WO2011053465A1 - Antibodies to epha3 - Google Patents
Antibodies to epha3 Download PDFInfo
- Publication number
- WO2011053465A1 WO2011053465A1 PCT/US2010/052725 US2010052725W WO2011053465A1 WO 2011053465 A1 WO2011053465 A1 WO 2011053465A1 US 2010052725 W US2010052725 W US 2010052725W WO 2011053465 A1 WO2011053465 A1 WO 2011053465A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- region
- sequence
- amino acid
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- Eph receptor tyrosine kinases belong to a large group of receptor tyrosine kinases (RTKs), kinases that phosphorylate proteins on tyrosine residues. Ephs and their membrane bound ephrin ligands (ephrins) control cell positioning and tissue organization (Poliakov, A., et al, Dev Cell 7:465-80 (2004)). In contrast to other receptor tyrosine kinases, Eph receptor activation does not only require ligand binding and dimerization but also involves preformed ligand oligomers.
- tyrosine phosphorylation of Eph receptors requires presentation of ephrin ligands in their clustered or membrane-attached forms (Davis et al, Science 266:816-819 (1994)). Functional and biochemical Eph responses occur at higher ligand oligomerization states (Stein et al, Genes Dev 12:667-678 (1998)).
- Ephs and ephrins have been shown to play a role in vascular development.
- the de-regulated re-emergence of some ephrins and their receptors in adults also has been observed to contribute to tumor invasion, metastasis and neo-angiogenesis.
- dominant-negative, soluble EpbA2 or A3 proteins exhibit effects on ephrin-induced endothelial cell function in vitro, and tumor angiogenesis and progression in vivo (Nakamoto,.
- Epha3 has also been reported to be activated and overexpressed on CD34 + cells in chronic myeloid leukemia (CML) patients in the accelerated phase and blast crisis stage (Cilloni et al, American Society of Hematology, Abstract 1092, 2008 (available on line November 14, 2008)).
- Cilloni et al. reported that when primary CML cells or EphA3- transfected normal cells were incubated with a specific monoclonal antibody, the antibody induced a significant reduction of proliferation in primary cells and transfected cells, reduced colony growth and induced changes to the adhesion properties. The antibody did not induce any significant changes in normal control cells or cells from CML patient in the chronic stage.
- This invention is based, in part, on the discovery of new anti-EphA3 antibodies.
- an antibody of the invention comprises a V H region that comprises a CDR3 comprising the amino acid sequence X 1 GX 2 YEX3FDX 4 , wherein Xi is S or G, X 2 is Y or V, X 3 is E or D, and X 4 is S, V, or I, with the proviso that when the amino acid sequence is SGYYEDFDS the CDR1 is not SYWIN and when the amino acid sequence is SGYYEEFDS the CDR1 is not TYWIS.
- the antibody has a CDR3 that comprises the amino acid sequence
- the antibody has a J segment that comprises at least 80% identity, typically at 85%, or at least 90% identity, to a human germline J segment amino acid sequence; or that differs from a human germline J segment at no more than two positions; and a V-segment that comprises at least 80%> identity, typically at least 85%> identity, and preferably 90%> identity, or greater, to a human germ line V-segment amino acid sequence.
- the J segment comprises at least 90% identity to human JH6 amino acid sequence
- the V-segment comprises at least 90% identity to a human VH1 1-02 amino acid sequence.
- the antibody has an FR4 that comprises
- the antibody comprises a V H CDR1, or a V H CDR2, or both a V H CDR1 and a V H CDR2, as shown in a V H region set forth in Figure 1.
- an antibody of the invention can have a V H CDRl that has the amino acid sequence GYWMN, TYWIS, or SYWIN and/or a CDR2 that has the amino acid sequence
- the antibody has a V H CDRl GYWMN and a CDR2
- the antibody has a V H CDRl TYWIS and a V H CDR2 DIYPGSGNTNYAQ(K/E)F(Q/R/L)G.
- an antibody of the invention has the V H CDRl, CDR2, and CDR3 from one of the V regions as shown in Figure 1.
- the antibody has a V H V-segment amino acid sequence of a V-segment sequence shown in Figure 1.
- the V H has the sequence of a V H region set forth in Figure 1.
- the invention also provides an antibody that has a V L region that comprises a CDR3 binding specificity determinant having the sequence X 1 X 2 YX 3 X 4 YPYT, wherein Xi is G, V, or A; X 2 is Q, R, or G; X3 is A, S, or L; and X 4 is N or K.
- the CDR3 comprises GQYANYPYT, VQYAKYPYT, AQYANYPYT, VQYSNYPYT, VQYANYPYT, VGYANYPYT, VRYANYPYT, or VQYLNYPYT.
- the CDR3 when the CDR3 is VQYANYPYT, the CDRl is not RASQEISGYLG, or RASQGllSYLA and/or the CDR2 is not AASTLDS or AASSLQS.
- the V L region comprises a J segment that comprises at least 80% identity, typically at least 85% or 90% identity, to a human germline J segment amino acid sequence, or that differs no more than two amino acids from a human germline segment; and a V-segment that comprises at least 80% identity, typically at least 90% identity, or greater, to a human germ line V-segment amino acid sequence.
- the J segment has no more than two amino acid changes, often no more than one amino acid change, relative to the sequence FGQGKLEIK from the human germline JK2 amino acid sequence and the V-segment comprises at least 90% identity to human germline JKI L15 amino acid sequence.
- the FR4 of the antibody has the amino acid sequence FGQGKLEIK, or has no more than one amino acid residue changed relative to the sequence FGQGKLEIK.
- the V L region comprises a CDRl, or a CDR2, or both a CDRl and CDR2 of a sequence VL region shown in Figure 1.
- a CDRl can have the sequence RASQGllSYLA, QASQDISTYLN,
- the V L region comprises the CDRl, CDR2, and CDR3 of one of the V L regions set forth in Figure 1. In some
- the V L region comprises a V-segment that has a V-segment sequence as shown in Figure 1.
- the V L region has the sequence of a V L region set forth in Figure 1.
- the V H region of the antibody comprises any of the V H regions described in the preceding paragraph.
- the invention provide an antibody that comprises a V L region that has a CDR3 comprising GQYANYPYT, VQYAKYPYT, AQYANYPYT,
- the antibody comprises a heavy chain CDR3 comprising the amino acid sequence
- the heavy chain CDR3 comprises the amino acid sequence GGYYEDFDS, SGYYEEFDS, SGVYEDFDS, SGYYEDFDV, or SGYYEDFDI.
- the antibody comprises a light chain CDRl or CDR2 set forth in
- the antibody comprises a light chain CDRl and CDR2 as set forth in Figure 1 and/or a heavy chain CDRl and CDR2 set forth in Figure 1.
- the antibody comprises a V L V-segment set forth in Figure 1.
- the invention additionally provides an antibody that comprises a V H region comprising a CDR3 having the sequence SGYYE(E/D)FDS and a V L region CDR3 sequence set forth in the preceding paragraph, with the proviso that the V L region CDR3 sequence is not VQYANYPYT or VQYMNYPYT.
- the antibody comprises a heavy chain CDRl or CDR2 set forth in Figure 1, or a light chain CDRl or CDR2 set forth in Figure 1. In some embodiments, the antibody comprises a heavy chain CDRl and CDR2 as set forth in Figure 1 and/or a light chain CDRl and CDR2 set forth in Figure 1.
- an anti-EphA3 antibody of the invention comprises the V H CDRl, CDR2, and CDR3 from one of the V H regions set forth in Figure 1 and the V L CDRl, CDR2, and CDR3 from one of the V L regions set forth in Figure 1.
- An antibody of the invention can comprise a V H region as set forth in Figure 1 or a V L region as set forth in Figure 1. Often, the antibody comprises a V H region as set forth in Figure 1 and a V L region as set forth in Figure 1.
- the antibody comprises a combinations of V H and V L regions that comprise: a) SEQ ID NO: l and SEQ ID NO:20, b) SEQ ID NO:2 and SEQ ID NO: l 1, c) SEQ ID NO: 2 and SEQ ID NO: 12, d) SEQ ID NO:2 and SEQ ID NO:19, e) SEQ ID NO:2 and SEQ ID NO:21, f) SEQ ID NO:2 and
- SEQ ID NO:22 g) SEQ ID NO:2 and SEQ ID NO:23, h) SEQ ID NO:3 and SEQ ID NO: 11, i) SEQ ID NO:3 and SEQ ID NO: 12, j) SEQ ID NO:3 and SEQ ID NO:21, k) SEQ ID NO:3 and SEQ ID NO:22, 1) SEQ ID NO:4 and SEQ ID N0: 11, m) SEQ ID N0:4 and SEQ ID NO : 13 , n) SEQ ID NO :5 and SEQ ID NO : 11 , o) SEQ ID NO : 5 and SEQ ID NO : 13 , p) SEQ ID NO:5 and SEQ ID NO:21, q) SEQ ID NO:6 and SEQ ID NO: 14, r) SEQ ID NO:6 and SEQ ID NO: 15, s) SEQ ID NO: 7 and SEQ ID NO: 14, t) SEQ ID NO: 7 and SEQ ID NO: 15, u) SEQ ID NO:8
- an antibody of the invention e.g., that has a V H region sequence selected from the V H region sequences in Figure 1 and a V L region selected from the V L region sequences in Figure 1, has a monovalent affinity better than about 10 nM, and often better than about 5 nM or 1 nM as determined by surface plasmon resonance analysis performed at 37°C.
- the antibodies of the invention have an affinity (as measured using surface plasmon resonance) of about 10 nM, about 5 nM, about 2.5 nM, about 1 nM, about 0.5 nM, about 0.25 nM, or about 0.1 nM, or better.
- An antibody of the invention as described herein may have a V H region and/or a V L region that comprises a methionine at the N-terminus.
- the antibody is an IgG. In some embodiments, the antibody is an IgGl or an IgG3. In some embodiments, the antibody is an IgG2 or an IgG4. [0015] In some embodiments, the antibody comprises a heavy chain constant regions having the amino acid sequence set forth in SEQ ID NO:24 and/or a kappa light chain constant region having the amino acid sequence set forth in SEQ ID NO:25.
- the heavy chain constant region of an antibody is afucosylated.
- an antibody preparation comprising an antibody of the invention is hypofucosylated or afucosylated.
- an anti-EphA3 antibody of the invention has a heavy chain amino acid sequence and a light chain amino acid sequence that comprises SEQ ID NO:26 and SEQ ID NO:27, SEQ ID NO:28 and SEQ ID NO:29, SEQ ID NO:30 and SEQ ID NO:31, SEQ ID NO:32 and SEQ ID NO:33, SEQ ID NO:34 and SEQ ID NO:35, or SEQ ID NO:36 and SEQ ID NO:27, respectively; and the antibody is afucosylated.
- the antibody is a (Fab') 2 . [0019] In some embodiments the antibody is PEGylated. [0020] In some embodiments, the antibody activates EphA3.
- the antibody does not compete with a natural ligand, e.g., ephrin A5, for binding to EphA3.
- the invention provides a method of treating a patient that has an EphA3 -dependent disease, the method comprising administering an antibody of the invention as described herein to the patient in a therapeutically effective amount.
- the patient may, e.g., have a cancer.
- the antibody is administered to a patient that has a solid tumor that comprises tumor cells that express EphA3.
- the antibody is administered to a patient that as a tumor that does not have tumor cells that express EphA3.
