WO2011000693A1 - Process for the preparation of testosterone - Google Patents

Process for the preparation of testosterone Download PDF

Info

Publication number
WO2011000693A1
WO2011000693A1 PCT/EP2010/058411 EP2010058411W WO2011000693A1 WO 2011000693 A1 WO2011000693 A1 WO 2011000693A1 EP 2010058411 W EP2010058411 W EP 2010058411W WO 2011000693 A1 WO2011000693 A1 WO 2011000693A1
Authority
WO
WIPO (PCT)
Prior art keywords
enzyme
dehydrogenase
process according
solution
cofactor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2010/058411
Other languages
French (fr)
Inventor
Stefano Fogal
Elisabetta Bergantino
Riccardo Motterle
Andrea Castellin
Giancarlo Arvotti
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Fabbrica Italiana Sintetici SpA (FIS)
Original Assignee
Fabbrica Italiana Sintetici SpA (FIS)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Fabbrica Italiana Sintetici SpA (FIS) filed Critical Fabbrica Italiana Sintetici SpA (FIS)
Priority to AU2010268260A priority Critical patent/AU2010268260B2/en
Priority to CA2767052A priority patent/CA2767052C/en
Priority to EP10725454.2A priority patent/EP2449128B1/en
Priority to US13/119,915 priority patent/US8592178B2/en
Publication of WO2011000693A1 publication Critical patent/WO2011000693A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P33/00Preparation of steroids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0006Oxidoreductases (1.) acting on CH-OH groups as donors (1.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y101/00Oxidoreductases acting on the CH-OH group of donors (1.1)
    • C12Y101/01Oxidoreductases acting on the CH-OH group of donors (1.1) with NAD+ or NADP+ as acceptor (1.1.1)
    • C12Y101/0106217Beta-estradiol 17-dehydrogenase (1.1.1.62)

Definitions

  • the object of the present invention is a process for the industrial preparation of testosterone from 4-androstene-3, 17-dione through the chemo- and stereo-selective enzymatic reduction of the carbonyl group at C17.
  • the synthesis in vivo of testosterone comprises the reduction of the 4-androstene-3, 17- dione carbonyl group at C17 by enzymes known as the 17 ⁇ -hydroxysteroid dehydrogenases (17 ⁇ -HSD).
  • the object of the present invention is, accordingly, an industrial process for preparing testosterone from the reduction of 4-androstene-3, 17- dione using a more stable enzyme, suitably prepared and purified, which allows obtaining greater reproducibility of the results and higher chemoselectivity and conversion rate.
  • FIG. 1 is an illustration of the cloning diagram of the gene codifying for the murine type V 17 ⁇ - hydroxysteroid dehydrogenase according to the present invention
  • Fig. 2 is the nucleotide sequence of the murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme, wherein the mutagenic primer forward is underlined and the start and end codons, and the restriction sites used are written in bold.
  • Fig. 2A is the amino acid sequence of the murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme
  • Fig. 2B is the amino acid sequence of the murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme modified according to the present invention;
  • Fig. 3 shows a SDS-page electrophoresis of the samples collected during the purification of the recombinant type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme, in which: Pm: molecular weight standard; a: cell homogenate; b: supernatant of the centrifuged bacterial lysate; c: pellet of the centrifuged bacterial lysate; d: washing of the chromatography column; e: eluate.
  • the molecular weight expected for the recombinant type V 17 ⁇ -hydroxysteroid dehydrogenase is 39,2 KDa;
  • Fig. 4 reports the absorbance plot at 340 nm vs time of a reaction mixture as described herein; it may be appreciated that NADPH is very quickly reduced when an enzyme is present as compared with self- oxidation;
  • Fig. 5 is an Arrhenius plot, which sets temperature relation against the kinetic constant of the conversion of 4-androstene-3, 17-dione to testosterone by the purified recombinant murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme;
  • Fig. 6 shows the activity of the enzyme as a function of the time in water at room temperature;
  • Fig. 7 shows the activity of the enzyme as a function of the pH in water at room temperature employing two different cofactors
  • the object of the present invention is an industrial process for preparing testosterone from the reduction of 4-androstene-3, 17-dione using the recombinant murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme (17 ⁇ -HSD5).
  • the used recombinant murine type V 17 ⁇ - hydroxysteroid dehydrogenase enzyme has a sequence corresponding to the SEQ ID n. 2.
  • said enzyme has been purified.
  • the enzyme 1 is the recombinant murine type V 17 ⁇ -hydroxysteroid dehydrogenase, which catalyzes the chemo- and regioselective reduction of the 4- androstene-3, 17-dione carbonyl group at C17, NAD(P)H is the reduced nicotinamide-adenine-dinucleotide (phosphate) acting as a cofactor.
