows that delivery of DNA encoding leader-less Avrlb protein (SEQ ID NO: 19) into soybean cells significantly reduced the number of blue GUS-positive patches when the Rpslb gene was present, but not when Rpslb was absent ( Figure 2A). This is consistent with a cytoplasmic location for the Avrlb-Rpslb interaction.
  • the bombardment assay was used to determine the effect of the RXLR2 AAAA mutation on secreted Avrlb protein (SEQ ID NO: 18).
  • soybean cells were bombarded with DNA encoding wild type Avrlb (SEQ ID NO: 22), including its normal secretory leader, a reduction in GUS-positive blue spots was observed comparable to that observed for the non-secreted protein [Figure 2, sAvrlb(WT)].
  • a gene encoding Aequorea coerulescens green fluorescent protein (acGFP; "GFP" herein) fused either to the Avr l b leader (SEQ ID NO : 27) or to full-length Avr l b (SEQ ID NO: 25) was constructed .
  • acGFP Aequorea coerulescens green fluorescent protein
  • SEQ ID NO: 27 Avr l b leader
  • SEQ ID NO: 25 full-length Avr l b
  • GFP protein could be seen diffusing into the apoplast between pairs of neighboring cells not shown). Similar observations were made when cell s expressing secreted GFP or Avrl b-GFP fusion proteins with a dEER mutation were plasmolyzed (not shown). If the RXLR2 and dEER motifs were intact however, the sAvr l b-GFP protein fusion accumulated in the cytoplasm and nucleus of the cells, similar to the mAvr l b-GFP (SEQ ID NO: 24) fusion lacking the leader.
  • the A vrlb RXLR and dEER motifs are sufficient to target GFP to soybean cells
  • the RXLR and dEER region of Avrl b was fused to GFP (SEQ ID NO: 46), and the fusion protein was synthesized in E. coli and partial ly purified. Root tips of soyb ean seedlings were incubated with the isolated fusion protein for 12 hours, washed for four hours in water, then observed under light and UV microscopy to l ocalize the GFP. GFP accumulated inside many of the root cells, whereas buffer alone did not produce any fluorescence. The optical sections produced by the confocal microscope revealed that the protein penetrated approximately 10 cell layers deep during the 1 2 hour incubation.
  • the characteristic accumulati on of GFP in the nuclei of the treated cells i s comparable to the pattern observed when GFP is expressed in planta, and verifies that the GFP is located inside the cells.
  • the nuclear localization of the protein also indicates that the cells are alive. If mutations were present in the RXLR or dEER motifs of the fusion protein, GFP did not accumulate inside the soybean root cells. When the RXLR and dEER region was replaced by the artificial protein transduction motif Arg9 (SEQ ID NO : 1 1 2), GFP once again entered the soybean root cells and accumulated in the nuclei .
  • Av l b RXLR and dEE motifs can be replaced by RXLR and dEER-containing protein sequences encoded by bioinformatically identified Avh genes
  • Avh genes could functional ly replace the RXLR2 and dEER motifs of Avrl b- 1
  • full length Avh genes from P. sojae and H. parasitica were fused to an Avrl b- 1 N-terminal deletion mutant lacking the RXLR and dEER motifs.
  • the fusion genes were then introduced into P. sojae and the transformants were tested for avirulence on Rps l b- containing soybean cultivars.
  • Both Avh genes, P. sojae Avh l 71 (sinc e identified as Avi-4/ ⁇ ; Dou et al .
  • the A vrl b host targeting signal can be functionally replaced by autonomous protein transduction motifs
  • PTDs Protein transduction domains cap able of autonomously carrying proteins across plasma cell membranes have been described and characterized in the HIV-1 Tat protein. Arginine-rich peptides such as Arg9 can also carry out this function.
  • the RXLR2 motif of Avrlb was replaced with the TAT PTD (SEQ ID NO: 42) or with Arg9 ( Figure 4A) (SEQ ID NO: 41).
  • the resultant proteins were treated using the particle bombardment assay, and both PTDs could functionally replace the RXLR2 motif of Avrlb, restoring the avirulence reaction of Avrlb with Rpslb ( Figure 4B).
  • Plasmodium effector proteins could functionally replace the RXLR and dEER region of Avrlb
  • the residues of Avrlb from the end of the secretory leader to the end of the dEER motif were replaced with the mature N-termini of three different Plasmodium effector proteins that are targeted to the erythrocyte cytoplasm, namely PfGBP-130 (SEQ ID NO: 121), PfHRPII (SEQ ID NO: 123) and PfPFE1615c (SEQ ID NO: 125)
  • PfGBP-130 SEQ ID NO: 121
  • PfHRPII SEQ ID NO: 123
  • PfPFE1615c SEQ ID NO: 125
  • the data presented in this Example characterizes the RXLR2 and dEER motifs as follows : 1 ) arginine at position 1 and leucine at position 3 are essential for function of the RXLR motif. However, there is not a strong requirement for the arginine at position 4. Therefore by functional assays, the oomycete RXLR motif resembles the Plasmodium motif (RxLxD/E/Q) even more closely than previously noted ; and 2) the amino acid sequences flanking the RXLR2 and dEER motifs are required in addition to the motifs themselves for the transit of Avr l b into soybean . Further, the region from residues 33 to 71 ( 1 9aa to the left of RXLR2 and 6aa to the right of dEER) were sufficient for protein translocation.
  • the Avr l b protein requires not only the RXLR motif itself, but also non- random surrounding sequences including the dEER motif. These surrounding sequences are not enriched in positive and hydrophobic residues, but instead are enriched in aci dic and hydrophi li c resi dues. Furthermore, our RXLR mutagenesis resu lts show that the presence of b asic and hydrophobic residues is not su ffi cient for RXLR function; instead the order of the amino acid residues is very important, and very subtle mutations such as RFLR ⁇ RFVR or QFLR abol ish function.
  • oomycete effectors may util ize a novel mechanism for translocation across the membrane, po ssibly involving host cell surface machinery (such as a receptor) that i s more complex than just the phospholipid bi layer.
  • host cell surface machinery such as a receptor
  • the Plasmodium Pexel/VTF moti f al so requires surrounding sequences that are enriched in acidic and hydrophil ic residues and is functional ly interchangeable with the oomycete RXLR domain in both erythrocytes and in soybean tissue (this study) .
  • oomycetes and Pl asmodium both may target host cell surface machinery that is common to plants and vertebrate animals but different than that targeted by animal PTDs.
  • P. sojae isolate P7076 (Race 19) was routinely grown and maintained on V8 agar). The P. sojae transformation procedure was described by Dou et al (Dou, D., Kale, S.D., Wang, X., Chen, Y., Wang, Q., Wang, X., Jiang, R.H.Y., Arredondo, F.D., Anderson, R., Thakur, P., McDowell, J., Wang, Y., and Tyler, B.M. (2008) Plant Cell 20(4), 1118-1133).
  • P. sojae transformants were selected that grew well on V8 medium with 50 ⁇ g/ml G418, and were cultured in VS liquid medium for 3 days. The mycelia were harvested, frozen in liquid nitrogen and ground to a powder for DNA or RNA extraction. Genomic DNA was isolated from mycelium using known techniques. DNA samples were quantified using a Nanodrop ND-1000 spectrophotometer (Thermo Scientific).
  • Avrlb-1 transgenes was verified by PCR amplification from 100 ng genomic DNA using a program of 94°C for 2 min, 30 cycles of 94 °C for 30 s, 56 °C for 30 s, 72°C for 30 s, and 72 °C for 5 min with primers of HamF and HamR (TS1). All the transformed P. sojae were double- checked by Pst I restriction and/or sequence, RNA was extracted from each sample using RNeasy Plant Mini Kit (QIAGEN, cat # 74904) with ⁇ -mercaptoethanol added buffer RLT and genomic DNA was removed using RNase-Free DNase (QIAGEN, cat #79254) according to the manufacturer's recommendations.
  • Seedlings were grown in the greenhouse or in a growth chamber (Percival AR-36L) with a program of 24°C at daytime and 22°C at night with a 14 hr day length under fluorescent light (250 ⁇ photons s-1 m-2). The virulence of each transformant was evaluated using hypocotyl inoculation. 1-2 days after the first primary leaf appeared, the hypocotyl of the soybean was wounded with a short incision and the incision was inoculated with a small piece of V8 agar cut from the edge of a 3 day old colony. Thereafter, the plants were incubated in a growth chamber under the conditions described above.
  • the numbers of dead and surviving plants were counted 4 days after inoculation, and summed over 2-5 replicates. The differences between the numbers of surviving plants from rps and Rpslb cultivars were compared using Fisher's exact test. Only the transformants producing a significant difference between rps and Rpslb cultivars were judged as avirulent.
  • Particle bombardment assays were carried out using a double-barreled extension of the Bio-Rad He/1000 Particle Delivery System ((Dou, D., Kale, S.D., Wang, X., Chen, Y., Wang, Q., Wang, X., Jiang, R.H.Y., Arredondo, F.D., Anderson, R., Thakur, P., McDowell, J., Wang, Y., and Tyler, B.M. (2008) Plant Cell 20(4), 1118-1133). Analyzing the bombardment data as a ratio between the test and control shots improves the reproducibility of the measurements greatly.
  • the avirulence activity of the Avrlb-1 constructs was measured as the reduction in the number of blue spots comparing the Avrlb-1 + GUS bombardment with the GUS + control bombardment. For each paired shot the logarithm of the ratio of the spot numbers of Avrlb-1 to that of the control was calculated, then the log-ratios obtained from the Rpslb and non-Rpslb leaves were compared using the Wilcoxon rank sum test.
  • plasmolysis was performed for 1 5 min in 0.8 M mannitol and cells were observed in a Zei ss LSM51 0 laser scanning confocal microscope (Jena, Germany) with an argon laser excitation wavelength of 488 nm .
  • RXLR-GFP Fusion Protein Expression and Purification Residues 33 to 71 of Avrl b (VESPDLVRRSLRNGDIAGGRFLRAHEEDDAGERTFSVTD (SEQ ID NO: 46) including the RXLR1 , RXLR2 and dEER motifs were fused to GFP, replacing the Arg9 encoding sequences i n vector pR9GFP (SEQ ID NO : 1 12), cal led pR9 by Chang et al., (Chang, M., Chou , J. C. and Lee, H.J . (2005 ) Plant and Cell Physiology 46, 482- 488) .
  • pR9GFP which also adds an N-termi nal His6 tag, was derived by Chang et al (2005) from Ptat-HA. C43(DE3) E. coli cells containing RXLR-GFP fusion constructs or pR9 were grown i n 200 mL of LB containing ampicillin l OO ⁇ ig/mL in a 1 L baffled flask shaken at 240 rpm at 37°C until reaching an OD of 0.4, at which point the cells were induced by additi on of I raL of 1 M IPTG (final [5 mM]) .
  • the cells were harvested by centrifugation at 4°C and then stored at -20°C. Visual confirmation of GFP expression was noted by the green color of the bacteri al cell pellet.
  • lysis buffer 50mM NaH 2 P0 4 , 300mM NaCl, l OmM imidazole, pH 8.0
  • Lysozyme S igma-Aldrich, cat# L6876 was added to a final concentration of l mg/mL then the suspension was incubated for 20 mi n on ice.
  • the column was washed twice with 5mL of wash buffer (50mM NaH 2 P0 4 , 300mM NaCl, 20mM imidazole, pH 8.0) .
  • the protein sample was loaded onto the column and then the column was washed twice with 1 0 vol (l OmL) of wash buffer.
  • the protein was eluted with 4 mL of elution buffer (50mM NaH 2 P0 4 , 300mM NaCl, 200mM imidazole, pH 8.0) into l mL fractions. These fractions were pooled and concentrated to 300 ⁇ 1 using a centrifugal protein concentrator (Amicon Centriplus Centri fugal Filter Device MWCO-3kDa) at 13 , 500x g.
  • a centrifugal protein concentrator Anamicon Centriplus Centri fugal Filter Device MWCO-3kDa
  • the sample was then mixed with an equal vo lume of 50mM MES buffer pH 5.8.
  • the protein concentration was measured at 280nm using a nanodrop spectrophotometer (ND- 1000) and adj usted to 8mg/mL. All purified GFP preparations fluoresced normally under UV illumination.
  • Root tips were cut into lengths of between 0.5 cm and 1 cm, and then were washed with water. Each root tip was completely submerged in 20 ⁇ , of the protein solution (8 mg/ml in 25 niM MES pH 5.8) in a eppendorf tube. The samples were incubated overnight at 28°C (-1 2 hours). The roots were then washed in 200 mL of water for 4 hours while shaken at 100 vpm on a rotary shaker. The roots were then viewed using a Zei ss LSM5 0 laser scanning confocal microscope with an argon laser excitation wavelength of 488 nm. For nuclear staining, the roots were stained with DAPI (4',6-diamidino-2- phenylindole) (Sigma- Aldrich cat# D8417) and viewed with a 405 nm filter.
  • DAPI 4,6-diamidino-2- phenylindole
  • GenBank Accession Numbers The sequences reported herein have been deposited in the GenBank database, namely Hp Avh341 (EF681 127). Accession numbers for sequences already i n. GenBank are Ps Avr l b- 1 (AAM20936), Ps Avr4/6 (ABS 50087), Pi Avr3 a (CAI72345 ); Hp Atr l (AY842877), Hp Atr l 3 (AY785301 ).
  • Pathogens of both plants and animal s produce effectors and/or toxins that act within the cytoplasm of host cells to suppress host defenses and cause disease.
  • Effector proteins of oomycete plant pathogens utilize N-terminal moti fs, RXLR and dEER, to enter host cells, and a simil ar motif, Pexel (RxLxE/D/Q), is used by
  • effectors of fungal plant pathogens contain functional variants of the RXLR and dEER motifs, and that the oomycete and fungal RXLR and dEER motifs, as well as the Plasmodium Pexel motifs, are responsible for bi nding of the effectors to phosphatidyl-mositoI-3- phosphate (PI-3-P) and/or phosphati dyI-inosito l-4-phosphate (PI-4-P) .
  • PI-3-P phosphatidyl-mositoI-3- phosphate
  • PI-4-P phosphati dyI-inosito l-4-phosphate
  • RXLR and dEER domain binds phosphoinositides
  • the RXLR and dEER domain of P. sojae Avrlb enables translocation of green fluorescent protein (GFP) into plant cells without any pathogen-encoded machinery (see Example 1), and the same is true for two additional bioinformatically predicted effectors, Avh5 (SEQ ID NO: 129) and Avh331 (SEQ ID NO: 127).
  • GFP green fluorescent protein
  • Avh5 SEQ ID NO: 129
  • Avh331 SEQ ID NO: 127
  • phosphatidylinositol-4-phosphate kinases from rice and Arabidopsis contained a PI-4- P binding domain consisting of 14 and 11 tandem RXLR and dEER motifs
  • N- terminal segments from the fungal effectors AvrL567 (SEQ ID NO : 138) and AvrM (SEQ ID NO: 142) of M. lini and from AvrPi-ta (SEQ ID NO : 143) of M. oryzae were fused to the C-terminus of Avrl b, in the presence of the Avrl b secretory leader, then tested the fusions in a particle bombardment cell re-entry assay that measures the ability of a motif to carry an Avr l b reporter protein back into soybean leaf cells after secretion .
  • Figure 7A shows that all three fungal N-terminal segments had significant ab i lity to deliver Avr l b back into soybean leaf cells .
  • the N-terminus of AvrL567 was subjected to further analysis by mutagenesis and root cel l entry assays. Al anine substitutions in the RFYR motif and in two downstream acidic residues that might act as a dEER motif ( Figure 7B) (SEQ ID NO: 139), aboli shed the activity of the AvrL567 N-terminal domain in the particle bombardment cell re-entry assay ( Figure 7A and B) .
  • AvrL567(N)-GFP (SEQ ID NO: 1 1 9) bound PI-3-P in both assays. Bind ing o f AvrL567(N)-GFP to PI-4-P was also be detected in the liposome assay though it is not as strong as to PI-3-P. Mutation o f the RXLR and dEER-lilce moti f to alanines (rfyr-de- mutant) (SEQ ID NO : 120) resulted in a loss of binding to the phosphoinosi tides in both assays.
  • Filter binding assays were used to determine if five additional fungal effectors could bind phospholipi ds.
  • the N-terminal sequences of the following effectors were fused to GFP : Magnaporthe grisea AvrPita (SEQ ID NO : 224), Puccima graminis Ps87 (SEQ ID NO: 226) ; Melampsora lini AvrM (SEQ ID NO: 228) ; Melampsora lini AvrP 123 (SEQ ID NO: 230); Melampsora lini AvrP4 (S EQ ID NO : 232).
  • the results, summarized in tabular form in Figure 1 5 showed that all five effectors bound phosphatide acid .
  • HTS host targeting signals
  • the three signals can carry Avr l b into soybean leaf cells and onion bulb epidermal cells8.
  • the three signals can also carry purified GFP into soybean root cells and this activity requires intact Pexel motifs.
  • the HTS-GFP fusion proteins were tested using fi l ter binding and liposome binding assays.
  • the PfGBP HTS fusion (SEQ ID NO : 121 ) could bind PI-4-P and also, more weakly, PI-3 -P ( Figure 8A).
  • the PfHRPII HTS fusion (SEQ ID NO: 123) could bind PI-3-P, and also rather weakly, PI-4-P ( Figure 8B)
  • the Pfl 61 5c HTS fusion (SEQ ID NO : 1 25) cou ld bind speci fically to PI-3-P ( Figure 8C) .
  • Liposome binding assays confirmed binding of all the fusion proteins to PI-3-P or PI-4-P
  • a synthetic cell entry motif composed of nine-arginine residues (Arg9) (SEQ ID NO: 1 12) was previously shown to deliver Avrl b into soybean leaf cells and into onion epidermal leaf cells in particle bombardment cell re-entry assays .
  • the motif could also enable uptake of purified GFP into soybean root cells8 and into maize and onion cells.
  • the mechanism of uptake has been proposed to be a plant form of macropinocytosis.
  • the Arg9-GFP fusion protein binds PI-3 -P , PI-4-P and phosphatidyl serine, albeit weakly (Figure 9D).
  • Figure 9C shows that di-octanoyI-PI-4-P does not stimulate uptake of the Arg9-GFP fusion protein in soybean root cells, suggesting that the stimulation by PI-4-P i s specific to RXLR and dEER-mediated uptake.
  • This conclusion is supported by the observation that exogenous PI-4-P did not promote the uptake of Avrl b(N)-GFP (SEQ ID NO: 46) and AvrL567(N)-GFP (SEQ ID NO: 1 1 9) proteins containing alanine substitutions in the RXLR and dEER motifs.
  • Inosi tol- l ,4-diphosphate represents the hydrophilic head-group of PI-4-P .
  • Preincubation with 1 00 ⁇ IP2 inhibited binding of Avrl b(N)-GFP (SEQ ID NO : 46) to PI-4-P-containing liposomes and could completely block binding of AvrL567(N)- GFP (S EQ ID NO: 1 19) to PI-4-P-containing liposomes, presumably via competitive i nhibi ti on.
  • Avrl b(N)-GFP SEQ ID NO : 46
  • AvrL567(N)-GFP SEQ ID NO: 1 1 9
  • IP2 almost completely blocked uptake of both Avrl b(N)-GFP ( Figure 9A) (SEQ ID NO: 46) or AvrL567(N)-GFP ( Figure 9B) (SEQ ID NO: 1 19) into soybean cells.
  • IP2 could not inhibit the binding of Arg9-GFP to liposomes (Figure 9D) and uptake of Arg9-GFP (SEQ ID NO: 1 12) was completely unaffected by preincubation with IP2 ( Figure 9C), supporting the conclusion that IP2 specifically b locks RXLR and dEER motif-mediated protein uptake.
  • Phosphatidyl-inositol-phosphates are universal ly found in eukaryotic cel ls. Since a number o f human and animal diseases are caused by fungi and oomycetes, as wel l as by apicomplexan parasites, we tested the possibility that RXLR and dEER motifs might mediate protein entry into human cells, using the human lung epithelial cell line A549 as a model .
  • Avrl b(N)-GFP Figure 1 0A) (SEQ ID NO: 46)
  • Inositol 1 , 3 diphosphate 1 ,3-IP2
  • Figure I OC PfHRPII(N)-GFP
  • the dEER motif i s variably spaced from the RXLR motif, so if residues from both motifs contact the phosphoinositide head group, the protein must fold so as to bring the two motifs into prox imity.
  • the three dimensional structure of the RXLR and dEER or Pexel domain is not yet available for any oomycete or apicomplexan effector proteins, respectively.
  • the crystal structure of AvrL567 has been determined.
  • the RFYR motif adopts a beta-stranded conformation on the surface of the protein. It will be interesting to determine if the structure of AvrL567 changes in solution in the presence of a phosphoinositide.
  • eukaryoti c pathogens of humans and other animal s have not been reported to produce effector proteins that can cross host membranes into the cytoplasm of host cells.
  • the finding that phosphoinositide-bmding effectors from oomycete and fungal plant pathogens can cross the membranes of human cel ls predicts that oomycete and fungal pathogens of humans and other animals may also uti lize this mechanism to debilitate their hosts.
  • Possible examples include oomycete pathogens of marine animals from the genera Saprolegnia and Aphanomyces, extracellular fungal pathogens such as Pneumocystis carinii,
  • the binding of phosphoinositides or other polar lipids to effector cell entry domains from diverse kingdoms will provide a powerful biochemic al tool for screening or directly iso lating new candidate effector proteins from all classes of microbes. It may also enable detection of phosphoinositide-binding plant proteins (or other polar-lipid-binding proteins) that can traffic through the apoplast and enter into target cells to transduce signals. Some precedents for such proteins already exist, such as the Drosophila antennapedia transcription factor that can move from cell to cel l via an argi ni ne-rich cell entry motif.
  • IP2 can block effector entry into both plant and human cells provides a proof-of- concept for this approach.
  • Soybean seeds were germinated in vermiculite for 3 -5 days. Roots were washed with water thoroughly to remove any debris. Approx imately 1 .5 cm root tips were cut and placed into the protein solution (50 ⁇ - 25 niM MES pH 5.8, 50 ⁇ g protein) and incubated for 1 2- 1 5 hr at 28°C. Then the root tips were rinsed with water and washed in 75 mL of water for 2 hr on an orbital shaker at 90 rpm . Roots were examined using a Zeiss LSM5 10 laser scanning confocal microscope with an argon laser excitation wavelength of 488 nm.
  • Lipid filter arrays were prepared by pipetting 1 ⁇ L ⁇ PI-3 -P, PI-5-P (Cayman Chemical), PS, PC, PE, PA, or PI-4-P (Avanti Polar Lipids, Cayman Chemical) at various concentrations on Hybond-C extra membranes.
  • Liposomes were prepared from a suspension of 0.71 ⁇ ig/ml phosphatidylcholine, 0.29 pg/ml phosphatidyl-ethano!amine (PC/PE) or 0.64 ⁇ g/mI phosphatidylcholine, 0.26 ⁇ ⁇ p hosphatidyl-ethanolamine, 0. 1 g/mI phosphatidyl-inositol- phosphate (PC/PE/PI-x-P).
  • lipid mixtures were dried under vacuum overnight, then the resultant l ipid films were rehydrated at 1 mg/mL (total lipid) in 20 mM Tris- HCI (pH 6.8) 100 mM NaCl, 2 mM dithiothreitol by three cycles of freeze-thawing.
  • Large unilamellar vesicles were formed by extruding the lipid suspension through a 0. 1 - ⁇ filter (nucleopore track-etch membrane, Whatman) 20 times and were used i mmedi ately. Effector fusion proteins were centri fuged at 100,000 g for 20 mi n at 25°C prior to assay to remove protein aggregates.
  • phosphoinositides PI-3-P or PI-4-P
  • phosphatidic acid to effector cel l entry domai ns indicates that these phospho lipids may serve as a cell entry receptors.
  • Increasing the concentration of free phosphoinositi.de such as di-octanoyl- PI-4-P by exogenous addition stimulated RXLR and dEER-mediated uptake of the Avr l b GFP fusion, Avr l b(N)-GFP, into soybean roots and human cells.
  • IP2 inositol 1 ,4 diphosphate
  • an assay is devised for screening compound libraries to identify novel compounds that interfere with the RXLR and dEER- mediated uptake of effector proteins into plant or human cells, through inhibition of the binding of, or interaction between phospholipids PI-3-P or PI-4-P and RXLR and dEER motif containing proteins.
  • Plasmids encoding the Avrl b sequence are expressed in BL21 E. coli cells and the protein are puri fied and diluted into appropriate binding buffer at an appropriate concentration, and thirty microliters are dispensed into each wel l coated 96 or 384 well plates using an automated dispenser.
  • each of the Avrl b protein-containing wells receive 300 nanoliter of a compound from the compound l ibrari es, followed by incubating the plate at room temperature for 60 minutes.
  • An equal volume of 2x stock solution of fluorescently labeled soluble PI-4-P (Echelon Inc. BOD1PY FL PhosphatidylinositoI(4) Phosphate catalog #C-04F6a; BF-PI-4-P) is prepared in suitable buffer and 30 microliter of this solution i s di spensed into each well of Avrl b coated preincubated 384 well plates using an automated dispenser.
  • the p late is incubated in dark for 60 minutes, fo llowed by the measurement of fluorescence, utilizing a Synergy plate reader integrated with a biostack.
  • the reactions are performed in duplicates and with negative controls, where the interactions are measured in the absence of the protein or fluorescently labeled BF-PI-4-P, and positive controls where the interaction is measured in the presence of a range of concentrations of inositol 1 ,4 diphosphate (IP2).