- the antibody is administered to a patient that has a myeloproflierative disorder. In some embodiments, the antibody is administered to a patient that has acute myeloid leukemia or chronic myeloid leukemia. In some some embodiments, the antibody is administered to a patient that has a lymphoma. In some embodiments, the antibody is administered to a patient that has myelodysplastic syndrome, polycythemia vera, essential thrombocythemia, or idiopathic myelofibrosis.
- Figure 1 provides exemplary V H and V L sequences of anti-EphA3 antibodies of the invention.
- Figure 2 provides a schematic of a heavy chain CDR2/FR3 cassette construction.
- Figure 3 shows results of an antigen binding ELISA with anti-EphA3 IgGs.
- ELISA plates coated with EphA3-Fc were treated with chimeric IIIA4 (circles), an exemplary engineered antibody of the invention (squares) or a control IgG (triangles) and probed for binding with an anti-human kappa chain HRP conjugate.
- Figure 4 shows the specificity of an engineered antibody of the invention for EphA3.
- Various Eph proteins were coated onto an ELISA plate, treated with engineered antibody and probed for binding with an anti-human kappa chain HRP conjugate.
- Figure 5 shows data from flow cytometric analysis of three cell lines in an experiment evaluated the ability of an exemplary engineered anti-EphA3 antibody of the invention to bind to cell surface expressed EphA3.
- B16, SKmel28, and LnCAP cells were blocked with 2% BSA and rat IgG and probed with engineered anti-EphA3 IgG, chimeric IIIA4 IgG or an isotype control IgG.
- Bound antibody was detected by an anti-human IgG Phycoerythrin conjugate using a Facs Caliber flow cytometry (BD). Dead cells were excluded by propidium iodide staining.
- the control antibody profile is the left-most curve shown in the graph.
- Figure 6 provides data showing that an afucosylated anti-EphA3 antibody has enhanced ADCC activity against AML cells compared with the fucosylated anti-EphA3 antibody.
- EphA3 refers to the Eph receptor A3. This receptor has also been referred to as "Human embryo kinase”, “hek”, “eph-like tyrosine kinase 1", “etkl” or “tyro4". EphA3 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events.
- Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats.
- the ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
- EphA3 binds ephrin-A ligands.
- EphA3 nucleic acid and protein sequences are known.
- An exemplary human EphA3 amino acid sequence is available under accession number (EAW68857).
- EphA3 causes phosphorylation of EphA3.
- An antibody that activates EphA3, i.e., causes phosphorylation of EphA3, is therefore considered to be an agonist in the context of this invention.
- EphA3 can be activated by dimerization. Such activation can lead to phosphorylation and apoptosis, although not necessarily to cell rounding. Activation, e.g., when clustering of EphA3 occurs, can additionally lead to morphological changes, typically rounding of the cell.
- EphA3 antibody or “anti-EphA3 antibody” are used interchangeably to refer to an antibody that specifically binds to EphA3.
- the antibody can dimerize EphA3.
- the term encompasses antibodies that bind to EphA3 in the presence of ephrin ligand (e.g., ephrin A5) binding, as well as antibodies that bind to the ligand binding site and compete with ligand binding to EphA3.
- ephrin ligand e.g., ephrin A5
- EphA3 antibody that binds to EphA3 in the presence of binding of an ephrin ligand refers to an antibody that does not significantly prevent binding of an ephrin ligand, such as ephrin A5, to EphA3.
- an ephrin ligand such as ephrin A5
- the presence of such an antibody in a binding reaction comprising EphA3 and an ephrin ligand, e.g., ephrin A5 reduces ephrin ligand binding to EphA3 by less than about 30%, typically less than 20% or 10%>.
- mAb IIIA4 refers to monoclonal antibody IIIA4 that was originally raised against LK63 human acute pre-B leukemia cells to affinity isolate EphA3 (Boyd, et al. J Biol Chem 267:3262-3267, 1992). mAb IIIA4 binds to the native EphA3 globular ephrin- binding domain (e.g., Smith, et al., J. Biol. Chem 279:9522-9531, 2004). It is deposited in the European Collection of Animal Cell Cultures under accession no. 91061920 (see, e.g., EP patent no. EP0590030).
- an "antibody having an active isotype” as used herein refers to an antibody that has a human Fc region that binds to an Fc receptor present on immune effector cells.
- Active isotypes include IgGl, IgG3, IgM, IgA, and IgE.
- the term encompasses antibodies that have a human Fc region that comprises modifications, such as mutations or changes to the sugar composition and/or level of glycosylation, that modulate Fc effector function.
- Fc region refers to the constant region of an antibody excluding the first constant region immunoglobulin domain.
- Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region
- Fc may include the J chain.
- Fc comprises
- Fc region may refer to this region in isolation or this region in the context of an antibody or antibody fragment.
- Fc region includes naturally occurring allelic variants of the Fc region as well as modifications that modulate effector function. Fc regions also include variants that don't result in alterations to biological function.
- one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function.
- Such variants can be selected according to general rules known in the art so as to have minimal effect on activity (see, e.g., Bowie, et ah, Science 247:306-1310, 1990).
- the term "equilibrium dissociation constant” or “affinity” abbreviated (K D ) refers to the dissociation rate constant (kd, time "1 ) divided by the association rate constant (k a , time "1 M "1 ). Equilibrium dissociation constants can be measured using any known method in the art.
- the antibodies of the present invention are high affinity antibodies.
- Such antibodies have a monovalent affinity better (less) than about about 50 nM and often less than about 10 nM as determined by surface plasmon resonance analysis performed at 37°C.
- the antibodies of the invention have an affinity (as measured using surface plasmon resonance) of less than about 50 nM, typically less than about 25 nM, or even less than 10 nM, e.g., about 5 nM or about 1 nM.
- an affinity is "better” if it has a higher affinity, e.g., as evidenced by a lower numerical K D .
- an antibody refers to a protein functionally defined as a binding protein and structurally defined as comprising an amino acid sequence that is recognized by one of skill as being derived from the framework region of an immunoglobulin encoding gene of an animal producing antibodies.
- An antibody can consist of one or more
- polypeptides substantially encoded by immunoglobulin genes or fragments of
- immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as myriad
- a typical immunoglobulin (antibody) structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kD) and one "heavy” chain (about 50-70 kD). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the terms variable light chain (V L ) and variable heavy chain (V H ) refer to these light and heavy chains respectively.
- antibody includes antibody fragments that retain binding specificity. For example, there are a number of well characterized antibody fragments.
- pepsin digests an antibody C-terminal to the disulfide linkages in the hinge region to produce F(ab)'2, a dimer of Fab which itself is a light chain joined to VH-CH1 by a disulfide bond.
- the F(ab)'2 may be reduced under mild conditions to break the disulfide linkage in the hinge region thereby converting the (Fab')2 dimer into an Fab' monomer.
- the Fab' monomer is essentially an Fab with part of the hinge region (see, Fundamental
- antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that fragments can be synthesized de novo either chemically or by utilizing recombinant DNA methodology.
- antibody as used herein also includes antibody fragments either produced by the
- Antibodies include V H -V L dimers, including single chain antibodies (antibodies that exist as a single polypeptide chain), such as single chain Fv antibodies (sFv or scFv) in which a variable heavy and a variable light region are joined together (directly or through a peptide linker) to form a continuous polypeptide.
- the single chain Fv antibody is a covalently linked V H -V L which may be expressed from a nucleic acid including V H - and V L - encoding sequences either joined directly or joined by a peptide-encoding linker (e.g., Huston, et al. Proc. Nat. Acad. Sci. USA, 85:5879-5883, 1988). While the V H and V L are connected to each as a single polypeptide chain, the V H and V L domains associate non-covalently.
- the antibody can be another fragment.
- Other fragments can also be generated, e.g., using recombinant techniques, as soluble proteins or as fragments obtained from display methods.
- Antibodies can also include diantibodies and miniantibodies.
- Antibodies of the invention also include heavy chain dimers, such as antibodies from camelids.
- V-region refers to an antibody variable region domain comprising the segments of Framework 1, CDR1, Framework 2, CDR2, and Framework 3, including CDR3 and Framework 4, which segments are added to the V-segment as a consequence of rearrangement of the heavy chain and light chain V-region genes during B-cell differentiation.
- a "V-segment” as used herein refers to the region of the V-region (heavy or light chain) that is encoded by a V gene.
- the V-segment of the heavy chain variable region encodes FR1-CDR1-FR2-CDR2 and FR3.
- the V-segment of the light chain variable region is defined as extending though FR3 up to CDR3.
- J-segment refers to a subsequence of the variable region encoded comprising a C-terminal portion of a CDR3 and the FR4.
- a germline J-segment is encoded by an immunoglobulin J-gene segment.
- CDR complementarity-determining region
- the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
- the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three dimensional space.
- amino acid sequences of the CDRs and framework regions can be determined using various well known definitions in the art, e.g., Kabat, Chothia, international
- ImMunoGeneTics database IMGT
- AbM ImMunoGeneTics database
- IMGT ImMunoGeneTics database
- AbM AbM ⁇ see, e.g., Johnson et al, supra; Chothia & Lesk, 1987, Canonical structures for the hypervariable regions of immunoglobulins. J. Mol. Biol. 196, 901-917; Chothia C. et al., 1989, Conformations of immunoglobulin hypervariable regions. Nature 342, 877-883; Chothia C. et al, 1992, structural repertoire of the human VH segments J. Mol. Biol. 227, 799-817; Al-Lazikani et al, J.Mol.Biol 1997, 273(4)).
- antigen combining sites are also described in the following: Ruiz et al., IMGT, the international ImMunoGeneTics database. Nucleic Acids Res., 28, 219-221 (2000); and Lefranc,M.-P. IMGT, the international ImMunoGeneTics database. Nucleic Acids Res. Jan l;29(l):207-9 (2001); MacCallum et al, Antibody-antigen interactions: Contact analysis and binding site topography, J. Mol. Biol, 262 (5), 732-745 (1996); and Martin et al, Proc. Natl Acad. Sci.
- Epitopes refers to a site on an antigen to which an antibody binds.
- Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996).
- chimeric antibody refers to an immunoglobulin molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region, or portion thereof, having a different or altered antigen specificity; or with corresponding sequences from another species or from another antibody class or subclass.
- humanized antibody refers to an immunoglobulin molecule in CDRs from a donor antibody are grafted onto human framework sequences. Humanized antibodies may also comprise residues of donor origin in the framework sequences. The humanized antibody can also comprise at least a portion of a human immunoglobulin constant region. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences.
- Humanization can be performed using methods known in the art (e.g., Jones et al., Nature 321 :522-525; 1986; Riechmann et al., Nature 332:323-327, 1988; Verhoeyen et al., Science 239: 1534- 1536, 1988); Presta, Curr. Op. Struct. Biol. 2:593-596, 1992; U.S. Patent No. 4,816,567), including techniques such as "superhumanizing” antibodies (Tan et al, J. Immunol. 169: 1119, 2002) and "resurfacing” (e.g., Staelens et al, Mol. Immunol. 43: 1243, 2006; and Roguska et al, Proc. Natl. Acad. Sci USA 91 : 969, 1994).
- methods known in the art e.g., Jones et al., Nature 321 :522-525; 1986; Riechmann et al., Nature
- a “HumaneeredTM” antibody in the context of this invention refers to an engineered human antibody having a binding specificity of a reference antibody.
- a “ HumaneeredTM” antibody for use in this invention has an immunoglobulin molecule that contains minimal sequence derived from a donor immunoglobulin.