  • the enzyme 2 is a dehydrogenase used for recycling the cofactor to the detriment of a substrate that is oxidized.
  • the process of the present invention allows retrieving and recycling the cofactor using dehydrogenases that regenerate the NADPH or the less expensive NADH due to the addition of a suitable substrate.
  • a buffering solution, a solvent, the cofactor, the cofactor- regenerating dehydrogenase enzyme and a suitable substrate are loaded to a magnetically stirred thermostated vial.
  • the mixture is then stirred from 20 0 C to 35°C and 4-androstene-3, 17-dione along with the recombinant murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme of the present invention are added thereto.
  • the reaction mixture is then vigorously stirred at room temperature for a sufficient period of time.
  • the testosterone is extracted by means of a suitable solvent, the phases are filtered, separated and the organic phase is concentrated to dryness.
  • the process yield is surprisingly almost quantitative and the purity of the obtained testosterone even more surprisingly ranges between 98% and 100% (HPLC A%) .
  • the mixture pH must be kept within the range of 4,0 to 9,0.
  • a suitable buffer for example, can be used.
  • the buffer can be used either alone or with solvents and co-solvents, such as, for example, methanol, ethanol, isopropanol, tert-butanol, glycerol, dimethyl sulfoxide (DMSO) , acetonitrile or dimethylformamide (DMF) .
  • solvents and co-solvents such as, for example, methanol, ethanol, isopropanol, tert-butanol, glycerol, dimethyl sulfoxide (DMSO) , acetonitrile or dimethylformamide (DMF) .
  • the process of the invention allows regenerating the cofactor by means of a suitable dehydrogenase.
  • a glucose dehydrogenase can be used, and accordingly, glucose as the substrate will be added to the reaction, thereby obtaining gluconic acid along with the regenerated cofactor.
  • the formate dehydrogenase enzyme can be used by adding the sodium formate substrate.
  • other known systems can be used for the enzymatic or chemical regeneration of the cofactor.
  • the cofactor when used in catalytic amounts, can be either NAD(H) or NADP(H), NAD(H) being however preferred as it is less expensive.
  • this is the murine type V 17 ⁇ - hydroxysteroid dehydrogenases (17 ⁇ -HSD5), suitably modified such as to enable the purification thereof.
  • the enzyme amino acid sequence is shown in Fig. 2B.
  • the murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme has been modified by the addition of the tail MGSSHHHHHHSSGLVPRGSH at the N- terminal end comprising a peptide segment consisting of consecutive histidines (His-Tag) so that the sequence thereof results to be (See SEQ ID n. 2) :
  • the enzyme has been cloned and expressed in Escherichia coli according to the procedures described in the following experimental section.
  • the person skilled in the art will recognize that other cloning vectors might be suitably used such as 5. cerevisiae or P. pastoris .
  • the thus-prepared enzyme can be quickly purified as described in the experimental section.
  • the following advantages are achieved: 1. Protection from the proteolytic degradation during the purification step; 2. Protection from the proteolytic degradation during the reaction step; 3. Substantial reduction in the potential side-reactions due to enzymes that are present in the cell paste or co-purified.
  • the transformation of the 4-androstene-3, 17-dione into testosterone is thus carried out surprisingly with high chemo- and regioselectivity and reproducibility of results, with an almost quantitative conversion and unexpectedly not generating further by-products.
  • Isopropil ⁇ -D-1-thiogalactopyranoside was weighed and dissolved in 5 mL milliQ water. The solution as filtered in a sterile environment by means of a 0.22 ⁇ m filter.
  • SOLUTION G buffer 500 mM imidazole for elution
  • Imidazole 51 6 g This was brought to volume, and to pH 7,4 by means of HCl 1 M or NaOH 1 M. Filtering was carried out by means of 0.22 ⁇ m filter.
  • the cDNA codifying for the murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme has been obtained from the ImaGenes GmbH library
  • the product obtained has been digested by digestion by the Ndel and Notl enzymes, the latter provided in the pCMV SPORT 6 plasmid, downstream of cDNA (see Fig. 1) .
  • the same double digestion has been carried out on the pET28a plasmid. Both digestion products have been gathered by means of T4-DNA ligase and the ligation product used for the transformation of E. coli DH5 ⁇ cells by means of electroporation .
  • the transformed cells have been plated in LB agar with 50 ⁇ g/mL kanamycin and incubated overnight at 37°C. Of the grown colonies, 19 have been subjected to screening by means of PCR for identifying the clones containing the recombinant plasmid of interest
  • pl7 ⁇ HSD murine type V 17 ⁇ - hydroxysteroid dehydrogenase enzyme
  • Fig. 1 A colony positive to screening has been used for inoculating 5 mL LB with 50 ⁇ g/mL kanamycin and the bacterial culture has been left to grow overnight at 37°C. The bacterial culture has been subsequently used for extracting the pl7 ⁇ HSD plasmid by means of mini-prep (Quiagen) .