  • IP2 inositol 1 ,4 diphosphate
  • the readouts are stored and analyzed for the identific ation of potenti al inhibitors of the reaction.
  • Statistical analysis are performed utili zing a combination of parameters and compounds that showed statistically significant inhibi tion are selected.
  • Percent inhibition [(Fluorescence in test well/Fluorescence in contro l wells) x 100] .
  • Percent inhibition [(Fluorescence in test well/Fluorescence in contro l wells) x 100] .
  • In excess of one hundred thousand drug-like, diverse heterocyclic chemical compounds are screened during this process for their potential to inhibit the interactions between BF-PI-4-P and Avr l b.
  • EXAMPLE 4 Screening assays for novel compounds that inhibit plant oomycete or fungal infection through blocking of RXLR and dEER containing effector protein action
  • detached leaf assays are used for soybean, potato, tomato, tobacco, grape, rice, and wheat.
  • the assays are used to test for infection by Phytophthora oomycete pathogens (soybean, potato, tomato, tobacco), downy mildew oomycete pathogens (tobacco and grape), rust fungi (soybean and wheat), Magnaporthe b last fungi (rice and wheat), and powdery mildew fungi (soybean, potato , tomato, tobacco, grape, wheat).
  • Expanded leaves are removed from young growth chamber-grown plants with the petio les intact (soybean, potato, tomato, tobacco, grape), or are clipped from the mother plant with sterile sc issors (wheat and rice).
  • the petioles or cut ends of the leaves are placed into plastic test tubes containing an aqueous solution of a suitable range of concentrations of each compound (determined from the biochemical ICso) -
  • the leaves are then fastened into a horizontal position, but with the petioles or cut ends bent down into the tubes.
  • the plants are then placed in a lighted growth chamber at 30% humi dity for 6 hr to enable the compounds to be drawn into the leaves by transpiration.
  • Phytophthora infections P. sojae on soybean; P. infestans on tomato and potato; P. parasitica on tobacco
  • Phytophthora infections are initi ated by spraying the leaves with an aqueous suspension of zoospores at a suitable concentration.
  • Infections with rust fungi Phakopsora pachyrizi for soybean; Puccinia striiformis f. sp . tritici (stripe rust) Puccinia triticina (leaf rust), Puccinia graminis f. sp.
  • tritici (stem rust) for wheat) are initiated by spraying the leaves with an aqueous suspens i on of urediniospores at a suitable concentration.
  • Infections with downy mildew oomycetes Peronsopora tabacina on tobacco; Plasmopora viticoia on grape) and infections of Magnaporthe blast fungi (Magnaporthe oryzae for rice; Magnaporthe grisea on wheat) are initiated by spraying the leaves with an aqueous suspension of conidia at a suitable concentration.
  • the p lants are replaced into the growth chamber at high (90%) humidity at a suitable temperature ( 15°C for P h y t o p h t h o r a
  • Eukaryotic pathogens such as oomycetes, fungi and apicomplexan parasites deliver hundreds of effector proteins into the cytoplasm of their host cells. Delivery of these protei ns is key to the pathogenic success o f these organisms.
  • the similarity between oomycete and apicomplexan effector delivery systems has been noted for some time.
  • inositol 1 ,4 diphosphate can inhibit oomycete and fungal effector uptake (Ex ample 2) shows that effector entry can be blocked by externally appli ed small molecular weight compounds.
  • This Example describes experiments that test whether infection by oomycetes, and po ssibly by fungi , can be mitigated by inhibiting effector entry using host-synthesized peptides that mimic inositol 1 ,4 diphosphate.
  • Biotrophic and hemi-biotrophic oomycete pathogens that are likely to use RXLR and dEER effectors include more than 80 species of Phytophthora and more than 500 species of downy mildews that together attack almost every crop species and horticultural species o f economi c importance. Peptides that could inhibit RXLR and dEER effector entry could thus provide broad-spectrum protection against many of these pathogens.
  • At least three commercially available phage display libraries are screened against a panel of effectors that have been well-characterized and/or are strongly expressed at the outset o f f. sojae or P. infestans infection.
  • the phage are eluted from the effectors using a rising concentration gradient of IP2 or soluble PI-P in order to identify those phage that have the greatest affinity for the PI-P binding sites of the effectors.
  • the candidates obtained are evaluated for their binding to all panel members, and to RXLR and dEER mutants of the panel members. In addition, their affinity for both soluble and liposome-bound PI-4-P and PI-3 -P is measured.
  • Synthetic peptides correspon ding to candidates with the highest affinities are prepared commercially and tested for their abi lity to inhibit uptake into plant and human cells.
  • the most promising peptides at this point are targeted for optimization of their breadth and affinity of binding.
  • Two optimization strategies are used. Firstly, PCR-directed random mutagenesi s of selected peptides is carried out an d high affinity, broad- spectrum mutants are selected by phage display. Loss-of-activity mutants are also characterized to help identify important residues.
  • targeted mutagenesis of selected peptides is carried out based on bioinformatic analysi s of all the phage peptide sequences obtained (both high quality and low quality peptides).
  • Surface Pl asmon resonance and NMR characterization of the binding of the most promising peptides to their target effector(s) also yields important information .
  • the cycle of selecting promising peptides and optimizing them is repeated as needed, or until li ttle further improvement is obtained. At this point the most promising peptides are fused to selected secreted plant proteins, and the chimeric proteins are expressed in plant tissues by transient expression.
  • the expression levels and stab ilities o f the chimeric proteins are assessed, as well as the ability of the expressed proteins to reduce entry of effector proteins and reduce infection by P. sojae or P. infestans.
  • the resistance of the plant tissue to additional pathogens is also evaluated.
  • Stable transgenic plants expressing the chimeric proteins are produced, and are evaluated systematically for di sease resi stance against diverse pathogens.
  • Other possible libraries for screening include Ph.D. -7 and the Ph.D. - 12 libraries that contain 7 or 12 random residues respectively, but without a disulfide bond; both have a complexity of around 2.8 x 10 9 .
  • the one-effector-at-a-time strategy targets Avrl b, Avh33 1 (Avr l k), Avh5, Avh6 and Avh l 72.
  • the first two effectors are avirulence gene products that trigger plant defense responses mediated by resistance (R) genes
  • the efficacy of candidate inhibitory peptides is also tested in planta by their ability to inhibit the R gene mediated response to the effectors.
  • Avh6 and Avhl 72 are maj or early-expressed effectors, so targeting them singly also has a measurable effect on pathogen virulence.
  • Avh5 is incl uded because its NMR characterization is well advanced. In each case, two di fferent fusions are produced: GFP and GST (glutathione-S-transferase) to reduce the chance of selecti ng phage that bind to an irrelevant part of the protein.
  • pools By using pools, the risk that a single chosen effector may be probl ematic is reduced, and by using three di fferent pools for the successive selection steps, the likelihood of finding broad specificity peptides is increased.
  • the order of the pools used for selecti on is varied.
  • the composition of the pools may be varied once data on the specificity of each effector for PI-3-P or PI-4-P is available, and/or if production of some chosen effector proteins in E, coli proves problematic .
  • Panning is carried out in microtiter tray wells; if sufficient enrichment of peptides is not seen in the wells, then the proteins are bound onto beads and the beads are used for panning.
  • the phage are step eluted with different concentrations o f inositol diphosphates (IP2) or soluble (e. g. di-hexanoyl) phosphatidyl phosphates.
  • IP2 inositol diphosphates
  • soluble e. g. di-hexanoyl
  • concentrations e. g. 1 ,3 IP2, 1 ,4 IP2, PI-3-P or PI-4-P, and the choice of concentrations is finalized once more precise data on the binding constant of the effectors for the phosphoinositides is available.
  • Each selected peptide is screened against a panel of al l the effectors mentioned listed above, plus a selection of 10 P. infestans infection-induced effectors and several fungal effectors.
  • RXLR and dEER region mutants are included to identify peptides that interact with those motifs. Phage with the broad specificity and a set of peptides with complementary sets of targets are identified. Screening is done in a western dot blot format in which effectors bound to a filter are probed with the phage and then with an anti-M 13 antibody. Alternatively, the phage are panned against effectors arrayed in microtiter wells , and then detected by spotting onto an E. coli lawn with a replicator.
  • the affinity of the phage for the effector is initially estimated by doing binding experiments in the presence of di fferent concentrations of PI-Ps or IP2s .
  • An oomycete effector protein mi croarray containing all 1440 effectors from P. sojae, P. infestans, P. ramorum and H. arabidopsidis is ideal for comprehensive screening of the most promising phage.
  • the most promising peptides are tested for the ability to block effector-GFP entry into root cells.
  • synthetic peptides are ordered from a commercial supplier.
  • phage display technology is a proven pl atform for improving binding via random mutagenesis.
  • a single randomized oligonucleotide is used to mutagenize the 2 1 nucleotides encoding each peptide loop.
  • Selection of phage on a range of di fferent effectors is used to improve the breadth of specificity.
  • Selection of phage in the presence of free peptide having the original sequence is used to select for improved affinity.
  • An alternative approach to improving the breadth of specificity is to concatenate several peptides, with a spacer or linker sequence in between. This is an acceptable construction for in planta expression.
  • the concatenated peptides are tested to ensure that they retain their original affinities and breadth of speci ficity. Fuse peptides to small secreted plant proteins, and test the effects of their expression in planta on effector entry and on disease resistance.
  • the peptide mimics are fused to larger proteins normal ly produced during infection to promote the peptides' stability and reduce their potential susceptib i l ity to endogenous plant proteases .
  • the fusions are evaluated in three steps: (i) exogenous application of purifi ed proteins to plant tissues ; (ii) transient expression in plants; and (iii) expression in stable transgenic plants .
  • a variety of candidate proteins are evaluated for fusions with the peptide mimics, includi ng highly stable plant proteins such as PR l a, lipid transfer proteins, protease inhibitors and proteases.
  • the mimic is attached to the C-terminus of the "carrier" protein via a suitabl e spacer so that the native N-terminal secretory leader can be used.
  • a single peptide mimic is attached to each carrier. Once attachment of single pepti des has been validated, multip le peptides are attached in tandem to improve the breadth of binding and/or for better efficacy against effectors with multiple phophoinositide binding sites.
  • C-terminal green fluorescent protein (GFP) fusions are used to evaluate the stabi lity and localization of the proteins in planta. Expression in E. coli or Pichia pastoris and evaluation of purified proteins.
  • Fusion proteins are expressed in E. coli or, due to the necessity to correctly form disulfide bonds, in eukaryotic expression system based on Pichia pastoris.
  • the purified peptide-fusion proteins are tested for effector binding in vitro to ensure they retain binding activity as fusions. They are then introduced into leaf and root tissues (by infiltration and direct uptake, respectively) from soybean and N. benthamiana to test their stability in planta (via western blots) and to test their ability to inhibit the uptake of exogenously applied effector-reporter fusions into the plant cells. Uptake assays based on su spension cultures cells and on protoplasts may also be used to distinguish between stability and effectiveness in effector uptake inhibition .
  • the BPMV system is used to transiently express the peptide fusion proteins in soybean and Agroinfiltration to transiently express the proteins in N. benthamiana. Versions that include GFP to facilitate evaluation of stability and localization are used. Transcription of the constructs is confirmed using RT-PCR or northern analysis. Protein levels are evaluated by western blots, and confocal microscopy is used to verify that the proteins are being delivered to the apoplast.
  • N. benthamiana tissue is tested for its response to the blu e mold downy mildew pathogen Peronospora tabacina. Soybean leaf tissue is tested for resistance to the soybean rust fungus, Phakopsora pachyrhizi.
  • Leptosphaeria maculans also enter plants via the same mechanism. Fusarium oxysporum f. sp . lycopersici is a xylem dwelling pathogen and Leptosphaeria maculans is an apop lastic pathogen.
  • AvrLm6 contains two RXLR-like sequences, RYWT and RTLK. Mutations in the second moti f (RYWT) but not the first (RTLK) abolish entry of AvrLm6 ⁇ GFP fusions into root cells ( Figure 16A).
  • Avr2 also contains two RXLR-like sequences, RMLH and RIYER. Mutations in the second motif (RIYER) but not the first (RMLH) abolish entry of Avr2-green fluorescent protein (GFP) fusion proteins into root cells ( Figure 1 6B) .
  • GFP fusions to the N-termini of three more fungal effectors or effector-like proteins bind PI-3-P.
  • the proteins are Leptosphaeria maculans effector AvrLm4/7 and two bioinformatically-predicted effector-like proteins from the human pathogens Cryptococcus neoformans (Cng2 ; AAW43853. 1 ) and Aspergillus fum igatus (Af2; XP 752996.1 ).
  • Each N-terminal domain contains potential RXLR-like m otifs ( Figure 1 7A).
  • EXAMPLE 7 Occurrence of RXLR-like moti fs in effector like proteins from a wide diversity of oomycetes, fungi and insects.
  • the fungal effectors include an effector (MiSSP7) from a mutuali stic ectomycorrhizal fungus, Laccaria bicolor (Marti n et al., 2008).
  • sucking and chewing insects produce effector-like proteins, including hessian flies (Mayetiola destructor) (Behura et al. , 2004) and pea aphids
  • phosphoinositide binding is a common property of most i f not all eukaryotic effectors that can autonomously enter host plant or ani mal cel ls across their plasma membranes, including effectors produced by host-associ ated oomycetes, fungi and animals (e.g. insects and nematodes), and including pathogens, mutualists, commensals, ectosymbionts and endosymbionts.
  • host-associ ated oomycetes fungi and animals
  • pathogens e.g. insects and nematodes
  • pathogens e.g. insects and nematodes
  • Avr3 a Phytophlhora 0 LSTTNANQAKIIKGTSPGGHSPRLLRAYQPD sojae DEGDSPEDR (SEQ ID NO: 307)
  • VIQSGR VIQSGR
  • HMKRTFTLALENTFYAMAWLIDFSFS EEGEPHFSY LQ (SEQ ID NO: 317) AvrLm4/7 Leptosphaeria F CREASISGEIRYPQGTCPTKTEALNDC maculans NKVTKGLIDFSOSHORAWGIDMT (SEQ ID NO: 317)
  • Avr2 Fusarium F LPVEDADSS VGQLQGRGNPYCVFPGRRTSS (Six3) oxysporum f.sp. TSFTTSFSTEPLGYA-RA/LHRDPPYERAGNSG lycopersici LNHRIYERSRVGGLRTVIDV (SEO ID NO:
  • AvrP123 Melampsora lini F OYVVDPGFGEIECMCGOIARLTORPFDVE
  • vH 13 May tiola I SPLPLAYTDOVYDACDRQFDETVRNSQPL destructor (SEQ ID NO: 338) vH9 Mayetiola I LVLDTRAMPETDFE ALKEWNRVOTLVLTA destructor PEORRTMVLIAEHLTNLKKMNVDSPGGSFL
  • HPSHTAESFYIDYP (SEQ ID NO: 350)
  • PVVPGQTVMEPSAALPDDGDHLYTLPMFDIR fumigatus PWERVSEVRLAREGYLYG SEO ID NO: 351
  • ATRFKASLHQCHH (SEQ ID NO : 353)
  • Phosphatidylinosiiol-3-phosphate is the natural target of RXLR(-like) effectors. Of the eight oomycete and fungal effectors tested to date, seven have a preference for binding to PI-3 -P , and one (Avrl b) has a preference for PI-4-P. Neither of PI-3-P nor PI-4-P has been reported to occur in the outer leaflet of the plasma membrane of plant or animal cells (Boon et al. , 2002) . Two papers have reported secretion of PI-4-P by plant cells (Regente et al., 2008 ; Gonorazsky et al ., 2008).
  • VAM7p has a preference for PI-3-P but can bind weakly to PI-4-P and PI-5-P ( Figure 1 8A) (Lee et al ., 2006).
  • the GFP fusion proteins were used to stain the surface of cells of human lung epithelial cel l, line A549 and soybean root cells. The results reveal very clearly that PI-3-P is present uniformly on the outer surface of roots cells ( Figure 1 8B), and at speci fic sites on the surface of the epithelial cel ls ( Figure 18C).
  • ⁇ -4-P could not be detected in either case. Nei ther PI-3-P nor PI-4-P could be detected on the surface of erythrocytes .
  • the lack of PI-3 -P or PI-4-P on the surface of erythrocytes is significant because nearly all published studies documenting the absence of PI-3 -P or PI-4-P from the outside of eukaryotic cells uti lized erythrocytes. Our results suggest that erythrocytes may be an exception in this regard.
  • PI-3 -P The finding of PI-3 -P on the outside of plant and animal cells, combined with the preference for most effectors for PI-3-P is consistent with PI-3-P being the principal receptor mediating entry o f the effectors into plant and anim als cells.
  • PI-4-P has been reported to be secreted from plant cells under certain conditions (Regente et al., 2008 ; Gonorazky et al., 2008), and it is possible that some effectors such as Avr lb have evolved to respond to PI-4-P .
  • EXAMPLE 10 A PI-3-P-binding protein blocks entry of effectors into plant and human cel ls .
  • VAM7p PX protein strongly inhib ited entry by GFP fusions of the oomycete effector Avrl b, and the fungal effectors AvrL567, Avr2 and AvrLm6 into soybean root cells ( Figure 20A) but di d not inhi bit entry of a synthetic cel l permeable protein Arg9-GFP th at does not bind phosphoinositides .
  • VAM7p PX protein strongly inhibited the entry by GFP fusions of Avr l b, AvrL567 and the Plasmodium effector PfHRPII into . human epitheli al cel ls, but did not inhibit entry of Arg9-GFP.
  • the abil ity to b lock effector entry using 1 , 3IP2 or 1 ,4IP2 provides a proof-of- concept for treating oomycete or fungal i nfections of plants or ani mals, including humans, with drugs that block the PI-3 -P-binding sites of the effectors. Such drugs may not need to fully block all effectors in order to be effective. Since a princ ipal function of effectors is to suppress the host defense responses, even partial inhibition of effector entry may be sufficient to obtain protein. This point may be important because some forms of geneti c resi stance in plants (maj or gene resistance) rely upon entry of effectors into the plant cells (the resistance gene product encodes a receptor that detects the presence of an intracellular effector).
  • P1-3-P Drugs are also used to interfere with biosynthesis or export of P1-3-P to the outer leaflet. Inside the cell, P1-3-P can be formed by the action of
  • phosphatidylinositol-3 -kinases on phosphatidylinositol and by the acti on of phosphatidylinosi to l 4, 5 phosphatases on phosphatidylinositol 3 ,4 diphosphate, phosphati dylinosito l 3, 5 diphosphate and phosphatidylinositol 3 ,4,5 diphosphate. Any drug which inhibited these enzymes could lower the level s of external PI-3-P.
  • PI-3 -P reaches the outer leaflet. All known PI-3 -P forming enzymes are located on the cytoplasmic face of membranes. PI-3 -P could reach the external leaflet of the plasma membrane or the luminal face of secretory vesicles by the action o f floppases or a scramblases. Alternatively PI-3-P might be transported to the outer leaflet by an ABC transporter or by a secreted lipid transfer protein. Any of the proteins involved in this process could be targeted with drugs, provided that they did not disrupt normal cell physiology. In addition to drugs that directly target the proteins described above, and drug that targets biosynthesis of the proteins, for exampl e siRNAs, are also effective.
  • drugs that bind directly to PI-3-P making it unavailable to effectors are effective.
  • neomycin binds PI-4,5- P2 very effectively; thus neomycin, neomyc in derivatives or other aminoglycosides that bind PI-3 -P may be used.
  • EXAMPLE 1 Methods to block effector entry using polypeptides .
  • Polypeptides with the properties described in Example 10 may al so be utilized. Polypeptides may have some adv antage over chemicals, in plant and animal systems, in that the host organism can be genetically engineered to produce the polypeptide, si mpl ifying del ivery and reducing cost. The ability to produce and select large numbers of variant polypeptides via phage display technologies provides additional power to improve specificity, if needed. Random peptides or single chain antibodies selected by phage display are used to block the PI-3-P binding sites of effectors .
  • effector-b inding proteins could be fused to proteases to facilitate degradation of the effectors.
  • PI-3-P-binding proteins The abi lity to block effector entry by pre-incubation with PI-3-P-binding proteins provides a strong indication that secretion of PI-3-P-binding proteins could provide protection against infection, especi ally if the secreted protein coul d be targeted to the infecti on site. Additionally, secretion of enzymes which can hydrolyze PI-3-P or modi fy it in other ways may be effective in reducing the level of PI-3-P available to transport effectors into cells. Examples of such enzymes include but are not limited to PI-3-P 4,5 kinases, PI-3-phosphatases, or phospholipases, etc. Examples of these enzymes have been described in the literature (Falasca et al., 2006).
  • enzymes that cause novel modifications of PI-3-P such as methylases, acetylases or glycosylases may be used.
  • a particularly useful enzyme is a phospholipase C that can cleave PI-3-P into diacylglycerol and l,3inositol diphosphate; not only is the level of PI-3-P reduced but the inhibitor 1,3- inositol diphosphate would be produced as a result.
  • phospholipase C that can cleave PI-3-P into diacylglycerol and l,3inositol diphosphate; not only is the level of PI-3-P reduced but the inhibitor 1,3- inositol diphosphate would be produced as a result.
  • phosphatidylinositol-specific phospholipase C's are specific for phosphatidylinositol, glycosyl phosphatidylinositol-protein anchors, or for phosphatidylinosito]-4-phosphate and phosphatidylinositol-4,5-diphosphate.
  • systematic mutagenesis is used to modify the specificity of a phosphatidylinositolspecific phospholipase C so that it could cleave PI-3-P.
  • transgenic hosts are produced in which the polypeptide gene is transcribed only during infection.
  • the polypeptide is targeted to the site of infection.
  • the Arabidopsis protein RPWS is specifically targeted to haustoria of certain oomycetes and fungi (Wang et al., 2009). RPWS is used to target anti-effector polypeptides to the haustorial space.
  • Laccaria bicolor provides insights into mycorrhizal symbiosis. Nature 452, 88-92.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Urology & Nephrology (AREA)
  • Veterinary Medicine (AREA)
  • Hematology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biomedical Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Endocrinology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Pathogenic effector proteins include one or more virulence motifs of amino acid consensus sequence BXZ, where B = RK or H; X = any amino acid or is absent; Z = L, M, I, W, Y or F) which bind to target polar lipids on a host (plant or animal) cell as a prerequisite for translocation of the pathogenic effector proteins into the cell. Translocation is prevented by binding blocking compounds to one or more motifs of the effector protein or to the lipid Iigands of the host cell. The blocking compounds include synthetic or naturally occurring polypeptides which bind the polar lipids or the motifs, various polar lipids, the hydrophilic head-groups of polar lipids, etc. Suitable blocking compounds can be identified by assays demonstrating binding to the motifs or to the target polar lipids.