- an antibody is " HumaneeredTM” by joining a DNA sequence encoding a binding specificity determinant (BSD) from the CDR3 region of the heavy chain of the reference antibody to human V H segment sequence and a light chain CDR3 BSD from the reference antibody to a human V L segment sequence.
- BSD binding specificity determinant
- binding specificity determinant refers to the minimum contiguous or non-contiguous amino acid sequence within a CDR region necessary for determining the binding specificity of an antibody.
- the minimum binding specificity determinants reside within a portion or the full-length of the CDR3 sequences of the heavy and light chains of the antibody.
- a "human” antibody as used herein encompasses humanized and HumaneeredTM antibodies, as well as human monoclonal antibodies that are obtained using known techniques.
- a “hypofucosylated” antibody preparation refers to an antibody preparation in which less than 50% of the oligosaccharide chains contain al,6-fucose. Typically, less than about 40%), less than about 30%>, less than about 20%>, less than about 10%>, or less than 5%> or less than 1% of the oligosaccharide chains contain al,6-fucose in a "hypofucosylated” antibody preparation.
- An “afucosylated” antibody lacks al,6-fucose in the carbohydrate attached to the CH2 domain of the IgG heavy chain.
- heterologous when used with reference to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not normally found in the same relationship to each other in nature.
- the nucleic acid is typically recombinantly produced, having two or more sequences, e.g., from unrelated genes arranged to make a new functional nucleic acid.
- a heterologous protein will often refer to two or more subsequences that are not found in the same relationship to each other in nature.
- recombinant when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified.
- recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.
- nucleic acid By the term “recombinant nucleic acid” herein is meant nucleic acid, originally formed in vitro, in general, by the manipulation of nucleic acid, e.g., using polymerases and endonucleases, in a form not normally found in nature. In this manner, operably linkage of different sequences is achieved.
- an isolated nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined are both considered recombinant for the purposes of this invention.
- a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombinantly, i.e., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes of the invention.
- a "recombinant protein” is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as depicted above.
- EphA3 -dependent disease refers to a disease in which a cell that expresses EphA3 is a target for therapy to treat the disease.
- vasculogenic bone marrow precursor cells refers to bone-marrow- derived endothelial precursors and/or circulating endothelial cell precursor cells.
- cancer cell or "tumor cell” as used herein refers to a neoplastic cell.
- the term includes cancer cells that are benign as well as malignant. Neoplastic transformation is associated with phenotypic changes of the tumor cell relative to the cell type from which it is derived. The changes can include loss of contact inhibition, morphological changes, and aberrant growth, (see, Freshney, Culture of Animal Cells a Manual of Basic Technique (3 rd edition, 1994).
- “Inhibiting growth of a cancer” in the context of the invention refers to slowing growth and/or reducing the cancer cell burden of a patient that has cancer. “Inhibiting growth of a cancer” thus includes killing cancer cells as well as slowing or arresting cancer cell growth.
- therapeutic agent refers to an agent that when administered to a patient suffering from a disease, in a therapeutically effective dose, will cure, or at least partially arrest the symptoms of the disease and complications associated with the disease.
- nucleic acid sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues (or nucleotides) that are the same (i.e., about 60% identity, preferably 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%), 95%), 96%), 97%), 98%>, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site).
- sequences are then said to be “substantially identical.”
- “Substantially identical” sequences also includes sequences that have deletions and/or additions, as well as those that have substitutions, as well as naturally occurring, e.g., polymorphic or allelic variants, and man-made variants.
- the preferred algorithms can account for gaps and the like.
- a “comparison window”, as used herein, includes reference to a segment of one of the number of contiguous positions selected from the group consisting typically of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Methods of alignment of sequences for comparison are well-known in the art.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol.
- BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention.
- An indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross-reactive with the antibodies raised against the second polypeptide.
- a polypeptide is typically substantially identical to a second polypeptide, e.g., where the two peptides differ only by conservative substitutions.
- isolated refers to material that is substantially or essentially free from components that normally accompany it as found in its native state. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid
- a protein that is the predominant species present in a preparation is substantially purified.
- the term "purified” in some embodiments denotes that a protein gives rise to essentially one band in an electrophoretic gel. Preferably, it means that the protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99%> pure.
- polypeptide refers to a polymer of amino acid residues.
- the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers, those containing modified residues, and non-naturally occurring amino acid polymer.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ - carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
- Constantly modified variants applies to both amino acid and nucleic acid sequences.
- conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical or associated, e.g., naturally contiguous, sequences.
- a large number of functionally identical nucleic acids encode most proteins. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
- nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes silent variations of the nucleic acid.
- AUG which is ordinarily the only codon for methionine
- TGG which is ordinarily the only codon for tryptophan
- nucleic acid which encodes a polypeptide is implicit in a described sequence with respect to the expression product, but not with respect to actual probe sequences.
- amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art.
- Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
- conservative substitutions for one another 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
- the invention relates to antibodies that bind to EphA3 with high affinity and typically, activate EphA3.
- the antibodies comprise variable regions with a high degree of amino acid sequence identity to human germ- line V H and V L sequences.
- the CDRH3 of an antibody of the invention comprises the amino acid sequence XiGX 2 YE(X 3 )FDX 4 , wherein Xi is S or G, X 2 is Y or V, X 3 is E or D, and X 4 is S, V, or I, with the proviso that the amino acid sequence is not SGYYEDFDS.
- CDRL3 of an antibody of the invention comprises the amino acid sequence XiX 2 YX 3 X 4 YPYT, wherein Xi is V or A, X 2 is Q, R, or G, X 3 is A, S, or L, and X 4 is N or K.
- the portion of the CDR3 excluding the BSD and the complete FR4 are comprised of human germ-line sequences.
- the CDR3-FR4 sequence excluding the BSD differs from human germ-line sequences by not more than 2 amino acids on each chain.
- the J-segment comprises a human germline J-segment.
- Human germline sequences can be determined, for example, through the publicly available international ImMunoGeneTics database (IMGT) and V-base (on the worldwide web at vbase.mrc-cpe.cam.ac.uk).
- the human germline V- segment repertoire consists of 51 heavy chain V-regions, 40 K light chain V-segments, and 31 ⁇ light chain V-segments, making a total of 3,621 germline V-region pairs.
- allelic variants for most of these V- segments, but the contribution of these variants to the structural diversity of the germline repertoire is limited.
- sequences of all human germ-line V-segment genes are known and can be accessed in the V-base database, provided by the MRC Centre for Protein
- Antibodies or antibodies fragments as described herein can be expressed in prokaryotic or eukaryotic microbial systems or in the cells of higher eukaryotes such as mammalian cells.
- an antibody that is employed in the invention can be in any format.
- the antibody can be an including an constant region, e.g., a human constant region, e.g., an intact Ig Von a Fab, Fab', F(ab') 2 or a fragment of an intact
- immunoglobulin e.g., an scFv or Fv. II. Heavy Chains
- a heavy chain of an anti-EphA3 antibody of the invention comprises a heavy-chain V-region that comprises the following elements:
- a CDRH3 region comprising the amino acid sequence X 1 GX 2 YEX 3 FDX 4 , wherein Xi is S or G, X 2 is Y or V, X3 is E or D, and X 4 is S, V, or I, with the proviso that the amino acid sequence is not SGYYEDFDS; and
- the CDR3 comprises GGYYEDFDS, SGYYEEFDS, SGVYEDFDS, SGYYEDFDV, or SGYYEDFDI.
- the V-segment typically has at least 80% identity, or 85%, 90%, 95%, or greater identity to a human germline V-segment, e.g., a human VHl subclass.
- the V-segment is a human V H I 1-02 segment that at least 80%>, 85%>, 90%>, 95%, 96%, 97%, 98%, or 99% or greater, identity to the germ-line segment VHl 1-02.
- the V-segment differs by not more than 15 residues from VHl 1-02 and preferably not more than 10 residues.
- an antibody of the invention comprises a V-segment that has at least 90% identity, or at least 91%, 92% 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the germ-line segment VH 1-02; or to one of the V-segments of the V H regions shown in Figure 1.
- the FR4 sequence of the antibodies of the invention is provided by a human JH1 , JH3, JH4, JH5 or JH6 gene germline segment, or a sequence that has a high degree of amino- acid sequence identity, e.g., at least 90%> or 95% identity, or differs at not more than 3, typically at not more than 2 amino acid residues in comparison to a human germline JH segment.
- the J segment is from a human germline JH6 sequence and the FR4 has the sequence WGQGTTVT VS S .
- the V-segment of the V H region has a CDR1 and/or CDR2 as shown in Figure 1.
- an antibody of the invention may have a CDR1 that has the sequence GYWMN, TYWIS, or SYWIN.
- An antibody of the invention may have a CDR2 that has the sequence DIYPGSGNTNYDEKFQG, DIYPGSGNTNYAQKFQG,
- DIYPGSGNTNYAQEFRG DIYPGSGNTNYAQKFLG, or DIYPGSGNTNYDEKFKR.
- an anti-EphA3 antibody of the invention may have a V H region CDR3 that has the sequence GGYYEDFDS, SGYYEEFDS, SGVYEDFDS, SGYYEDFDV, or SGYYEDFDI, and a CDR1 sequence GYWMN, TYWIS, or SYWIN and a CDR2 DIYPGSGNTNYDEKFQG, DIYPGSGNTNYAQKFQG, DIYPGSGNTNYAQEFRG, DIYPGSGNTNYAQKFLG, or DIYPGSGNTNYDEKFKR.
- an anti-EphA3 antibody of the invention may have a V H region CDR3 that has the sequence SGYYEDFDS and a CDR1 and/or a CDR2 of a VH region set forth in Figure 1.
- a V H region V-segment of an antibody of the invention has a V-segment sequence shown in Figure 1.
- an antibody of the invention has a V H region sequence set forth in Figure 1.
- a light chain of an anti-EphA3 antibody of the invention comprises at light-chain V-region that comprises the following elements: 1) human light-chain V-segment sequences comprising FR1-CDR1-FR2-CDR2-
- CDRL3 region that has the sequence CDR3 that comprises the sequence X 1 X 2 YX 3 X 4 PYT, wherein Xj is V or A; X 2 is Q, R, or G; X 3 is A, S, or L; and X 4 is N or K; and
- the CDR3 has a sequence XiX 2 YX 3 X 4 YPYT, wherein Xi is V, X 2 is Q, X 3 is A, and X 4 is N.
- the V L CDR3 is GQYANYPYT, VQYAKYPYT, AQYANYPYT, VQYSNYPYT, VQYANYPYT, VGYANYPYT,
- the V L region comprises either a Vlambda or a Vkappa V-segment.
- An example of a Vkappa sequence that supports binding in combination with a complementary V f j-region is provided in Figure 1.
- the Vkappa segments may be of any subclass, e.g. and is often of the VKI sub-class.
- the segments have at least 80% sequence identity to a human germline VKI e.g., at least 80% identity to the human germ-line VKI L15 sequence.
- the VK segment may differ by not more than 5 residues from VKI L15
- the V L region V-segment of an antibody of the invention has at least 85% identity, or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the human kappa V-segment sequence of a V L region shown in Figure 1.
- the FR4 sequence of the V L region of an antibody of the invention is provided by a human germline J segment, e.g. or a sequence that has a high degree of amino-acid sequence identity to a human germline J segment.