  • the purified plasmid has been sequenced using the T7 promoter primer and T7 terminator, in order to control the correct sequence thereof.
  • the expression plasmid pl7 ⁇ HSD has been introduced in E.coli cells of the BL21 strain by means of chemical transformation (CaCl 2 ) .
  • the cells have been subsequently plated in LB agar with 50 ⁇ g/mL kanamycin and incubated overnight at 37 0 C under stirring.
  • Several colonies have been used for inoculating a pre-culture of 5 mL LB 50 ⁇ g/mL kanamycin, grown overnight at 37 0 C, which has been used as inoculum for 2,5 L culture in a flask.
  • the culture has been amplified at 37°C under stirring at 200 rpm, until reaching an optical density at 600 nm (OD 600 ) of 0.85, then IPTG (Isopropyl ⁇ -D-1- thiogalactopyranoside, protein expression inducer) has been added thereto at a final concentration of 0.1 mM.
  • the culture broth After 18 h growth the culture broth has been collected and centrifuged at 6000 G for 10 minutes at 4 0 C. After the supernatant has been eliminated, the bacterial pellet has been resuspended in 800 mL phosphate buffer 100 mM pH 7.2 and centrifuged again at 6000 G for 10 minutes at 4°C.
  • the washed bacterial pellet has been resuspended in 70 mL of solution F (20 mM Na phosphate buffer pH 7.4, 500 mM NaCl, 5 mM Imidazole).
  • the bacteria have been then lysated by means of sonication and the solution has been centrifuged again at 12000 G for 15 minutes at 4°C.
  • the supernatant has been recovered and caused to flow through a chromatography column loaded with 2 mL resin capable of specifically binding the proteins provided with His-tag to Ni 2+ or, alternatively, to Co 2+ immobilized on the matrix (Immobilized Metal Affinity Chromatography, IMAC) .
  • IMAC Immobilized Metal Affinity Chromatography
  • the solution A is thus replaced with the solution G (20 mM Na Phosphate buffer pH 7.4, 500 mM NaCl, 500 mM Imidazole) and the chromatographic profile followed by UV absorption at 280 nm.
  • the moieties corresponding to the absorption peak have been collected and gathered and have been stored in 20% glycerol at -20 0 C.
  • the protein concentration is evaluated using the Bradford method described below. For every passage an aliquot is hold to monitor the enzyme purity level by means of SDS-PAGE analysis (Fig. 3) carried out according to LammLi method (LammLi U.K.; Cleavage of structural protein during the assembly of the head of bacteriophage T4. Nature 227, 680-685 (1970)).
  • the loaded amounts of each sample have been calculated based on the respective dilution factor.
  • the mass calculated for the protein in native form is 37 KDa; for the recombinant form, added with his-tag and thrombin cleavage site, is 39,2 KDa.
  • the SDS-PAGE analysis has confirmed the high enzyme expression level and a good purity degree obtained from purification, which is sufficient for industrial application (see Fig. 3/e) .
  • the first plate was loaded with 360 ⁇ l of the cell suspension and the second plate (diluted) with the remaining 40 ⁇ l of the cell suspension.
  • the plates were incubated at 37°C overnight (about 14 hours) under stirring at 190 rpm.
  • the optical density (OD) value was measured every 10 minutes at 600 nm (up to an absorbance value of about 1 the LB solution not inoculated being the blank) .
  • the optical density (OD) value was measured and 1/OD mL milliliter suspension amount was taken. This aliquot was centrifuged in 1.5 mL Eppendorf, the supernatant was eliminated and the pellet was resuspended in 100 ⁇ l SB-IX (SOLUTION D) . This sample was then loaded in the final gel. The culture broth obtained was collected and centrifuged at 6000 G for 10 minutes at 4°C. The supernatant was eliminated, the total bacterial pellet was gathered and resuspended in 800 mL phosphate buffer 100 mM at pH 7.4. This was again centrifuged at 6000 G for 10 minutes at 4°C.
  • the supernatant could be stored at 4 0 C and had to be purified as soon as possible.
  • a chromatography column was loaded with 50 mL Ni 2+ resin for proteins provided with His-tag.
  • the column was equilibrated by causing 500 mL solution 20 mM phosphate buffer pH 7.4, 500 mM NaCl and 5 mM imidazole (SOLUTION F) to flow and it was hold at 1 mL/min flow until at the UV/Vis the spectrum of the incoming SOLUTION F resulted to be equal to that of SOLUTION F exiting from the column at 280 nm.
  • SOLUTION F 500 mM NaCl and 5 mM imidazole
  • the protein was thus eluted with 100 mL SOLUTION 20 mM Na phosphate buffer at pH 7,4, 500 nM NaCl and 500 mM imidazole (SOLUTION G) .