Description

COMPOSITIONS AND METHODS TO PROTECT CELLS
BY BLOCKING ENTRY OF PATHOGEN PROTEINS
DESCRIPTION BACKGROUND OF THE INVENTION
Field of the Invention
The present invention generally relates to prevention of microbial, especially oomycete or fungal , disease and, more particul arly, to cel lular targets for blocking entry of pathogen effector proteins into plant or animal cell s. The invention also prov ides compositi ons and methods for identifying compounds that block entry of pathogen effector proteins into cell s, and treatments using such compounds.
Background description
Fungi and parasites such as Plasmodium are eukaryotes, which are organisms that have comp lex internal cell structures (bacteria and viruses have simpler structures and are excluded). Infections by parasites and fungi are especial ly difficult to develop drugs for because humans are also eukaryotes, so many drugs toxic to these organisms are also toxic to humans. In addition to the malaria parasite, Plasmodium, other eukaryotic pathogens of humans include the parasites Schistosoma, Onchocerca, Trypanosoma , and Leishmania, fungi that afflict AIDS patients such as Candida, Histoplasma, Cryptococcus and Aspergillus, and the Valley Fever fungus,
Coccidioides, that affects healthy people in the Southwest. Fungal spores are also responsible for allergies, asthma and mold-related i l lnesses.
Eukaryoti c pathogens of plants are also a major problem in agriculture, horti culture and forestry, and include fungi and fungal-like organisms related to marine al gae called oomycetes. These diseases cause bill ions o f doll ars in losses each year. Some fungal p lant pathogens include rust fungi, such as the new virulent wheat rust fungus, Ug99, that is sweeping through Africa and the middle east, and the rice blast fungus which causes maj or losses to the US and Asian rice crop each year.
Oomycete pathogens include the late blight pathogen of potato {Phytophthora infestans) that causes the Irish potato famine and sti ll causes $ 5 bi llion in losses worldwide annually, Phytophthora ramorum that causes Sudden Oak Death in
Cal i fornia, and Phytophthora sojae that caused $ 3 -2b damage to the US soybean crop . Worldwide transport of plants and plant products across diverse ecosystems has hastened the spread of many plant pathogens. With the increased pressure on agricultural production systems due to competing needs for food and biofuels, there is an urgent need to explore new highly effi cacious strategi es for biotechnology-based approaches to disease control.
Eukaryotic pathogens of both humans and plants release protein toxins called effectors that have the abi lity to infiltrate inside host cells, across the membrane barrier that normally surrounds the host cells . Once the effectors enter the host cell, they reprogram the cells to suppress or block the immune responses of the host and to make the host tissue more congenial for reproduction and spread of the pathogen . Therefore, drugs that could block the entry of effector proteins into host cells would potential ly suppress infection by a broad range of eukaryotic pathogens important to medicine and agriculture.
Like animals, plants have evolved defense mechanisms that afford some protection from pathogens. Constitutive defenses include structures such as the cuticle and preformed anti -m icrobial chemicals. Plants have also evo lved an active defense response that i s induced by detection of an attacking pathogen. The response includes rapid synthesi s of anti-microbial chemicals and proteins, and a programmed cell death (PCD) response, called the hypersensitive response (HR). The abili ty of plants to detect and respond to pathogens is mediated by various receptors and si gnal transducti on pathways that have close similarities to the innate immunity mechanisms of ani mals. Unfortunately, however, pathogens of both plants and animals have evolved mechani sms to avoid or suppress host defenses, thereby retaining the ability to cause many destructive diseases affecting crops and forests.
Oomycetes are fungus-like organisms many of which are pathogens. For examp le, most o f the more than 80 species of the oomycete genus Phytoph thora are destructive pathogens, including the potato late bli ght pathogen, Phytophthora infestans, which caused the Irish potato famine in the 1 8th century, the soybean root and stem rot pathogen P. sojae, and Phytophthora ramorum, the causative agent of Sudden Oak Death that is currently ravishing oak forests in Californi a. The closely related oomycete genus Pythium contains more than 100 species, most of which are also pathogens . The oomycetes also inc lude a number of commercially important and diverse downy mildew pathogens that are obligate parasites, often with narrow host ranges.
The sequencing of Expressed Sequence Tags (ESTs) and genomes from several oomycete pathogens has been completed or i s under way. Draft genome sequences for the soybean pathogen Phytophthora sojae and for P. ramorum have been completed; those of P. infestans and the Arabidopsis downy mildew pathogen Hyaloperonospora arabidopsidis are nearing completion; and genome sequencing of the broad host range plant pathogens Phytophthora capsici and Pythium ultimum and the fish pathogen Saprolegnia parasitica is also underway. In addition, substantial libraries of EST sequences are avai lable for most of these species, as well as for Phytophthora parasitica and the S aprolegniomycete plant pathogens Aphanomyces euteiches and Aphanomyces cochlioicles. The mining of these pathogen sequences by comparative genomics and the prediction of which proteins are secreted by the pathogens has resulted in identification of large numbers of candidate genes that potentially encode proteins invol ved in plant infection.
Among these are the so-cal led "effector proteins" or "effectors". Effectors, which are secreted by plant pathogens and have the abi lity to enter plant cells, have been documented for many classes of plant pathogens, includi ng bacteria, fungi, oomycetes and nematodes. Once inside a host cell, the maj or function of an effector protein is to suppress the signal transduction pathways that mediate plants defense responses, and many effector proteins also suppress host programmed cel l death. The activities of fungal effector proteins are known to include chitin-bind ing, cytotoxi city, metal loprotease activity, and protease inhibition. Pathogen effectors may also reprogram the plant cell to promote nutrition of the pathogen.
In response to pathogen attacks mediated by effectors, plants have evolved certain resistance ("R") genes that encode receptor proteins having the ability to bi nd and sequester, and thereby inactivate, the pathogen effector proteins. (In fact, effectors were initially discovered based on their abi lity to trigger responses mediated by R gene-encoded host receptors). Pathogen genes encoding effectors are referred to as avi rulence (Avr) genes, because, i n practice, they actually prevent infection of host plants whi ch contain cognate receptor proteins by binding to the receptor, thereby alerti ng the plant to their presence, and initiating an anti-pathogen response. In contrast, genes encoding plant effectors for which cognate plant receptors do not exist are referred to as viru lence genes. Genetic mapping of oomycete Avr genes led to the cloning of the first four effector genes: Avrlb-1 from P. sojae (Shan, W., Cao, M., Leung, D. & Tyler, B. M. The Avrlb locus of Phytophthora sojae encodes an elicitor and a regulator required for avirulence on soybean plants carrying resistance gene Rpslb. Mol. Plant Microbe Interact 17, 394-403 (2004); Avr3a from P. infestans (Armstrong, M. R. et al. An ancestral oomycete locus contains late blight avirulence gene Avr3a, encoding a protein that is recognized in the host cytoplasm. Proc Natl Acad Sci U S A 102, 7766- 71 (2005); and ATR1 (Rehmany, A.P., Gordon, A., Rose, L.E., Allen, R.L.,
Armstrong, M.R., Whisson, S.C., Kamoun, 8., Tyler, B.M., Birch, P.R., and Beynon, J.L. (2005). Differential recognition of highly divergent downy mildew avirulence gene alleles by RPP1 resistance genes from two Arabidopsis lines. Plant Cell 17, 1839-1850), and ATR13 (Allen, R.L., Bittner-Eddy, P.D., Grenville-Briggs, L.J., Meitz, J.C., Rehmany, A. P., Rose, L.E., and Beynon, J.L. (2004). Host-parasite coevolutionary conflict between Arabidopsis and downy mildew. Science 306, 1 57- 1960), both from H. arabidopsidis , Many other effector genes have subsequently been identified and analyses have shown that all effector genes encode small secreted hydrophilic proteins that lack disulfide bonds. Significantly, effector proteins have the ability to enter plant cells unaided by any other pathogen encoded molecules. Thus, the mechanism of entry must lie in the effector proteins themselves. Sequence comparisons have led to the identification of two common motifs in the N-terminus region of effector proteins: 1) RxLR or RXLR (which stands for "arginine, any amino acid, leucine, arginine"); and 2) dEER (which stands for "aspartate which is not highly conserved, glutamate, glutamate, arginine") (Birch, P.R., Rehmany, A. P., Pritchard, L., Kamoun, S., and Beynon, J.L.2006. Trends Microbiol 14, 8-11; Tyler, 2006.
Science 313, 1261-1266; Rehmany, et al.2005. Plant Cell 17, 1839-1850). These motifs have been suspected of being responsible for the ability of effector proteins to enter plant cells. This speculation has been encouraged by the observation that a similar N-terminal "Pexel" motif (RxLxE/Q, i.e. "arginine, any amino acid, leucine, any amino acid, then aspartate or glutamate or glutamine") is required for effectors of the malaria parasite, Plasmodium, to cross the host parasitiphorous vacuolar membrane into the cytoplasm of red blood cells. In addition, experimental evidence has shown that mutations in either the RxLR or dEER motifs can alter an effector' s ability to translocate into host cells.
Effectors of fungal plant pathogens have also been predicted to translocate into host cells because many plants (e.g. flax and rice) possess intracellular receptors, encoded by maj or resistance (R) genes, which mediate a rapid defense response when fungal effectors are present. However, prior to the present invention, fungal effectors had not been well characterized and the presence of amino acid sequence motifs that mediated entry into host cells had not been demonstrated.
In spite of previous suspici ons concerning putative involvement of the RxLR and dEER motifs in effector translocation, the precise mode of and requirements for transl ocation of effector proteins were not known. And, in fact, it was previou sly not known whether fungal pathogens even possessed these or analogous motifs. This lack of knowledge had h indered the development of effective methods to combat the infection of both plant and animal host cells by oomycete, fungal and Plasmodium pathogens . Further, the lack of detai led characterization of the RxLR and dEER motifs and their flanking sequences has prevented the selection, from an enormous pool of genomic sequence data, of genes that likely encode additional effector proteins, the identi fication of which could lead to strategies for inhibiting their pathogenic acti on in cells.
SUMMARY OF THE INVENTION
The present invention provides methods to block the entry of pathogen effector proteins into host cells (e.g. , "translocation"), thereby preventi ng host cell infection. The methods are based on the discovery that binding of polar lipi ds such as phosphatidyI-inositol-3 -phosphate (PI-3 -P) and/or phosphatidyl-inositol- 4-phosphate (PI-4-P) and/or phosphatidic acid to effector molecules via a virulence motif is a prerequisite to translocation of the effector into a host cell, and that when binding is blocked, translocation, and hence infection of the cell, does n ot occur. The motifs have the sequence '"BXZ" where B = arginine, lysine or histidine; X = any amino acid or no amino acid (i.e. X may be absent); and Z = leucine, methionine, isoleucine, tryptophan, tyrosine or phenylalanine. The BXZ motif encompasses a fami ly of motifs, which frequently occur at or near the N-terminus of an effector protein, examples of which include but are not limited to RxLR (which may function in concert with a dEER moti f), Pexel, RYWT, RIYER, RSLR, RRLLR, RRFLR, and RFYR, and others, all of which may collectively be referred to herein as "virulence motifs.
Binding may be prevented by any of several strategies including but not limited to i) blocking the effector motif itself, and ii) blocking the lipids of the cell to which the motif binds. The moti f itself may be blocked by e.g. inositol 1 , 4-diphosphate, or by other inositol containing phosphatidic acids, phospholipids and sphingolipids, or any other compound which binds to one or the virulence motif. Blocking of the lipid (generally at or on the celt surface) can be accompl ished using, for example, proteins or peptides or other molecules that b ind the l ipid s (e.g. mimeti cs of the motifs, or proteins or other compounds that destroy, remove or block access to phosphatidyl- inositol-3-phosphate (PI-3-P) and/or phosphatidyl-inositol- 4-phosphate (PI-4-P) and/or phosphatidic acid and/or any other polar lipid that is bound by an effector) thereby preventing effector binding to a moti f. According to the invention , the entry of effector protei ns from oomycetes, fungi, and other types of pathogens, including human pathogens (e.g. Plasmodium) may be blocked. For example, Plasmodium effector proteins include a Pexel motif which i s selectively bound as a prerequi site for translocation . Blocki ng of effector entry prevents the pathogen from inhibiting host cell defense mechanisms and allows the host to mount an effective response to the pathogen.
The invention al so provides elucidation of the structural requirements of the virulence motifs in oomycetes and fungi, and of the sequences which flank the motifs, leading to the ability to predict which genes in the genome of a pathogen are likely to encode effector molecules.
According to an embodiment the invention, translocation of an effector protein from a pathogen, such as a bacteria, fungus, oomycete, protozoa or nematode, into a host including ani mal s (including humans) and plants i s prevented by selectively binding a blocking compound to one or more BXZ virulence motifs of the effector protein. According to another embodiment, translocation of an effector protein from a pathogen is prevented by selectively binding a blocking compound to one or more pol ar lipi ds which would otherwise bind an effector motif. By preventing entry of the effector protein into the cell, the host cell defense mechanisms are permitted to mount an effective defense against the pathogen (it being recognized that after entry, the effector protein would compromise the host cel l defense mechanisms). Thus, the invention provides a mechanism to avoid the adverse outcomes attributed to pathogenic effector proteins, and it is applicable in promoting the health and viabi lity of both pl ants and animals.
Another embodiment of the invention pertains to i denti fying compounds which are suitable for use in protecting cells (animal and plant) from pathogenic effector proteins. In operation , an assay is used to determine whether or not a compound binds to one or more moti fs of an effector protein which are bound by phosphoinositides or another polar lipid as a prerequisite for translocation . The assay may include pathogenic effector proteins which include a BXZ motif (e .g. RxLRPexel, RYWT, RIYER, RSLR, RRLLR, RRFLR, and RFYR or simi lar motifs), and/or may include protein substrates which present one or more BXZ motifs in a manner which can be bound by a candidate compound. Alternatively, an assay may include one or more polar lipids which bind to the motifs, in order to identi fy compounds which bind and thus would block moti f binding. Such assays may include competition assays between candidate compounds and compounds (e.g. peptides or proteins) which contain the moti f(s) . The assay may be in the solid or liquid phase and may employ fluorescent, phosphorescent, chemi luminescent, col orimetric, or other suitable labels to indicate binding of a candidate compound to one or more motifs which are required to be bound by phosphoinositi des or another po lar lipid as a prerequisite for translocation .
Yet another embodiment of the invention pertains to a methodology of identifying whether an amino acid sequence of a protein in a pathogen is part of an effector protein. In this embodiment, hidden Markov modeling (HMM) is used to compare flanking sequences of a BXZ sequence (e.g. of an RxLR sequence) to determine whether the structural features for the moti f are present. Through identification of effector proteins, effective strategies for preventing entry of the effector proteins into a cell (animal or plant) can be pursued.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1A-E. RxLR and dEER motifs are required for Avrlb function in P. sojae transformants. (A) Sequences of mutations in the RxLRl, RxLR2 and dEER motifs. Bold indicates amino acids of the RxLR motifs and the alanines used to replace them in the mutations. Italics indicate the dEER motif and the alanines used to replace it in the mutant. (B) Pst I restriction analysis of PCR products amplified from Avrlb- 1 transformants using primers specific for the HAM34 promoter and terminator regions. Pst I restriction profiles of Avrlb(RxLRlAAAA), Avrlb(RxLR2AAAA),
Avrlb(RxLRlAAAA, 2AAAA), Avi b(dEERA6) and wild type (WT) Avrlb are distinguished from each other because the mutations introduce a Pst I site.
Avrlb(dEERAf')-9 was confirmed by sequencing the PCR product. C, Detection of Avrlb mRNA in P. sojae stable transformants by RT-PCR. Upper panel shows amplification with primers internal to the Avrlb C-terminus. Lower panel shows amplification with P. sojae actin primers. P. sojae stable transformants were the same as for (B) except that an amplification reaction is also shown from RNA from a P. sojae transformant containing a β-glucuronidase gene (GUS). No amplification was observed when reverse transcriptase was omitted from the reactions. (D) Distributions of HMM scores of RxLR flanking regions for all RxLR-containing secreted proteins from P. sojae and P. ramorum (non-permuted), for all secreted proteins retaining an RxLR string after sequence permutation (permuted), and for all high quality RxLR- effector candidates identified by Jiang et al (2008) (curated). The locations on the distribution of the HMM scores of the RxLR strings of known avirulence proteins and HpAvh341 are shown by the arrows. (E) Phenotype of L77-1S63 (Rpslb) seedlings inoculated on the hypocotyls with transformants carrying the indicated wild type or mutant Avrlb- 1 genes and photographed 4 days later.
Figure 2. RxLR and dEER functions confirmed by particle bombardment assay.
Soybean leaves were bombarded using a double-barreled device that delivered Avrlb- 1 DNA-bearing particles to one side of the leaf and control (empty vector) DNA to the other; both sides received GUS DNA. Ratio of blue spots in the presence of Avrlb-1 compared to the control. sAvrlb indicates a gene encoding secretory Avrlb and mAvrlb indicates one encoding mature Avrlb (lacking the secretory leader). WT indicates wild-type RxLR motif, RxLR2AAAA indicates the four alanine replacement of the RxLR2 motif, dEERA6 indicates the six alanine replacement of the dEER motif. Averages and standard errors are from 16 pairs of shots, p values comparing results from cultivars with Rpslb (L77-1863) or without (rps; Williams) were calculated using the Wilcoxon rank sum test.
Figure 3A-D. P. sojae stable trans formants show that two other Avh proteins can replace the RxLR and dEER region of Avrlb. (A) Sequences of the N-termini of wild type and mutant Avrlb proteins, and of fusions with two other Avh proteins.
Underlined, secretory leader; bold, RxLR motifs; italics, dEER motifs. The C-termmal sequence of Avrlb is shown in lowercase. (B) PCR analysis of DNA from P. sojae stable transformants. WT: pi = pHamAvrlb plasmid DNA, T17 and T20 = two transfonnants with wild type Avrlb-1 transgenes. HpAvh341 -AvrlbCt: pi = pHamAvh341 plasmid DNA (encoding Hp Avh341 -Avrl bCt), 13 and 17 = two transformants containing pHamAvh341. PsAvr4/6-AvrlbCt: pHamAvhl71 plasmid DNA (encoding Ps Avr4/6-Avrl bCt), 3 and 19 = two transformants containing pHamAvhl71. mAvrlbCt: pi = pHamAvrlbCt plasmid DNA (encoding mAvrlbCt protein), 4 and 5 = two transformants containing pHamAvrl bCt. The sizes of the PCR products for Avrlb-1, pHamAvh341, pHamAvh!71 and pHamAvrlbCt are 577bp, 721 bp, 748bp and 385bp respectively C, Detection of Avrlb mRNA in P. sojae stable transformants by RT-PCR. Upper panel shows amplification with primers internal to the Avrlb C-terminus. Lower panel shows amplification with P. sojae actin primers. P. sojae stable transformants were the same as for (B) except that an amplification reaction is also shown from RNA from a P. sojae transformant containing a β- glucuronidase gene (GUS). pi = pHamAvrlb plasmid DNA as template. No
amplification was observed when reverse transcriptase was omitted from the reactions (D) Phenotype of L77-1863 (Rpslb) seedlings inoculated on the hypocotyls with the indicated transformants carrying wild type or mutant Avrlb-1 genes and photographed 4 days later. HpAvh341-Avrlb-17, PsAvr4/6-Avrlb-3 and niAvrlbCt-5 gave similar results to HpAvh341 -Avrl b-13, PsAvr4/6-Avrlb-19 and mAvrlbCt-4 (Table 1).
Figure 4A and B. Functional replacement of Avrlb host targeting signal with protein transduction motifs and Plasmodium host targeting signals, (A) Sequences of modified Avrlb proteins. PfGBP, PfHRP and Pfl615c refer to the Plasmodium Pf GBP-130, Pf HRPII and Pf PFE1615c proteins. All non-native Avrlb sequences are underlined, Avrlb RxLR2 and Plasmodium RxLXE/Q motifs are in bold, and acidic residues in the dEER region are in italics. The Avrlb secretory leader was used in all constructs. (B) Ratio of blue spots in the presence of Avrlb-1 compared to the control, assayed as described in Figure 2. Constructs are as in (A). Averages and standard errors are from 8 pairs of shots.
Figure 5. Summary of Avrlb-1 mutations and their phenotypes in P. sojae stable transformants and soybean transient expression assays. A, Avirulent; V, Virulent; NT, Not Tested; Y, significantly fewer blue (GUS-positive) tissue patches from GUS expression resulting from Avr lb-induced cell death; N, not significantly fewer blue tissue patches; P, partial reduction in blue tissue patches; SP, signal peptide.
Figures 6A-H. Binding of oomycete effector proteins to phosphoinositides. a-c, Filter- binding assays, d-f, Liposome binding assays. RxLR and dEER mutations are described in Figure 6G and H. (N)-GFP indicates a fusion of the N-terminal domain to GFP. (FL)-GST indicates a fusion of the full length effector proteins (without signal peptide) to GST. in d-f, B and F indicate Hposome-bound and -free proteins respectively; M = size markers. PI-3-P = phosphatidyl inositol-3-phosphate; PI-4-P = phosphatidyl inositol-4-phosphate; PI-5-P ~ phosphatidyl inositol-5-phosphate; PI = phosphatidyl inositol; PA = phosphatide acid; PS = phosphatidyl serine; PE = phosphatidyl ethanolamine; PC— phosphatidyl choline. No mutant proteins bound to PI-5-P, PI, PA, PS, PE or PC (not shown).
Figures 7A-C. Identification of host-targeting signals in fungal effectors
a, Particle bombardment cell re-entry assays of fungal effectors fused to Avrlb. N- terminal sequences of AvrL567, AvrM and AvrPi-ta (shown in b) were fused to the secretory leader (s) and C-terminal domain of Avrl b. AvrL567-Avr lb fusions lacking the secretory leader (m) or with mutations in the putative RxLR and dEER motif (rfyr- de-) were also assayed. Effector re-entry resulting in cell killing was measured by double-barreled particle bombardment in which parallel bombardments with a beta- glucuronidase (GUS) reporter gene, with and without the Avrl b fusion, were compared in the presence of resistance gene Rps l b (cultivar L77- 1 863) or in its absence (rps; cultivar Wil liams). Averages and standard errors shown are from 14- 1 6 pairs of bombardments . P values were calculated using the Wilcoxon rank sum test, b, N-terminal sequences of effectors tested in a, with RXLR-like motifs shaded and dEER-like moti fs underlined. The start of the Avr l b C-terminal domain used for all fusi ons is boxed. Three sequences containing potential moti fs from AvrPi-ta and one from AvrL567 were inserted into Avr l b in place o f the RFLR motif. Cell entry activity of each sequence is given as relative ablation. Ablation = [ 1 - (GUS+ spots on Rps l b)/(GUS+ spots on rps)] . Relative ablation = ablation of construct/ablation of wild-type Avrl b . In the seq uence al ignment, dashes indicate identi cal residues, periods i ndicate gaps in the alignment and *··* indicates Avr l b sequences.
Figu res 8A-F. Bi nding of P. falciparum effector fusion proteins to phosphoinositides a-c, Fi lter binding assays Mutant proteins did not bind to PI-5-P, Pi, PA, PS , PE or PC (not shown) except PfGBP(N)-GFP(pexel-) which bound weakly to P S. d-f, Binding of wi ld-type and mutant fusion proteins to PI-3-P or PI-4-P in liposomes; B and F indicate liposome-bound and -free proteins respectively; M = size markers .
Figu res 9A-D . Modulation o f effector entry i nto root cells by phosphoinosi tides a, Stimulation of Avrl b(N)-GFP entry by PI-4-P and inhibition by IP2. b, Stimulation of AvrL567(N)-GFP entry by PI-4-P and inhibition by IP2. c, Entry of Arg9-GFP is not stimulated by PI-4-P nor inhibited by IP2. In each case, 1 mg/m l protein was incubated with soybean root tips for 9 hr or 12 hr then washed and photographed. Either 250 μΜ di-octanoyl-PI-4-P or 500 μΜ IP2 was preincubated with the proteins for 30 min prior to exposure to the roots. Paired light micrographs and fluorescence optical sections are from the same root tips in each case. Lighting and photographic exposure were identical for all photographs, d, Inhibition of effector-binding to liposomes by IP2. Binding of Avrl b(N)-GFP, AvrL567(N)-GFP and Arg9-GFP to liposomes containing PI-4-P was measured in the presence or absence of 300 μΜ inositol 1 ,4 diphosphate ( 1 ,4IP2). Also, binding of Arg9-GFP to liposomes containing PI-3 -P was measured in the presence or absence of 300 μΜ inositol 1 ,3 diphosphate ( 1 ,3 IP2).
Figu res 10A-E. Effector entry into human cells and inhibition by inositol
diphosphates a-d, Cel ls of the human lung epithelial cell line A549 were incubated with the indicated fusion proteins (1 mg/ml) for 15 hr, in the presence or absence of 430 μΜ inosito l 1 ,3 diphosphate ( 1 ,3IP2), 440 μΜ inositol 1 ,4 diphosphate ( 1 ,4IP2) or 240 μΜ dioctanoyl-PI-4-P, then washed and photographed . Paired light micrographs and fluorescence optical sections are from the same cells in each case. Lighting and photographic exposure were identical for all photographs.
Figu res 1 1 A-B. Description of plasmi ds used in Example 1 .
Figu res 12A-B. Ol igonucleotides used for lasmid construction . Uppercase letters indicate bases that match the initial template. Lower case letters indi cate mutations or 5 ' extensions that do not match the initial template. Restricti on sites introduced into the amplicon are underl ined. A pipe (|) indicates the boundary between Avrl b- 1 sequences and fused sequences (Avh, GFP or P lasmodium RXLX motif) in the fusion oligonucleotides.
Figu res 1 3 A-F. Description of plasmids used in Example 2.
Figure 14A-F. Oligonucleotides used. Restriction sites are in bold. Mutations created by the primers are in lower case.
Figure 15. Binding of fungal effector proteins to phosphatidic acid shown in tabular form. Fi lter-binding assay were used to test which pol ar lipids were bound bind by the indicated fungal effector protei ns. The N-terminus of each fungal effector
(documented in the sequence list) was fused to GFP, the fusi on proteins were puri fied from E. coli, and then tested for binding to the same polar lipids as documented in Figure 6. Mutant proteins contained amino acid substitutions in the motifs listed in the row above (A = alanine; S = serine). All the wild-type proteins listed bound phosphatidic acid, but none of the mutants did.
Figu re 16A-D. Effectors from non-haustorial fungal pathogens enter vi a RXLR- mediated P1-3-P binding. A. N-terminus of AvrLm6 (SEQ ID NO: 3 1 9) showing functional and non-functional RXLR motifs. 1 mg/mL GFP fusion proteins were incubated with soybean root cells for 12 hr then washed for 2 hr. B . N-terminus of Avr2 (SEQ ID NO : 326) showing functional and non-functional RXLR motifs. 1 mg/mL GFP fusion proteins were incubated with soybean root cells for 12 hr then washed for 2 hr. C. Bi nding of AvrLm6-GFP to lipids in filter- (l eft) and Hposome- (right) binding assays. D. Binding of Avr2-GFP to lipids in fi lter- (left) and liposome- (right) binding assays. In both C and D lipids are: PI phosphatidyl (ptd)-inositol ; C I P = cerami de- 1 phosphate; LPA = lysophosphatidic acid; PA = phosphatidic acid; PS = ptd-serine; PE = ptd-ethanolamine; PC = ptd-choline. In the liposome assays (right panels), B = bound; F = free; M = markers .
Figu re 1 7A and B . Binding of three fungal effectors to phosphoinositides. A. N- terminal seq uences of effector-like proteins Af2 from Aspergillus fumigatus (AO; XP752996. 1 ), CNg2 from Cryptococcus neoform ans (Cng2 ; AAW43853. 1 ) and AvrLm4/7 from Leptosphaeria maculans. Candi date RXLR-like motifs are boxed. B . Sequences shown in A were fused to GFP and the expressed proteins tested for l ipi d bindi ng using filter-b inding assays as described in Figure 16D.
Figu re 18A-D. P I-3 -P is located on the surface of root cells and epithelial cells, but not erythrocytes A. Bi nding of biosensors to phosphoinositides in filter assays, as described for Figure 1 6. B. Binding of biosensors to root cel ls . Fusion proteins were incub ated with soybean root cell s for 12 hr then washed for 2 hr. Pairs of fluorescence and light micrographs are shown. Bars = 50 μΜ or 100 μΜ. C . Binding of biosensors to epithelial cells. Fusion proteins were incubated with cells for 2 hr then washed for 30 min. Pairs of fluorescence micrographs and fluorescence/l ight overlays are shown . Bars = 10 μΜ. D. Bi nding of biosensors to human erythrocytes. Fusion proteins were incubated with cells for 2 hr then washed for 30 min . Two independent fluorescence/li ght overlays are shown. Bars = 20 μΜ . Figure 19. Mutations of the Avr b peptide (SEQ ID NO: 305) containing the RXLR moti f assayed usi ng the double barrel particle bombardment assay. Cell entry activity measured as cell death in the presence of Rps b relative to wild-type Avr l b. Dashes indicate identical residues; · · · · indicates Avrl b sequences.
Figure 20A-C. PI-3-P binding proteins and inositol diphosphate b lock effector entry A. Blocking binding of effector-GFP fusions into root cells. Fusion proteins were incubated wi th soybean root cells for 12 hr then washed for 2 hr. Inositol 1 ,4 diphosphate (500 μΜ) was preincubated with the fusion proteins for 30 min. 5 mg/ml VAMp7 PX proteins was preincubated with the roots for 2 hr. Pairs of fluorescence and light micrographs are shown. Bars = 100 μΜ . B . Binding of biosensors to epithelial cells. Fusion proteins were incubated with cells for 2 hr then washed for 30 min. Inositol 1 ,4 diphosphate (500 μΜ) was preincubated with the fusion proteins for 30 min. 5 mg/ml VAMp7 PX proteins was preincubated with the cells for 2 hr.
Overlays of fluorescence and light micrographs are shown. Bars = 10 μΜ. C. Full- length Avrl k protein, with or without the RXLR mutation, was produced in E. coli. 0.25 mg/mL protein was infi ltrated into the primary unifoliate leaves of 13 day o ld seedlings of cultivars Williams (no rps gene) or Wi lli ams 82 (Rps l k) . Where indicated, the protein was co-infiitrated with 500 χΜ 1 ,3 IP2. The plants leaves were photographed 5 days after infi ltration.
DETAILED DESCRIPTION
Sinc e many resistance genes against oomycetes encode intracellular proteins, and since several cognate oomycete avirulence genes encode secreted proteins, it has been inferred that there must be a mechanism for translocating the avirulence protei ns into the plant cells . Since the RxLR and dEER motifs were first identi fied during the Phytophthora genome sequence annotation, there has been extensive speculation that these moti fs are i nvolved in transporting avirulence proteins into host cells .
Importantly, proteins in this fami ly use the N-terminal motifs RxLR and dEER to cross the host plasm a cell membrane autonomously, i.e. no other proteins are necessary to effect thi s translocation. Once inside the host cell, the proteins suppress host defense signal ing. The importance of this effector family i s underlined by the fact that plants have evolved intracellular defense receptors to detect the effectors and trigger a rapid counter-attack.
The present invention establishes that effectors of fungal plant pathogens contain virulence motifs with consensus sequence BXZ, where B is R, K or H; X is any amino acid and may be absent; and Z is a hydrophobic amino acid, generally L, M, I, W, Y or F. The sequence BXZ represents three contiguous amino acids, or two contiguous amino acids is X is absent. The BXZ family of motifs includes exemplary motifs such as RxLR (which may function with a dEER motif, an exemplary RxLR moti f being RSLR) and related functional variants thereof (e.g. RRLLR, RRFLR), as wel l as exemplary motifs RFYR, RYWT, RIYER, etc). The virulence motifs are responsible for bin ding of the pathogen effector proteins to polar lipids (e. g.