- the J segment is a human germline JK2 sequence and the FR4 of the antibody has the sequence FGQGKLEIK.
- the V-segment of the V L region has a CDR1 and/or CDR2 as shown in Figure 1.
- an antibody of the invention may have a CDR1 sequence of RASQGIISYLA, QASQDISTYLN, RASQEISGYLG, or RASQSISSYLA and/or a CDR2 sequence AASSLQS, GASSLQS, AASSLQR, or AASTLDS.
- an anti-EphA3 antibody of the invention may have a V L region CDR1 and a CDR2 in a combination as shown in one of the V-segments of the V L regions set forth in Figure 1 and a V L region CDR3 sequence that comprises GQYANYPYT, VQYAKYPYT, AQYANYPYT, VQYSNYPYT, VQYANYPYT, VGYANYPYT,
- an anti-EphA3 antibody may comprise a V L region FR4 region that is FGQGKLEIK.
- a V L region of an anti-EphA3 antibody of the invention can comprise, e.g., a CDR3 GQYANYPYT, VQYAKYPYT, AQYANYPYT, VQYSNYPYT, VQYANYPYT, VGYANYPYT, VRYANYPYT, or
- VQYLNYPYT a CDRl sequence RASQGIISYLA, QASQDISTYLN, RASQEISGYLG, or RASQSISSYLA; and a CDR2 sequence AASSLQS, GASSLQS, AASSLQR, or AASTLDS.
- a V L region V-segment of an antibody of the invention has a V-segment sequence shown in Figure 1.
- an antibody of the invention has a V L region sequence set forth in Figure 1.
- an antibody of the invention comprises any one of the V L regions set forth in SEQ ID NOs: 11-23 with any one of the V H regions set forth in SEQ ID NOs: l-10.
- the affinity of an antibody may be assessed using well known assays to determine binding activity and affinity. Such techniques include ELISA assays as well as binding determinations that employ surface plasmon resonance or interferometry. For example, affinities can be determined by biolayer interferometry using a ForteBio (Mountain View, CA) Octet biosensor.
- Antibodies of the invention typically compete with mIIIA4 for binding to EphA3.
- the ability of an antibody described herein to block or compete with mIIIA4 for binding to EphA3 indicates that the antibody binds to the same epitope or to an epitope that is close to, e.g., overlapping, with the epitope that is bound by mIIIA4 for binding to EphA3.
- an antibody described herein e.g., an antibody comprising a V H and V L region combination as shown in the table provided in Figure 1 , can be used as a reference antibody for assessing whether another antibody competes for binding to EphA3.
- test antibody is considered to competitively inhibit binding of a reference antibody, if binding of the reference antibody to the antigen is reduced by at least 30%, usually at least about 40%>, 50%>, 60%) or 75%o, and often by at least about 90%>, in the presence of the test antibody.
- Many assays can be employed to assess binding, including ELISA, as well as other assays, such as immunoblots.
- the antibody is an activating antibody.
- An antibody may be tested to confirm that the antibody retains the activity of activating EphA3.
- the activity can be determined using any number of endpoints, including phosphorylation assays, or an indirect endpoint such as apopotosis.
- Antibody libraries may be expressed in a suitable host cell including mammalian cells, yeast cells or prokaryotic cells.
- a signal peptide can be introduced at the N-terminus to direct secretion to the extracellular medium.
- Antibodies may be secreted from bacterial cells such as E. coli with or without a signal peptide. Methods for signal-less secretion of antibody fragments from E. coli are described in US patent application 20070020685.
- one of the VH-regions of the invention e.g., shown in Figure 1
- one of the V L -regions of the invention e.g., shown in Figure 1
- expressed in any of a number of formats in a suitable expression system e.g., shown in Figure 1
- the antibody may be expressed as a scFv, Fab, Fab' (containing an immunoglobulin hinge sequence), F(ab') 2 , (formed by di-sulfide bond formation between the hinge sequences of two Fab' molecules), whole immunoglobulin or truncated immunoglobulin or as a fusion protein in a prokaryotic or eukaryotic host cell, either inside the host cell or by secretion.
- a methionine residue may optionally be present at the N-terminus, for example, in polypeptides produced in signal-less expression systems.
- Each of the VH-regions described herein may be paired with each of the VL regions to generate an anti-EphA3 antibody.
- Antibodies may be produced using any number of expression systems, including both prokaryotic and eukaryotic expression systems.
- the expression system is a mammalian cell expression, such as a CHO cell expression system. Many such systems are widely available from commercial suppliers.
- the VH and VL regions may be expressed using a single vector, e.g., in a discistronic expression unit, or under the control of different promoters.
- the VH and VL region may be expressed using separate vectors.
- a VH or VL region as described herein may optionally comprise a methionine at the N-terminus.
- An antibody of the invention may be produced in any number of formats, including as a Fab, a Fab', a F(ab') 2 , a scFv, or a dAB.
- An antibody of the invention can also include a human constant region.
- the constant region of the light chain may be a human kappa or lambda constant region.
- the heavy chain constant region is often a gamma chain constant region, for example, a gamma- 1, gamma-2, gamma-3, or gamma-4 constant region.
- the antibody may be an IgA or IgM.
- the antibody VL region e.g., a VL region set forth in Figure 1
- a human kappa constant region ⁇ e.g., SEQ ID NO:25
- the VH region is combined a human gamma- 1 constant region. Any suitable gamma- 1 allotype can be chosen. Thus, in some embodiments of the invention, in some
- the antibody is an IgG having a constant region, e.g., SEQ ID NO:24, that has a VH selected from a VH region sequence set forth in Figure 1.
- the antibody has a VL selected from the VL region sequences set forth in Figure 1.
- the antibody has a kappa constant region as set forth in SEQ ID NO:25, and a heavy chain constant region as set forth in SEQ ID NO:24, where the heavy and light chain variable regions comprise one of the following combinations from the sequences set forth in Figure 1.
- the antibody can be conjugated to another molecule, e.g., polyethylene glycol (PEGylation) or serum albumin, to provide an extended half-life in vivo .
- PEGylation polyethylene glycol
- serum albumin serum albumin
- the antibodies of the invention are in the form of a Fab' or a (Fab') 2 .
- a full-length light chain is generated by fusion of a VL-region to human kappa or lambda constant region.
- Either constant region may be used for any light chain; however, in typical embodiments, a kappa constant region is used in combination with a Vkappa variable region and a lambda constant region is used with a Vlambda variable region.
- the heavy chain of the Fab' is a Fd' fragment generated by fusion of a VH-region of the invention to human heavy chain constant region sequences, the first constant (CHI) domain and hinge region.
- the heavy chain constant region sequences can be from any of the immunoglobulin classes, but is often from an IgG, and may be from an IgGl, IgG2, IgG3 or IgG4.
- the Fab' antibodies of the invention may also be hybrid sequences, e.g., a hinge sequence may be from one immunoglobulin sub-class and the CHI domain may be from a different sub-class.
- An antibody that is employed in the invention can be in numerous formats.
- the antibody can include an Fc region, e.g., a human Fc region.
- such antibodies include IgG antibodies that bind EphA3 and that have an active isotype.
- the antibody can be an active fragment ⁇ e.g., it can dimerize EphA3) or derivative of an antibody such as an Fab, Fab', F(ab') 2 , Fv, scFv, or a single domain antibody ("dAb").
- the antibody may be a F(ab') 2 .
- Other exemplary embodiments of antibodies that can be employed in the invention include activating nanobodies or activating camellid antibodies.
- Such antibodies may additionally be recombinantly engineered by methods well known to persons of skill in the art. As noted above, such antibodies can be produced using known techniques. As appreciated by one of skill in the art, in some embodiments when an antibody is in a format that can be monovalent, e.g., an Fv or Fab format, the antibody may be employed as a multivalent antibody, such as a trivalent or tetravalent antibody. Methods of generating multivalent antibodies re known (see, e.g., King et al, Cancer Res. 54:6176-6185, 1994).
- an antibody for use in the invention has an Fc constant region that has an effector function, e.g., binds to an Fc receptor present on immune effector cells.
- effector functions include Clq binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors ⁇ e.g., B cell receptor), and the like.
- Such effector functions generally require the Fc region to be combined with a binding domain ⁇ e.g. an antibody variable domain) and can be assessed using known assays (see, e.g., the references cited hereinbelow.)
- a binding domain e.g. an antibody variable domain
- the Fc region can be from a naturally occurring IgGl, or other active isotypes, including IgG3, IgM, IgA, and IgE.
- active isotypes include antibodies where the Fc region comprises modifications to increase binding to the Fc receptor or otherwise improve the potency of the antibody.
- Such an Fc constant region may comprise modifications, such as mutations, changes to the level of glycosylation and the like, that increase binding to the Fc receptor.
- Fc receptors that have enhanced effector function, including modified binding affinity to one or more Fc ligands (e.g., FcyR, Clq). Additionally, such Fc variants have altered antibody- dependent cell-mediated cytotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) activity.
- Fc variants include those disclosed by Ghetie et al, Nat Biotech.
- Glycosylation is a form of post-translational modification by which carbohydrates (sugars) are enzymatically linked to macromolecules to produce glycans.
- carbohydrates are typically attached to antibody Fc region via one or more N-linkages (through a nitrogen of asparagine or arginine side chains); however, O- linkages (via hydroxy oxygen of serine, threonine, tyrosine, hydroxylysine, or hydroxyproline side chains) are also possible.
- IgG antibodies have a conserved N-linked glycosylation site in the CH2 domain at residue Asn297, while some classes and subclasses also have O-linked sugars, often in the hinge region, e.g. IgD and IgA of some species.
- the sugars are typically complex, high-mannose, branched sugars; in the case of N-linkages, the sugar that attaches directly to the amino acid sidechain nitrogen is typically N-acetyl glucosamine.
- the glycosylation of Fc regions may be modified.
- a modification may be aglycosylation, for example, by altering one or more sites of glycosylation within the antibody sequence.
- An Fc region can also be made that has an altered type of glycosylation, such as a hypofucosylated Fc variant having reduced amounts of fucosyl residues, or an afucosylated Fc variant lacking fucosyl residues,or an Fc variant having increased bisecting GlcNAc structures.
- Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered
- glycosylation machinery Cells with altered glycosylation machinery, including rat myeloma cells as well as yeast and plants, have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation.
- fucose Additional techniques for reducing fucose include ProBioGen technology (von Horsten et al, Glycobiology, (advance access publication July 23, 2010); PotelligentTM technology (Biowa, Inc. Princeton, N.J.); and GlycoMAbTM glycosylation engineering technology (GLYCART biotechnology AG, Zurich, Switzerland).
- N-linked oligosaccharide content of an antibody can be analyzed by methods known in the art. The following is an example of such a method: Antibodies are subjected to digestion with the enzyme N-glycosidase F (Roche; TaKaRa). Released carbohydrates are analyzed by matrix assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS) with positive ion mode (Papac et al., Glycobiol. 8: 445-454, 1998).
- MALDI-TOF MS matrix assisted laser desorption/ionization time-of-flight mass spectrometry
- Monosaccharide composition is then characterized by modified high-performance anion exchange chromatography (HPAEC) (Shinkawa et al., J. Biol. Chem. 278: 3466-3473, 2003).
- HPAEC high-performance anion exchange chromatography
- the antibody is additionally engineered to reduce immunogenicity, e.g., so that the antibody is suitable for repeat administration.