  • the obtained value must be multiplied by 50 (dilution factor) .
  • the NADPH like the NADH, is characterized by 340 nm absorption of 6.2 mM ⁇ 1 cm ⁇ 1 , whereas the oxidized form thereof does not absorb at the same wavelength.
  • the activity units can be estimated, which are intended as substrate micromoles converted per minute per protein milligram (U/mg) .
  • a fresh saturated NADPH solution in phosphate buffer 100 mM at about pH 7 (SOLUTION Q) and a fresh saturated solution of 4-androstene-3, 17-dione in phosphate buffer 100 mM at pH 7 (SOLUTION P) were prepared.
  • a quartz 100 ⁇ l cuvette 1 cm optical path, 96 ⁇ l SOLUTION P, 4 ⁇ l phosphate buffer 100 mM at pH 7 were added.
  • the blank was measured at 340 nm.
  • the absorbance values at 340 nm were detected every second.
  • a quartz 100 ⁇ l cuvette 96 ⁇ l SOLUTION P, 2 ⁇ l SOLUTION Q and finally, 2 ⁇ l protein elution quantified by Bradford assay were inserted.
  • the term "inventive enzyme” or “enzyme of the invention” relates to the 17 ⁇ -recombinant murine type V hydroxysteroid dehydrogenase enzyme described above, which is characterized by the amino acid sequence of SEQ. ID n. 2.
  • the enzyme of the invention is the purified 17 ⁇ -recombinant murine type V hydroxysteroid dehydrogenase of amino acid sequence of SEQ. ID n. 2.
  • buffer solution phosphate buffer 50 mM
  • Example 5 The process described in the Example 5 was repeated, but employing the cell paste containing wild type murine enzyme Type V 17 ⁇ -hydroxysteroid dehydrogenase instead of the enzime of the invention (purified recombinant murine enzyme Type V 17 ⁇ -hydroxysteroid dehydrogenase) .
  • the results are illustrated in Table 2.
  • the conversion does not proceed over 56% and the product contains also a mixture of by-products generated by the reduction of the ketonic function in positions 3- ⁇ , 3- ⁇ and 17- ⁇ .
  • Figure 7 shows the activity of the enzyme as a function of the pH in water at room temperature employing two different cofactors. It can be seen that the enzyme shows the highest activity at pH comprised between 5.0 and 7.0. In particular, using NADPH as the co-factor the best pH is 5.5 and using NADH is 6.5-7.0, respectively.
  • Figure 8 shows the activity of the enzyme as a function of the parameters applied for its preparation. It can be seen that the highest activity of the enzyme is reached performing the incubation (protein expression) at a temperature lower than 30 0 C, particularly preferred is the range between 20 0 C and 30 0 C. The incubation temperature is a key parameter for the preparation of the enzyme.
  • the recombinant murine type V 17 ⁇ -hydroxysteroid dehydrogenase enzyme modified as described above enables the purification thereof and makes it is suitable for industrial purposes due to the excellent chemo- and stereoselectivity properties.
  • the surprisingly high stability allows to obtain optimum results that can be repeated over the time.
  • the enzyme can independently use NADP(H) or NAD(H) as a cofactor, which are both advantageously used in catalytic amounts.
  • the enzyme is capable of catalyzing also the reverse reaction, from testosterone to 4-androstene-3, 17-dione, using NAD or NADP as the cofactors.
  • the enzyme of the present invention is capable of carrying out the catalysis also in water-organic solvent mixtures, such as methanol, ethanol, isopropanol in percentages as high as 50%.
  • water-organic solvent mixtures such as methanol, ethanol, isopropanol in percentages as high as 50%.
  • This mixtures allow increasing the substrate solubility, which is as low as about 50 ⁇ g/mL in water .
  • the enzyme has a half-life of more than
  • the enzyme activity strongly depends on temperature and solvent type.
  • the enzyme of the present, invention has surprisingly shown an excellent cnemo- and regioselectivity as well as such a stability as to allow the almost complete, reproducible and exclusive conversion of 4-androstene-3, 17-dione to testosterone ,
  • Lys Ser lie GIy VaI Ser Asn Phe Asn Arg Arg GIn Leu GIu Lys lie
  • Lys Asp lie VaI Leu VaI Ala Tyr Ser Ala Leu GIy Ser His Arg GIu 210 215 220 Lys GIn Trp VaI Asp GIn Ser Ser Pro VaI Leu Leu Asp Asn Pro VaI 225 230 235 240
  • Tyr lie Ser GIy Ser Ser Phe Lys Asp His Pro Asp Phe Pro Phe Trp 305 310 315 320
  • GIy Phe Arg His lie Asp Ser Ala Ser Met Tyr GIn Asn GIu Lys GIu 65 70 75 80
  • Lys Asn lie Arg Tyr lie Ser GIy Ser Ser Phe Lys Asp His Pro Asp

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Health & Medical Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Steroid Compounds (AREA)

Abstract

The present invention relates to an industrial process for the reduction of 4-androstene-3, 17-dione in order to obtain testosterone using a particularly stable and selective enzyme produced in a recombinant manner.