phosphatidyl-inositol-3- phosphate (PI-3-P) and/or phosphatidyl-inositol-4-phosphate (PI-4-P) and/or phosphatidic acid) at or near the surface of a host cell . Stimulation of host cel l entry by, for example, PI-4-P, and inhibition by inositol 1 , 4 diphosphate suggests that the binding of effectors to polar lipids (such as phosphoinosi tides, phospholipids and sphi ngolipids) medi ates cell entry of the effectors . Al l effectors that were tested could also enter human cells, suggesting that this mode of effector entry may be very widespread in plant and animal (inc luding human) pathogenesis, incl uding that which util izes the Plasmodium Pexel ("P") motif. Identification of thi s broad spectrum of effectors containing virulence motifs thereof constitutes a novel target class, and raises the possibility of targeted blockade of pathogen effector proteins. Thi s knowledge can be exploited to develop new classes of antibiotic treatments to prevent a wide variety o f pathogenic fungal, Plasmodial and oomycete infections in plants and animals .
The i nvention also identifies the sequence requirements for the function of the virulence motifs and/or domains. With respect to the BXZ motif, it has been determined that general l y only the presence of arginine, lysine or histidine at the fi rst positi on and the presence of leucine, isoleucine, methionine, tyrosine, phenylalanine or tryptophan at the third position are required to enable function. However, in some embodiments, methionine or leucine at the second position may allow function if none of leucine, isol eucine, methionine, tyrosine, phenylalanine or tryptophan are present at the third position. In some embodiments, the sequences flanking the motifs are required for function. As used herein the term "domain", in some embodiments, refers to a region or regions of the primary sequence of an effector protein containing more than one virulence motif, e .g. both the RxLR and dEER moti fs, or one or more analogous virulence motifs as described herein. The sequence requirements can be defined by a hidden m arkov m odel . For example, mutational analysis of the RxLR motif shows that, in some embodiments, the requirement for the first and third positions are quite strict. Furthermore, reversing the order of residues 1 and 2 or of 3 and 4 also abolishes activity, i ndicating that the mere presence of positive charge and hydrophobi ci ty within the motif are insufficient. The arginine at position 4 is more flexible and can be replaced by lysine or glutam ine. Naturally occurring functional variants of RxLR include lysine, histidine, threonine, glycine and alanine at the fourth position.
As a result of these findings, the invention provides methods to inhibit the entry, into a host cel l, of effector proteins expressed by pathogens and containing the virulence motifs. The method is carried out by blocking the interaction, for ex ample, by the binding o f the motifs to a natural ligand such as a polar lipid, exemplified by phospho lipids (e.g. phosphoinositides) and/or sphigolipids . Blocking may be accomplished by any of several means, for example, by exposing one or more virulence motifs to one or more molecules or molecular species which are capable of binding to or otherwise interacting with the virulence motifs, thus preventing the polar lipid (e.g. phosphoi nositide, phospholipid or sphingolipid) from binding to the virulence motif. Herein, mo lecular species such as phosphoinositides, phospholipids and/or sphigolipids which, in nature, bind to one or more motifs of an effector molecule as described herein, causing the effector protein to translocate into the targeted host cell, may be referred to as "natural molecules" or "natural ligands" of the motif. Conversely, the motifs disclosed herein may be considered "natural l igands" of the polar lipids to which they bind. These designations distinguish them from the blocking molecules of the invention, which are added exogenously to cells and used to prevent binding o f the natural ligands to the motifs, thereby preventing translocation of the effector protein into the cell . The blocking molecules may or may not be molecules that occur in nature, but if they are, then when used in the present invention, they are i solated or substantially purified, or chemically synthesized.
Blocking molecules of choice include but are not lim ited to lipid-derived molecules which bind to the motif but not in a manner that results in entry of the effector protein into the cell, e.g. molecules that are sterically related to natural ligands but which do not comprise all requisi te properties for enabling translocation of the effector. In other embodi ments, the blocking molecules are inositol or i nositol derivatives (e. g. various phosphorylated inositols such as inosito l monophosphate, various inositol diphosphates such as inositol 1 , 4 diphosphate, and other similar molecules); or peptides that bind to the moti f and block access to the motif by natural ligands; or pepti des that bind to the motif and target the effector for protease degradati on; or peptides that bind to the motif and anchor the effector to an external structure such as a cell wall or cell matrix such that the effector cannot enter the cell ; or molecules that bind to the moti f and cause chemical modification of the effector so that it can no longer enter cells ; or other "small molecule" compounds that possess the geometric and charge requisites for binding to one or more of the motifs, thereby blocki ng the binding of the natural ligand that is responsible for effector translocation.
In one embodiment of the invention, the blocking molecule is a peptide, in parti cular a peptide with an amino acid primary sequence that is designed to include amino ac id residues with charges suitable for interacting with and/or binding to the charged res idues of the moti f. In such a peptide, the amino acid sequence is designed so that charged atoms or groups (especially of the side chains) are spatially arranged in a manner that allows, for example, negatively charged side chains to be within bonding distance of positi vely charged side chains of e.g. R residues of the moti f, or for aliphatic side chains of the peptide to interact with aliphati c side chains of the motif, etc. Approaches to synthetic peptide design are described, for example, by Devlin et al. (Devlin, J . J., Panganiban, L.C. and Devlin, P.E. ( 1 990) Random peptide libraries : a source o f specific protein binding molecules. Science, 249, 404-406) and Scott and Sm i th (Scott, J .K. and Smith, G.P. (1990) Searching for peptide ligands with an epitope library. Science, 249, 386-390). Such peptides may be designed to be stable by e. g. by avoiding the use of known protease cleavage sites in the sequence; by introducing various non-natural amino acids; or by various mod i fications to amino acids (e. g. am idation, sul fonation, etc.) that increase the stability of the molecule, so long a such modifications do not interfere with binding to the effector motif.
The binding or interaction of the blocking molecule(s) may be of any suitable type, and wi ll, depend on the nature of the blocking molecule. For example, the bind ing may be covalent and hence essentially irreversibl e. Thus, in some
embodiments of the invention, the blocking molecule is one that, upon contact with one or more chemically reactive functi onal groups of the motif or polar lipid, forms a covalent bond wi th the one or more functional groups that participate in binding, or with functional groups of adj acent portions of the molecule (e.g. adjacent residues of and effector p rotein) in a manner that blocks access to the motif (e.g. by phospholipids and/or sphingolipids that are natural ligands of the moti f) and/or to the polar lipid, which would otherwise permit translocation of the effector into the host cell that the pathogen is trying to infect. Usually, however, the binding is non-covalent and comprises, for ex ample, electrostatic and/or charge interacti ons, hydrophobic i nteractions, van der Waal s interactions, etc . For a blocking molecule to be effective, a Kd better than ten-fold less than the concentration of the competing natural Hgand (polar lipid or motif) in the region of the host membrane i s preferred (a lower Kd indicates ti ghter binding). In this manner, binding of the natural Hgand is prevented or at least attenuated or slowed so as to render the natural ligands ineffective i n enabling the effector molecule to enter the targeted host cell, and infection of the host by the pathogen which manufactured the effector molecule is prevented, or attenuated or slowed. Those of skill in the art will recognize that much benefit can accrue from a treatment that inhibits a pathogen, even if inhibition is not absolute, but merely attenuates or slows the symptoms of infection, "inhibition" or "prevention of infection" as used herein is intended to encompass all such degrees of inhibition. blocking, etc . In addition, in the case of plants, the overall biomass of harvested plants or plant products, and therefore the usefulness of the crop, may be advantageously increased even i f some plants remain affected by the pathogen after treatment as described herein.
"Motifs" to which natural Iigand binding is blocked include BXZ moti fs as described herein, as well as RxLR moti fs, dEER motifs, the Pexel motif, and the RYWT, RIYER, RSLR, RRLLR, RRFLR, and RFYR moti fs. Those of skill in the art wi l l recognize that many effector proteins contain both an RxLR moti f and a dEER moti f, or one or more virulence motifs as described herei n. According to the inventi on, in one embodiment, the binding of a blocking mo lecule (which in some embodiments may be a natural ligand such as a phospholipid or sphingolipid) to one or more (e. g. either one or the other, or both, of the RxLR and dEER moti fs) is blocked, and blocking occurs in a manner that prevents the effector protein that bears the moti f(s) from entering the host cel l. In another embodiment, the binding of a natural ligand to a Pexel moti f is blocked, and blocking occurs i n a m anner that prevents the effector protein that bears the motif from entering a host cell. In another embodiment, the bi nding of a natural ligand to a RYWT, RIYER, RS LR, RRLLR, RRFLR, and/or RFYR moti f is blocked, and blocking occurs i n a manner that prevents the effector protei n that bears the moti f from entering a host cell . In some
embodiments, the b locking molecule binds to or interacts directly with residues of one or more of the virulence moti fs, i f two or more virulence motifs are present in an effector. However, thi s need not always be the case, as binding to a single moti f may be sufficient. In other embodiments, the blocking mo lecule (or molecules) binds to or i nteracts with adj acent residues. "Adjacent residues" may, but need not necessari ly be, adjacent in primary sequence to the motif. They may also be in proximity due to the secondary or terti ary structure of the effector molecule. For example, in one embodiment, the effector protein compri ses an RXLR motif fol lowed by at least one aspartate or one glutam ate resi due wi thin a 60 amino aci d carboxy terminal flanking sequence. In other words, within the effector protein, the sequence which is attached directly to the carboxy terminus of the RxLR motif (which, in primary sequence, follows immediately after the carboxyl terminal R of the moti f) contains at least one aspartate residue and/or at least one glutamate residue within the first 60 amino acids of the sequence.
In addition, the RxLR motifs that are targeted for blocking by the methods of the invention include but are not limited to those which compri se at least one of a two or three am ino acid sequence selected from the group consisting of: arginine, any amino acid, leucine; histidine, any amino acid, leucine; lysine, any amino acid, leucine; arginine, any amino acid, isoleucine; histidine, any amino acid, isoleuciiie; lysine, any amino acid, isoleucine; arginine, any amino acid, methionine; histidine, any ami no acid, methionine; lysine, any amino acid, methionine; arginine, any amino acid, tyrosine ; histidine, any amino acid, tyrosine; lysine, any amino acid, tyrosine; argin i ne, any amino aci d, phenylalani ne; histidine, any amino acid, phenylalanine; lysine, any amino acid, phenylalanine; arginine, any amino acid, tryptophan; histidine, any amino acid, tryptophan; lysine, any amino acid, tryptophan; arginine, any amino acid, val ine; histidine, any amino acid, valine; lysine, any amino acid, valine;
arginine, leucine; histidine, leucine; lysine, leucine ; argi nine, isoleucine; h istidine, isoleucine; lysi ne, isoleucine; arginine, methionine; histidine, methionine; lysine, methionine ; argi nine, tyrosine; hi stidine, tyrosine; lysine, tyrosine; arginine, phenylal anine; histi dine, phenylalanine; lysine, phenylalanine; arginine, tryptophan; histidine, tryptophan; lysine, tryptophan; arginine, valine; histi dine, valine; and lysine, val i ne. In some embodiments, the R of the RxLR moti f is preceded by R, i .e. the motif is RRxLR, with "x" being any amino acid, or in particular L or F. These p articular sequence may be represented by standard conventions using the single letter abbreviation for the amino acid and an "x" for the variable residue, e.g. as RXL for "arginine, any amino acid, leucine".
In addition, blocking may be accomplished by exposing one or more of the pol ar lipids to which the motifs bind (i.e. "target lipids") to one or more molecules or mol ecular species which are capable of binding to or otherwise interacting with the targeted polar lipid, thus preventing the motif (and hence the effector molecule) from binding to the polar lipid. In this embodiment, blocking molecules include but are not limited to : peptides, proteins, and other molecules which bind the polar lipid(s), for example, peptide mimetics of one or more effector motifs, small molecules or drugs which bind the polar lipids, v arious charged species which bind to the polar lipids, etc . The blocking mo lecul e may bind to the natural target lipid (e.g. phosphoinositide, phospholipid, sphingolipid or other polar lipid) in order to block the binding of the effector to its target. In one embodiment the blocking molecule may be a naturally occurring protein that binds to the target lipid, such as a protein containing, for example, a C I , C2, PH, FYVE, PX, ENTH, ANTH, BAR, FERM, PDZ, and tubby domains (Stahelin, R.V. (2009). Lipid binding domains : more than simple lipid effectors. .! Lipid Res 50 Suppl , S299-304) . in another embodiment, the blocking molecule may be a peptide with an amino acid primary sequence that is designed to include amino acid residues with charges suitable for interacting with and/or binding to the target phosphoinosi tide, phospholipid or sphingolipid. In yet another
embodiment, the blocki ng molecule may be a polypeptide (e.g. a peptide, polypepti de, etc.) which includes one or more moti f sequences and/or is a mimeti c of one or more moti f sequ ences. B locking molecules that target the polar lipid li gands of the motif may bind to any portion of the lipid that prevents effector binding, or even to adj acent molecules or cellular components that sterically interfere with motif-lipid binding.
The host cells that are protected from effector protein invasion include m any species of plant and animal cells, including human cel ls . Examples of plant cel ls that can benefit from the practice of the invention include but are not limited to: wheat, maize, rice, sorghum, barley, oats, millet, soybean , common bean (e. g. Phaseolus speci es), green pea (Pisum speci es), cowpea, chickpea, alfalfa, clover, tom ato, potato , tobacco, pepper, egg plant, grape, strawberry, raspberry, cranberry, blueberry, blackberry, hops, walnut, apple, peach, pl um, pistachio, apricot, almond, pear, avocado, cacao, coffee, tea, pineapple, passionfruit, coconut, date and oil palm, citrus, safflower, carrot, sesame, common bean, banana, citrus (e.g. orange, lemon, grapefrui t), papaya, macadamia, guava, pomegranate, pecan, Brassica species (canola, cabbage, caulifl ower, mu stard etc), cucurbits (pumpkin, cantaloupe, squash, zucchini , m elons etc), cotton, sugar cane, sugar beets, sunflower, lettuce, onion, garlic, ornamental cut flowers, grasses used in lawns, athletic fields, golf courses and pastures (e.g. Festuca , Lolium , Zoysia, Agrostis, Cynodon, Dactylis, Phleum,
Phalaris, Poa, Bromua and Agropyron species) , etc.
Examples of animal cells that may benefit from the practice of the invention include but are not limited to : h umans, cattle, sheep, pigs, goats, horses, cats, dogs, chickens, turkeys, bees, salmon, trout, bass, catfish, shell fish, crayfish, lobsters, shrimp, crabs, etc .
Many types of invasive pathogens may be targeted and their effector proteins prevented from entering host cel ls by the methods of the invention. Examples of such pathogens include but are not limited to: any Phytophthora species, e.g. Phylophthora infestans, Phytophthora sojae, Phytophthora ramorutn , Phytophthora parasitica, Phytophthora capsici, Phytophthora nicotianae, Phytophthora cinnamomi,
Phytophthora cryptogea, Phytophthora drechsleri, Phytophthora cactoruin,
Phytophthora cambivora, Phytophthora citrophthora, Phytophthora citricola, Phytophthora megasperma, Phytophthora palmivora, Phytoph thora megakarya, Phytophthora boehmeriae, Phytophthora kemoviae, Phytophthora erythroseptica, Phytophthora fragariae, Phytophthora heveae, Phytophthora lateralis, Phytophthora syringae; any Pyth ium species, e. g. Pythium ultimum , Pythium aphan idermatum, Pythium irregulare, Pythium graininicola, Pythium arrhenomanes, Pythium
insidiosum ; any downy mildew species; any Peronospora species, e. g. Peronospora tabacina, Peronospora destructor, Peronospora sparsa , Peronospora viciae; any Bremia species, e.g. Bremia lactucae; any Plasmopora species, e.g. Plasmopora viticola, Plasmopara halstedii; any Pseudoperonospora species, e. g.
Pseudoperonospora cubensis, Pseudoperonospora humuli; any Sclerospora species e.g. Sclerospora graininicola; any Peronosclerospora species, e.g. Peronosclerospora philippinesis, Peronosclerospora sorgh i, Peronosclerospora sacchari; any
Sclerophthora species, e.g. Sclerophthora rayssiae, Sclerophthora macrospora; any A lbugo species, e.g. Albugo Candida; any Aphanomyces species, e.g. Aphanomyces cochlioides, Aphanomyces euteiches, Aphanomyces invadans; any Saprolegnia species, e. g. Saprolegn ia parasitica ; any Achlya species ; any rust fungi; any smut fungi; any bunt fungi ; any powdery mildew fungi ; any Puccinia species, Puccinia striiformis, Puccin ia graminis, Puccinia triticina (syn. Puccinia recondita), Puccinia sorghi, Puccinia schedonnardii, Puccinia cacabata; any Phakopsora species, e. g. Phakopsora pachyrhizi, Phakopsora gossypii; any Phoma species, e.g. Phoma glycinicola; any Ascochyta species, e.g. Ascochyta gossypii; any Cryphonectria species, e.g. Cryphonectria parasitica; any Magnaporthe species, e.g. Magnaporthe oryzae; any Gaeumannomyces species, e.g. Gaeumannomyces graminis; any
Synchytrium species, e.g. Synchytrium endobioticum; any Ustilago species, e.g.
Ustilago maydis, Ustilago tritici, Ustilaginoidea virens; any Tilletia species, e. g. Tilletia indica , Tilletia caries, Tilletia foetida, Tilletia barclayana; any Erysiphe species, e.g. Erysiphe necator (formerly Uncinula necator) ; any Blumeria speci es, e.g. Blumeria graminis; Podosphaera oxyacanthae; any Alternaria species, e.g. Alternaria alternatel y any Botrytis species, e.g. Botrytis cinerea; any Diaporthe species, e.g.
Diaporthe phaseo!orum ; any Fusarium species, e. g. Fusarium graminearum , Fusarium oxysporum (e.g. f. sp. lycopersici), Fusarium mon iliforme, Fusarium solani; any Leptosphaeria speci es, e.g. Leptosphaeria maculans, Leptosphaeria maydis; any Macrophomina species, e. g. Macrophomina phaseolina ; any Monilinia species, e.g. Monilinia fructicola ; any Mycosphaerella speci es, e.g. Mycosphaerella graminicola, Mycosphaerella fijiensis, Mycosphaerella tassiana, Mycosphaerella zeae-maydis; any Phialophora species, e.g. Ph ialophora gregata; any Phymatotrichopsis species, e.g. Phymaiotrichopsis omnivora; any Taphrina species, e.g. Taphrina deformans; any Aspergillus species, e.g. Aspergillus flavus, Aspergillus parasiticus, Aspergillus fumigatus; any Verticillium species, e. g. Verticillium dahliae, Verticillium albo-atrum, Rhizoctonia solani, Ophiostoma ulmi (syn. Ceratocystis ulmi), Ophiostoma novo-ulmi; any Septovia species, e.g. Septoria avenue; any Pyrenophora species, e.g.
Pyrenophora tritici-repentis; any Colletotrichum species, e. g. Colletotrichum graminicola; any Sclerotin ia species, e.g. Sclerotinia sclerotiorum ; any Sclerotium species, e. g Sclerotium rolfsii; any Thielaviopsis species, e. g Thielaviopsis basicola ; any Coccidioides species, e.g. Coccidioides immitus; any Paracoccidioides species, e.g. Paracoccidioides braziliensis; any Pneumocystis species, e. g. Pneumocystis carinii; any Histoplasma species, e.g. Histoplasma capsulatum; any Cryptococcus species, e. g. Cryptococcus neoformans; any Candida species, e.g. Candida albicans; any api complexan parasite species such as : any Plasmodium species, e.g. Plasmodium falciparum , Plasmodium vivax, Plasmodium ovale, Plasmodium malariae; any Babesia speci es, e.g. Babesia bovis, Babesia bigemina ; any Cryptosporidium species, e.g. Cryptosporidium parvum; any Toxoplasma species, e.g. Toxoplasma gondii; any Trypanosomatid species such as : any Trypanosoma species, e. g. Trypanosoma brucei, Trypanosoma cruzi, Trypanosoma congolense, Trypanosoma vivax; any Leishmania speci es, e. g. Leismania donovani. Any amebozoan parasites; any Entamoeba species, e.g. Entamoeba histolytica ; any Mas tigamoeba species; any Schistosoma species; any Onchocerca species; any Giardia species; any microsporidial species; any
Enterocytozoon species; any Encephalitozoon species, e.g. Encephalitozoon cuniculi, etc.
As a result of the practice of the methods o f the invention, entry of a pathogen effector protein into the host cell is prevented, inhibited, slowed, or otherwise decreased or lessened . As a result, the host cell can mount a robust or normal immune response to the pathogen, and infection of the host organism is averted (prevented), or the degree of infection (i .e. the deleterious symptoms that typically accompany the presence of an infection by the pathogen) are el i minated or decreased. Thus, some aspects of the invention also include methods of preventing or attenuating the symptoms of infection usually caused in a host organism by a patho gen which emp loys effector proteins comprising one or more virulence motifs as described herein to enter host cells. In some embodiments, the methods are used to prevent infection and/or symptoms of in fection . In other embodiments, infection may have already started but the methods of the invention can be used to curtai l the spread of the infection to other organisms, or to lessen the symptoms in an organism that is already afflicted. This is the case, in particular, with Plasmodium infections, where the methods o f the invention are especially useful in preventing the subsequent rounds of parasite multiplication after initial infection, or with other pathogens that multiply
logari thmically. In addition, the invention provides methods of maintaining a host cell ' s ability to mount an immune response to a pathogen, the pathogen being one that produces effector proteins that comprise one or more of the motifs described herein, and the method involving blocking the effector protein from entering the host cell by preventing the binding of its natural ligand .
The mode of admini stration of the blocking molecules of the invention wil l depend on several factors, including the nature of the molecul e and the host.
Generally, the blocking molecule will be in a composition or formulation suitable for administration. If the host organism is a plant, application is generally in the form of a foliar spray or watering solution of e.g. an aqueous or oil solution that includes the blocking molecule in a concentration suffici ent to block effector molecu les of pathogens wh i ch are likely to attack the plant. For admini stration to an animal, which may be a human, any suitable composition, many of which are known in the art, may be employed, e.g. various pi l ls, powders, liquids, inj ectable formulations, etc.
Likewise, any suitable means may be used, includi ng but not limited to by inj ection (e.g. subcutaneous or intramuscular), inhalation, orally, i ntranasally, by ingestion of a food product containing the protein, etc. In addition, the compositions may include one or more than one blocking molecule. For example, a preparation for application to plants may include mo lecules that block the effector proteins of one or of several different types of pathogen. In addition, the blocking molecules may be administered to plants in conjunction wi th other benefici al substances, such as fertil izers, various pesti ci des, growth factors, etc. The same is true for administration to animals, where on or more than one type of blocking molecule may be administered, and may be administered in conj unction with other benefici al substances such as chemotherapeutic agents that also have activity against the pathogen.
In some embodiments, a combination of blocking agents is utilized, e.g. two or more agents that act on or effect the effector protein, or two or more agents that acts on or effect the lipid, or a mixture of blocking agents, one or more of which acts on the effector protein, and one or more of which acts on the lipid.
In another aspect, the invention provides elucidation of the structural requirements of the virulence motifs (e.g. BXZ motifs, such as RXLR, RYWT, RIYER and related or similarly functioning motifs) in oomycetes, fungi, and other pathogens, and of the sequences which flank the motifs, thereby al lowing, for example, the design of molecules to bind the motif. As a result, the invention also provides methods to predict which genes in the genome of a pathogen are likely to encode effector mol ecul es. This is signi ficant because, as demonstrated herein, the mere presence of a sequence conforming to the XLR and dEER motif in a protein may not be sufficient to insure that the protein is an effector, i . e. that the protein is able to traverse the cell wall and enter the cell upon binding to phospholipids or sphingolipids. Functional virulence moti fs (or functional virulence domains) may have additional requirements, parti cularly in the flanking sequences, as described herein . In one embodiment, the invention describes a non-random distribution of amino acid residues in the regions flanking the RXLR motif, represented by a position-weight matrix. One method of predicting whether or not a gene encodes a true effector protein involves the use of a hidden markov model (HMM) based on the position-wei ght matrix. This method may also be applied to the analysis of other BXZ motifs.
The development of thi s aspect of the invention was based in the observation of di fferences in activity between two putative RXLR motifs, RXLR 1 and RXLR2, as described in detail in Example 1 below. The differences suggested that surrounding sequences are also important to the activity of an RXLR motif. To define the di fferences in the surrounding sequences a hidden markov model (HMM) was created using the 10 amino acid residues to the left and right of the RXLR motifs of all of known P. sojae and P. ramorum Avh genes. Using this HMM, the sequences surrounding RXLR2 (which was an authentic, functional motif) had a high score of 1 8.5 , representing an excellent match to the consensus flanking sequence, and very unlikely to have been found in a random sequence. In contrast, sequences surrounding RXLR 1 (a non-functional moti f) had a low, non-significant score o f 0.0. Using the same HMM, the sequences surrounding the RXLR motif of P. infestans Avr3a scored 1 0.9. Using a similar HMM derived from Hyaloperonospora parasitica Avh genes, the sequences surrounding the RXLR motifs of the H. parasitica Atrl and Atrl 3 proteins had scores of 9.8 and 6.3 respectively. These and other comparisons described in Example 1 , showed that HMM scores of zero, such as that of Avrl b RXLR1 , are characteristic of RXLR strings found at random, i. e. such sequences are not likely to represent true RXLR motifs . On the other hand, HMM scores over 5.0 are
characteristic of non-random occurrences of RXLR strings, and the proteins in which such non-random strings occur are likely to be authentic functional RXLR sequences . In other words, such sequences are likely, upon binding a phospholipid or
sphingolipid, to promote or allow the translocation, into a host cell , of effector (avirulence) proteins in which they are located or of which they form a part. HMM scores between 0 and 5 are equivocal and cannot be assigned to either category of protein (random RXLR strings vs authentic RXLR motifs). This methodology may also be applied to other virulence moti fs, e. g. RYWT, RIYER, etc .
For further discussions of the use of a hidden markov model, see United States patent 6, 128,587 to Sj olander (October 3, 2000) , the complete contents of which are hereby incorporated by reference.
The invention also provides a method for screening compounds to identify those that inhibit binding of phosphoinositides, phospholipids or sphingolipids (or other natural lipid ligands) to a BXZ moti f (e.g. to an RXLR moti f, and optional ly also to a dEER motif) in an effector protein, and which thus can inhibit translocation of effector proteins that have these motifs into cells. The method involves exposing a candidate or putative blocking compound to one or more BXZ vi rulence motifs (e.g. one or both of the RXLR and dEER moti fs, and/or one or both of RYWT and RIYER) under conditions suitable for binding of either the natural phospholipid/sphingolipid ligands or phosphoinositides to the motifs (phosphoinositides are known to be capable of such binding) . The screening is evaluated in that if the candi date compound is able to bind to one or more of the virulence motifs, and especially to two motifs when they are found to be present in a single effector (e.g. RXLR and dEER) then the compound is selected as a compound that wi ll inhibit binding of the natural ligands to the motifs in an effector protein, and prevent entry of the effector protein into a cell. This is especially the case if the blocking compound is able to competitively bind to the motif in the presence of a natural ligand. Alternatively, such screening methods may be adapted and used to identify blocking compounds which bind to or otherwi se interfere with the polar lipid to which the motif binds.
Blocking of effector-lipid binding may also be prevented or attenuated using genetic engineering/molecular biology techniques. S uch techniques may target one or both of the effector (e . g. the motif sequence) and the l ipid to which a motif binds. For example, host cells (e.g. in plants) may be genetically engineered to express inhibitory RNA (e.g. siRNA) that inhibits one or more enzymes involved in synthesis of a target lipid, or in transport of the lipid to the cell surface where it is accessible to the motif. Al ternatively, host cells may be genetically engineered to produce peptides or proteins which contain one or more moti fs, in a manner that promotes expression of the peptides/proteins and their binding to at least one target lipid. Other strategies will occur to those of skill in the art, and all such methods are encompassed by the invention.
The invention also provides methods for preventing pathogens from invading or infecting cells, by prophylactic al ly applying one or more of the blocki ng compounds described herei n to a substrate wi th whi ch a pathogen and a cell the pathogen might infect may come in contact. The method inhibits entry, into the cell, of a pathogenic effector protein (entry of the pathogenic effector protein requiring binding of at least one motif of the effector protein as described herein to at least one polar lipid of the cell) and comprises the step of contacting a substrate which contains or is likely to contain a pathogen comprising the pathogenic effector protein with a blocking compound as described herein. By "contacting" is meant applying, permeating, coating or otherwise placing the blocking compound on the substrate. The blocking compound i s capable of i) binding to at least one motif of the pathogenic effector protein ; or ii) binding to at least one pol ar lipid o f said cell (the polar lipid being the cellular ligand of the effector protein mot if). Binding of the blocking compound prevents entry of the pathogenic effector protein into said cell (and hence prevents infection of the cell by the pathogen), if the pathogen comes into contact with the substate. The blocking agent may be applied to the substrate by any suitable means, e .g. by spraying, painting, coating, etc., or even by manufacturing the substrate to contain the blocking agent (e.g. fabric), or by permeating or soaking the substrate with the blocking agent, etc . The substrate may be any suitable substrate that may be contacted by the pathogen, and which usually will be or may also come into contact with a cell which might be infected by the pathogen, or in some cases may be the cell or a collection of cel l s which may encounter or be exposed to the pathogen. Exemplary substrates include but are not limited to : pl ants (e.g. to leaves, fruit, roots, etc .) for example, by spraying or otherwise placing the blocking agent, sometimes, though not always, on an exterior surface of the plant (e.g. mature plants, plants "in the field", plants in green houses, seedlings, seeds, sprouts, etc.); fabrics (e. g. fabrics used for tents, mosqui to netting, clothing, etc.), water (e.g. bodies of water, swamps, pools of standing water, wel ls, dri nking water, etc .); skin, h air and/or fur, eyes, ear and nasal passages, the mouth, etc. , e. g. of an animal (e. g. mammals such as humans, or other mammals, and also repti les, fish, birds, etc. i . e. veterinary applications are also contemplated). For animal s, application may be external by the application of e.g. lotions, sprays, rinses, mists, drops, washes, (e. g. mouthwash), etc; (internal administration is also contemplated, as described above). The substrate may also be an insect, e.g. an i nsect that is known or suspected of carrying the pathogen which comprises the effector protein, or is capab le of synthesizing the effector protein.
The invention is further i llustrated by the following Examples, which should not be interpreted as li miting the invention in any way.