- Methods for generating antibodies with reduced immunogenicity include humanization and humaneering procedures and modification techniques such as de-immunization, in which an antibody is further engineered, e.g., in one or more framework regions, to remove T cell epitopes.
- antibodies are employed in a form that can activate EphA3 present on the surface of EphA3 -expressing cells, e.g., vasculogenic bone marrow precursor cells, or that can kill such cells by ADCC.
- an antibody is dimeric.
- the antibody may be in a monomeric form that has an active isotype.
- the antibody is in a multivalent form, e.g., a trivalent or tetravalent form, that can cross-link EphA3.
- the invention also provides methods of treating a patient that has a disease in which it is desirable to kill EphA3 -expressing cells.
- a disease may be a neoplastic disease.
- the invention provides a method of treating a neoplastic disease using an antibody of the invention where the method comprises administering an anti-EphA3 antibody of the invention to a patient (that has a tumor) to inhibit tumor growth.
- Tumors that can be treated include tumors of the breast, lung, colon, stomach, liver, kidney, ovary, esophagus, and prostate, and the others.
- a solid tumor treated with an antibody of the invention can therefore be a breast carcinoma, lung carcinoma, prostate carcinoma, gastric carcinoma, esophageal carcinoma, colorectal carcinoma, liver carcinoma, ovarian carcinoma, vulval carcinoma, kidney carcinoma, cervical carcinoma, endometrial carcinoma, choriocarcinoma, head and neck cancer, nasopharyngeal carcinoma, laryngeal carcinoma, hepatoblastoma, Kaposi's sarcoma, melanoma, skin carcinoma, hemangioma, cavernous hemangioma, hemangioblastoma, pancreatic carcinoma, retinoblastoma, astrocytoma, glioblastoma, Schwannoma, oligodendroglioma,
- medulloblastoma, neuroblastomas, sarcomas include fibrosarcomas, rhabdomyosarcoma, osteogenic sarcoma, leiomyosarcoma, urinary tract carcinoma, thyroid carcinoma, and Wilm's tumor.
- Abnormal vascular proliferation associated with phakomatoses, and edema can also be treated with an antibody of the invention.
- the anti-EphA3 antibody is administered to a patient that expresses EphA3 on the surface of the tumor cells. In some embodiments, the anti-EphA3 is administered to a patient that expresses EphA3 on the endothelium of blood vessels in the tumor. In some embodiments, the patient may express EphA3 on both the tumor cell surface and the endothelium. In some embodiments, the antibody is in a format as described, e.g., in WO/2008/112192. [0126] In some embodiments, a non-neoplastic condition is treated using an antibody of the invention.
- the non-neoplastic condition is selected from the group consisting of undesired or aberrant hypertrophy, arthritis, rheumatoid arthritis (RA), psoriasis, psoriatic plaques, sarcoidosis, atherosclerosis, atherosclerotic plaques, edema from myocardial infarction, diabetic and other proliferative retinopathies, retrolental fibroplasia, neovascular glaucoma, age-related macular degeneration, diabetic macular edema, corneal neovascularization, corneal graft neovascularization, corneal graft rejection, retinal/choroidal neovascularization, neovascularization of the angle (rubeosis), ocular neovascular disease, vascular restenosis, arteriovenous malformations (AVM), meningioma, hemangioma, angiofibroma, thyroid hyperplasias (including Grav
- an antibody of the invention is administered to a patient suffering from a myeloproliferative disorder.
- the myeloproliferative disorder is acute myeloid leukemia, chronic myeloid leukemia, myelodysplastic syndrome, polycythemia vera (PV), essential thrombocythemia (ET), or idiopathic myelofibrosis (IM).
- an anti-EphA3 antibody of the invention can be used in combination with one or more additional therapeutic agents to treat a patient that has chronic myeloid leukemia where leukemic stem cells from the patient express EphA3.
- therapeutic agents include various chemotherapeutic agents and imatinib mesylate (GLEEVEC®).
- the antibody may be administered alone, or in combination with other therapies to treat the disease of interest.
- the anti-EphA3 antibody is administered in combination with a Bv8 antagonist, e.g., a Bv8 antibody antagonist.
- Bv8 antagonists are known (see, e.g., WO 2009039337 and the references relating to Bv8 antagonists cited therein).
- Bv8 antagonists include, antibodies and antibody fragments specifically binding to a native sequence Bv8 polypeptide, or a native sequence Bv8 receptor (PKR-I /EG-VEGFRl or PKR-2/EG-VEGFR2) polypeptide.
- a patient may also be treated with additional therapeutic agents, including a VEGF antagonist, e.g., an anti-VEGF antibody antagonist, as well as other therapeutic agents, examples of which are additionally described below.
- the anti-EphA3 antibody is administered to a patient that has previously been treated with a VEGF antagonist, e.g. , an anti-VEGF antibody antagonist.
- the tumor may be refractory to treatment with a VEGF antagonist.
- the anti-EphA3 antibody is administered to a patient that has an early stage tumor, e.g., a Stage I, Stage II, or Stage III tumor.
- a patient that is considered to be refractory to treatment with a VEGF antagonist e.g., a VEGF antibody antagonist, or has a tumor that is refractory to treatment with a VEGF antagonist as used herein refers to a patient who responds to therapy, but suffer from side effects, develops resistance, does not respond to the therapy, does not respond satisfactorily to the therapy, etc.
- a VEGF antagonist e.g., a VEGF antibody antagonist
- a tumor that is refractory to treatment with a VEGF antagonist as used herein refers to a patient who responds to therapy, but suffer from side effects, develops resistance, does not respond to the therapy, does not respond satisfactorily to the therapy, etc.
- the number of tumor cells has not been significantly reduced, or has increased, or tumor size has not been significantly reduced, or has increased, or there is not further reduction in size or in number of cancer cells.
- a patient who has a non-neoplastic condition that is refractory to treatment with a VEGF antagonist in the context of this invention refers to a patient who does not respond satisfactorily to treatment with the VEGF antagonist, for example, the patient suffers side effects, develops resistance, or does not exhibit reduction in therapeutic indicators for the condition.
- the methods of the invention comprise administering an anti-EphA3 antibody as a pharmaceutical composition to a patient in a therapeutically effective amount using a dosing regimen suitable for treatment of the disease.
- the composition can be formulated for use in a variety of drug delivery systems.
- One or more physiologically acceptable excipients or carriers can also be included in the compositions for proper formulation. Suitable formulations for use in the present invention are found in Remington: The Science and Practice of Pharmacy, 21st Edition, Philadelphia, PA. Lippincott Williams & Wilkins, 2005.
- the anti-EphA3 antibody is provided in a solution suitable for injection into the patient such as a sterile isotonic aqueous solution for injection.
- the antibody is dissolved or suspended at a suitable concentration in an acceptable carrier.
- the carrier is aqueous, e.g., water, saline, phosphate buffered saline, and the like.
- compositions may contain auxiliary pharmaceutical substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, and the like.
- auxiliary pharmaceutical substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, and the like.
- the pharmaceutical compositions of the invention are administered to a patient, e.g., a patient that has a tumor or non-neoplastic condition, in an amount sufficient to cure or at least partially arrest the disease or symptoms of the disease and its complications. An amount adequate to accomplish this is defined as a "therapeutically effective dose.”
- a therapeutically effective dose is determined by monitoring a patient's response to therapy. Typical benchmarks indicative of a therapeutically effective dose include amelioration of symptoms of the disease in the patient.
- Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health, including other factors such as age, weight, gender, administration route, etc. Single or multiple administrations of the antibody may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the methods provide a sufficient quantity of anti-EphA3 antibody to effectively treat the patient.
- the antibody can be administered by injection or infusion through any suitable route including but not limited to intravenous, sub-cutaneous, intramuscular or intraperitoneal routes.
- the antibody may be administered by insufflation.
- the antibody may be stored at 10 mg/ml in sterile isotonic aqueous saline solution for injection at 4°C and is diluted in either 100 ml or 200 ml 0.9% sodium chloride for injection prior to administration to the patient.
- the antibody is administered by intravenous infusion over the course of 1 hour at a dose of between 0.2 and 10 mg/kg. In other embodiments, the antibody is administered by intravenous infusion over a period of between 15 minutes and 2 hours.
- the administration procedure is via sub-cutaneous bolus injection.
- the dose of antibody is chosen in order to provide effective therapy for the patient and is in the range of less than 0.1 mg/kg body weight to about 25 mg/kg body weight or in the range 1 mg - 2 g per patient. Preferably the dose is in the range 1 - 10 mg/kg or approximately 50 mg - 1000 mg / patient.
- the dose may be repeated at an appropriate frequency which may be in the range once per day to once every three months, depending on the pharmacokinetics of the antibody (e.g., half-life of the antibody in the circulation) and the pharmacodynamic response (e.g., the duration of the therapeutic effect of the antibody).
- the in vivo half-life of between about 7 and about 25 days and antibody dosing is repeated between once per week and once every 3 months. In other embodiments, the antibody is administered approximately once per month.
- a V H region and/or V L region of the invention may also be used for diagnostic purposes.
- the V H and/or V L region may be used for clinical analysis, such as detection of EphA3 levels on cells from a patient.
- a V H or V L region of the invention may also be used, e.g., to produce anti-Id antibodies.
- V-region DNA from murine monoclonal mIIIA4 were provided by Dr. Martin Lackmann (Department of Biochemistry and Molecular Biology, Monash University,
- Fab fragments were expressed by secretion from E. coli. Cells were grown in 2xYT medium to an OD 6 oo of 0.6. Expression was induced using IPTG for 3 hours at 33° C.
- Assembled Fabs were obtained from periplasmic fractions and purified by affinity chromatography using Streptococcal Protein G (HiTrap Protein G HP columns; GE
- the plate was washed three times with PBST and once with PBS.
- Eph extracellular (ec) domains were obtained from R&D Systems Inc: EphAl-Fc fusion protein, EphA2 ec domain, EphA5 ec domain, EphB4 ec domain and EphB6-Fc fusion protein.
- ELISA wells were coated with 100 ng of Eph protein for 1 hr at 37° C. After washing once with PBST, wells were blocked with 5%> milk in PBST at 37° C for one hour. Wells were washed once and a two fold dilution series of candidate humaneered antibody added to each set of coated Eph proteins.
- the wells were washed three times in PBST and 50 ⁇ of anti-human-kappa chain HRP conjugate (Sigma; diluted to 0.1 ng/ml in PBST) was added to each well.
- the plate was incubated for 45 minutes, washed 3 times with PBST, washed one with PBS and 100 ⁇ of TMB added to each well.
- the reaction was stopped by addition of 0.2N H 2 SO 4 and binding measured by absorbance at 450 nm.
- Chimeric IIIA4 IgG was constructed to contain human IgGl constant regions and variable regions from the original mouse IIIA4 antibody.
- PCR was used to amplify the heavy and light chains from mouse IIIA4 DNA provided by Martin Lackmann and also to incorporate restriction sites for cloning.
- the heavy chain variable region was cloned into a vector expressing the full IgGl heavy chain expressed from a CMV promoter located downstream of a UCOE sequence.
- the plasmid contains the Neo gene for selection in mammalian cells and the Amp gene for plasmid production in E.coli.
- the light chain variable region was cloned into a vector expressing the human kappa light chain constant region, expressed from a CMV promoter downstream of a UCOE sequence.
- the plasmid contains a gene for hygromycin selection in mammalian cells and the Amp gene for production in E. coli.