Description

DESCRIPTION
Title: "Process for the preparation of testosterone"
[0001] The object of the present invention is a process for the industrial preparation of testosterone from 4-androstene-3, 17-dione through the chemo- and stereo-selective enzymatic reduction of the carbonyl group at C17.
In nature, the synthesis in vivo of testosterone comprises the reduction of the 4-androstene-3, 17- dione carbonyl group at C17 by enzymes known as the 17β-hydroxysteroid dehydrogenases (17β-HSD).
The use of human type V 17β-hydroxysteroid dehydrogenases (17β-HSD5) for the synthesis of testosterone in vitro has already been described. Dufort et al (Endocrynology, 1999, Vol. 140, No .2 ; p 568-574) in 1999 have used human 17β-hydroxysteroid dehydrogenase expressed in cultured human cells and have studied their capacity of converting the 4- androstene-3, 17-dione into testosterone and the dihydrotestosterone in 3α-17β-androstanediol . However, there resulted a low enzyme regioselectivity, which has resulted to be poorly stable, as indicated by the rapid activity decrease during the purification step, both when it is recombinantly expressed in human and bacterial cells such as Escherichia coli.
[0002] The same murine type V 17β-hydroxysteroid dehydrogenase enzyme has proven to be more stable and more regioselective than the human homologue (75% sequence identity) , as described in the work by Dufort et al (Endocrynology, 1999, Vol. 140, No .2 ; p 568-574) .
[0003] In the same article, it is also reported that the conversion from 4-androstene-3, 17-dione to testosterone using a human type V 17β-hydroxysteroid dehydrogenase is as low as 25%, whereas the same reaction carried out by means of a murine type V 17β- hydroxysteroid dehydrogenase provides a conversion around 60%. No other data concerning the purity of the product and the selectivity of the reduction reaction is provided therein.
[0004] In the application PCT WO2007/118644 by IEP GmbH, the Example 1 reports that the in vitro conversion from 4-androstene-3, 17-dione into testosterone using a 17β-hydroxysteroid dehydrogenase from Pseudomonas testosteroni ranges within 90-95%. In US patent 2.796.382 filed on October 9, 1953 by Paul Talalay, the conversion of 4-androsten-3, 17- dione into testosterone, still using a 17β- hydroxysteroid dehydrogenase from Pseudomonas testosteroni, is said to be quantitative but it is calculated on the base of the cofactor consumption and in fact no purity data of the resulting product is ever reported. Moreover, it is well known that the biocatalytic processes suffer from low reproducibility and low stability of the enzymes, therefore making said processes non convenient for industrial scale applications.
[0005] The object of the present invention is, accordingly, an industrial process for preparing testosterone from the reduction of 4-androstene-3, 17- dione using a more stable enzyme, suitably prepared and purified, which allows obtaining greater reproducibility of the results and higher chemoselectivity and conversion rate.
[0006] BRIEF DESCRIPTION OF THE DRAWINGS
[0007] Fig. 1 is an illustration of the cloning diagram of the gene codifying for the murine type V 17β- hydroxysteroid dehydrogenase according to the present invention;
[0008] Fig. 2 is the nucleotide sequence of the murine type V 17β-hydroxysteroid dehydrogenase enzyme, wherein the mutagenic primer forward is underlined and the start and end codons, and the restriction sites used are written in bold. Fig. 2A is the amino acid sequence of the murine type V 17β-hydroxysteroid dehydrogenase enzyme, whereas Fig. 2B is the amino acid sequence of the murine type V 17β-hydroxysteroid dehydrogenase enzyme modified according to the present invention;
[0009] Fig. 3 shows a SDS-page electrophoresis of the samples collected during the purification of the recombinant type V 17β-hydroxysteroid dehydrogenase enzyme, in which: Pm: molecular weight standard; a: cell homogenate; b: supernatant of the centrifuged bacterial lysate; c: pellet of the centrifuged bacterial lysate; d: washing of the chromatography column; e: eluate. The molecular weight expected for the recombinant type V 17β-hydroxysteroid dehydrogenase is 39,2 KDa;
[0010] Fig. 4 reports the absorbance plot at 340 nm vs time of a reaction mixture as described herein; it may be appreciated that NADPH is very quickly reduced when an enzyme is present as compared with self- oxidation;
[0011] Fig. 5 is an Arrhenius plot, which sets temperature relation against the kinetic constant of the conversion of 4-androstene-3, 17-dione to testosterone by the purified recombinant murine type V 17β-hydroxysteroid dehydrogenase enzyme; Fig. 6 shows the activity of the enzyme as a function of the time in water at room temperature;
[0012] Fig. 7 shows the activity of the enzyme as a function of the pH in water at room temperature employing two different cofactors;
DETAILED DESCRIPTION OF THE INVENTION
[0013] The object of the present invention is an industrial process for preparing testosterone from the reduction of 4-androstene-3, 17-dione using the recombinant murine type V 17β-hydroxysteroid dehydrogenase enzyme (17β-HSD5).