EXAMPLES
EXAMPLE 1 . RXLR-mediated entry of Phytophthora sojae effector Avrl b (SEQ ID NO : 2) into soybean cel ls does not require pathogen encoded machinery
Effector proteins secreted by oomycete and fungal p athogens have been inferred to enter host cel ls, where they interact with host resistance gene products. Usi ng the effector protein Avrl b of Phytophthora sojae, an oomycete pathogen of soybean , we show that a pair of sequence motifs, RXLR and dEER, plus surrounding sequences, (S EQ ID NO : 46) are both necessary and sufficient to deliver the protein into plant cells. Particle bombardment experiments demonstrate that these motifs function in the absence of the pathogen, indicating that no additional pathogen encoded machinery is required for effector protein entry into host cells. Furthermore, fusion of the Avrlb RXLR and dEER domain to green fluorescent protein (GFP) allows GFP to enter soybean root cells autonomously. The conclusion that RXLR and dEER serve to transduce oomycete effectors into host cells indicates that the more than 370 RXLR and dEER containing proteins encoded in the genome sequence of P. sojae are candidate effectors. We further show that the RXLR and dEER motifs can be replaced by the closely related erythrocyte targeting signals found in effector proteins of Plasmodium, the protozoan that causes malaria in humans. Mutational analysis of the RXLR motif shows that the required residues are very similar in the motifs of
Plasmodium and Phytophthora. Thus the machinery of the hosts (soybean and human) targeted by the effectors may be very ancient.
RXLR2 and dEER motifs of Avrlb are required for its virulence function in transgenic P. sojae lines
To test the function of the RXLR and dEER motifs of Avrlb, transgenic P. sojae strains that expressed either wild-type or mutant Avrlb-1 genes were created. Wild-type Avrlb contains two RXLR motifs, RXLR1 and RXLR2 (Figure 1A).
Mutations in either or both of the RXLR motifs (SEQ ID NO: 3,4,5), in addition to a mutation in the dEER motif (Figure 1A) (SEQ ID NO: 6), were created. The Avrlb-1 gene constructs were fused to a strong constitutive promoter, HAM34 (Judelson, FL, Tyler, B.M., and Michelmore, R.W.1991. Mol. Plant-Microbe Interact.4, 602-607,), and introduced into a strain, P7076, that expresses a variant Avrlb protein that does not confer avirulence against Rpslb-containing soybeans (Shan, W., Cao, M., Leung, D., and Tyler, B.M.2004. Mol. Plant-Microbe Interact.17, 394-403). Two
independent trans form ants (T17 and T20) expressing wild type Avrlb-1 (Figure IB, C) lost the ability to infect soybean plants carrying Rpslb, but were unaffected in their ability to infect plants lacking Rpslb (Figure IE, Table 1). This demonstrated that they had acquired avirulence against Rpslb as a result of a functional Avrlb gene product. This result was confirmed using two different pairs of isolines of soybean that differed only in the presence of Rpsl b, namely Williams (no Rps gene) with L77- 1863 (Rpslb; Williams background) and HARO(l-7)l (No Rps; Harosoy background) with HAR013 (Rpslb; Harosoy background) (Figure IE; Table 1).
In contrast, in five independent transformants expressing the RXLR2AAAA (SEQ ID NO 4) mutant, there was no gain of avirulence against Rpslb cultivars, despite the presence of abundant mRNA from the transgene (Figure IE, Table 1). Thus, the RXLR2 motif is necessary for Avrlb activity when the protein is delivered by the pathogen. Since the RXLR1 motif was intact in the RXLR2AAAA mutant, the motif appeared to be non-functional. Consistent with this inference, the RXLR1AAAA mutation (SEQ ID NO 3) did not abolish avirulence in three independent
transformants (Figure IE, Table 1). As expected, avirulence was lost in the
RXLR1AAAA, RXLR2AAAA double mutants (Figure IE, Table 1) (SEQ ID NO: 5). A mutation in the dEER motif (SEQ ID NO: 6) also abolished avirulence (in two independent transformants) indicating that this motif is also required for the function of the protein (Figure IE, Table 1).
Table 1. Molecular characterization and avirulence testing of P. sojae stable transformants
Strains Transgene Expression Transformant Avirulence pc
(PCR)a (RT-PCR)b Validation0 (Surviving
seedlings)11
Rpslb rps
P7076 (Gus)
GUS no no 1/23 1/22 0.77
P7076 (s Avrlb WT)
T17 yes yes Pst I 20/30 0/21 3.9 E-07
T20 yes yes Sequence 25/44 2/28 1.2 E-05 P7076 (sAvrlb RXLRl AAAA)
RXLRl -2 yes yes Pst I 32/36 3/20 5.0 E-08
RXLRl-3 yes yes Pst I 31/54 3/21 6.4 E-04
RXLRl -5 yes yes Pst I 37/57 7/23 5.1 E-03
P7076 (sAvrlb RXLR2AAAA)
RXLR2-18 yes yes Pst 1 6/44 3/17 0.48
RXLR2-20 yes yes Pst Γ 4/46 3/19 0.33
P7076 (sAvrJb RXLRl AAAA; RXLR2AAAA)
RXLR 1+2-4 yes yes Pst 5/31 2/16 0.55
RXLR1+2-6 yes yes Pst I 4/43 1/21 0.47
P7076 {sAvrlb dEERA6)
dEER-9 yes yes Sequence 4/59 2/23 0.79 dEER-14 yes yes Pst I 4/40 3/15 0.28
Ps Avr4/6-AvrlbCt
4/6-lb-3 yes yes size 15/24 3/11 0.057
4/6-lb-19 yes yes size 14/26 3/16 0.025
Hp 341-AvrlbCt
341-lb-I 3 yes yes size 16/19 0/11 6.6 E-06
341-1 b-17 yes yes size 23/24 0/7 3.0 E-06 mAvrlbCt
mAvrlbCt-4 yes yes size 3/20 3/16 0.77 mAvrlbCt-5 yes yes size 2/21 1/15 0.63 The presence of transgenes was verified by PCR as described in the Materials and Methods. + = transgene present; - = transgene not detected.
b Transgene expression was determined by qualitative RT-PCR (RT-PCR) and by quantitative RT-PCR (q-PCR) as described in the Materials and Methods. Yes = transgene transcripts present; no = transgene transcripts not detected; ND = not determined.
e The presence of the relevant mutation in the transforming plasmid was verified by sequencing in every case. The presence of the correct mutation within the transgenes of each transformed strain was verified after PCR amplification of the Avrlb-1 transgene by Pst I digestion or by sequencing in the case of the mutants (e.g. Figure 1) or by size in the case of the Avh gene fusions and N-terminal deletion (e.g. Figure 4). d The avirulence of each transgenic strain was tested by inoculation of seedlings containing Rpslb (L77-1863) or no rps gene (Williams), as described in the Materials and Methods. The number of surviving seedlings/total inoculated seedlings is shown, summed from all replicates
c Fisher's exact test (one tailed) was used to compare the frequency of seedling survival between rps and Rpslb plants. A significant p value (0.05) indicates that the transformant's phenotype is avirulent.
The difference in activity between RXLR1 (SEQ ID NO: 3) and RXLR2 (SEQ ID NO: 4) suggests that surrounding sequences are important to the activity of an RXLR motif. To define the differences in the surrounding sequences a hidden markov model (HMM) was created using the 10 amino acid residues to the left and right of the RXLR motifs of all of the P. sojae and P. ramorum Avh genes (Tyler et al., 2006; Jiang et al., 2008). Using this HMM, the sequences surrounding RXLR2 (SEQ ID NO: 5) had a high score of 18.5, representing an excellent match to the consensus flanking sequence, very unlikely to have been found in a random sequence. In contrast, sequences surrounding RXLR1 (SEQ ID NO: 3) had a low, non-significant score of 0.0. Using the same HMM, the sequences surrounding the RXLR motif of P. infestans Avr3a scored 1 0.9. Using a similar HMM derived from Hyaloperonospora parasitica Avh genes, the sequences surrounding the RXLR motifs of the H. parasitica Atr l and Atr l 3 proteins had scores of 9.8 and 6.3 respectively.
To establish the signi ficance of these HMM scores, the Phytophthora HMM was used to score the RXLR moti fs of 1240 RXLR-containing sequences identi fied from a pool of all putative secreted P. sojae and P. ramorum proteins by Jiang et al. (2008). As a control, 639 RXLR-containing sequences were scored found after permuting the sequences of all the putative secreted P. sojae and P. ramorum proteins (Jiang et al. , 2008) . As shown in Figure I D, the RXLR strings of 698 (56%) o f the 1240 real proteins had an HMM score of zero, whi le the RXLR strings of 595 (93%) of the permuted proteins had a zero score, and only 1 3 ( 1.8 %) scored above 5.0. I contrast, of 765 proteins that Jiang et at. (2008) identified as high quality candidate effectors, only 1 8% had an HMM score of zero, and 543 (72%) had a score over 5.0. From this comparison we conclude that HMM scores of zero, such as that of Avr lb RXLR 1 (SEQ ID NO : 3 ), are characteristic o f RXLR strings found at random , while scores over 5.0 are characteristic of non-random occurrences of RXLR strings and of the RXLR strings of functional avirulence proteins. HMM scores between 0 and 5 are equivocal . The curated Avh genes with a score of zero may represent pseudogenes as many of them were identifi ed principally by C-terminal sequence similarity.
The interaction between A vrl b and the Rpsl b gene product occurs within host cells and does not require the RXLR and dEER motifs
To confi rm that the site o f interaction of Avrlb with the Rps l b gene product is within the plant cell, particle bombardment was used to introduce DNA encoding Avr l b proteins lacking a secretory leader into soybean cells together wi th DNA encoding β-gliiciironi dase (GUS). This assay measures the functional interaction of the Avrlb protein with the intracellular product of the soybean Rps l b gene; when the two proteins interact, programmed cell death is triggered in the transformed cells ablating the development of tissue patches expressing GUS . Since the Avrl b protein lacks its normal secretory leader, the protein should be synthesized in the plant cytoplasm. To facilitate the comparison of test and control bombardments, a novel double-barreled attachment for the Bio-Rad Gene Gun was utilized (Dou et al., 2008). The gun shooting two different DNA samples side-by-side into a leaf in the same shot, which greatly improves the reproducibility of the results (Dou et al., 2008). Figure 2 shows that delivery of DNA encoding leader-less Avrlb protein (SEQ ID NO: 19) into soybean cells significantly reduced the number of blue GUS-positive patches when the Rpslb gene was present, but not when Rpslb was absent (Figure 2A). This is consistent with a cytoplasmic location for the Avrlb-Rpslb interaction. When RXLR2 or dEER motifs were replaced by four or six alanine residues, respectively [Figure 2A, mAvrlb(RXLR2AAAA) (SEQ ID NO: 20) and mAvrlb(dEERA6)( SEQ ID NO: 23)], the interaction of the cytoplasmic, leader-less Avrlb with Rpslb was unaffected (Figure 2A), indicating that the RXLR2 and dEER motifs were not required for the interaction. RXLR-mediated transit into soybean cells does not require the pathogen
To test whether RXLR function requires the presence of the pathogen, the bombardment assay was used to determine the effect of the RXLR2AAAA mutation on secreted Avrlb protein (SEQ ID NO: 18). When soybean cells were bombarded with DNA encoding wild type Avrlb (SEQ ID NO: 22), including its normal secretory leader, a reduction in GUS-positive blue spots was observed comparable to that observed for the non-secreted protein [Figure 2, sAvrlb(WT)]. However when the RXLR2AAAA (SEQ ID NO: 28)or dEERA6 (SEQ ID NO: 29) mutations were present in the bombarded DNA, there was no reduction in the number of blue spots [Figure 2, sAvrl b(RXLR2AAAA) (SEQ ID NO: 11) and sAvrlb(dEERA6) (SEQ ID NO: 13)]. From these results it may be inferred first that the secretory leader is functional in soybean and targets Avrlb protein to the outside of the cell; second, that the RXLR2 (but not RXLR1) and dEER motifs are required for Avrlb protein to re-enter the cell, which confirms the conclusion from the P. sojae transformation experiments. Importantly, the results also show that RXLR-dEER-mediated entry does not require the presence of the pathogen.
To support the inference that the secretory leader of Avrlb was correctly exporting the protein from the plant cells in the bombardment assay, a gene encoding Aequorea coerulescens green fluorescent protein (acGFP; "GFP" herein) fused either to the Avr l b leader (SEQ ID NO : 27) or to full-length Avr l b (SEQ ID NO: 25) was constructed . These fusions enabled tracking of the proteins and checking their stability. To aid in visualization onion bulb epidermal cells were used rather than soybean cells. GFP was exported from the cells and accumulated in the apoplast when the secretory leader was attached to GFP but accumulated in the cytoplasm and nucleus when the leader was not attached (not shown). When full length Avrlb was fused to GFP (SEQ ID NO: 25), the proteins also accumul ated in the apoplast if a mutation was present in either the RXLR2 motif (SEQ ID No : 28) or in the dEER moti f (SEQ ID No : 29). This observation confirmed that the protein encoded by these mutants was stable and correctly targeted outside of the cells. When cells expressing Avrl b-GFP fusi on proteins with RXLR mutati ons were p lasmolyzed by treatment with 0.8M mannitol for 1 5 min, the GFP was associated with the cell wall and not with the plasma cell membrane (not shown). Furthermore, GFP protein could be seen diffusing into the apoplast between pairs of neighboring cells not shown). Similar observations were made when cell s expressing secreted GFP or Avrl b-GFP fusion proteins with a dEER mutation were plasmolyzed (not shown). If the RXLR2 and dEER motifs were intact however, the sAvr l b-GFP protein fusion accumulated in the cytoplasm and nucleus of the cells, similar to the mAvr l b-GFP (SEQ ID NO: 24) fusion lacking the leader. When cells expressing sAvr lb-GFP fusion proteins were plasmolyzed by treatment with 0.8M mannitol for 1 5 min, the GFP cou ld be observed to have either fully or partially returned to the inside of the cells. These results supported our conclusion that the RXLR2 and dEER motifs act together to enable Avr l b protein to re-enter the p lant cell s.
The A vrlb RXLR and dEER motifs are sufficient to target GFP to soybean cells
The RXLR and dEER region of Avrl b was fused to GFP (SEQ ID NO: 46), and the fusion protein was synthesized in E. coli and partial ly purified. Root tips of soyb ean seedlings were incubated with the isolated fusion protein for 12 hours, washed for four hours in water, then observed under light and UV microscopy to l ocalize the GFP. GFP accumulated inside many of the root cells, whereas buffer alone did not produce any fluorescence. The optical sections produced by the confocal microscope revealed that the protein penetrated approximately 10 cell layers deep during the 1 2 hour incubation. The characteristic accumulati on of GFP in the nuclei of the treated cells i s comparable to the pattern observed when GFP is expressed in planta, and verifies that the GFP is located inside the cells. The nuclear localization of the protein also indicates that the cells are alive. If mutations were present in the RXLR or dEER motifs of the fusion protein, GFP did not accumulate inside the soybean root cells. When the RXLR and dEER region was replaced by the artificial protein transduction motif Arg9 (SEQ ID NO : 1 1 2), GFP once again entered the soybean root cells and accumulated in the nuclei .
Av l b RXLR and dEE motifs can be replaced by RXLR and dEER-containing protein sequences encoded by bioinformatically identified Avh genes
To determine if the RXLR and dEER motifs of bioinformati cally identified Avh genes could functional ly replace the RXLR2 and dEER motifs of Avrl b- 1 , full length Avh genes from P. sojae and H. parasitica were fused to an Avrl b- 1 N-terminal deletion mutant lacking the RXLR and dEER motifs. The fusion genes were then introduced into P. sojae and the transformants were tested for avirulence on Rps l b- containing soybean cultivars. Both Avh genes, P. sojae Avh l 71 (sinc e identified as Avi-4/ό ; Dou et al . , 2008) (SEQ ID NO: 8) and H. parasitica Avh341 (SEQ ID NO: 7), could replace the requirement for the RXLR2 and dEER motifs as j udged by the avirulence of the transformants on Rps l b-containing cultivars, whereas transformants containing only the C-terminus of Avrl b fused to an initiator methionine remained virulent (Figure 3 and Table 1 ). This result indicates that the RXLR and dEER motifs form a distinct transferable functional domain of Avr l b and other Avh proteins . The HMM scores of the RXLR-dEER moti fs of Ps Avr4/6 and Hp Avh341 are both well within the functional range (6.9 and 14.2, respectively).
The A vrl b host targeting signal can be functionally replaced by autonomous protein transduction motifs
Protein transduction domains (PTDs) cap able of autonomously carrying proteins across plasma cell membranes have been described and characterized in the HIV-1 Tat protein. Arginine-rich peptides such as Arg9 can also carry out this function. To compare RXLR and dEER mediated effector delivery with the function of PTDs, the RXLR2 motif of Avrlb was replaced with the TAT PTD (SEQ ID NO: 42) or with Arg9 (Figure 4A) (SEQ ID NO: 41). The resultant proteins were treated using the particle bombardment assay, and both PTDs could functionally replace the RXLR2 motif of Avrlb, restoring the avirulence reaction of Avrlb with Rpslb (Figure 4B). Furthermore, when the version of secreted Avrlb that contained the Arg9 sequence in place of the RXLR2 motif was fused to GFP (SEQ ID NO: 30), the fusion protein accumulated in the cytoplasm and the nucleus of bombarded onion bulb cells rather than the apoplast, confirming that Arg9 could functionally replace RXLR2 (not shown). Similar results were obtained when the version of secreted Avrlb that contained the TAT PTD was fused in place of the RXLR2 motif to GFP (SEQ ID NO: 31). Finally, when Arg9 was fused to GFP (SEQ ID NO: 112), the isolated proteins could enter soybean root cells directly (not shown).
The Avrlb host targeting signal is interchangeable with host targeting signals from Plasmodium effectors
To test if the erythrocyte targeting signals of Plasmodium effector proteins could functionally replace the RXLR and dEER region of Avrlb, the residues of Avrlb from the end of the secretory leader to the end of the dEER motif were replaced with the mature N-termini of three different Plasmodium effector proteins that are targeted to the erythrocyte cytoplasm, namely PfGBP-130 (SEQ ID NO: 121), PfHRPII (SEQ ID NO: 123) and PfPFE1615c (SEQ ID NO: 125) (Bhattacharjee, S., Hiller, N.L., Liolios, K., Win, J., Kanneganti, T.D., Young, C, Kamoun, S., and Haldar, K. 2006, PLoS Pathog 2, e50.). The entire 37-41 amino acid region of each Plasmodium effector required for transduction was used (Figure 4A). As shown in Figure 4B, all three Plasmodium host targeting domains could functionally replace the Avrlb N- terminus in targeting Avrlb to the soybean cytoplasm, assuming that they do not simply interfere with secretion.
Functional characterization of the RXLR motif To experimentally characterize the sequence requirements of the RXLR motif, a series o f mutations were introduced into the motif in a version of the Avr l b- 1 gene that retained the secretory leader, and assayed the mutants using the bombardment assay (Table 2). Mutations which targeted the arginine at position 1 or the leucine at position 3 has the strongest effect on the ability of Avr l b to ablate GUS-positive tissue patches. Replacement of Rl with lysine reduced function significantly (33 % ablation compared to 78 %; p < 0.001 ) whi le glutamine replacement comp letely abolished i t. Replacement of L3 with alanine or even the relatively conservative valine al so completely abolished function. Replacement of the arginine at position 4 with a glutamine slightly but significantly reduced function (58% ablation compared to 72%; p < 0.001 ). Reversing the order withi n the first and second two pai rs of positi vely- charged and hydrophobi c residues (RFLR -> FRLR; RFLR -> RFRL) completely abol ished avirulence activity, indicating that positions of R l and L3 were critical, not j ust their presence.
Table 2. Function of RXLR2 mutants of Avrl b assayed by particle bombardment
Figure imgf000041_0001
35 RFAR 0.94 ± 0.03 0.91 ± 0.05 0 >0.1 No
40 RFVR 0.95 ± 0.05 1.03 ± 0.07 0 >0.1 No
33 RFRL 1.02 ± 0.04 0.96 ± 0.04 0 >0.1 No a Amino acid sequence of RXLR2 in wild-type and mutants. RFLR is the wild-type. Altered residues are underlined.
b Ratio of blue spots in the presence of various RXLR2 mutants of Avrlb-1, compared to the control empty vector when bombarded onto leaves from rps plants (Williams) or Rps lb plants (L77-1863). Averages and standard errors are from 16 pairs of shots. c Ablation calculated as 1- (Rps lb ratio)/(rps ratio) for ratios significantly different between rps and Rps lb.
d p values comparing results from, rps and Rpslb cultivars were calculated using the Wilcoxon rank sum test.
0 Ablations for FLR and RFLQ were significantly different than wildtype (RFLR) with p < 0.001.
This example demonstrates that
1) both the RXLR2 and dEER motifs of Avrlb are required for this protein to confer avirulence on P. sojae transformants (summarized in Figure 5);
2) the RXLR2 and dEER motifs are not required to trigger an interaction with the Rpslb gene product when the Avrlb protein is synthesized in the soybean cytoplasm;
3) when Avrlb protein is directed to be secreted out of the soybean cell, the RXLR2 and dEER motifs are once more required for the protein to trigger an interaction with Rpslb, which is consistent with the motifs being required for the Avrlb protein to reenter the soybean cell across the plasma cell membrane; 4) fusion of the RXLR and dEER region to GFP (SEQ ID NO: 46) enabled the isolated fusion protein to enter soybean root cells in the absence of the pathogen, but only if the RXLR and dEER motifs were both intact; and 5) RXLR-dependent entry of Avrlb does not require the presence of the pathogen. These observations lead to the conclusion that the RXLR and dEER motifs do indeed have the function of transporting avirulence proteins into host cells.
In addition, the data presented in this Example characterizes the RXLR2 and dEER motifs as follows : 1 ) arginine at position 1 and leucine at position 3 are essential for function of the RXLR motif. However, there is not a strong requirement for the arginine at position 4. Therefore by functional assays, the oomycete RXLR motif resembles the Plasmodium motif (RxLxD/E/Q) even more closely than previously noted ; and 2) the amino acid sequences flanking the RXLR2 and dEER motifs are required in addition to the motifs themselves for the transit of Avr l b into soybean . Further, the region from residues 33 to 71 ( 1 9aa to the left of RXLR2 and 6aa to the right of dEER) were sufficient for protein translocation.
The Avr l b protein requires not only the RXLR motif itself, but also non- random surrounding sequences including the dEER motif. These surrounding sequences are not enriched in positive and hydrophobic residues, but instead are enriched in aci dic and hydrophi li c resi dues. Furthermore, our RXLR mutagenesis resu lts show that the presence of b asic and hydrophobic residues is not su ffi cient for RXLR function; instead the order of the amino acid residues is very important, and very subtle mutations such as RFLR→ RFVR or QFLR abol ish function. Therefore, oomycete effectors may util ize a novel mechanism for translocation across the membrane, po ssibly involving host cell surface machinery (such as a receptor) that i s more complex than just the phospholipid bi layer. The Plasmodium Pexel/VTF moti f al so requires surrounding sequences that are enriched in acidic and hydrophil ic residues and is functional ly interchangeable with the oomycete RXLR domain in both erythrocytes and in soybean tissue (this study) . Thus oomycetes and Pl asmodium both may target host cell surface machinery that is common to plants and vertebrate animals but different than that targeted by animal PTDs. The targeted machinery, i f common, must not only be very ancient, but also must serve an irrep laceable function in the host organisms since it must have been preserved against strong negati ve selection pressure resulting from exploitation by the pathogens. These results do not indicate which specific flanking sequences are required. However, HMMs constructed from the 10 amino acid residues flanking the upstream and downstream sides of all P. sojae and P. ramorum Avh RXLR motifs, clearly separated the RXLR moti s of functional avirulence proteins from RXLR motifs obtained by chance from real or permuted proteins sequences. These findings indicate that reliable bioinformatic searches for RXLR effector candidates should include the use of HMMs to evaluate the sequences flanking putative RXLR and dEER motifs. METHODS: Plasmids and oligonucleotides used in the study are depicted in tabular form as Figure 11A and B and Figure 12A and B, respectively.
P, sojae isolates and transformation: P. sojae isolate P7076 (Race 19) was routinely grown and maintained on V8 agar). The P. sojae transformation procedure was described by Dou et al (Dou, D., Kale, S.D., Wang, X., Chen, Y., Wang, Q., Wang, X., Jiang, R.H.Y., Arredondo, F.D., Anderson, R., Thakur, P., McDowell, J., Wang, Y., and Tyler, B.M. (2008) Plant Cell 20(4), 1118-1133).
Characterization of P. sojae transformants: P. sojae transformants were selected that grew well on V8 medium with 50 μg/ml G418, and were cultured in VS liquid medium for 3 days. The mycelia were harvested, frozen in liquid nitrogen and ground to a powder for DNA or RNA extraction. Genomic DNA was isolated from mycelium using known techniques. DNA samples were quantified using a Nanodrop ND-1000 spectrophotometer (Thermo Scientific). The presence of Avrlb-1 transgenes was verified by PCR amplification from 100 ng genomic DNA using a program of 94°C for 2 min, 30 cycles of 94 °C for 30 s, 56 °C for 30 s, 72°C for 30 s, and 72 °C for 5 min with primers of HamF and HamR (TS1). All the transformed P. sojae were double- checked by Pst I restriction and/or sequence, RNA was extracted from each sample using RNeasy Plant Mini Kit (QIAGEN, cat # 74904) with β-mercaptoethanol added buffer RLT and genomic DNA was removed using RNase-Free DNase (QIAGEN, cat #79254) according to the manufacturer's recommendations. RNA was quantified using a Nanodrop ND-1000 spectrophotometer. Avrlb-1 transgene transcription was verified by RT-PCR using the internal primers, AvrlbReF and AvrlbReR (TS1) and P. sojae actin was used as the reference. Phenotypic assays for avirulence: Avrlb phenotypic expression was assayed using soybean cultivars HARO(l-7) (rps), Harol3 (Harosoy background, Rpslb), Williams (rps) and L77-1863 (Williams background, Rpslb). Seedlings were grown in the greenhouse or in a growth chamber (Percival AR-36L) with a program of 24°C at daytime and 22°C at night with a 14 hr day length under fluorescent light (250 μιηοΐ photons s-1 m-2). The virulence of each transformant was evaluated using hypocotyl inoculation. 1-2 days after the first primary leaf appeared, the hypocotyl of the soybean was wounded with a short incision and the incision was inoculated with a small piece of V8 agar cut from the edge of a 3 day old colony. Thereafter, the plants were incubated in a growth chamber under the conditions described above. The numbers of dead and surviving plants were counted 4 days after inoculation, and summed over 2-5 replicates. The differences between the numbers of surviving plants from rps and Rpslb cultivars were compared using Fisher's exact test. Only the transformants producing a significant difference between rps and Rpslb cultivars were judged as avirulent.
Particle bombardment assays: Particle bombardment assays were carried out using a double-barreled extension of the Bio-Rad He/1000 Particle Delivery System ((Dou, D., Kale, S.D., Wang, X., Chen, Y., Wang, Q., Wang, X., Jiang, R.H.Y., Arredondo, F.D., Anderson, R., Thakur, P., McDowell, J., Wang, Y., and Tyler, B.M. (2008) Plant Cell 20(4), 1118-1133). Analyzing the bombardment data as a ratio between the test and control shots improves the reproducibility of the measurements greatly. The avirulence activity of the Avrlb-1 constructs was measured as the reduction in the number of blue spots comparing the Avrlb-1 + GUS bombardment with the GUS + control bombardment. For each paired shot the logarithm of the ratio of the spot numbers of Avrlb-1 to that of the control was calculated, then the log-ratios obtained from the Rpslb and non-Rpslb leaves were compared using the Wilcoxon rank sum test.
Bombardment assays of onion bulb cells with GFP constructs: Preparation of DNA- particle mixtures was as described above.5 mm hemispherical layers of yellow and white onion bulbs were bombarded without the double barrel attachment under a 26 psi vacuum, using a rupture pressure of 1100 psi. The onion layers were incubated between 24-48 hr at 25°C, then viewed wi th a Zeiss Axioskop2 Plus microscope using a 480nm fi lter for GFP fluorescence. Images were captured using a Qimaging Retiga 1300 Camera. To further confirm the GFP had been secreted out of the onion cell s, plasmolysis was performed for 1 5 min in 0.8 M mannitol and cells were observed in a Zei ss LSM51 0 laser scanning confocal microscope (Jena, Germany) with an argon laser excitation wavelength of 488 nm .
RXLR-GFP Fusion Protein Expression and Purification : Residues 33 to 71 of Avrl b (VESPDLVRRSLRNGDIAGGRFLRAHEEDDAGERTFSVTD (SEQ ID NO: 46) including the RXLR1 , RXLR2 and dEER motifs were fused to GFP, replacing the Arg9 encoding sequences i n vector pR9GFP (SEQ ID NO : 1 12), cal led pR9 by Chang et al., (Chang, M., Chou , J. C. and Lee, H.J . (2005 ) Plant and Cell Physiology 46, 482- 488) . pR9GFP, which also adds an N-termi nal His6 tag, was derived by Chang et al (2005) from Ptat-HA. C43(DE3) E. coli cells containing RXLR-GFP fusion constructs or pR9 were grown i n 200 mL of LB containing ampicillin l OO^ig/mL in a 1 L baffled flask shaken at 240 rpm at 37°C until reaching an OD of 0.4, at which point the cells were induced by additi on of I raL of 1 M IPTG (final [5 mM]) . After 4 hours further growth at the same conditions, the cells were harvested by centrifugation at 4°C and then stored at -20°C. Visual confirmation of GFP expression was noted by the green color of the bacteri al cell pellet. To extract the GFP fusion proteins, cells were thawed on i ce for 20 min then 4 mL of lysis buffer (50mM NaH2P04, 300mM NaCl, l OmM imidazole, pH 8.0) were ad ded per I g of wet cell weight. Lysozyme (S igma-Aldrich, cat# L6876) was added to a final concentration of l mg/mL then the suspension was incubated for 20 mi n on ice. Soni cation (Branson sonifier 1 50D, with Double stepped micro tip, 3mm) was done at 300W at 1 5 sec bursts four times with 1 5 sec cooling peri ods between each burst. The lysate was centrifuged at 10,000x g for 30 minutes at 4°C, then the supernatant was transferred to a fresh tube and kept on ice until use. 5 LL of each sample was stored for SDS-PAGE analysis. Protein purification using Ni- NTA affinity chromatography was performed using the QiaExpressionist protocol . 2mL of 50% Ni-NTA super flow slurry (Qiagen) was loaded on a column. The column was washed twice with 5mL of wash buffer (50mM NaH2P04, 300mM NaCl, 20mM imidazole, pH 8.0) . The protein sample was loaded onto the column and then the column was washed twice with 1 0 vol (l OmL) of wash buffer. The protein was eluted with 4 mL of elution buffer (50mM NaH2P04, 300mM NaCl, 200mM imidazole, pH 8.0) into l mL fractions. These fractions were pooled and concentrated to 300μ1 using a centrifugal protein concentrator (Amicon Centriplus Centri fugal Filter Device MWCO-3kDa) at 13 , 500x g. The sample was then mixed with an equal vo lume of 50mM MES buffer pH 5.8. The protein concentration was measured at 280nm using a nanodrop spectrophotometer (ND- 1000) and adj usted to 8mg/mL. All purified GFP preparations fluoresced normally under UV illumination.
RXLR-GFP Fusion Protein Root Cell Transduction Assay. Root tips were cut into lengths of between 0.5 cm and 1 cm, and then were washed with water. Each root tip was completely submerged in 20 μί, of the protein solution (8 mg/ml in 25 niM MES pH 5.8) in a eppendorf tube. The samples were incubated overnight at 28°C (-1 2 hours). The roots were then washed in 200 mL of water for 4 hours while shaken at 100 vpm on a rotary shaker. The roots were then viewed using a Zei ss LSM5 0 laser scanning confocal microscope with an argon laser excitation wavelength of 488 nm. For nuclear staining, the roots were stained with DAPI (4',6-diamidino-2- phenylindole) (Sigma- Aldrich cat# D8417) and viewed with a 405 nm filter.
Hidden Markof Model Analysis: By using the program HMMER 2.3.2 (Eddy, S .R. ( 1 998). Profi le hidden Markov models. Bioinformatics 14, 755-763 ; and website located at hmmer.j aneli a.org), an HMM was built from the full set of 765 high quality candidate effectors identified from the P. sojae and P. ramorum genomes by Jiang et a! (Jiang, R. H . Y. , Tripathy, S. , Covers, F. & Tyler, B . M. Proc . Natl. Acad. Sci . USA 105, 4874-4879 (2008), using the 10 amino acids on the left side of each RXLR motif together with the 10 amino acids on the right side each RXLR motif. The same procedure was used to build an HMM from a curated list of 191 high quality candidate effectors from Hyaloperonospora parasitica developed at the H. parasitica genome annotation j amboree in August 2007 and available at pmgn.vbi .vt.edu. To estimate the significance o f HMM scores, all proteins ( 1240) with a predicted N-terminal signal peptide (SP) and the string RXLR located between 30 and 60 amino acids after the SP cleavage site were obtained by translating the genome sequences of P. sojae and P. ramorum in al l reading frames. The sequences of all the putative secreted proteins were permuted (other than the signal peptide) and RXLR-containing sequences were again identified; 639 of the permuted proteins had RXLR strings, indicating that about 639 of the 1240 detected RXLR moti fs could be expected by chance. The distributions o f HMM scores the set of 1240 real proteins, the 639 permuted proteins and the 765 curated proteins were then calculated. The frequency that a permuted protein received a score between 0 and 5.0 was 0.044. The frequency that a permuted protein received a score better than 5.0 was 0.01 8.