- Engineered antibody IgG heavy and light chain vectors were constructed similarly except the DNA for the variable regions was obtained from E. coli expression vectors described above and the heavy chain expression vector contained the puromycin resistance gene instead of neomycin.
- Humaneered antibody IgG and chimeric IIIA4 IgG were expressed in a modified CHO cell line by cotransfection of the heavy and light chain constructs using Fugene 6 reagent (Promega).
- Murine and Reference V-region Amino Acid Sequences Murine (mIIIA4) and a reference (FA4) V-region sequences are shown below. CDR sequences are underlined. mIIIA4 and FA4 Vh:
- the Fab FA4 has intact murine V-regions from mIIIA4 fused with human constant regions and was purified from E. coli. A dilution ELISA of Fab fragments binding to the antigen produced binding curves that were dependent on antibody concentration.
- Epitope-focused libraries were constructed from a human V-segment library sequences linked to the unique CDR3-FR4 region containing the BSD and human germ-line J-segment sequences.
- the "full-length" Vh (Vhl and Vh5) and Vk (Vkl) libraries were used as a base for construction of "cassette” libraries in which only part of the murine V-segment is initially replaced by a library of human sequences.
- cassettes "libraries” were constructed for both the Vh and Vk chains. Cassettes for the V-heavy and V-kappa chains were made by bridge PCR with overlapping common sequences within the framework 2 region.
- Vh CDR2-FR3 A cassette library consisting of Vh CDR2-FR3 was constructed.
- a schematic is shown in Figure 2.
- the first four residues (boxed) of the reference CDR2 were encoded by the 5 ' PCR primer.
- the underlined amino acid residues in the mIIIA4 CDR2 and the human germ- line Vhl -58 CDR2 were varied in pair -wise combination in the forward primer (shown by the amino acid residues above and below the line).
- the 3' PCR primer is complementary to human germ-line Vhl FR3.
- the primers were used to amplify and append a Hu Vhl FR3 library (derived from spleen mRNA) to the engineered CDR2 library.
- Consecutive bridge PCR reactions were used to attach "front end” and CDR3-FR4 cassettes to construct a functional V-region.
- Human Vh or Vk cassettes that supported binding to the antigen were identified by colony-lift binding assay and a rank order was determined according to affinity by ELISA.
- V-heavy screening identified "front-end”, "middle” and CDR2/FR3 cassettes that supported EphA3-Fc recombinant fusion protein antigen binding.
- V-kappa screening identified "front- end” and "middle” cassettes that supported antigen binding.
- the functional cassettes for each chain were recombined to construct a fully engineered, high affinity Fab that bound antigen.
- Vhl-02 Aligned V-segments of murine reference and two engineered Fabs amino acid sequences were compared with the closest single human germ-line V-gene, Vhl-02 or Vkl L15.
- the FR4 for the humaneered Fab Vh-regions is from human germ-line JH6 and has the sequence WGQGTTVTVSS.
- the FR4 for the humaneered Fab Vk-regions is from human germ-line Jk2 and has the sequence FGQGKLEIK.
- Each of the Vh-regions and Vk-regions of the engineered Fabs have a high homology to human germ-line amino acid sequence. Exemplary homologies are shown in Table 1.
- Engineered Fabs were isolated from colony-lift binding assays and affinity confirmed by antigen-binding ELISA. Engineered Fab clones with strong positive signals in antigen-binding ELISA were purified and further characterized by kinetic comparison with the optimized reference Fab FA106. [0154] Binding kinetics of two engineered Fabs and reference Fab FA106 were analyzed using a Biacore. The three Fabs were diluted from the starting concentration of 500 nM to 100 nM and further tested in a three-fold dilution series using PBS, pH 7.4 with 0.005% Tween-20 and 0.1 mg/ml BSA. Each of the five concentrations was tested three times over the three different density surfaces.
- the number in parentheses represents the standard error in the last reported digit based on the data from the three different density surfaces.
- the terms "low”, “medium”, and “high” in the left column refer to chip densities.
- Humaneered Fabl was expressed as an IgG in mammalian cells and purified from culture supernatant. Fab fragment was generated by papain digestion for analysis of monovalant binding affinity. Binding of Fab to human and mouse EphA3-Fc was measured on a Biacore 3000 using biotinylated EphA3 variants captured on a Streptavidin chip. Fab was diluted in HBSP running buffer from 50nM to 0.62nM with 3x dilutions. Results were double blanked with an empty reference cell and multiple HBSP buffer injections. Global fit analysis of the Biacore data was carried out assuming a 1 : 1 interaction. The binding kinetics parameters are shown in Table 3. The data show that Humaneered Fabl produced from mammalian cells binds with high affinity to both human and murine EphA3. Table 3 Engineered Fab 1 Binds Human and Mouse EphA3 with Comparable Affinity
- Binding of Fab 1 to immobilized mouse and human EphA3-Fc fusion proteins was analyzed by surface plasmon resonance analysis using a Biacore 3000 instrument and global fit analysis.
- k a association constant
- k d dissociation constant
- K D overall affinity
- a full-length antibody (IgGlK) was constructed, expressed from CHO cells and purified by Protein A affinity chromatography. ELISA plates were coated with EphA3-Fc and binding of cIIIA4 IgG, an exemplary engineered IgG, and a control IgGl were compared ( Figure 3). The EC50 in this assay was approximately three-fold lower for the engineered IgG than for the original chimeric antibody.
- EpbA3 is a member of the Eph receptor family which binds Ephrin ligands. The most homologous members of the family are the EphA receptors whose extracellular domains vary between 39% and 62% sequence identity to EphA3.
- EphA5 homology to EphA3 is 61% and represents one of the most homologous family members to EpbA3.
- the engineered antibody bound EphA3 specifically; binding was not observed to EpbAl, EphA2 or EphA5. There was also no detectable binding to either of two EphB receptors tested (EphB4 and EphB6).
- the exemplary engineered antibody was also tested for binding to EphA3 expressed on the surface of live cells.
- Three tumor cell lines known to express EphA3 were used: a mouse melanoma (B16), a human melanoma (SKmel28), and a prostate cancer line (LnCAP).
- Live cells were probed with the engineered IgG, chimeric IIIA4 or a control antibody.
- Bound antibody was detected using flow cytometry by an anti-human IgG phycoerythrin conjugate (Figure 5). Strong binding was observed for both the engineered IgG and Chimeric IIIA4 to B16 and SKmel28 cells. Both IgGs also bound LnCAP.
- Example 3 Evaluation of the ability of Fab and F(ab')2 fragments to induce apoptosis
- Fab fragments were generated by papain digestion of an exemplary engineered IgGl antibody of the invention (Abl) or control human IgGl antibody.
- One mg of antibody was incubated with O.Olmg of papain (Roche # 10108014001) in lOOmM Sodium Acetate pH 5.0 at 37°C for 18h.
- F(ab')2 was produced by pepsin digestion.
- Five mg of IgG was incubated with 250 ⁇ immobilized pepsin agarose slurry (Pierce # 20343) at 37°C for 18h in lOOmM Sodium Acetate pH 4.0.
- both digests were incubated with protein A resin for 30 minutes to remove Fc fragments and the supernatants were collected.
- Fab and F(ab') 2 fragments were dialyzed into 50mM Na Succinate pH 6.0, 145mM NaCl and 0.05% Tween 80.
- Antibody 1 was produced in two glycosylation forms by expression in different CHO cell lines.
- One form (fucosylated Antibody 1) has glycosylation patterns typical of an IgGlK (f-allotype) therapeutic antibody including a 1,6 fucose.
- the other form (designated afucosylated Antibody 1) is produced in a CHO cell line containing a homozygous deletion of the a- 1,6 fucosyl transferase gene FUT8 to prevent the addition of a- 1,6 fucose and is therefore afucosylated.
- ADCC NK-cell mediated antibody-dependent cellular cytotoxicity
- Afucosylated Antibody 1 shows increased ADCC activity against EphA3 -positive target cells compared with fucosylated Antibody 1 ( Figure 6).
- V L region sequences of anti-EphA3 antibodies of the invention are exemplary V L region sequences of anti-EphA3 antibodies of the invention:
- SEQ ID NO:24 Exemplary heavy chain constant region
- SEQ ID NO:25 Exemplary light chain constant region
- Exemplary antibodies of the invention (heavy chain and light chain sequences): SEQ ID NO:26 (heavy chain, antibody comprising SEQ ID NO:26/27) QVQLVQSGAEVKKPGAS VKVSCKASGYTFTGYWMNWVRQAPGQGLEWMGDIYPG SGNTNYDEKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSGYYEEFDSWGQ GTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRE
- SEQ ID NO:27 (light chain, antibody comprising SEQ ID NO:26/27)
- SEQ ID NO:28 (heavy chain, antibody comprising SEQ ID NO:28/29)
- SEQ ID NO:29 (light chain, antibody comprising SEQ ID NO:28/29)
- SEQ ID NO:30 (heavy chain, antibody comprising SEQ ID NO:30/31)
- SEQ ID NO:31 (light chain, antibody comprising SEQ ID NO:30/31)
- SEQ ID NO:32 (heavy chain, antibody comprising SEQ ID NO:32/33)
- SEQ ID NO:34 (heavy chain, antibody comprising SEQ ID NO:34/35)
Abstract
Description
Claims
Priority Applications (8)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201080056618.XA CN102666589B (en) | 2009-10-14 | 2010-10-14 | Antibodies to epha3 |
PL10777137T PL2488554T3 (en) | 2009-10-14 | 2010-10-14 | Antibodies to epha3 |
DK10777137.0T DK2488554T3 (en) | 2009-10-14 | 2010-10-14 | ANTIBODIES AGAINST EPHA3 |
JP2012534368A JP2013508292A (en) | 2009-10-14 | 2010-10-14 | Antibodies against EphA3 |
CA2777068A CA2777068C (en) | 2009-10-14 | 2010-10-14 | Antibodies to epha3 |
AU2010313621A AU2010313621C1 (en) | 2009-10-14 | 2010-10-14 | Antibodies to EphA3 |
EP10777137.0A EP2488554B1 (en) | 2009-10-14 | 2010-10-14 | Antibodies to epha3 |