[0014] Accoridng to a preferred embodiment of the invention, the used recombinant murine type V 17β- hydroxysteroid dehydrogenase enzyme has a sequence corresponding to the SEQ ID n. 2.
[0015] According to a more preferred embodiment, said enzyme has been purified.
[0016] Particularly, said process is carried out according to the following scheme
Figure imgf000007_0001
4-androstene-3,17-dione
testosterone
Product
Figure imgf000007_0002
Substrate
ENZYME 2
wherein the enzyme 1 is the recombinant murine type V 17β-hydroxysteroid dehydrogenase, which catalyzes the chemo- and regioselective reduction of the 4- androstene-3, 17-dione carbonyl group at C17, NAD(P)H is the reduced nicotinamide-adenine-dinucleotide (phosphate) acting as a cofactor. The enzyme 2 is a dehydrogenase used for recycling the cofactor to the detriment of a substrate that is oxidized.
[0017] Advantageously, the process of the present invention allows retrieving and recycling the cofactor using dehydrogenases that regenerate the NADPH or the less expensive NADH due to the addition of a suitable substrate.
[0018] More particularly, in order to carry out the process of the present invention a buffering solution, a solvent, the cofactor, the cofactor- regenerating dehydrogenase enzyme and a suitable substrate are loaded to a magnetically stirred thermostated vial. The mixture is then stirred from 200C to 35°C and 4-androstene-3, 17-dione along with the recombinant murine type V 17β-hydroxysteroid dehydrogenase enzyme of the present invention are added thereto. The reaction mixture is then vigorously stirred at room temperature for a sufficient period of time. When the reaction has been accomplished, the testosterone is extracted by means of a suitable solvent, the phases are filtered, separated and the organic phase is concentrated to dryness. The process yield is surprisingly almost quantitative and the purity of the obtained testosterone even more surprisingly ranges between 98% and 100% (HPLC A%) .
[0019] In more detail, the mixture pH must be kept within the range of 4,0 to 9,0. To the purpose, a suitable buffer, for example, can be used.
[0020] The buffer can be used either alone or with solvents and co-solvents, such as, for example, methanol, ethanol, isopropanol, tert-butanol, glycerol, dimethyl sulfoxide (DMSO) , acetonitrile or dimethylformamide (DMF) .
[0021] As described above, advantageously, the process of the invention allows regenerating the cofactor by means of a suitable dehydrogenase. A glucose dehydrogenase can be used, and accordingly, glucose as the substrate will be added to the reaction, thereby obtaining gluconic acid along with the regenerated cofactor. Alternatively, the formate dehydrogenase enzyme can be used by adding the sodium formate substrate. Alternatively, other known systems can be used for the enzymatic or chemical regeneration of the cofactor.
[0022] In turn, when used in catalytic amounts, the cofactor can be either NAD(H) or NADP(H), NAD(H) being however preferred as it is less expensive.
[0023] As relates to the enzyme used in the process of the present invention, this is the murine type V 17β- hydroxysteroid dehydrogenases (17β-HSD5), suitably modified such as to enable the purification thereof. The enzyme amino acid sequence is shown in Fig. 2B.
[0024] Particularly, for the purposes of the present invention, the murine type V 17β-hydroxysteroid dehydrogenase enzyme has been modified by the addition of the tail MGSSHHHHHHSSGLVPRGSH at the N- terminal end comprising a peptide segment consisting of consecutive histidines (His-Tag) so that the sequence thereof results to be (See SEQ ID n. 2) :
MGSSHHHHHHSSGLVPRGSHMDSKQQTVRLSDGHFIPILGFGTYAPQEVPKSK ATEATKIAIDAGFRHIDSASMYQNEKEVGLAIRSKIADGTVKREDIFYTSKVW CTFHRPELVRVCLEQSLKQLQLDYVDLYLIHFPMAMKPGENYLPKDENGKLIY DAVDICDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILKKPGLKYKPVCNQVE CHPYLNQGKLLDFCRSKDIVLVAYSALGSHREKQWVDQSSPVLLDNPVLGSMA KKYNRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLDD LNKNIRYISGSSFKDHPDFPFWDEY
[0025] The enzyme has been cloned and expressed in Escherichia coli according to the procedures described in the following experimental section. The person skilled in the art will recognize that other cloning vectors might be suitably used such as 5. cerevisiae or P. pastoris .