Accession Numbers : The sequences reported herein have been deposited in the GenBank database, namely Hp Avh341 (EF681 127). Accession numbers for sequences already i n. GenBank are Ps Avr l b- 1 (AAM20936), Ps Avr4/6 (ABS 50087), Pi Avr3 a (CAI72345 ); Hp Atr l (AY842877), Hp Atr l 3 (AY785301 ).
EXAMPLE 2. Effector host-targeting signals of eukaryotic pathogens bind
phosphoinositides or phosphatidic aci d
Pathogens of both plants and animal s produce effectors and/or toxins that act within the cytoplasm of host cells to suppress host defenses and cause disease.
Effector proteins of oomycete plant pathogens utilize N-terminal moti fs, RXLR and dEER, to enter host cells, and a simil ar motif, Pexel (RxLxE/D/Q), is used by
Pl asmodium effectors to enter erythrocytes. This Example shows that effectors of fungal plant pathogens contain functional variants of the RXLR and dEER motifs, and that the oomycete and fungal RXLR and dEER motifs, as well as the Plasmodium Pexel motifs, are responsible for bi nding of the effectors to phosphatidyl-mositoI-3- phosphate (PI-3-P) and/or phosphati dyI-inosito l-4-phosphate (PI-4-P) . Stimulation of host cel l entry by PI-4-P, and inhibition by inositol 1 ,4 diphosphate suggest that phosphoinositide binding mediates cell entry. All the effectors could also enter human cel ls, suggesting th at phosphoinositide-mediated effector entry may be very widespread in plant, animal and human pathogenesis.
Oomycete RXLR and dEER domain binds phosphoinositides The RXLR and dEER domain of P. sojae Avrlb enables translocation of green fluorescent protein (GFP) into plant cells without any pathogen-encoded machinery (see Example 1), and the same is true for two additional bioinformatically predicted effectors, Avh5 (SEQ ID NO: 129) and Avh331 (SEQ ID NO: 127). In these experiments, accumulation of the GFP fusion proteins inside the cells was confirmed by the accumulation of GFP within the nuclei of the cells (a natural property of GFP), and by plasmolysis experiments. In principle, a cell entry domain could bind either a (glyco)protein or (glyco)lipid receptor. After noting that beta-type
phosphatidylinositol-4-phosphate kinases from rice and Arabidopsis contained a PI-4- P binding domain consisting of 14 and 11 tandem RXLR and dEER motifs
respectively, experiments were conducted to test whether oomycete the RXLR and dEER domain could bind phosphoinositides. An array of 8 different lipids found in plant cell membranes were spotted in decreasing amounts onto a Hybond-C extra membrane. Then the membrane was probed with GFP fused to the N-terminal RXLR and dEER domains of Avrlb (SEQ ID NO: 46), Avh331 (SEQ ID NO: 116) or Avh5 (SEQ ID NO: 113). Figure 6 shows that the Avrlb- and Avh331-GFP fusions bound to PI-4-P while Avh331- and Avh5-GFP fusions bound to PI-3-P. Alanine substitutions mutations in either the RXLR or the dEER motif of any of the three fusions abolished binding, just as they abolished entry into soybean root cells. Fusions of full-length Avh5 (SEQ ID NO: 129) or Avh331 (SEQ ID NO: 127) proteins at their N-termmi to glutathione-S-transferase (GST) could also bind the same phosphoinositides as just their N-terminal domains fused at their C-termini to GFP and binding by the full length proteins also required intact RXLR and dEER motifs (Figure 6) (full-length Avrlb could not be produced in E. coli).
To independently confirm binding of the effector RXLR and dEER domains to the phosphoinositides, the binding of the fusion proteins to liposomes composed of phosphatidyl-choline (PC) and phosphatidyl-ethanolamine (PE) was tested. In the absence of phosphoinositides, neither the effector N terminus-GFP fusion proteins nor the full length GST-effector fusion proteins bound the liposomes (Figure 6). However, when either PI-3-P or PI-4-P were included, all the fusion proteins bound to the liposomes. In every case, when any o f the RXLR or the dEER motifs were mutated by alanine substitutions, the mutant fusion proteins lost their ability to bind the liposomes (Figure 6) .
Identification of fungal effector translocation domains
To test whether fungal effectors contain N-terminal cell entry domains, N- terminal segments from the fungal effectors AvrL567 (SEQ ID NO : 138) and AvrM (SEQ ID NO: 142) of M. lini and from AvrPi-ta (SEQ ID NO : 143) of M. oryzae were fused to the C-terminus of Avrl b, in the presence of the Avrl b secretory leader, then tested the fusions in a particle bombardment cell re-entry assay that measures the ability of a motif to carry an Avr l b reporter protein back into soybean leaf cells after secretion . Figure 7A shows that all three fungal N-terminal segments had significant ab i lity to deliver Avr l b back into soybean leaf cells .
S ince the fungal effectors contained no obvious RXLR or dEER motifs, we decided to define experimentally the range of residu es within the RXLR motif of Avr l b that could permit cell entry, using the particle bombardment cell re-entry assay. The results revealed that lysine (K) or histidine (H) but not glutamine (Q) co uld replace the arginine at position ί in the motif, that any large hydrophobic residue (isoleucine, I; methioni ne, M; phenylalanine, F; tyrosine, Y) could repl ace the leucine at position 3, albeit with varying efficiencies, but valine (V) and alanine (A) could not. At position 4, all residues tested (lysine, K; glutamine, Q; glycine, G) al lowed function. Furthermore, the presence of either an L or M residue at position 2 could substitute for a large hydrophobic residue at position 3.
Using this information, one, seven and four potential cell entry m otifs were identifi ed in N-terminal regions of AvrL567 (SEQ ID NO: 138), AvrM (SEQ ID NO : 1 42) and AvrPi-ta (SEQ ID NO : 143), respectively (Figure 7B). The single motif in AvrL567, RFYR, had a particularly good match to the oomycete RXLR motif, and RFYR had already been shown to be functional (Figures 7B and 7C). Four of the candidate motifs in the AvrPi-ta N-terminus, including two that overlapped at one residue (RFLK and KLIFK (SEQ ID NO: 146)), were tested for cell entry activity by substituting them for the RXLR motif of Avr l b. The two single motifs and the overlapping pair were all active in the cell re-entry assay (Figure 7B) .
The N-terminus of AvrL567 was subjected to further analysis by mutagenesis and root cel l entry assays. Al anine substitutions in the RFYR motif and in two downstream acidic residues that might act as a dEER motif (Figure 7B) (SEQ ID NO: 139), aboli shed the activity of the AvrL567 N-terminal domain in the particle bombardment cell re-entry assay (Figure 7A and B) . To confirm the cell entry acti vity of the AvrL567 N-terminal domain, it was fused to GFP (creating AvrL567(N) -GFP (SEQ ID NO: 1 1 9)), with and without (SEQ ID NO: 120) the alanine substitutions, and then the fusion proteins were tested for cell entry in the soybean root uptake assay. The GFP-fusion with the intact AvrL567 N-terminus (SEQ ID NO: 1 19) efficiently accumulated in the root cells, inc luding the nuclei , whereas the fusion with the mutated RFYR and acidic residues (rfyr-de-) (SEQ ID NO: 1 20) did not (not shown) . Thus the RFYR moti f and the two downstream acidic residues appear to act as a RXLR and dEER moti f in M. lini AvrL567.
Fungal and apicomplexan effectors bind phosphoinositides
Both filter binding and liposome binding were used to test whether the N- terminal domain of AvrL567 bound phosphoinositides . AvrL567(N)-GFP (SEQ ID NO: 1 1 9) bound PI-3-P in both assays. Bind ing o f AvrL567(N)-GFP to PI-4-P was also be detected in the liposome assay though it is not as strong as to PI-3-P. Mutation o f the RXLR and dEER-lilce moti f to alanines (rfyr-de- mutant) (SEQ ID NO : 120) resulted in a loss of binding to the phosphoinosi tides in both assays.
Filter binding assays were used to determine if five additional fungal effectors could bind phospholipi ds. The N-terminal sequences of the following effectors were fused to GFP : Magnaporthe grisea AvrPita (SEQ ID NO : 224), Puccima graminis Ps87 (SEQ ID NO: 226) ; Melampsora lini AvrM (SEQ ID NO: 228) ; Melampsora lini AvrP 123 (SEQ ID NO: 230); Melampsora lini AvrP4 (S EQ ID NO : 232). The results, summarized in tabular form in Figure 1 5 , showed that all five effectors bound phosphatide acid . Mutati ons in RXLR-like motifs found in AvrPtia (SEQ ID NO : 225), Ps87 (SEQ ID NO : 227), AvrM (SEQ ID NO : 228), AvrP 123 (SEQ ID NO: 230) and AvrP4 (SEQ ID NO : 232) all abolished binding to phosphatidic acid, in the case of AvrPita, the mutant protein (SEQ ID NO: 225) was unable to enter soybean root cells, whereas the wildtype protein (SEQ ID NO : 224) could enter root cells, suggesting that binding of AvrPita to phosphatidic acid was required to enter pl ant cel ls.
The host targeting signals (HTS) of three Plasmodium falciparum effectors, PfGBP (SEQ ID NO: 121 ), PfHRPII (SEQ ID NO : 123), and Pfl 61 5c (SEQ ID NO:
1 25) can carry Avr l b into soybean leaf cells and onion bulb epidermal cells8. The three signals can also carry purified GFP into soybean root cells and this activity requires intact Pexel motifs. To test whether the three signals also could bind phosphoinositides, the HTS-GFP fusion proteins were tested using fi l ter binding and liposome binding assays. The PfGBP HTS fusion (SEQ ID NO : 121 ) could bind PI-4-P and also, more weakly, PI-3 -P (Figure 8A). The PfHRPII HTS fusion (SEQ ID NO: 123) could bind PI-3-P, and also rather weakly, PI-4-P (Figure 8B) The Pfl 61 5c HTS fusion (SEQ ID NO : 1 25) cou ld bind speci fically to PI-3-P (Figure 8C) . Liposome binding assays confirmed binding of all the fusion proteins to PI-3-P or PI-4-P
(Figures 8D-F) . In both assays, alanine substitutions in the Pexel motifs of each effector abol ished phosphoinositide binding (Figure 8A-F) (SEQ ID NO : 122, 1 24,
126) .
Modulation of effector entry by exogenous phosphoinositides
The bindi ng of phosphoinositides to the effector cel l entry domains suggested that these phosphol ipids might serve as a cell entry receptor in each case. Tomato cel ls secreted PI-4-P when stimulated by fungal xylanase, suggesting that free PI-4-P might exi st in the plant apoplast24. Therefore, increasing the concentration of free phosphoinosi tide by exogenous addition might stimul ate RXLR and dEER-medi ated uptake. To test this hypothesis, a so luble form of PI-4-P, di-octanoyl-PI-4-P (250 μΜ), was mixed with the Avrl b GFP fusion, Avr l b(N)-GFP, for 30 min pri or to exposure to soybean roots. After 9 hr, strong stimulation of Avr l b(N)-GFP uptake by PI-4-P was evident (Fi gure 9A) . The phospholipids, PI, PC and PE all did not stimulate uptake. Uptake of the fungal AvrL567(N)-GFP fusion (SEQ ID NO: 1 1 9) was also strongly stimulated by PI-4-P (Figure 9B), even though it binds most strongly to PI-3-P.
A synthetic cell entry motif composed of nine-arginine residues (Arg9) (SEQ ID NO: 1 12) was previously shown to deliver Avrl b into soybean leaf cells and into onion epidermal leaf cells in particle bombardment cell re-entry assays . The motif could also enable uptake of purified GFP into soybean root cells8 and into maize and onion cells. The mechanism of uptake has been proposed to be a plant form of macropinocytosis. The Arg9-GFP fusion protein binds PI-3 -P , PI-4-P and phosphatidyl serine, albeit weakly (Figure 9D). Figure 9C shows that di-octanoyI-PI-4-P does not stimulate uptake of the Arg9-GFP fusion protein in soybean root cells, suggesting that the stimulation by PI-4-P i s specific to RXLR and dEER-mediated uptake. This conclusion is supported by the observation that exogenous PI-4-P did not promote the uptake of Avrl b(N)-GFP (SEQ ID NO: 46) and AvrL567(N)-GFP (SEQ ID NO: 1 1 9) proteins containing alanine substitutions in the RXLR and dEER motifs.
Inosi tol- l ,4-diphosphate (IP2) represents the hydrophilic head-group of PI-4-P . Preincubation with 1 00 μΜ IP2 inhibited binding of Avrl b(N)-GFP (SEQ ID NO : 46) to PI-4-P-containing liposomes and could completely block binding of AvrL567(N)- GFP (S EQ ID NO: 1 19) to PI-4-P-containing liposomes, presumably via competitive i nhibi ti on. To test whether IP2 could block effector uptake in planta, which would imply that a PI-4-P-like molecule mediated uptake in planta, Avrl b(N)-GFP (SEQ ID NO : 46) or AvrL567(N)-GFP (SEQ ID NO: 1 1 9) was preincubated with 500 μΜ IP2 for 30 m in prior to exposure to soybean roots . IP2 almost completely blocked uptake of both Avrl b(N)-GFP (Figure 9A) (SEQ ID NO: 46) or AvrL567(N)-GFP (Figure 9B) (SEQ ID NO: 1 19) into soybean cells. IP2 could not inhibit the binding of Arg9-GFP to liposomes (Figure 9D) and uptake of Arg9-GFP (SEQ ID NO: 1 12) was completely unaffected by preincubation with IP2 (Figure 9C), supporting the conclusion that IP2 specifically b locks RXLR and dEER motif-mediated protein uptake.
Effector entry into human cells
Phosphatidyl-inositol-phosphates are universal ly found in eukaryotic cel ls. Since a number o f human and animal diseases are caused by fungi and oomycetes, as wel l as by apicomplexan parasites, we tested the possibility that RXLR and dEER motifs might mediate protein entry into human cells, using the human lung epithelial cell line A549 as a model . Avrl b(N)-GFP (Figure 1 0A) (SEQ ID NO: 46),
AvrL567(N)-GFP (Figure 10B) (SEQ ID NO : 1 1 9) and PfHRPII(N)-GFP (Figure I OC) (SEQ ID NO: 1 23) (SEQ ID NO : 60) could ail enter the A549 cells, but entry did not occur if alanine substitutions were present in the RXLR or Pexel motifs of the proteins (SEQ ID NO: 47 ,48, 120, 124). In these experiments, accumulation of the GFP fusion proteins inside the cells was confirmed by the accumulation of GFP within vesicle-like structures within the cells, and by the fact that the cells were treated with protease (trypsin) prior to photographing. Protein accumulation was strongly inhibited in each case by 1 ,4-IP2, supporting the hypothesis that entry was medi ated by
phosphoinositide bindi ng. Exogenous di-octanoyl-PI-4-P did not stimulate
accumulation, suggesting that the availability of PI-4-P or other phosphatidylinositides in the growth medium was not l i miting. Inositol 1 , 3 diphosphate ( 1 ,3-IP2), the headgroup of PI-3 -P , could also inhibit entry of PfHRPII(N)-GFP (Figure I OC) (SEQ ID NO : 123), consistent with the observation that the protein bound PI-3 -P more strongly than PI-4-P in the fi lter-binding assay.
Discussion : Two independent assays, namely filter-binding and liposome-b iding, demonstrated that the N-terminus of all seven effectors tested could bind to either PI- 3-P or PI-4-P, but not to PI-5-P nor to any other phospholipids tested. The primary structures of the RXLR and dEER effector domains do not resemble any known phosphoinositide binding domains. However, the binding of the pathogen RXLR and dEER domai ns to phosphoinositides is concordant with the bi nding of the RXLR and dEER domains of rice and Arabidopsis β-type PI-4-kinases. In the oomycete effector proteins, the dEER motif i s variably spaced from the RXLR motif, so if residues from both motifs contact the phosphoinositide head group, the protein must fold so as to bring the two motifs into prox imity. The three dimensional structure of the RXLR and dEER or Pexel domain is not yet available for any oomycete or apicomplexan effector proteins, respectively. However, the crystal structure of AvrL567 has been determined. In this structure, the RFYR motif adopts a beta-stranded conformation on the surface of the protein. It will be interesting to determine if the structure of AvrL567 changes in solution in the presence of a phosphoinositide.
The stimulation of protein entry into soybean root cells by PI-4-P and the inhibition of entry by IP2 together support the hypothesis that binding to
phosphoinositides mediates entry of these pathogen effectors into plant cells. Similar findings with a human lung epithelial cel l line suggest the possibility that effectors of oomycetes and fungi that infect humans and other animals might enter host cell s via a similar mechanism. This mechanism appears to be different than reported for other peptides with cell entry activity because entry of those other peptides is not dependent on phosphoinositides.
These data demonstrate that several fungal effectors contain N-terminal domains that are cap able of carrying Avrl b into soybean leaf cells. Within these domains are RXLR-Hke motifs that can repl ace the Avrl b RXLR motif in carrying reporter proteins into host cells. In the one case tested in detail so far, AvrL567, the motif RFYR was identified as necessary for the activity of the N-terminal cell entry domain, and for the binding of the domain to PI-3-P . The mutagenesis survey of the Avrl b RXLR moti f and the diverse functional motifs found in the fungal effectors together suggest that a wide diversity of RXLR-like sequences support binding of phosphoinositides. Bioinformatic screens with the highly redundant motif suggested by the data identifies huge numbers of matches, most of whi ch are likely spurious as judged by searches of permuted protein sequences. Thus, it is very likely that there are additional requirements for phosphoinositide binding. Both the RXLR and dEER motifs of Avrl b and the Pexel moti fs of Plasmodium effectors are insufficient by themselves to facilitate cell entry; in both cases flanking sequences are required.
Other than in apicomplexan parasites, eukaryoti c pathogens of humans and other animal s have not been reported to produce effector proteins that can cross host membranes into the cytoplasm of host cells. The finding that phosphoinositide-bmding effectors from oomycete and fungal plant pathogens can cross the membranes of human cel ls predicts that oomycete and fungal pathogens of humans and other animals may also uti lize this mechanism to debilitate their hosts. Possible examples include oomycete pathogens of marine animals from the genera Saprolegnia and Aphanomyces, extracellular fungal pathogens such as Pneumocystis carinii,
Coccidioides immitus and Aspergillus fumigatus, and intra-phagosomal fungal pathogens of humans such as Cryptococcus neoformans and Histoplasma caps latum .
The binding of phosphoinositides or other polar lipids to effector cell entry domains from diverse kingdoms will provide a powerful biochemic al tool for screening or directly iso lating new candidate effector proteins from all classes of microbes. It may also enable detection of phosphoinositide-binding plant proteins (or other polar-lipid-binding proteins) that can traffic through the apoplast and enter into target cells to transduce signals. Some precedents for such proteins already exist, such as the Drosophila antennapedia transcription factor that can move from cell to cel l via an argi ni ne-rich cell entry motif.
Understandi ng the role of phosphoinositides and other polar lipids in pathogen effector entry also opens the possibility of targeting cell entry domains for
preventative or therapeutic intervention in both agriculture and medicine. The finding that IP2 can block effector entry into both plant and human cells provides a proof-of- concept for this approach.
METHODS SUMMARY
Cloning was performed according to known molecu lar biology techniques. Proteins were expressed in E. coli BL21 DE3 and puri fi ed using affinity
chromatography. Plasmids and oligonucleotides used in the study are depicted in tabular form as Figures 13 A-F and Figures 14A-D, respectively.
Soybean seeds were germinated in vermiculite for 3 -5 days. Roots were washed with water thoroughly to remove any debris. Approx imately 1 .5 cm root tips were cut and placed into the protein solution (50 μΐ- 25 niM MES pH 5.8, 50 μg protein) and incubated for 1 2- 1 5 hr at 28°C. Then the root tips were rinsed with water and washed in 75 mL of water for 2 hr on an orbital shaker at 90 rpm . Roots were examined using a Zeiss LSM5 10 laser scanning confocal microscope with an argon laser excitation wavelength of 488 nm. Lipid filter arrays were prepared by pipetting 1 μL· PI-3 -P, PI-5-P (Cayman Chemical), PS, PC, PE, PA, or PI-4-P (Avanti Polar Lipids, Cayman Chemical) at various concentrations on Hybond-C extra membranes.
Liposomes were prepared from a suspension of 0.71 ^ig/ml phosphatidylcholine, 0.29 pg/ml phosphatidyl-ethano!amine (PC/PE) or 0.64 μg/mI phosphatidylcholine, 0.26 μ ιΙ p hosphatidyl-ethanolamine, 0. 1 g/mI phosphatidyl-inositol- phosphate (PC/PE/PI-x-P). The lipid mixtures were dried under vacuum overnight, then the resultant l ipid films were rehydrated at 1 mg/mL (total lipid) in 20 mM Tris- HCI (pH 6.8) 100 mM NaCl, 2 mM dithiothreitol by three cycles of freeze-thawing. Large unilamellar vesicles were formed by extruding the lipid suspension through a 0. 1 - μΜ filter (nucleopore track-etch membrane, Whatman) 20 times and were used i mmedi ately. Effector fusion proteins were centri fuged at 100,000 g for 20 mi n at 25°C prior to assay to remove protein aggregates. 10 μg of protein was added to 50 μg of liposomes and incubated for 1 hr at room temperature. Protein-Iiposome mixtures were centrifuged at 1 00,000 g for 15 min at 25°C . Pellets containing liposome-bound proteins and supernatants containing free proteins, were then analyzed by SD S-PAGE . EXAMPLE 3. Assay for screening compound libraries to identify novel compounds that interfere with the RXLR and dEER-mediated uptake of effector proteins into plant or human cells
The binding of phosphoinositides (PI-3-P or PI-4-P) and phosphatidic acid to effector cel l entry domai ns indicates that these phospho lipids may serve as a cell entry receptors. Increasing the concentration of free phosphoinositi.de such as di-octanoyl- PI-4-P by exogenous addition stimulated RXLR and dEER-mediated uptake of the Avr l b GFP fusion, Avr l b(N)-GFP, into soybean roots and human cells. Furthermore, preincubation with inositol 1 ,4 diphosphate (IP2) inhibited binding of Avr l b(N)-GFP to PI-4-P-contai.ning liposomes presumably vi a competitive inhibition. In addition, IP2 almost completely blocked uptake o f both Avrlb(N)-GFP into soybean root cel ls and human cells in cell cu lture. Therefore, an assay is devised for screening compound libraries to identify novel compounds that interfere with the RXLR and dEER- mediated uptake of effector proteins into plant or human cells, through inhibition of the binding of, or interaction between phospholipids PI-3-P or PI-4-P and RXLR and dEER motif containing proteins. Plasmids encoding the Avrl b sequence are expressed in BL21 E. coli cells and the protein are puri fied and diluted into appropriate binding buffer at an appropriate concentration, and thirty microliters are dispensed into each wel l coated 96 or 384 well plates using an automated dispenser. Through a robotized transfer mechanism involving steel pins, each of the Avrl b protein-containing wells (in a 96 or 384 well p late) receive 300 nanoliter of a compound from the compound l ibrari es, followed by incubating the plate at room temperature for 60 minutes. An equal volume of 2x stock solution of fluorescently labeled soluble PI-4-P (Echelon Inc. BOD1PY FL PhosphatidylinositoI(4) Phosphate catalog #C-04F6a; BF-PI-4-P) is prepared in suitable buffer and 30 microliter of this solution i s di spensed into each well of Avrl b coated preincubated 384 well plates using an automated dispenser. After BF-PI-4-P addition, the p late is incubated in dark for 60 minutes, fo llowed by the measurement of fluorescence, utilizing a Synergy plate reader integrated with a biostack. The reactions are performed in duplicates and with negative controls, where the interactions are measured in the absence of the protein or fluorescently labeled BF-PI-4-P, and positive controls where the interaction is measured in the presence of a range of concentrations of inositol 1 ,4 diphosphate (IP2). The readouts are stored and analyzed for the identific ation of potenti al inhibitors of the reaction. Statistical analysis are performed utili zing a combination of parameters and compounds that showed statistically significant inhibi tion are selected. Briefly, the background absorbance is subtracted from the test reads. Subsequently, the net absorbance is compared to control s wells, that did not receive the test compounds and the percent decrease in absorbance is measured by the following formula: Percent inhibition = [(Fluorescence in test well/Fluorescence in contro l wells) x 100] . In excess of one hundred thousand drug-like, diverse heterocyclic chemical compounds are screened during this process for their potential to inhibit the interactions between BF-PI-4-P and Avr l b. These compounds 'are obtained from several sources including established chemical vendors like Asinex, Analyticon, Biomol, Bionet, ChemDiv, Enami ne, Maybridge, Spectrum, TimTec as well as a range of diversity oriented synthesis compounds that have been generated by academic research laboratories from around the world. Typical screening identifies several hundred compounds that inhibit the reaction at a statistically significant >40% levels. Successful events in this initial screen lead to the consolidation of select wells from the original library stock to generate a new second generation of plate for screening the activity of these compounds at three compound concentrations to allow the calculation of a preliminary 1C50 valu e. A select group of compounds is then selected that showed >50% inhibi tion. Larger quantities of select compounds are ordered from the specific vendors (above) for rescreening in the soybean root or human cell uptake assays for their potential to i nhibi t the uptake of Avrl b(N)-GFP into soybean roots cell s or human cells in cu lture.
EXAMPLE 4. Screening assays for novel compounds that inhibit plant oomycete or fungal infection through blocking of RXLR and dEER containing effector protein action
To further characterize candidate protective compounds obtained from the RXLR and dEER protein screen, the ability of the compounds to protect against oomycete or fungal pathogen infection are tested in detached leaf assays. The following detached leaf assays are used for soybean, potato, tomato, tobacco, grape, rice, and wheat. The assays are used to test for infection by Phytophthora oomycete pathogens (soybean, potato, tomato, tobacco), downy mildew oomycete pathogens (tobacco and grape), rust fungi (soybean and wheat), Magnaporthe b last fungi (rice and wheat), and powdery mildew fungi (soybean, potato , tomato, tobacco, grape, wheat).
Expanded leaves are removed from young growth chamber-grown plants with the petio les intact (soybean, potato, tomato, tobacco, grape), or are clipped from the mother plant with sterile sc issors (wheat and rice). The petioles or cut ends of the leaves are placed into plastic test tubes containing an aqueous solution of a suitable range of concentrations of each compound (determined from the biochemical ICso) - The leaves are then fastened into a horizontal position, but with the petioles or cut ends bent down into the tubes. The plants are then placed in a lighted growth chamber at 30% humi dity for 6 hr to enable the compounds to be drawn into the leaves by transpiration.
The plants are then inoculated with pathogen spores. Phytophthora infections (P. sojae on soybean; P. infestans on tomato and potato; P. parasitica on tobacco) are initi ated by spraying the leaves with an aqueous suspension of zoospores at a suitable concentration. Infections with rust fungi (Phakopsora pachyrizi for soybean; Puccinia striiformis f. sp . tritici (stripe rust) Puccinia triticina (leaf rust), Puccinia graminis f. sp. tritici (stem rust) for wheat) are initiated by spraying the leaves with an aqueous suspens i on of urediniospores at a suitable concentration. Infections with downy mildew oomycetes (Peronsopora tabacina on tobacco; Plasmopora viticoia on grape) and infections of Magnaporthe blast fungi (Magnaporthe oryzae for rice; Magnaporthe grisea on wheat) are initiated by spraying the leaves with an aqueous suspension of conidia at a suitable concentration. In each case, after spraying with the pathogen spore suspension, the p lants are replaced into the growth chamber at high (90%) humidity at a suitable temperature ( 15°C for P h y t o p h t h o r a
i n f e s t a n s and downy mildew oomycetes; 25°C for P. soj ae; 20°C for al l others) until symptoms develop (3-7 days). Infections with powdery mildew
(Microsphaera diffusa on soybean; Erysiphe cichoracearum on potato and tobacco ; Leveillula taurica on tomato or potato ; Erysiphe necator on grape; Blumeria gram inis f. sp. tritici on wheat) are done dry. The arrays of plant leaves are placed into a dusting tower and heavi ly infected leaves are introduced into the top of the tower and shaken vigorously for one minute, then the spores are allowed to settle for 20 min. The plants are replaced into growth chambers maintained at 70% humidity (except Microsphaera diffusa which is favored by low humidity of 30%) and 25°C.
To assay disease development in each case, the leaves are photographed, and from the photographs the numbers o f lesi ons on each leaf are counted (total lesions and sporulating lesion) and the areas of the lesions are determined digitally. The results are assess ed statistically by reference to negative controls (water), positive controls (benomyl for the fungi and metalaxyl for the oomycetes) . EXAMPLE 5. Protecting plants against oomycete infection by blocking effector entry using peptide receptor mimics
Eukaryotic pathogens such as oomycetes, fungi and apicomplexan parasites deliver hundreds of effector proteins into the cytoplasm of their host cells. Delivery of these protei ns is key to the pathogenic success o f these organisms. The similarity between oomycete and apicomplexan effector delivery systems has been noted for some time. The discovery that inositol 1 ,4 diphosphate can inhibit oomycete and fungal effector uptake (Ex ample 2) shows that effector entry can be blocked by externally appli ed small molecular weight compounds. This Example describes experiments that test whether infection by oomycetes, and po ssibly by fungi , can be mitigated by inhibiting effector entry using host-synthesized peptides that mimic inositol 1 ,4 diphosphate. Biotrophic and hemi-biotrophic oomycete pathogens that are likely to use RXLR and dEER effectors include more than 80 species of Phytophthora and more than 500 species of downy mildews that together attack almost every crop species and horticultural species o f economi c importance. Peptides that could inhibit RXLR and dEER effector entry could thus provide broad-spectrum protection against many of these pathogens. Even if protection is narrow, and mu ltiple peptides must be selected for each speci es of pathogen, this approach o ffers an important new weapon against these highly adaptable pathogens. The fact that one fungal effector from a rust pathogen also may use phosphoinositides to enter host cells suggests that the protection provided by anti-RXLR and dEER peptides may extend to many biotrophic and hemi-biotrophic fungal pathogens such as rusts, smuts, powdery mildews and the rice bl ast fungus.
At least three commercially available phage display libraries are screened against a panel of effectors that have been well-characterized and/or are strongly expressed at the outset o f f. sojae or P. infestans infection. The phage are eluted from the effectors using a rising concentration gradient of IP2 or soluble PI-P in order to identify those phage that have the greatest affinity for the PI-P binding sites of the effectors. The candidates obtained are evaluated for their binding to all panel members, and to RXLR and dEER mutants of the panel members. In addition, their affinity for both soluble and liposome-bound PI-4-P and PI-3 -P is measured. Synthetic peptides correspon ding to candidates with the highest affinities are prepared commercially and tested for their abi lity to inhibit uptake into plant and human cells. The most promising peptides at this point (broadest specificity, highest affinity and/or strongest inhibition of effector entry) are targeted for optimization of their breadth and affinity of binding. Two optimization strategies are used. Firstly, PCR-directed random mutagenesi s of selected peptides is carried out an d high affinity, broad- spectrum mutants are selected by phage display. Loss-of-activity mutants are also characterized to help identify important residues. As a parallel alternative approach, targeted mutagenesis of selected peptides is carried out based on bioinformatic analysi s of all the phage peptide sequences obtained (both high quality and low quality peptides). Surface Pl asmon resonance and NMR characterization of the binding of the most promising peptides to their target effector(s) also yields important information . The cycle of selecting promising peptides and optimizing them is repeated as needed, or until li ttle further improvement is obtained. At this point the most promising peptides are fused to selected secreted plant proteins, and the chimeric proteins are expressed in plant tissues by transient expression. The expression levels and stab ilities o f the chimeric proteins are assessed, as well as the ability of the expressed proteins to reduce entry of effector proteins and reduce infection by P. sojae or P. infestans. The resistance of the plant tissue to additional pathogens is also evaluated. Stable transgenic plants expressing the chimeric proteins are produced, and are evaluated systematically for di sease resi stance against diverse pathogens.
Initial ly th e Ph. D.-C7C random peptide phage display library available from New England Biolabs, Inc. is screened. In this library, a loop of 7 random amino acid residues i s constrained by a disulfide bond at the base of the loop where it is fused to the N- terminus of the pill coat protein. This configuration was chosen because the loop wil l eventually be transferred to a secreted plant protein, and the disul fide bond wil l ensure that the loop has a similar structure in that context as on the phage. The library contains 1 .2 x 109 independent phage, providing about 60% statistical coverage of the total theoretical complexity of a heptapeptide l ibrary (207 = 1 .3 x 109). Other possible libraries for screening include Ph.D. -7 and the Ph.D. - 12 libraries that contain 7 or 12 random residues respectively, but without a disulfide bond; both have a complexity of around 2.8 x 109.