ES10777137T ES2743558T3 (en) | 2009-10-14 | 2010-10-14 | EphA3 antibodies |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US25166809P | 2009-10-14 | 2009-10-14 | |
US61/251,668 | 2009-10-14 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2011053465A1 true WO2011053465A1 (en) | 2011-05-05 |
Family
ID=43499991
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2010/052725 WO2011053465A1 (en) | 2009-10-14 | 2010-10-14 | Antibodies to epha3 |
Country Status (11)
Country | Link |
---|---|
US (2) | US8664365B2 (en) |
EP (1) | EP2488554B1 (en) |
JP (2) | JP2013508292A (en) |
CN (1) | CN102666589B (en) |
AU (1) | AU2010313621C1 (en) |
CA (1) | CA2777068C (en) |
DK (1) | DK2488554T3 (en) |
ES (1) | ES2743558T3 (en) |
PL (1) | PL2488554T3 (en) |
PT (1) | PT2488554T (en) |
WO (1) | WO2011053465A1 (en) |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2582388A2 (en) * | 2010-06-18 | 2013-04-24 | Kalobios Pharmaceuticals, Inc. | Detection of epha3 as a marker of the presence of a solid tumor |
WO2018053032A1 (en) * | 2016-09-13 | 2018-03-22 | Humanigen, Inc. | Epha3 antibodies for the treatment of pulmonary fibrosis |
WO2023014182A1 (en) * | 2021-08-06 | 2023-02-09 | 한국생명공학연구원 | Novel anti-epha2 chimeric antigen receptor and immune cell expressing same |
US11795221B2 (en) | 2018-02-28 | 2023-10-24 | WuXi Biologics Ireland Limited | Monoclonal antibody against human LAG-3, method for preparing the same, and use thereof |
Families Citing this family (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2011235867B2 (en) * | 2010-04-01 | 2015-12-03 | Kalobios Pharmaceuticals, Inc. | EphA3 antibodies for the treatment of multiple myeloma |
AU2012295334A1 (en) | 2011-08-12 | 2013-05-02 | Kalobios Pharmaceuticals, Inc. | Methods of treating hematological proliferative disorders by targeting EphA3 expressed on aberrant vasculature in bone marrow |
ME03476B (en) * | 2013-08-01 | 2020-01-20 | Five Prime Therapeutics Inc | Afucosylated anti-fgfr2iiib antibodies |
WO2017091580A1 (en) | 2015-11-23 | 2017-06-01 | Five Prime Therapeutics, Inc. | Predicting response to cancer treatment with fgfr2 inhibitors |
CN110621336A (en) | 2017-05-16 | 2019-12-27 | 戊瑞治疗有限公司 | Combination of an anti-FGFR 2 antibody with a chemotherapeutic agent in the treatment of cancer |
US20210246215A1 (en) * | 2019-11-08 | 2021-08-12 | Humanigen, Inc. | Epha3 directed car-t cells for treatment of tumors |
WO2022087484A1 (en) * | 2020-10-23 | 2022-04-28 | Williams Katherine L | Antibodies to coronavirus sars-cov-2 |
Citations (32)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
WO1994002935A1 (en) | 1992-07-22 | 1994-02-03 | Sinvent A/S | Method and device for active noise reduction in a local area |
EP0590030A1 (en) | 1991-06-21 | 1994-04-06 | Amrad Corporation Limited | A receptor-type tyrosine kinase [human eph/elk-like kinase - hek] and use thereof |
US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
US5885573A (en) | 1993-06-01 | 1999-03-23 | Arch Development Corporation | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
WO2000061739A1 (en) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
US6165745A (en) | 1992-04-24 | 2000-12-26 | Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
US20050255552A1 (en) | 2004-01-20 | 2005-11-17 | Kalobios, Inc. | Antibody specificity transfer using minimal essential binding determinants |
US20060039904A1 (en) | 2004-08-16 | 2006-02-23 | Medimmune, Inc. | EPH receptor Fc variants with enhanced antibody dependent cell-mediated cytotoxicity activity |
US20060134098A1 (en) | 2004-11-16 | 2006-06-22 | Kalobios, Inc. | Immunoglobulin variable region cassette exchange |
US20060253928A1 (en) | 2002-03-19 | 2006-11-09 | Bakker Hendrikus A C | Optimizing glycan processing in plants |
US20070020685A1 (en) | 2005-07-22 | 2007-01-25 | Kalobios Pharmaceuticals, Inc. | Secretion of antibodies without signal peptides from bacteria |
US20070178551A1 (en) | 2000-06-28 | 2007-08-02 | Glycofi, Inc. | Methods for producing modified glycoproteins |
US20070248600A1 (en) | 2006-04-11 | 2007-10-25 | Silke Hansen | Glycosylated antibodies |
US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
WO2008060092A1 (en) | 2006-11-17 | 2008-05-22 | Sang Yun Park | Rotative force generator |
WO2008112192A2 (en) | 2007-03-08 | 2008-09-18 | Kalobios Pharmaceuticals, Inc. | Epha3 antibodies for the treatment of solid tumors |
WO2009039337A2 (en) | 2007-09-21 | 2009-03-26 | Genentech, Inc. | Inhibition of angiogenesis |
WO2010102244A1 (en) * | 2009-03-06 | 2010-09-10 | Kalobios Pharmaceuticals, Inc. | Treatment of leukemias and chronic myeloproliferative diseases with antibodies to epha3 |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006052409A2 (en) * | 2004-10-23 | 2006-05-18 | Case Western Reserve University | Peptide and small molecule agonists of epha and their uses |
-
2010
- 2010-10-14 JP JP2012534368A patent/JP2013508292A/en active Pending
- 2010-10-14 PL PL10777137T patent/PL2488554T3/en unknown
- 2010-10-14 US US12/904,953 patent/US8664365B2/en active Active
- 2010-10-14 PT PT10777137T patent/PT2488554T/en unknown
- 2010-10-14 CN CN201080056618.XA patent/CN102666589B/en active Active
- 2010-10-14 CA CA2777068A patent/CA2777068C/en active Active
- 2010-10-14 WO PCT/US2010/052725 patent/WO2011053465A1/en active Application Filing
- 2010-10-14 DK DK10777137.0T patent/DK2488554T3/en active
- 2010-10-14 AU AU2010313621A patent/AU2010313621C1/en active Active
- 2010-10-14 ES ES10777137T patent/ES2743558T3/en active Active
- 2010-10-14 EP EP10777137.0A patent/EP2488554B1/en active Active
-
2013
- 2013-12-30 US US14/143,427 patent/US9290571B2/en active Active
-
2015
- 2015-11-25 JP JP2015229465A patent/JP2016094424A/en active Pending
Patent Citations (37)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
EP0590030A1 (en) | 1991-06-21 | 1994-04-06 | Amrad Corporation Limited | A receptor-type tyrosine kinase [human eph/elk-like kinase - hek] and use thereof |
US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
US6165745A (en) | 1992-04-24 | 2000-12-26 | Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
WO1994002935A1 (en) | 1992-07-22 | 1994-02-03 | Sinvent A/S | Method and device for active noise reduction in a local area |
US5885573A (en) | 1993-06-01 | 1999-03-23 | Arch Development Corporation | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
US6821505B2 (en) | 1997-03-03 | 2004-11-23 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
US7335742B2 (en) | 1999-01-15 | 2008-02-26 | Genentech, Inc. | Polypeptide variants with altered effector function |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
US7214775B2 (en) | 1999-04-09 | 2007-05-08 | Kyowa Hakko Kogyo Co., Ltd. | Method of modulating the activity of functional immune molecules |
WO2000061739A1 (en) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
US20070178551A1 (en) | 2000-06-28 | 2007-08-02 | Glycofi, Inc. | Methods for producing modified glycoproteins |
US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
US20060253928A1 (en) | 2002-03-19 | 2006-11-09 | Bakker Hendrikus A C | Optimizing glycan processing in plants |
WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
US20050255552A1 (en) | 2004-01-20 | 2005-11-17 | Kalobios, Inc. | Antibody specificity transfer using minimal essential binding determinants |
US20060039904A1 (en) | 2004-08-16 | 2006-02-23 | Medimmune, Inc. | EPH receptor Fc variants with enhanced antibody dependent cell-mediated cytotoxicity activity |
US20060134098A1 (en) | 2004-11-16 | 2006-06-22 | Kalobios, Inc. | Immunoglobulin variable region cassette exchange |
US20070020685A1 (en) | 2005-07-22 | 2007-01-25 | Kalobios Pharmaceuticals, Inc. | Secretion of antibodies without signal peptides from bacteria |
US20070248600A1 (en) | 2006-04-11 | 2007-10-25 | Silke Hansen | Glycosylated antibodies |
WO2008060092A1 (en) | 2006-11-17 | 2008-05-22 | Sang Yun Park | Rotative force generator |
WO2008112192A2 (en) | 2007-03-08 | 2008-09-18 | Kalobios Pharmaceuticals, Inc. | Epha3 antibodies for the treatment of solid tumors |
WO2009039337A2 (en) | 2007-09-21 | 2009-03-26 | Genentech, Inc. | Inhibition of angiogenesis |
WO2010102244A1 (en) * | 2009-03-06 | 2010-09-10 | Kalobios Pharmaceuticals, Inc. | Treatment of leukemias and chronic myeloproliferative diseases with antibodies to epha3 |
Non-Patent Citations (89)
Title |
---|
"Current Protocols in Molecular Biology", 1995 |
"Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996 |
"Fundamental Immunology", 1993, RAVEN PRESS |
"Remington: The Science and Practice ofPharmacy", 2005, LIPPINCOTT WILLIAMS & WILKINS |
ALEGRC ET AL., TRANSPLANTATION, vol. 57, 1994, pages 1537 - 1543 |
AL-LAZIKANI ET AL., JMOL.BÍOL, vol. 273, no. 4, 1997 |
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402 |
ANONYMOUS: "Study of KB004 in Subjects With Hematologic Malignancies", 21 September 2010 (2010-09-21), XP002620037, Retrieved from the Internet <URL:http://clinicaltrials.gov/ct2/show/NCT01211691> [retrieved on 20110201] * |
ARMOUR ET AL., EUR J IMMUNOL, vol. 29, 1999, pages 2613 - 2624 |
ARRUGA FRANCESCA ET AL: "EphA3 is abnormally expressed in chronic myeloprolipherative disorders and could represent a new molecular target", PROCEEDINGS OF THE ANNUAL MEETING OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, AMERICAN ASSOCIATION FOR CANCER RESEARCH, US, vol. 50, 1 April 2009 (2009-04-01), pages 692, XP009137278, ISSN: 0197-016X * |
BOOTH, C. ET AL., NAT MED, vol. 8, 2002, pages 1360 - 1 |
BOWIE ET AL., SCIENCE, vol. 247, 1990, pages 306 - 1310 |
BOYD ET AL., JBIOL CHEM, vol. 267, 1992, pages 3262 - 3267 |
BRANTLEY ET AL., ONCOGENE, vol. 21, 2002, pages 7011 - 26 |
BRANTLEY-SIEDERS ET AL., CURR PHARM DES, vol. 10, 2004, pages 3431 - 42 |
CHAPMAN ET AL., NATURE BIOTECH., vol. 17, 1999, pages 780 |
CHCNG ET AL., NEOPLASIA, vol. 5, 2003, pages 445 - 56 |
CHOTHIA C. ET AL.: "Conformations of immunoglobulin hypervariable regions", NATURE, vol. 342, 1989, pages 877 - 883, XP002030586, DOI: doi:10.1038/342877a0 |