[0026] The thus-prepared enzyme can be quickly purified as described in the experimental section. The following advantages are achieved: 1. Protection from the proteolytic degradation during the purification step; 2. Protection from the proteolytic degradation during the reaction step; 3. Substantial reduction in the potential side-reactions due to enzymes that are present in the cell paste or co-purified. The transformation of the 4-androstene-3, 17-dione into testosterone is thus carried out surprisingly with high chemo- and regioselectivity and reproducibility of results, with an almost quantitative conversion and unexpectedly not generating further by-products. Materials and methods
The following solutions have been prepared, in which SB designates the solubilization buffer. [0027] Kanamycin (50 mg/mL) are dissolved in 50 mL milliQ water. The solution is filtered in sterile environment using a 0,22 μm filter. Storage at -200C.
[0028] SOLUTION A (LB agar Kanamycin 50 μg/mL for plates
For 1 liter of solution the following amounts were poured in a becker:
Tryptone 10 g
Yeast extract 5 g
NaCl 5 g
It was dissolved in deionized water and brought to 1
L final volume. The pH was brought to 7.5 by adding IM NaOH solution (about 1 mL) . The solution was transferred into 1 L autoclavable bottles and 15 g agar (for bacterial cultures) was added. This was autoclaved at 1200C for 20 minutes at 2 bar. In a sterile environment, the bottled solution was left to cool to about 50-60 0C (before solidification) . 1 mL Kanamycin solution (50 mg/mL) was added. The bottle was stirred. About 20 mL solution per plate was added before the medium had solidified and the plates were left uncovered to complete solidification. The plates were closed and stored in a sterile environment at 4 °C (for max 1-2 months) . [0029] SOLUTION B (LB agar Kanamycin 50 microg/mL for culture in 1 L flasks)
The following amounts were poured into a becker:
Trypton 10 g
Yeast extract 5 g
NaCl 5 g
This was dissolved in deionized water and brought to
1 L final volume. The pH was brought to 7.5 by adding IM NaOH solution (about 1 mL) . The solution was transferred into autoclavable flasks according to the requirements, with gauze and cotton plugs. This was autoclaved at 1200C for 20 minutes and left to cool to room temperature in a sterile environment. 1 mL Kanamycin solution (50 mg/mL) (see above) was added.
[0030] SOLUTION C (IPTG 5 mL 0 , 5 M solution)
0,595 g Isopropil β-D-1-thiogalactopyranoside was weighed and dissolved in 5 mL milliQ water. The solution as filtered in a sterile environment by means of a 0.22 μm filter.
This was stored at -200C.
[0031] SOLUTION D (SB=solubilization buffer IX 30 mL)
10 mL SB3X solution was diluted with 20 mL deionized water .
This was stored at -200C and resuspended after thawing . [0032] SOLUTION E (SB3X 4OmL)
16 mL TRIS 0,125 mM pH 6.8 was added to 12 g glycerol. 3.6 g SDS and 0.62 g DTT was added thereto. Several tens of milligrams of bromophenol blue were mixed and added thereto. This was brought to volume with deionized water, stored at -200C, and resuspended after thawing.
[0033] SOLUTION F (5 mM imidazole buffer for balancing
2 liter column)
In 1,5 1 mQ water the following was dissolved:
NaCl 43.8 g
Sodium phosphate (NaH2PO3) 1.8 g
Na2HPO3 - 12H2O 5 . 4 g
Imidazole 0 . 57 g
This was brought to volume and brought to pH 7.4 by means of HCl 1 M or NaOH 1 M. Filtration was carried out by means of 0.22 μm filter.
[0034] SOLUTION G (buffer 500 mM imidazole for elution)
In 1.5 1 mQ water the following was dissolved:
NaCl 43.8 g
Sodium phosphate (NaH2PO3) 1.8 g
Na2HPO3 . 12H2O 5 . 4 g
Imidazole 51 . 6 g This was brought to volume, and to pH 7,4 by means of HCl 1 M or NaOH 1 M. Filtering was carried out by means of 0.22 μm filter.
Cloning
[0035] All the cloning procedures below described have been carried out according to the instructions stated in Sambrook and Russel; Molecular Cloning - a Laboratory Manual (3rd Edition), CSHL Press (2001- New York) . For the cloning, the pET28a plasmid
(Novagen, Darmstadt-Germany) has been used for the E. coli (strain BL21) expression, so as to allow the expression of the fusion protein to a tag of six amino-terminal histidines. The cDNA codifying for the murine type V 17β-hydroxysteroid dehydrogenase enzyme has been obtained from the ImaGenes GmbH library
(Berlin, Germany) , contained in the pCMV SPORT 6 plasmid vector (fig. 1). The nucleotide sequence has been controlled by means of sequencing and based thereon the primer 5'- GCTGAGAACATATGGATTCTAAG -3', has been designed, which contains the restriction site Ndel (containing the ATG start codon for the translation) . This primer (forward) , together with the T7 promoter δ'-TAATACGACTCACTACA-S' primer
(reverse) , has been used in a PCR reaction (polymerase chain reaction) for the amplification of the cDNA of interest.