Two approaches are used to select RXLR and dEER-specific phage. In the first, individual effectors are screened. Since this allows interactions with residues outside the immediate RXLR and dEER region, inhibitory peptides with a narrow specificity are likely to be obtained. In a complementary approach, the phage are selected on several di fferent effectors successively, in order to only obtain peptides with broad speci ficity. Both strategies are adj usted as needed.
The one-effector-at-a-time strategy targets Avrl b, Avh33 1 (Avr l k), Avh5, Avh6 and Avh l 72. Because the first two effectors are avirulence gene products that trigger plant defense responses mediated by resistance (R) genes, the efficacy of candidate inhibitory peptides is also tested in planta by their ability to inhibit the R gene mediated response to the effectors. Avh6 and Avhl 72 are maj or early-expressed effectors, so targeting them singly also has a measurable effect on pathogen virulence. Avh5 is incl uded because its NMR characterization is well advanced. In each case, two di fferent fusions are produced: GFP and GST (glutathione-S-transferase) to reduce the chance of selecti ng phage that bind to an irrelevant part of the protein.
In the second strategy, three pools of effectors are created, and the phage are successively selected on the different pools. One example of such a set of pools is : pool 1 - Avr l b + Avh331 + Avh6; pool 2 = Avh5 + Avh l 72 + Avh l 52; pool 3 = Avh38 + Avh260 + AvrL567. Each effector lis ted is either an avirulence protein or a strongly-early-expressed P. sojae effector, or is otherwise well-characterized . By using pools, the risk that a single chosen effector may be probl ematic is reduced, and by using three di fferent pools for the successive selection steps, the likelihood of finding broad specificity peptides is increased. The order of the pools used for selecti on is varied. The composition of the pools may be varied once data on the specificity of each effector for PI-3-P or PI-4-P is available, and/or if production of some chosen effector proteins in E, coli proves problematic . Panning is carried out in microtiter tray wells; if sufficient enrichment of peptides is not seen in the wells, then the proteins are bound onto beads and the beads are used for panning. The phage are step eluted with different concentrations o f inositol diphosphates (IP2) or soluble (e. g. di-hexanoyl) phosphatidyl phosphates. The choice of 1 ,3 IP2, 1 ,4 IP2, PI-3-P or PI-4-P, and the choice of concentrations is finalized once more precise data on the binding constant of the effectors for the phosphoinositides is available.
Characterization of discovered peptides for binding to multiple effectors, and for ability to block entry of key oomycete and fungal effectors into plant cells.
Each selected peptide is screened against a panel of al l the effectors mentioned listed above, plus a selection of 10 P. infestans infection-induced effectors and several fungal effectors. RXLR and dEER region mutants are included to identify peptides that interact with those motifs. Phage with the broad specificity and a set of peptides with complementary sets of targets are identified. Screening is done in a western dot blot format in which effectors bound to a filter are probed with the phage and then with an anti-M 13 antibody. Alternatively, the phage are panned against effectors arrayed in microtiter wells , and then detected by spotting onto an E. coli lawn with a replicator. The affinity of the phage for the effector is initially estimated by doing binding experiments in the presence of di fferent concentrations of PI-Ps or IP2s . An oomycete effector protein mi croarray containing all 1440 effectors from P. sojae, P. infestans, P. ramorum and H. arabidopsidis is ideal for comprehensive screening of the most promising phage. The most promising peptides are tested for the ability to block effector-GFP entry into root cells. To obtain sufficient peptides for these experiments, synthetic peptides are ordered from a commercial supplier. A
quantitative cell entry assay using luci ferase and suspension culture cells may also be employed. Binding of the most promising peptides to key effectors is further characterized by NMR and surface plasmon resonance (SPR) .
Concatenation and mutagenesis of the most promising peptides to further optimize broad-spectrum binding and ability to block effector entry into plant cells. Bioinformatic comparisons of peptide sequences having different affinities and ranges of specificity provide important starting clues about the potential for using targeted mutations to improve affinity and specificity of the identified peptides.
Alternatively, phage display technology is a proven pl atform for improving binding via random mutagenesis. A single randomized oligonucleotide is used to mutagenize the 2 1 nucleotides encoding each peptide loop. Selection of phage on a range of di fferent effectors is used to improve the breadth of specificity. Selection of phage in the presence of free peptide having the original sequence is used to select for improved affinity. An alternative approach to improving the breadth of specificity is to concatenate several peptides, with a spacer or linker sequence in between. This is an acceptable construction for in planta expression. The concatenated peptides are tested to ensure that they retain their original affinities and breadth of speci ficity. Fuse peptides to small secreted plant proteins, and test the effects of their expression in planta on effector entry and on disease resistance.
For evaluation in planta, the peptide mimics are fused to larger proteins normal ly produced during infection to promote the peptides' stability and reduce their potential susceptib i l ity to endogenous plant proteases . The fusions are evaluated in three steps: (i) exogenous application of purifi ed proteins to plant tissues ; (ii) transient expression in plants; and (iii) expression in stable transgenic plants . A variety of candidate proteins are evaluated for fusions with the peptide mimics, includi ng highly stable plant proteins such as PR l a, lipid transfer proteins, protease inhibitors and proteases. Fusion to a protease inhibitor promotes stabi lity, while conversely, fusion to a protease more effectively targets pathogen effectors for proteolysis. Generally, the mimic is attached to the C-terminus of the "carrier" protein via a suitabl e spacer so that the native N-terminal secretory leader can be used.
Initially a single peptide mimic is attached to each carrier. Once attachment of single pepti des has been validated, multip le peptides are attached in tandem to improve the breadth of binding and/or for better efficacy against effectors with multiple phophoinositide binding sites. C-terminal green fluorescent protein (GFP) fusions are used to evaluate the stabi lity and localization of the proteins in planta. Expression in E. coli or Pichia pastoris and evaluation of purified proteins.
Fusion proteins are expressed in E. coli or, due to the necessity to correctly form disulfide bonds, in eukaryotic expression system based on Pichia pastoris. The purified peptide-fusion proteins are tested for effector binding in vitro to ensure they retain binding activity as fusions. They are then introduced into leaf and root tissues (by infiltration and direct uptake, respectively) from soybean and N. benthamiana to test their stability in planta (via western blots) and to test their ability to inhibit the uptake of exogenously applied effector-reporter fusions into the plant cells. Uptake assays based on su spension cultures cells and on protoplasts may also be used to distinguish between stability and effectiveness in effector uptake inhibition .
Transient expression in planta.
Excellent virus-based transient expression systems now exist for soybean and Arabidopsi s. Infil tration of Agrobacterium tumefaciens strains harboring vectors designed to deliver gene expression constructs into plant cells locally
(Agroinfiltration) and particle bombardment have also been used extensively. Initi al ly a quantitative "double-barrel" particle bombardment assay is used to measure the ability of plant-expressed peptide fusion proteins to interfere with effector entry into soybean cell s, using either the native effectors, Avr lb or Avh33 1 (i .e. Avrl k), or fusions of other effectors to an Avrl b reporter. By using GFP-fusions in conjunction with onion epidermal cell bombardment direct visual ization of the localization of the peptide fusions or the targeted effector (or both together if one carries a red fluorescent protein, e . g mCherry) is possible. Bi-molecular fluorescence
complementation (BiFC; "split- YFP") is used to verify effector-peptide interaction in planta in the oni on system.
In order to evaluate the potential effect of peptide-fusion expression in planta on pathogen infection, the BPMV system is used to transiently express the peptide fusion proteins in soybean and Agroinfiltration to transiently express the proteins in N. benthamiana. Versions that include GFP to facilitate evaluation of stability and localization are used. Transcription of the constructs is confirmed using RT-PCR or northern analysis. Protein levels are evaluated by western blots, and confocal microscopy is used to verify that the proteins are being delivered to the apoplast.
Areas of plant tissue transiently expressing the peptide fusions are inoculated with P. sojae (soybean) or P. infestans (N. benthamiana) and disease development is evaluated. Empty vectors and vectors with the entire construct minus the peptide mimic are used as negative controls in these experiments. N. benthamiana tissue is tested for its response to the blu e mold downy mildew pathogen Peronospora tabacina. Soybean leaf tissue is tested for resistance to the soybean rust fungus, Phakopsora pachyrhizi.
Hairy root cultures of soybean expressing the peptides are created, and assayed them for P. sojae resistance, to show that expression of Avrl b and Avh331 confers increased susceptibil ity to P. sojae. Stably transformed soybean, N. benthamiana and Arabidopsis plants expressing the fusion proteins are tested and display resistance to a variety of oomycete and fungal pathogens.
EXAMPLE 6. Identi fi cation of additional Virulence Motifs
The previous Examp les present results showing that a fungal effector protein , AvrL567 , from a rust fungus that forms haustori a (specialized feeding structures) enters plant cells via RXLR sequence motif-mediated binding to a
phosphatidylinositide within the p lant cell wall. In this Example, results are presented which show that effector protein Avr2 from the tomato pathogen Fusarium oxysporum f. sp. lycopersici and effector protein AvrLm6 from the Brassica pathogen
Leptosphaeria maculans also enter plants via the same mechanism. Fusarium oxysporum f. sp . lycopersici is a xylem dwelling pathogen and Leptosphaeria maculans is an apop lastic pathogen.
AvrLm6 contains two RXLR-like sequences, RYWT and RTLK. Mutations in the second moti f (RYWT) but not the first (RTLK) abolish entry of AvrLm6~GFP fusions into root cells (Figure 16A). Avr2 also contains two RXLR-like sequences, RMLH and RIYER. Mutations in the second motif (RIYER) but not the first (RMLH) abolish entry of Avr2-green fluorescent protein (GFP) fusion proteins into root cells (Figure 1 6B) . Both effector-GFP fusions bind PI-3-P strongly, PI-4-P moderately and PI-5-P weakly, but there was no binding to any other lipids (Figures 16C and D) . In each case, the PI-P binding is dependent on the functional RXLR-like sequences, RYWT (in AvrLm6) and RIYER (in Avr2). Entry of AvrLm6 (Figure 16E) and Avr2 (Figure 16F) is inhibited in both cases by inositol 1 ,4 diphosphate (Figure 16E), inositol 1 ,3 diphosphate (not shown) and by the PI-3 -P binding proteins VAMp7 PX, indicating that entry into the soybean root cells is dependent on the presence of PI-3- P.
It has been found that GFP fusions to the N-termini of three more fungal effectors or effector-like proteins bind PI-3-P. The proteins are Leptosphaeria maculans effector AvrLm4/7 and two bioinformatically-predicted effector-like proteins from the human pathogens Cryptococcus neoformans (Cng2 ; AAW43853. 1 ) and Aspergillus fum igatus (Af2; XP 752996.1 ). Each N-terminal domain contains potential RXLR-like m otifs (Figure 1 7A).
These findings extend previ ously findings that several effectors from oomycete plant pathogens and apicomplexan pathogens of vertebrates (e.g. Plasmodium falciparum) bind phosphoinositides, particularly PI-3 -P, which enables them to enter plant and ani mal cel ls .
EXAMPLE 7. Occurrence of RXLR-like moti fs in effector like proteins from a wide diversity of oomycetes, fungi and insects.
Using a bioinformatic approach informed by detailed mutagenesis of the Avrl b RXLR motif, we have identified candidate RXLR-like motifs in 20 experimentally validated fungal effectors, as well as in 1 3 experimentally validated oomycete effectors (Tab le 1 ). The fungal effectors include an effector (MiSSP7) from a mutuali stic ectomycorrhizal fungus, Laccaria bicolor (Marti n et al., 2008).
Some sucking and chewing insects produce effector-like proteins, including hessian flies (Mayetiola destructor) (Behura et al. , 2004) and pea aphids
{A cyrth osiphon pisum) (Mutti et al., 2008). We have identified candidate RXLR-like motifs in the N-terminus of effectors vH9 and vH 13 from Mayetiola destructor, and in the effector C002 from A cyrthosiphon pisum (Table 3 ). Among oomycetes, RXLR-containing effectors have so far been documented in pathogens from the order Peronosporales. We have identified RXLR-like moti fs in bioinformatically predicted effectors from Pythiiim ultimum (Pythiales) and A lbugo Candida (Albuginales), suggesting that RXLR-like effectors may be common to the entire oomycete Phylum (Table 4) .
We have also identified RXLR-like moti fs in bioinformatically predicted effectors from the necrotrophic plant pathogens Pyrenophora tritici-repentis and Alternaria brassicicola, and from the human pathogens Cryptococcus neoformans, Aspergillus fumigatus and Coccidioides immitus (Table 4).
Thus, phosphoinositide binding, particularly to PI-3 -P, is a common property of most i f not all eukaryotic effectors that can autonomously enter host plant or ani mal cel ls across their plasma membranes, including effectors produced by host-associ ated oomycetes, fungi and animals (e.g. insects and nematodes), and including pathogens, mutualists, commensals, ectosymbionts and endosymbionts. A further corollary is that chemical or transgeni c control measures that target the interaction of RXLR-like sequences wi th phosphoi nositides will potentially be effective against a wide range of oomycete, fungal and animal pathogens.
Table 3. RXLR-like sequences in experimentally veri fied effectors. Effectors named AvrXXX are avirulence gene products. Moti fs experimentally verified as functiona! arein bold and underlined. Motifs experimentally determined to be non-functional are markedin italics . Putative motifs are underlined. Sequences shown are from the N- ierminus of the respective proteins. Note that Laccaria bicolor is a mutulasitic fungus. Ki ngdoms : O = oomycetes; F ~ fungi; I = insects
Figure imgf000069_0001
Avrlb Phytophlhora O TEYSDETNIAMVESPDLVR SIRNGDIAGGR sojae FLRAHEEDDAGERTFSV (SEQ ID NO: 305)
Avrlk Phytophlhora 0 LTCATSEQQTRPELCFFFSVRSSWPSTISDGA sojae CLALVSAEQGATAGRNTLSLR5A ATEDM
ATSTRSLRSOATNVDDDANVSIENR fSEO ID NO: 306)
Avr3 a Phytophlhora 0 LSTTNANQAKIIKGTSPGGHSPRLLRAYQPD sojae DEGDSPEDR (SEQ ID NO: 307)
Avr3c Phytophlhora 0 VEPSATSTVEVAEVOARGAD RFLRSLOTE sojae EE QGDSDVNEAEDGSEER (SEQ ID NO:
308)
Avr46 Phytophlhora 0 ITDESOPRDATIVDAPLTGRGANARYLRTST sojae SIIKAPDAQLPSTKAAIAS (SEQ ID NO: 309)
Avhl72 Phytophlhora 0 TAEVDSKTALAAEVPAAIRSLESDTPASRLL sojae RTGTVTSADNEDR (SEQ ID NO: 310)
Avr3 a Phytophlhora 0 IDOTKVLVYGTPAHmDSAGRRLLRKNEE infestans NEETSEER (SEQ ID NO: 311)
Avr4 Phytophlhora 0 ADSL ART VSVVDNV VKSRFLRAOTDE infestans NEER (SEQ ID NO: 312)
AvrBlbl Phytophlhora o AVSSNLNTAVNYASTSKIRFLSTEYNADEKR infestans SLRGDYNNEVTKEPNTSDE (SEQ ID NO:
313)
AvrBlb2 Phytophlhora 0 VAAFPIPDESRPLSKTSPDTVAPRSLRIEAQE infestans VIQSGR (SEQ ID NO: 314)
Atrl Hyaloperonospora 0 TESSETSGTIVHVFPLRDVADHRNDA
arabidopsidis LINRALRAOTALDDDEER fSEO ID NO: 315)
Atrl3 Hyaloperonospora 0 LLHAHALEIEDETGVTAGROLRAAASEVFGL arabidopsidis SRASFGLGKAQDPLDKFF (SEQ ID NO: 316)
AvrLml Leptosphaeria F SPATKNNVNQPLDNISRRSEWKSVQIS
maculans PVKEHSAKTADNTENNHNLEKRVFTSP
HMKRTFTLALENTFYAMAWLIDFSFS EEGEPHFSY LQ (SEQ ID NO: 317) AvrLm4/7 Leptosphaeria F CREASISGEIRYPQGTCPTKTEALNDC maculans NKVTKGLIDFSOSHORAWGIDMT (SEQ ID
NO: 318)
AvrLm6 Leptosphaeria F QPHLLCACESGRRDGVDDT J7 ^VKGTGG maculans RFVFSSRYWTKAEGAPHE (SEQ ID NO: 319)
Avr-Pita Magnaporthe F HPVYDYNPIPNHIHGDLKRRAYIERYSQCS oryza DSOASEIRAALKSCAELASWGYHAVKSD
NRLFKLIFKTDSTDION (SEO ID NO: 320)
Avr-Pii Magnaporthe F LPTPASLNGNTEVATISDVKLEARSDTTYHK o yzae CSKCGYGSDDSDAYFNHKC (SEQ ID NO:
321)
Avr-Pia Magnaporthe F RFCVYYDGI-ILPATRVLLMYVRIGTTATITA oryzae RGHEFEVEAKDQNC VILTNG (SEQ ID NO:
322)
Avr-Pizt Magnaporthe F SFVQCNHHLLYNGRHWGTIRKKAGWAV oryzae RFYEEKPGOPKRLVAICKNA (SEO ID NO:
323)
Avr-PikD Magnaporthe F ETGNKYIEKRAIDLSRERDPNFFDHPGIPVPE oryzae CFWFMFKNNVRQ (SEQ ID NO: 324)
Avrl Fusarium F LPKGEEGDIIGTFNFSSSDSOPLKIHWVDTPD (Six4) oxysporum f.sp. SSGSNLVKRSA (SEQ ID NO: 325)
ly coper sici
Avr2 Fusarium F LPVEDADSS VGQLQGRGNPYCVFPGRRTSS (Six3) oxysporum f.sp. TSFTTSFSTEPLGYA-RA/LHRDPPYERAGNSG lycopersici LNHRIYERSRVGGLRTVIDV (SEO ID NO:
326)
Avr3 Fusarium F QEAAVREPQIFFNLTYTEYLDKVAASHGSPP (Sixl) oxysporum f.sp. DKSDLPWNDTMGSFPGNETDDGVQTETGSS lycopersici LSRRGHIVNLR REPFGEESRNDRVTQD
(SEQ ID NO: 327) Six2 Fusarium F NPAGDSLPDDAHLPDRRLSPSEVQALKKAQ oxysporum f.sp. IYPPGYIHKRVTFGEGKDAV (SEQ ID NO: lycopersici 328)
Six5 Fusarium F RDHQYCACQSGSGDSIDIDATTQLQNDNS oxysporum f.sp. KSYLWAOTSPAYWFADRHK (SEQ ID NO: lycopersici 329)
Six6 Fusarium F GPLAQTESESADVAEHTINYIDIAPEEFEPPK oxys porum f.sp. ANLSSLVSRDTLPVST (SEQ ID NO: 330) lycopersici
AvrL567 Melampsora lini F MEHVPAELTRVSEGYTRFYRSPTASVILSG
LVKVKWDNEQMTMPLF WIG (SEQ ID NO: 331)
AvrM Melampsora lini F SLSNNLGTVPDVPHQIPND SGTPAIEDPICA
AIEDPKDMKGFNKALKSTPESEKLGTSSVE GIPOPEFDRGFLRPFGAKMKFLKPDQVO KLSTDDLITYM (SEQ ID NO: 332)
AvrP123 Melampsora lini F OYVVDPGFGEIECMCGOIARLTORPFDVE
CEAT (SEQ ID NO: 333)
Avi-P4 Melampsora lini F EFLEDARDIQGFSRKSGSKLEEESDSSRDRQ
(SEQ ID NO: 334)
STP1 U tilago maydis F NGSISNASHHHORRMVRORHIEARSAMSWL
TKISSKASDWMFGSVHAPNLDKKDLPKPLV GGVAVMPKMPY (SEQ ID NO: 335)
MiSSP7 Laccaria bicolor F SPVPGEVGLVERGPIPNAVFRRVPEPNFFKD
LLRALGOASOGGDLHR (SEO ID NO: 336)
C007 Acyrlhosiphon I SAAEPYDEQEEASVELPMEFIRQCDEYKSKI pis um WDKAFSNOEAMOLMELTFNTGKELGSHEV
(SEQ ID NO: 337)
vH 13 May tiola I SPLPLAYTDOVYDACDRQFDETVRNSQPL destructor (SEQ ID NO: 338) vH9 Mayetiola I LVLDTRAMPETDFE ALKEWNRVOTLVLTA destructor PEORRTMVLIAEHLTNLKKMNVDSPGGSFL
YLKDGDPVIKLPSVEHFEITFRGPYGVDKNF
SFYMPKLKKLIVRDADANDKKIIKFVSOHS
RTLKTLDLVAANYRTLRTLGAM HIEEFVT
SPP (SEQ ID NO: 339)
Table 4 RXLR-like sequences i n bioinformatically predicted effectors. Motifs experimentally verified as functional are in bold and underlined . Putative motifs are underl ined. Sequences shown are from the N-terminus of the respective proteins. Note that Cryptococcits neoformans, Aspergillus fumigatus and Coccidioides immitus are human pathogens. Pyrenophora tritici-repentis and Alte n ria hrassicicola are necrotrophic plant p athogens. Kingdoms: O = oomycetes; F = fungi .
Figure imgf000073_0001
Afl3 Aspergillus F
flavus LOPWERVDEIRLARKGYLYGSP (SEO ID NO:
344)
PTRGJ)2320 Pyrenophora F OVKGNAIRCGODD SDODTRNFCRFMFTSD triticirepentis RTLKINGEFRGNA (SEQ ID NO: 345)
AB09791 .1 Alternaria F APASYPASALGKRWVDTTGGQ MPAHFVST brassicicola VRKLSTEKLKT ROLDOLL (SEQ ID NO : 346)
Cng l Cryptococc s F LTVPOAHRETLEEAG LTTIAAINTKKLIKDV neoformans TVGTMSSVFPDGTDNGGRP (SEQ ID NO: 347)
Cng2 Cryptococcus F IOOGQKANAREOHRGR TNLTIKLPGAHSYK neoformans AKFEGCMVVLODKKLYVEHAGCESLAYAHP
(SEQ ID NO: 348)
Afl Aspergillus F IPSAFPQDNAVNQVLLSDSYQDQSVSSISAED fumigatus DAQNSAVIHIGESETMRAPSWFTSTLMARRLL
ALSTTGTVSTIFPDPLPGNSHAPPSVAGLP
(SEQ ID NO: 349)
ΑΪ2 Aspergillus F VAMGVSEQRKANERKMDARRMARFNIDIETS fumigatus GETOEEDEIRGKRIVLRDNKVYLDDPLPANRK
HPSHTAESFYIDYP (SEQ ID NO: 350)
Af3 Aspergillus F PVVPGQTVMEPSAALPDDGDHLYTLPMFDIR fumigatus PWERVSEVRLAREGYLYG (SEO ID NO: 351 )
Ci l Coccidioides F SPVFPGGDKRDALYQKPIAPAGEFPFDSSPPEA immitus RMTIPYADNEPDSSLSIPSWPTTHLLARRLLGL
STTGVLSTVFPRTNRDPALVGVP (SEQ ID NO: 352)
Ci2 Coccidioides F IRSSORSORROEHRSRKMNLIVSCSDPSRKSK immitus DVDGCFVVLRNHKLWIASRPSDGEANEPSDD
ATRFKASLHQCHH (SEQ ID NO : 353)
EXAMPLE 8. Phosphatidylinosiiol-3-phosphate is the natural target of RXLR(-like) effectors. Of the eight oomycete and fungal effectors tested to date, seven have a preference for binding to PI-3 -P , and one (Avrl b) has a preference for PI-4-P. Neither of PI-3-P nor PI-4-P has been reported to occur in the outer leaflet of the plasma membrane of plant or animal cells (Boon et al. , 2002) . Two papers have reported secretion of PI-4-P by plant cells (Regente et al., 2008 ; Gonorazsky et al ., 2008).
In order to test directly for the presence of PI-3-P and PI-4-P, we fused the PX domain of VAM7p and the PH domains of the human proteins FAPP l and PEPP l to green fluorescent protein (GFP). PEPP l and FAPP l bind very specifically to PI-3 -P and PI-4-P, respectively (Figure I SA) (Dowler et al. , 2000) . VAM7p has a preference for PI-3-P but can bind weakly to PI-4-P and PI-5-P (Figure 1 8A) (Lee et al ., 2006). The GFP fusion proteins were used to stain the surface of cells of human lung epithelial cel l, line A549 and soybean root cells. The results reveal very clearly that PI-3-P is present uniformly on the outer surface of roots cells (Figure 1 8B), and at speci fic sites on the surface of the epithelial cel ls (Figure 18C).
As can be seen , Ρΐ-4-P could not be detected in either case. Nei ther PI-3-P nor PI-4-P could be detected on the surface of erythrocytes . The lack of PI-3 -P or PI-4-P on the surface of erythrocytes is significant because nearly all published studies documenting the absence of PI-3 -P or PI-4-P from the outside of eukaryotic cells uti lized erythrocytes. Our results suggest that erythrocytes may be an exception in this regard.
The finding of PI-3 -P on the outside of plant and animal cells, combined with the preference for most effectors for PI-3-P is consistent with PI-3-P being the principal receptor mediating entry o f the effectors into plant and anim als cells. The absence of PI-4-P from the membranes suggests PI-4-P is un likely to be the principal ro ute of cell entry. However, PI-4-P has been reported to be secreted from plant cells under certain conditions (Regente et al., 2008 ; Gonorazky et al., 2008), and it is possible that some effectors such as Avr lb have evolved to respond to PI-4-P .
EXAMPLE 9.
Since several of the fungal effectors that were tested contained no obvious RXLR or dEER motifs, we used the leaf bombardment assay to define the range of residues within the RXLR motif of Avrl b that could permit cell entry. The results (Figure 1 9) revealed that lysine or histidine but not glutamine could replace the arginine at position 1 in the motif, that any large hydrophobic residue (isoleucine, methionine, phenylalanine, or tyrosine) could replac e the leucine at position 3, but valine and alanine could not. At position 4, all residues tested allowed function.
Furthermore, the presence o f either a leucine or methionine residue at position 2 coul d substitute for leucine at po sition 3. The effector binding moti f was thus refined to BXZ, where B = R, or H; X is any amino acid and may be absent; and z = L, M, I, W, Y, or F.
EXAMPLE 10. A PI-3-P-binding protein blocks entry of effectors into plant and human cel ls .
To determine more directly i f PI-3-P mediates host cell entry, we pre-incubated soybean roots and epithelial cells with unlabeled VAM7p PX protein, wh ich binds PI- 3-P, prior to exposing the cells to effector-GFP fusions. Pre-incubation with VAM7p PX protein strongly inhib ited entry by GFP fusions of the oomycete effector Avrl b, and the fungal effectors AvrL567, Avr2 and AvrLm6 into soybean root cells (Figure 20A) but di d not inhi bit entry of a synthetic cel l permeable protein Arg9-GFP th at does not bind phosphoinositides . Similarly, VAM7p PX protein strongly inhibited the entry by GFP fusions of Avr l b, AvrL567 and the Plasmodium effector PfHRPII into . human epitheli al cel ls, but did not inhibit entry of Arg9-GFP.
These results strongly support the hypothesis that PI-3 -P binding is necessary for the effector GFP fusi ons to enter plant and animal cells.
The previous examples showed that the head group mimic 1 ,4 inosi tol diphosphate ( 1 ,4IP2) could inhibit entry of effector-GFP fusions into soybean root cells and human epithelial cells (Figure 20A and B) . Presumably the binding of 1 ,4IP2 to the effectors is strong enough to compete with binding for cel lular PI-3-P.
To test the abil ity of inositol diphosphate to inhibit entry of a native effector (not a GFP fusion) into p lant cel ls, we produced full length protein of the oomycete effector Avrl k (from Phytophthora sojae) in E. coli. We then infiltrated the purified protein into soybean leaves which did or did not carry the resistance gene Rps l k. In the presence of Rps l k, Avrl k triggers a programmed cell death response called the hypersensi tive response (HR) (Figure 20C, panel 1 ). In the presence of 1 ,3 IP2, however, no HR was observed, consistent with 1 ,3IP2 blocking the entry of the effector into the leaf cells. When the RXLR motif of Avr l k (RSLR) was mutated, no HR was observed, even in the absence of 1 ,3IP2, confirming the RXLR motif was essential for cell entry. When the Rps l k gene was absent, no HR was observed, as expected. These resu lts show that entry of RXLR effectors into plant cells requires binding to PI-3-P.
EXAMPLE 11. Methods to block effector entry using small-molecule drugs
The abil ity to b lock effector entry using 1 , 3IP2 or 1 ,4IP2 provides a proof-of- concept for treating oomycete or fungal i nfections of plants or ani mals, including humans, with drugs that block the PI-3 -P-binding sites of the effectors. Such drugs may not need to fully block all effectors in order to be effective. Since a princ ipal function of effectors is to suppress the host defense responses, even partial inhibition of effector entry may be sufficient to obtain protein. This point may be important because some forms of geneti c resi stance in plants (maj or gene resistance) rely upon entry of effectors into the plant cells (the resistance gene product encodes a receptor that detects the presence of an intracellular effector).
Drugs are also used to interfere with biosynthesis or export of P1-3-P to the outer leaflet. Inside the cell, P1-3-P can be formed by the action of
phosphatidylinositol-3 -kinases on phosphatidylinositol , and by the acti on of phosphatidylinosi to l 4, 5 phosphatases on phosphatidylinositol 3 ,4 diphosphate, phosphati dylinosito l 3, 5 diphosphate and phosphatidylinositol 3 ,4,5 diphosphate. Any drug which inhibited these enzymes could lower the level s of external PI-3-P.
Currently it is not known how PI-3 -P reaches the outer leaflet. All known PI-3 -P forming enzymes are located on the cytoplasmic face of membranes. PI-3 -P could reach the external leaflet of the plasma membrane or the luminal face of secretory vesicles by the action o f floppases or a scramblases. Alternatively PI-3-P might be transported to the outer leaflet by an ABC transporter or by a secreted lipid transfer protein. Any of the proteins involved in this process could be targeted with drugs, provided that they did not disrupt normal cell physiology. In addition to drugs that directly target the proteins described above, and drug that targets biosynthesis of the proteins, for exampl e siRNAs, are also effective.
Some specific examples of drugs that may be used in the practice of the invention include but are not limited to membrane-permeant derivatives of inositol diphosphates (Li et al . , 1992) and bis(hydroxymethyI)-inositol (Hu et al., 2000).
Alternatively, drugs that bind directly to PI-3-P making it unavailable to effectors are effective. For example, neomycin binds PI-4,5- P2 very effectively; thus neomycin, neomyc in derivatives or other aminoglycosides that bind PI-3 -P may be used.
If effective drugs cause toxicity, forms of the drugs which are activated only when in close proximity to the pathogen are used. For example, infection in both p lant and animal cell systems results in local high concentrations of hydrogen peroxide. A pro-drug that is activated by oxidation or peroxidation mitigates toxicity.
EXAMPLE 1 2. Methods to block effector entry using polypeptides .
Polypeptides with the properties described in Example 10 may al so be utilized. Polypeptides may have some adv antage over chemicals, in plant and animal systems, in that the host organism can be genetically engineered to produce the polypeptide, si mpl ifying del ivery and reducing cost. The ability to produce and select large numbers of variant polypeptides via phage display technologies provides additional power to improve specificity, if needed. Random peptides or single chain antibodies selected by phage display are used to block the PI-3-P binding sites of effectors .
Additionally such effector-b inding proteins could be fused to proteases to facilitate degradation of the effectors.
The abi lity to block effector entry by pre-incubation with PI-3-P-binding proteins provides a strong indication that secretion of PI-3-P-binding proteins could provide protection against infection, especi ally if the secreted protein coul d be targeted to the infecti on site. Additionally, secretion of enzymes which can hydrolyze PI-3-P or modi fy it in other ways may be effective in reducing the level of PI-3-P available to transport effectors into cells. Examples of such enzymes include but are not limited to PI-3-P 4,5 kinases, PI-3-phosphatases, or phospholipases, etc. Examples of these enzymes have been described in the literature (Falasca et al., 2006).
Additionally, enzymes (e.g. from microbes) that cause novel modifications of PI-3-P such as methylases, acetylases or glycosylases may be used. A particularly useful enzyme is a phospholipase C that can cleave PI-3-P into diacylglycerol and l,3inositol diphosphate; not only is the level of PI-3-P reduced but the inhibitor 1,3- inositol diphosphate would be produced as a result. Currently known
phosphatidylinositol-specific phospholipase C's are specific for phosphatidylinositol, glycosyl phosphatidylinositol-protein anchors, or for phosphatidylinosito]-4-phosphate and phosphatidylinositol-4,5-diphosphate. In some embodiments, systematic mutagenesis is used to modify the specificity of a phosphatidylinositolspecific phospholipase C so that it could cleave PI-3-P.
Further, in cases where polypeptides that manipulate PI-3-P levels cause deleterious physiological effects on the host, transgenic hosts are produced in which the polypeptide gene is transcribed only during infection. Alternatively, or jointly with this strategy, the polypeptide is targeted to the site of infection. For example, the Arabidopsis protein RPWS is specifically targeted to haustoria of certain oomycetes and fungi (Wang et al., 2009). RPWS is used to target anti-effector polypeptides to the haustorial space.
REFERENCES FOR EXAMPLES 6-12
Behura, S. ., Valicente, F.H., Rider, S.D., Jr., Shun-Chen, M., Jackson, S., and Stuart, J. J. (2004). A physically anchored genetic map and linkage to avirulence reveals recombination suppression over the proximal region of Hessian fly
chromosome A2. Genetics 167, 343-355.
Boon, J.M., and Smith, B.D. (2002). Chemical control of phospholipid distribution across bi layer membranes. Med Res Rev 22, 251-281.
Dowler, S., Currie, R.A., Campbell, D.G., Deak, M., Kular, G., Downes, CP., and Alessi, D.R. (2000). Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities. The Biochemical journal 351, 19- 31.
Falasca, M., and Maffucci, T. (2006). Emerging roles of phosphatidylinositol 3- monophosphate as a dynamic lipid second messenger. Archives of physiology and biochemistry 112, 274-284
Gonorazky, G., Laxalt, A.M., Testerink, C, Munnik, T., and de la Canal, L. (2008). Phosphatidylinositol 4-phosphate accumulates extracellularly upon xylanase treatment in tomato cell suspensions. Plant, cell & environment 31, 1051-1062.
Hu, Y., Qiao, L., Wang, S., Rong, S.B., Meuillet, E.J., Berggren, M., Gallegos, A., Powis, G., and Kozikowski, A. P. (2000).3-(Hydroxymethyl)-bearing
phosphatidylinositol ether lipid analogues and carbonate surrogates block PI3-K, Akt, and cancer cell growth. J Med Chem 43, 3045-3051.
Lee, S.A., Kovacs, J., Stahelin, R.V., Cheever, M.L., Overduin, M., Setty, T.G., Burd, C.G., Cho, W., And Kutateladze, T.G. (2006). Molecular mechanism of membrane docking by the Vam7p PX domain. J Bio] Chem 281, 37091-37101.
Li, W., Schultz, C, Llopis, J., and Tsien, R.Y. (1992). Membrane-permeant esters of inositol polyphosphates, chemical syntheses and biological applications. Tetrahedron 53, 12017-12040.
Martin, F., Aerts, A., Ahren, D., Brun, A., Danchin, E.G., Duchaussoy, F., Gibon, J., Kohler, A., Lindquist, E., Pereda, V., et al. (2008). The genome of Laccaria bicolor provides insights into mycorrhizal symbiosis. Nature 452, 88-92.
Mutti, N.S., Louis, J., Pappan, L.K., Pappan, K., Begum, K., Chen, M.S., Park, Y., Dittmer, N., Marshall, J., Reese, J.C., et al. (2008). A protein from the salivary glands of the pea aphid, Acyrthosiphon pisum, is essential in feeding on a host plant.
Proceedings of the National Academy of Sciences of the United States of America 105, 9965-9969.
Regente, M., Corti Monzon, G., and de la Canal, L. (2008). Phospholipids are present in extracellular fluids of imbibing sunflower seeds and are modulated by hormonal treatments. Journal of experimental botany 59, 553-562. Wang, W. , Wen, Y., Berkey, R. , and Xiao, S. (2009). Specific Targeting of the Arabidopsi s Resistance Protein RPW8.2 to the Interfacial Membrane Encasing the Fungal Haustorium Renders Broad-Spectrum Resistance to Powdery Mildew. Plant Cell 21 , 2898-2913.