CHOTHIA C. ET AL.: "structural repertoire of the human VH segments", J. MOL. BIOL., vol. 227, 1992, pages 799 - 817, XP024020608, DOI: doi:10.1016/0022-2836(92)90224-8 |
CHOTHIA ET AL., J MOL BIOL, vol. 227, 1992, pages 776 - 798 |
CHOTHIA; LESK: "Canonical structures for the hypervariable regions of immunoglobulins", J. MOL. BIOL., vol. 196, 1987, pages 901 - 917, XP024010426, DOI: doi:10.1016/0022-2836(87)90412-8 |
CILLONI DANIELA ET AL: "EphA3 Kinase Is Constitutively Activated in Chronic Myeloid Leukaemia during Progression to Accelerated and Blast Crisis and It Could Represent a New Molecular Target", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 112, no. 11, 1 November 2008 (2008-11-01), pages 399, XP009137279, ISSN: 0006-4971 * |
CILLONI ET AL., AMERICAN SOCIETY OF HEMATOLOGY, 14 November 2008 (2008-11-14) |
DATABASE REGISTRY [Online] CHEMICAL ABSTRACTS SERVICE, COLUMBUS, OHIO, US; 28 July 2010 (2010-07-28), anonymous: "Immunoglobulin G1, anti-(human EphA receptor EphA3) (human monoclonal KB004 heavy chain), disulfide with human monoclonal KB004 kappa-chain, dimer", XP002620038, retrieved from STN Database accession no. 1234137-51-9 * |
DAVIES ET AL., BIOTECHNOL. BIOENG., vol. 74, 2001, pages 288 - 294 |
DAVIS ET AL., SCIENCE, vol. 266, 1994, pages 816 - 819 |
DOBRZANSKI ET AL., CANCER RES, vol. 64, 2004, pages 910 - 9 |
DUNCAN ET AL., NATURE, vol. 332, 1988, pages 563 - 564 |
FRESHNEY: "Culture of Animal Cells a Manual of Basic Technique", 1994 |
GHETIE ET AL., NAT BIOTECH., vol. 15, 1997, pages 637 - 40 |
HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915 |
HUMPHREYS ET AL., PROTEIN ENG. DES., vol. 20, 2007, pages 227 |
HUSTON ET AL., PROC. NAT. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
HUTCHINS ET AL., PROC NATL. ACAD SCI USA, vol. 92, 1995, pages 11980 - 11984 |
IDUSOGIE ET AL., J IMMUNOL, vol. 166, 2001, pages 2571 - 2575 |
IDUSOGIE ET AL., JLMMUNOL, vol. 164, pages 4178 - 4184 |
JEFFERIS ET AL., IMMUNOL LETT, vol. 54, 1996, pages 101 - 104 |
JEFFERIS ET AL., IMMUNOL LETT, vol. 82, 2002, pages 57 - 65 |
JEFFERIS ET AL., IMMUNOL LETT., vol. 44, 1995, pages 111 - 117 |
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
KABAT ET AL.: "National Technical Information Service", 1991, NIH PUBLICATION, pages: 91 - 3242 |
KANDA ET AL., GLYCOBIOLOGY, vol. 17, 2006, pages 104 - 118 |
KING ET AL., CANCER RES., vol. 54, 1994, pages 6176 - 6185 |
KNIGHT ET AL., PLATELETS, vol. 15, 2004, pages 409 |
LAZAR ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 4005 - 4010 |
LEFRANC,M.-P.: "IMGT, the international ImMunoGeneTics database", NUCLEIC ACIDS RES., vol. 29, no. 1, 1 January 2001 (2001-01-01), pages 207 - 9, XP002281078, DOI: doi:10.1093/nar/29.1.207 |
LIST A: "Developmental therapeutics for MDS", LEUKEMIA RESEARCH, vol. 33, no. Suppl. 1, May 2009 (2009-05-01), & 10TH INTERNATIONAL SYMPOSIUM ON MYELODYSPLASTIC SYNDROMES; PATRAS, GREECE; MAY 06 -09, 2009, pages S27 - S28, XP002620034, ISSN: 0145-2126 * |
LUND ET AL., FASEB J, vol. 9, 1995, pages 115 - 119 |
LUND ET AL., J IMMUNOL, vol. 157, 1996, pages 4963 - 4969 |
LUND ET AL., J. IMMUNOL, vol. 147, 1991, pages 2657 - 2662 |
LUND ET AL., MOLLMMUNOL, vol. 29, 1992, pages 53 - 59 |
MACCALLUM ET AL.: "Antibody-antigen interactions: Contact analysis and binding site topography", J. MOL. BIOI., vol. 262, no. 5, 1996, pages 732 - 745, XP002242391, DOI: doi:10.1006/jmbi.1996.0548 |
MARME, D., ANN HEMATOL, vol. 81, no. 2, 2002, pages 566 |
MARTIN ET AL., METHODS ENZYMOL., vol. 203, 1991, pages 121 - 153 |
MARTIN ET AL., PROC. NATL ACAD. SCI. USA, vol. 86, 1989, pages 9268 - 9272 |
NAKAMOTO ET AL., MICROSC RES TECH, vol. 59, 2002, pages 58 - 67 |
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, no. 443, 1970 |
NIWA ET AL., CLINC. CANCER RES., vol. 1, 2004, pages 6248 - 6255 |
PALATH VARGHESE ET AL: "A Recombinant Human Antibody to EphA3 with Pro-Apoptotic and Enhanced ADCC Activity Shows Selective Cytotoxicity against Myeloid Leukemia Cells and CD123-Positive Leukemic Stem Cells", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 114, no. 22, 20 November 2009 (2009-11-20), pages 688, XP009137260, ISSN: 0006-4971 * |
PAPAC ET AL., GLYCOBIOL, vol. 8, 1998, pages 445 - 454 |
PEARSON; LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
PEDERSEN ET AL., IMMUNOMETHODS, vol. 1, 1992, pages 126 |
PEDLEY ET AL., BR. J. CANCER, vol. 70, 1994, pages 1126 |
POLIAKOV, A. ET AL., DEV CELL, vol. 7, 2004, pages 465 - 80 |
PRESTA ET AL., BIOCHEM SOC TRANS, vol. 30, 2002, pages 487 - 490 |
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596 |
REDDY ET AL., J IMMUNOL, vol. 164, 2000, pages 1925 - 1933 |
REES ET AL.: "Protein Structure Prediction", 1996, OXFORD UNIVERSITY PRESS, pages: 141 - 172 |
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
ROGUSKA ET AL., PROC. NATL. ACAD. SCI USA, vol. 91, 1994, pages 969 |
RUIZ ET AL.: "the international ImMunoGeneTics database", NUCLEIC ACIDS RES., vol. 28, 2000, pages 219 - 221 |
SHIELDS ET AL., J BIOL CHEM, vol. 277, 2002, pages 26733 - 26740 |
SHIELDS ET AL., JBIOL CHEM, vol. 276, 2001, pages 6591 - 6604 |
SHINKAWA ET AL., J BIOL CHEM, vol. 278, 2003, pages 3466 - 3473 |
SHINKAWA ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 3466 - 3473 |
SMITH ET AL., J. BIOL. CHEM, vol. 279, 2004, pages 9522 - 9531 |
SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
STAELENS ET AL., MOL. IMMUNOL., vol. 43, 2006, pages 1243 |
STEIN ET AL., GENES DEV, vol. 12, 1998, pages 667 - 678 |
TAN ET AL., J. LMMUNOL., vol. 169, 2002, pages 1119 |
TOMLINSON ET AL., EMBO J, vol. 14, 1995, pages 4628 - 4638 |
UMANA ET AL., NAT. BIOTECHNOL, vol. 17, 1999, pages 176 - 180 |
VEARING CHRISTOPHER ET AL: "Concurrent binding of anti-EphA3 antibody and ephrin-A5 amplifies EphA3 signaling and downstream responses: Potential as EphA3-specific tumor-targeting reagents", CANCER RESEARCH, AMERICAN ASSOCIATION FOR CANCER REREARCH, US, vol. 65, no. 15, 1 August 2005 (2005-08-01), pages 6745 - 6754, XP002493162, ISSN: 0008-5472, DOI: DOI:10.1158/0008-5472.CAN-05-0758 * |
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
VON HORSTEN ET AL., GLYCOBIOLOGY, 23 July 2010 (2010-07-23) |
WILLIAMS ET AL., J MOL BIOL, vol. 264, 1996, pages 220 - 232 |
XU ET AL., CELL IMMNUNOL, vol. 200, 2000, pages 16 - 26 |
YAMANE-OHNUKI N ET AL: "Establishment of FUT8 knockout chinese hamster ovary cells: an ideal host cell line for producing completely defucosylated antibodies with enhanced antibody-dependent cellular cytotoxicity", BIOTECHNOLOGY AND BIOENGINEERING, WILEY & SONS, HOBOKEN, NJ, US, vol. 87, no. 5, 6 August 2004 (2004-08-06), pages 614 - 622, XP002983758, ISSN: 0006-3592, DOI: DOI:10.1002/BIT.20151 * |
Cited By (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2582388A2 (en) * | 2010-06-18 | 2013-04-24 | Kalobios Pharmaceuticals, Inc. | Detection of epha3 as a marker of the presence of a solid tumor |
EP2582388A4 (en) * | 2010-06-18 | 2014-04-16 | Kalobios Pharmaceuticals Inc | Detection of epha3 as a marker of the presence of a solid tumor |
WO2018053032A1 (en) * | 2016-09-13 | 2018-03-22 | Humanigen, Inc. | Epha3 antibodies for the treatment of pulmonary fibrosis |
US11795221B2 (en) | 2018-02-28 | 2023-10-24 | WuXi Biologics Ireland Limited | Monoclonal antibody against human LAG-3, method for preparing the same, and use thereof |
WO2023014182A1 (en) * | 2021-08-06 | 2023-02-09 | 한국생명공학연구원 | Novel anti-epha2 chimeric antigen receptor and immune cell expressing same |
Also Published As
Publication number | Publication date |
---|---|
PT2488554T (en) | 2019-09-13 |
US20140120114A1 (en) | 2014-05-01 |
PL2488554T3 (en) | 2020-03-31 |
AU2010313621A1 (en) | 2012-05-03 |
US9290571B2 (en) | 2016-03-22 |
CN102666589B (en) | 2014-08-20 |
DK2488554T3 (en) | 2019-09-02 |
EP2488554B1 (en) | 2019-07-24 |
ES2743558T3 (en) | 2020-02-19 |
CA2777068A1 (en) | 2011-05-05 |
CA2777068C (en) | 2020-05-26 |
AU2010313621C1 (en) | 2015-11-26 |
CN102666589A (en) | 2012-09-12 |
US20110123549A1 (en) | 2011-05-26 |
EP2488554A1 (en) | 2012-08-22 |
US8664365B2 (en) | 2014-03-04 |
JP2013508292A (en) | 2013-03-07 |
JP2016094424A (en) | 2016-05-26 |
AU2010313621B2 (en) | 2015-07-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2010313621B2 (en) | Antibodies to EphA3 | |
DK2941302T3 (en) | ANTIBODIES BINDING TO TL1A AND THEIR USES | |
KR20180028519A (en) | Anti-TfR antibodies and uses thereof in the treatment of proliferative and inflammatory disorders | |
CA2722137A1 (en) | Antibodies to granulocyte-macrophage colony-stimulating factor | |
MX2013015061A (en) | Anti-cxcr4 antibody with effector functions and its use for the treatment of cancer. | |
JP2017536101A (en) | Antibodies that bind to CCR6 and uses thereof | |
US11639393B2 (en) | Anti-CCR8 antibodies | |
TW201121569A (en) | Treatment of cancer involving mutated KRAS or BRAF genes | |
US9045539B2 (en) | Anti-EMR1 antibodies | |
WO2022166846A1 (en) | Anti-tnfr2 antibody and use thereof | |
WO2022052846A1 (en) | Anti-cd47 antibody and use thereof | |
WO2022242681A1 (en) | Anti-cea antibodies and methods of use | |
WO2022079199A1 (en) | Binding molecules that multimerise cd45 | |
CN117642428A (en) | Antibodies to | |
NZ618655B2 (en) | Anti-cxcr4 antibody with effector functions and its use for the treatment of cancer. |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WWE | Wipo information: entry into national phase |
Ref document number: 201080056618.X Country of ref document: CN |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10777137 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2010313621 Country of ref document: AU Ref document number: 2777068 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2012534368 Country of ref document: JP |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2010777137 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2010313621 Country of ref document: AU Date of ref document: 20101014 Kind code of ref document: A |