Claims

We claim:
1 . A method of inhibiting entry, into a cell, of a pathogenic effector protein, said entry of said pathogenic effector protein into said cell requiring binding of at least one moti f of said effector protein to at least one polar lipi d of said cell, comprising the step of
i) binding a blocking compound to said at l east one motif of said pathogenic effector protein; or
i i) binding a blocking compound to said at least one polar lipid of said cell, wherein sai d step of binding prevents entry of said pathogenic effector protein into said cell.
2. The method of claim 1 , wherei n said at least one moti f compri ses an am ino acid sequence BXZ, where
B is an amino acid selected from arginine, lysine and histidine;
X is any amino acid and may be present or absent; and
Z is an am ino acid selected from leucine, methion ine, isoleucine, tryptophan, tyrosine and phenylalanine.
3. The method of claim 2, and wherein said at least one moti f is selected from the group consisting of RxLR, RSLR, Pexel, RYWT, RIYER, RRLLR, RRFLR, and RFYR.
4. The method of cl aim 3, wherein said at least one motif is RIYER or RYWT.
5. The method of cl aim 1 , wherein said blocking compound i s a polypepti de that binds to said at least one moti f.
6. The method of claim 5 , wh erein said polypepti de is a synthetic peptide.
7. The method of claim 1, wherein said blocking compound is a polar lipid.
8. The method of claim 7 wherein said polar lipid is selected from phosphoinositides, phospholipids, and sphingolipids.
9. The method of claim 8 wherein said phosphoinositide is selected from the group consisting of phosphatidyl-inositol-3-phosphate (PI-3-P), phosphatidyl-inositol-4- phosphate (PI-4-P), phosphatidyl-inositol-5-phosphate (PI-5-P), phosphatidyl-inositol-
3.4- diphosphate (PI-3.4-P2), phosphatidyl-inositol-3,5-diphosphate (PI-3,5-P2), phosphatidyl-inositol-4,5-diphosphate (PI-4,5-P2), phosphatidyl-inositol-3,4,5- triphosphate (PI-3,4,5-P3), lysophosphatidyl-inositol-3-phosphate (LPI-3-P), lysophosphatidyl-inositol-4-phosphate (LPI-4-P), lysophosphatidyl-inositol-5- phosphate (LPI-5-P), lysophosphatidyl-inositol-3,4-diphosphate (LPI-3,4-P2), lysophosphatidyl-inositol-3,5-diphosphate (LPI-3,5-P2), lysophosphatidyl-inositol-
4.5- diphosphate (LPI-4,5-P2), and lysophosphatidyl-inositol-3,4,5-triphosp ate (LPI- 3,4,5-P3), and phosphatidyl-inositol (PI), and lysophosphatidyl-inositol (LPI).
10. The method of claim 7 wherein said polar lipid is selected from the group consisting of phosphatidyl-serine (PS), phosphatidyl-glycerol (PG), phosphatidyl- ethanolamine (PE), phosphatidyl-choline (PC), lysophosphatidyl-serine (LPS), lysophosphatidyl-glycerol (LPG), lysophosphatidyl-ethanolamine (LPE),
lysophosphatidyl-choline (LPC), phosphatidic acid (PA), lysophosphatidic acid (LPA), sphingosine-l-phosphate (S-l-P), ceramide-1 -phosphate (C-l-P), a
glycosylphosphatidylinositol (GPI)-protein anchor, a glycosylsphingosylinositol (GSI)-protein anchor, a glycosyl phosphoryl inositol ceramide (GPIC) and
sphingomyelin (SM).
11. The method of claim 1, wherein said blocking compound is selected from the group consisting of: an inositol phosphate, an inositol sulfate, an inositol carboxylate, an inositol arsenate, an inositol phosphorothioate, a hexose phosphate, a hexose sulfate, a hexose carboxylate, a hexose arsenate, a hexose phosphorothioate, a hexitol phosphate, a hexitol sulfate, a hexitol carboxylate, a hexitol arsenate, a hexitol phosphorothioate, a polyol phosphate, a polyol sulfate, a po lyol carboxylate, a polyol arsenate, a polyol phosphorothioate, a phosphorylated glycan, a sulfated glycan, a carboxylated glycan, a glycan arsenate, or a glycan phosphorothioate.
1 3. The method of claim 12, wherein said blocking compound i s a polypeptide that binds to said at least one polar lipid.
14. The method of claim 13 , wherein said polypeptide is or comprises a porti on of a lipid-binding protein.
15. The method of claim 14, wherein said polypeptide comprises a domain selected from the group consisting of C I , C2, PH, FYVE, PX, ENTH, ANTH, BAR, FERM, PDZ, and tubby domains .
16. The method o f claim 13 , wherein said polypeptide is a synthetic peptide.
17. The method of claim 1 , wherein said host cell is a plant cell .
1 8. The m ethod of claim 1 7, wherein said plant cell is of a type selected from the group consi sting of wheat, maize, rice, sorghum , barley, oats, millet, soybean, common bean (Phaseolus species), green pea (Pisum species), cowpea, chickpea, alfalfa, clover, tomato, potato, tobacco, pepper, egg plant, grape, strawberry, raspberry, cranberry, blueberry, blackberry, hops, walnut, apple, peach, plum, pistachio, apricot, almond, pear, avocado, cacao, coffee, tea, pineapple, passionfruit, coconut, date and oi l palm, citrus, orange, lemon, grapefruit, safflower, carrot, sesame, common bean, banana, citrus, papaya, macadamia, guava, pomegranate, pecan , Brassic a species, canola, cabbage, cauliflower, mustard, cucurbits, pumpkin, cantaiope, squash, zucchini, melon, cotton, sugar cane, sugar beets, sunflower, lettuce, oni on, garlic, ornamental cut flowers; and grass .
19. The method of claim 1 wherei n said host cell is an animal cell .
20. The method of c laim 1 9, wherein said animal cell is from or in an animal selected from the group consisting of cattle, sheep, pigs, goats, horses, cats, dogs, chickens, turkeys, bees, salmon, trout, bass, catfish, shellfish, crayfish, lobsters, shrimp, and crabs.
2 1 . The method of claim 20 wherein said animal cell is a human cell .
22. The method of claim 20 wherein said animal cell is a red bloo d cel l, a lymphocyte, a m acrophage, a neutrophil, a dendritic cell, a spl een cell, a thymus cell, a l iver cell, a nerve cell, a brain cell , a lung cell, a muscle cel l, or an epithel ial cel l.
23. The method of claim 1 wherein said pathogenic effector protein is from an oomycete.
24. The method of claim 23 wherein said oomycete is selected from the group consisting of: a Phytophthora species, Phytophthora infestans, Phytophthora sojae, Phytophthora ramorum, Phytophthora parasitica, Phytophthora capsici, Phytophthora nicotianae, Phytophthora cinnamomi, Phytophthora cryptogea, Phytophthora drechsleri, Phytophthora cactorum , Phytophthora cambivora, Phytophthora citrophthora, Phytophthora citricola, Phytophthora megasperma, Phytophthora palmivora, Phytophthora megakarya, Phytophthora boehmeriae, Phytophthora kernoviae, Phytophthora erythroseptica, Phytophthora fragariae , Phytophthora heveae, Phytophthora lateralis, Phytophthora syringae, a Pythium species, Pythium ultimum, Pyth ium aphanidermatum , Pythium irregulare, Pythium gram inicola, Pythium arrh enomanes , Pythium insidiosum, a downy mildew species, a Peronospora species, Pevonospora tabacina , Peronospora destructor, Peronospora sparsa, Peronospora viciae, a Brem ia species, Bremia lactucae, a Plasmopora species, Plasmopora viticola, Plasmopara h lstedii, a Pseudoperonospora species,
Pseudoperonospora cubensis, Pseudoperonospora h muli, a Sclerospora species, Sclerospora gramin icola, a Peronosclerospora species, Peronosclerospora
philippinesis, Peronosclerospora sorghi, Peronosclerospora sacchari, a
Sclerophthora species, Sclerophthora rayssiae, Sclerophthora macrospora, a Albugo species, Albugo Ca ndida , a Aphanomyces species, Aphanomyces cochlioides,
Aphanomyces euteiches, Aphanomyces invadans, a Saprolegnia species, Saprolegnia parasitica , and a A chlya species.
25. The method of claim 1 wherein said pathogenic effector protein is from a fungus.
26. The method of claim 25 wherein said fungus is selected from the group consisting of: a rust fungus, a smut fungus, a bunt fungus, a powdery mildew fungus, a Puccinia species, Puccin ia striiformis, Puccinia graminis, Puccinia triticina (syn. Puccinia recondita), Puccin ia sorghi, Puccinia schedonnardii, Puccinia cacahata, a
Phakopsora species, Phakopsora pachyrhizi, Phakopsora gossypii, a Phoma species, Phoma glycinicola, a Ascochyta species, Ascochyta gossypii, a Cryphonectria species, Cryphonectria parasitica, a Magnaporthe species, Magnaporthe oryzae, a
Gaeuman nomyces species, Gaeumannomyces graminis, a Synchytrium speci es, Synchytrium endobioticum , a Ustilago species, Ustilago maydis, Ustilago tritici, Ustilaginoidea virens, a Tilletia species, Tilletia in dica , Tilletia caries, Tilletia foetida, Tilletia barclayana, a Erysiphe species, Erysiphe necator, a Blumeria species, Blumeria gram inis, Podosphaera oxyacaiithae, a Alternaria species, Alternaria alternata, & Botryiis species, Botrytis cinerea, a Diaporthe species, Diaporthe phaseolorum , a Fusarium species, Fusarium graminearum , Fusarium oxysporum, Fusarium moniliforme, Fusarium solani, a Leptosphaeria species, Leptosphaeria maculans, Leptosphaeria maydis , a Macrophom ina. species, Macrophom ina phaseolina, a Monilinia species, Monilinia fructicola, a Mycosphaerella species, Mycosphaerella gramin icola , Mycosphaerella fijiensis, Mycosphaerella tassiana , Mycosphaerella zeae-maydis, a Phialophora species, Ph ialophora gregata, a
Phymatotrichopsis species, Phymatotrichopsis omn ivora, a Taphrina species,
Taphrina deformans , a Aspergillus species, Aspergillus flavus, Aspergillus
parasiticus, Aspergillus fum igatus, a Verticiliium species, Verticillium dahliae, Verticillium albo-atrum, Rh izoctonia solani, Ophiostoma ulmi, Ophiostoma novo- ulmi, a. Septoria species, Septoria avenae, a Pyrenophora speci es, Pyrenophora tritici- repentis, a Colletotrichum species, Colletotrichum graminicola, a Sclerotinia species, Sclerotinia sclerotiorum, a Sclerotium species, Sclerotium rolfsii, a Thielaviopsis species, Thielaviopsis basicola, a Coccidioides species, Coccidioides immitus, a Paracoccidioides speci es, Paracoccidioides braziliensis, a Pneumocystis species, Pneumocystis carinii, a Histoplasma species, Histoplasma capsulatum, a
Cryptococcus species, Cryptococcus neoformans, a Candida species, Candida albicans, a microsporidial species, a Enterocytozoon species, a Encephalitozoon species and Encephalitozoon cuniculi.
27. The meth od of claim 1 , wherein said pathogen effector protein is from a protozoon.
28. The method of claim 27 wherein said protozoon i s selected from the group consisting of: an apicomplexan parasite, a Plasmodium species, Plasmodium falciparum, Plasmodium vivax, Plasmodium ovale, Plasmodium malariae, a Babesia species, Babesia bovis, Babesia bigem ina, a Cryptosporidium species,
Cryptosporidium parvuni, a Toxoplasma species, Toxoplasma gondii, a
Trypanosomatid species, a Trypanosoma speci es, Trypanosoma brucei, Trypanosoma cruzi, Trypanosoma congolense, Trypanosoma vivax, a Leishmania species, Leisman ia donovani, an amebozoan parasite, an Entamoeba species, Entamoeba histolytica, a Mastigamoeba species, a Schistosoma species, a Onchocerca species, and a Giardia species.
29. The method of claim 1 wherein said step of binding includes the step of providing to a plant or animal a sufficient quantity of said blocking compound so that it is present to bind to said target molecule prior to entry of said pathogenic effector protein into cells of said plan or animal.
30. A method for screening compounds to identify whether they are potential blocking compounds for inhibiting entry of pathogenic effector proteins into a cell, compri sing the steps of:
providing one or more proteins each of which has one or more motifs which are bound by polar lipi ds as a prerequisite to translocation;
exposing a candidate compound to said one or more proteins; and
determining whether said candidate compound binds to sai d one or more motifs of said one or more proteins, and, if binding occurs, determining that said compound i s a potenti al blocking compound for inhibiting entry of pathogeni c effector proteins into a cell,
wherein said one or more moti fs comprises an amino acid sequence BXZ, where B is an amino acid selected from arginine, lysine and histidine;
X is any amino aci d and may be present or absent; and
Z is an amino acid selected from leucine, methionine, isoleucine, tryptophan, tyrosine and phenylalanine.
3 1 . The method of claim 30 wherein said one or more proteins provided in sai d providing step are pathogenic effector proteins derived from a bacterial, protozoal , fungal, oomycete or nematode source.
32. A method for screening compounds to identify whether they are potenti al blocking compounds for inhibiting entry of pathogenic effector proteins into a cell, compri sing the steps of: providing one or more polar lipids, each of which binds to one or more motifs of an effector protein as a prerequisi te to translocation of said effector protein into said cell;
exposing a candidate compound to said one or more polar lipids; and determining whether said candidate compound binds to said one or morepolar lipids, and, i f binding occurs, determining that said compound is a potential blocking compound for inhibiting entry of pathogeni c effector proteins into said cell,
wherein sai d one or more motifs comprises an amino acid sequence BXZ, where B is an amino acid selected from arginine, lysine and histidine;
X is any amino acid and may be present or absent; and
Z is an amino acid selected from leucine, methionine, iso!eucine, tryptophan, tyrosi ne and phenylal anine.
33 , The method of c laim 32, wherein said said effector proteins are pathogenic effector proteins derived from a bacterial, protozoal, fungal, oomycete or nematode source.
34. A method of inhi biti g entry, into a cell, of a pathogenic effector protein, said entry of said pathogenic effector protein into said cell requiring binding of at least one motif of said effector protein to at least one polar lipid of said cell, comprising the step of
contacting a substrate which contains or is likely to contain a pathogen comprising said pathogenic effector protein with a blocking compound, said blocking compound being capable o f
i) binding to said at least one moti f o f said pathogenic effector protein ; or ii) binding to said at least one polar lipid of said cell ,
wherein binding o f said blocking compound prevents entry of said pathogenic effector protein into said cell if said pathogen comes into contact with said substate.
35. The method of cl aim 34, wherein said substrate is selected from the group consisting of plants, fabric, water, skin and fur.
PCT/US2010/056351 2009-11-11 2010-11-11 Compositions and methods to protect cells by blocking entry of pathogen proteins Ceased WO2011060144A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US26022709P 2009-11-11 2009-11-11
US61/260,227 2009-11-11

Publications (2)

Publication Number Publication Date
WO2011060144A2 true WO2011060144A2 (en) 2011-05-19
WO2011060144A3 WO2011060144A3 (en) 2011-09-29

Family

ID=43992395

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/056351 Ceased WO2011060144A2 (en) 2009-11-11 2010-11-11 Compositions and methods to protect cells by blocking entry of pathogen proteins

Country Status (1)

Country Link
WO (1) WO2011060144A2 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102533852A (en) * 2012-02-24 2012-07-04 南京农业大学 Application of phytophthora sojae gene PsIR1 capable of inducing plant disease resistance
CN107881254A (en) * 2017-12-18 2018-04-06 福建省农业科学院植物保护研究所 Loop-mediated isothermal amplification method detects the primer and its detection method of ramie mould bacterium
CN110804615A (en) * 2019-11-04 2020-02-18 山东农业大学 Phytophthora capsici effector RxLR553394 gene and application thereof
CN110840901A (en) * 2019-12-12 2020-02-28 南京大学 Application of lysophosphatidylethanolamine 18:1 in preparation of medicines for relieving and treating inflammatory bowel diseases
IT201900008529A1 (en) * 2019-06-10 2020-12-10 Edmund Mach Fond Peptides with fungicidal activity, their compositions and related uses in the agronomic field
CN113121659A (en) * 2021-04-23 2021-07-16 南京林业大学 Phytophthora camphora effector protein Avh57 and application thereof
CN116004588A (en) * 2022-01-10 2023-04-25 西北农林科技大学 AGC protein kinase containing FYVE structural domain, encoding gene and application thereof

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6660263B2 (en) * 2000-05-18 2003-12-09 Hmv Corporation Oocydin and methods of use for protection of plants from Oomyocyte pathogens
KR20100058509A (en) * 2007-07-31 2010-06-03 메디뮨 엘엘씨 Multispecific epitope binding proteins and uses thereof

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102533852A (en) * 2012-02-24 2012-07-04 南京农业大学 Application of phytophthora sojae gene PsIR1 capable of inducing plant disease resistance
CN107881254A (en) * 2017-12-18 2018-04-06 福建省农业科学院植物保护研究所 Loop-mediated isothermal amplification method detects the primer and its detection method of ramie mould bacterium
IT201900008529A1 (en) * 2019-06-10 2020-12-10 Edmund Mach Fond Peptides with fungicidal activity, their compositions and related uses in the agronomic field
CN110804615A (en) * 2019-11-04 2020-02-18 山东农业大学 Phytophthora capsici effector RxLR553394 gene and application thereof
CN110840901A (en) * 2019-12-12 2020-02-28 南京大学 Application of lysophosphatidylethanolamine 18:1 in preparation of medicines for relieving and treating inflammatory bowel diseases
CN113121659A (en) * 2021-04-23 2021-07-16 南京林业大学 Phytophthora camphora effector protein Avh57 and application thereof
CN113121659B (en) * 2021-04-23 2021-10-22 南京林业大学 Phytophthora camphora effector protein Avh57 and application thereof
CN116004588A (en) * 2022-01-10 2023-04-25 西北农林科技大学 AGC protein kinase containing FYVE structural domain, encoding gene and application thereof

Also Published As

Publication number Publication date
WO2011060144A3 (en) 2011-09-29

Similar Documents

Publication Publication Date Title
US20140331365A1 (en) Compositions and methods to protect cells by blocking entry of pathogen proteins
US20100093601A1 (en) Compositions and methods to protect cells by blocking entry of pathogen proteins
Pandey et al. An oomycete effector subverts host vesicle trafficking to channel starvation-induced autophagy to the pathogen interface
WO2011060144A2 (en) Compositions and methods to protect cells by blocking entry of pathogen proteins
US20110165649A1 (en) Methods and compositions to improve the health of plants, animals and microbes by manipulating protein entry into symbionts and their hosts
Wang et al. Horizontally transferred salivary protein promotes insect feeding by suppressing ferredoxin-mediated plant defenses
Yu et al. A root‐knot nematode effector targets the Arabidopsis cysteine protease RD21A for degradation to suppress plant defense and promote parasitism
Margets et al. The soybean cyst nematode effector cysteine protease 1 (CPR1) targets a mitochondrial soybean branched-chain amino acid aminotransferase (GmBCAT1)
Zhang et al. Replication organelles of plant positive-strand RNA viruses: a boost in knowledge following new imaging approaches
Lange et al. The transient receptor potential (TRP) channel family in Colletotrichum graminicola: a molecular and physiological analysis
Lin et al. Translocon subunits of the COP9 signalosome complex are a central hub for regulating multiple photoresponsive processes and autophagic flux in Magnaporthe oryzae
CN103502270B (en) Antinematodal methods and compositions
Testi et al. An oomycete effector impairs autophagy in evolutionary distant organisms and favors host infection
Tomczynska et al. A cell biology study reveals new insights into the transport mechanisms of oomycete effectors
Sharma Role of Fusarium graminearum STE3 Receptor in Mediating Fungal Hyphal Chemotropism and Pathogenesis
Matz Annexins to the Rescue: First Responders to Fight Loss of Membrane Integrity in Neurospora crassa
Lin et al. COP9 signalosome complex subunit-7-mediated regulation of cAMP levels contributes to autophagic degradation and pathogenesis of rice blast fungus Magnaporthe oryzae
Carroll Sprayable formulations of dsRNA as a tool for management of Popillia japonica (Coleoptera: Scarabaeidae)
Prakash Functional Characterisation of SKP1 in Rice Blast Fungus (Magnaporthe oryzae)
Betts Identification of new pathogenicity genes in Magnaporthe oryzae through the construction of an Agrobacterium tumefaciens-mediated insertion mutant library
Putker The effector GpRBP-1, a cornerstone in understanding potato cyst nematode-host compatibility
Camborde Functional characterization of different candidate effectors from the root rot oomycete Aphanomyces euteiches
Hayes The influence of cyst nematodes on the plant secretory pathway
De Jong Cf-dependent early defence responses induced by avirulence proteins of the tomato pathogen: Cladosporium fulvum
Schultz-Larsen Suppression and triggering of Arabidopsis immunity by Albugo species

Legal Events

Date Code Title Description
NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 10830711

Country of ref document: EP

Kind code of ref document: A2