The product obtained has been digested by digestion by the Ndel and Notl enzymes, the latter provided in the pCMV SPORT 6 plasmid, downstream of cDNA (see Fig. 1) . The same double digestion has been carried out on the pET28a plasmid. Both digestion products have been gathered by means of T4-DNA ligase and the ligation product used for the transformation of E. coli DH5α cells by means of electroporation .
The transformed cells have been plated in LB agar with 50 μg/mL kanamycin and incubated overnight at 37°C. Of the grown colonies, 19 have been subjected to screening by means of PCR for identifying the clones containing the recombinant plasmid of interest
(pET28a containing the cDNA the murine type V 17β- hydroxysteroid dehydrogenase enzyme, hereinafter called pl7βHSD) , using the primer T7 promoter and T7 terminator (Fig. 1). A colony positive to screening has been used for inoculating 5 mL LB with 50 μg/mL kanamycin and the bacterial culture has been left to grow overnight at 37°C. The bacterial culture has been subsequently used for extracting the pl7βHSD plasmid by means of mini-prep (Quiagen) . The purified plasmid has been sequenced using the T7 promoter primer and T7 terminator, in order to control the correct sequence thereof.
Small-scale expression and purification of the recombinant murine type V 17β-hydroxysteroid
dehydrogenase enzyme
[0036] The expression plasmid pl7βHSD has been introduced in E.coli cells of the BL21 strain by means of chemical transformation (CaCl2) . The cells have been subsequently plated in LB agar with 50 μg/mL kanamycin and incubated overnight at 370C under stirring. Several colonies have been used for inoculating a pre-culture of 5 mL LB 50 μg/mL kanamycin, grown overnight at 370C, which has been used as inoculum for 2,5 L culture in a flask. The culture has been amplified at 37°C under stirring at 200 rpm, until reaching an optical density at 600 nm (OD600) of 0.85, then IPTG (Isopropyl β-D-1- thiogalactopyranoside, protein expression inducer) has been added thereto at a final concentration of 0.1 mM.
After 18 h growth the culture broth has been collected and centrifuged at 6000 G for 10 minutes at 40C. After the supernatant has been eliminated, the bacterial pellet has been resuspended in 800 mL phosphate buffer 100 mM pH 7.2 and centrifuged again at 6000 G for 10 minutes at 4°C.
The washed bacterial pellet has been resuspended in 70 mL of solution F (20 mM Na phosphate buffer pH 7.4, 500 mM NaCl, 5 mM Imidazole). The bacteria have been then lysated by means of sonication and the solution has been centrifuged again at 12000 G for 15 minutes at 4°C.
The supernatant has been recovered and caused to flow through a chromatography column loaded with 2 mL resin capable of specifically binding the proteins provided with His-tag to Ni2+ or, alternatively, to Co2+ immobilized on the matrix (Immobilized Metal Affinity Chromatography, IMAC) . The latter has been previously equilibrated with the solution F. The chromatography column is washed with the solution A, until the UV/Vis spectrum of the eluate results to be comparable with that of the incoming solution A.
The solution A is thus replaced with the solution G (20 mM Na Phosphate buffer pH 7.4, 500 mM NaCl, 500 mM Imidazole) and the chromatographic profile followed by UV absorption at 280 nm. The moieties corresponding to the absorption peak have been collected and gathered and have been stored in 20% glycerol at -200C. The protein concentration is evaluated using the Bradford method described below. For every passage an aliquot is hold to monitor the enzyme purity level by means of SDS-PAGE analysis (Fig. 3) carried out according to LammLi method (LammLi U.K.; Cleavage of structural protein during the assembly of the head of bacteriophage T4. Nature 227, 680-685 (1970)).
[0037] The loaded amounts of each sample have been calculated based on the respective dilution factor. The mass calculated for the protein in native form is 37 KDa; for the recombinant form, added with his-tag and thrombin cleavage site, is 39,2 KDa. The SDS-PAGE analysis has confirmed the high enzyme expression level and a good purity degree obtained from purification, which is sufficient for industrial application (see Fig. 3/e) .
Middle scale expression and purification of the recombinant murine type V 17β-hydroxysteroid
dehydrogenase enzyme
[0038] Under sterile conditions in a 10 mL inoculum tube at 00C, 200 μl of chemically competent BL21 cells (CaCl2) and 1 μg of the plasmid obtained according to what has been described in the above paragraph have been loaded. This has been left to incubate at 00C for 40-60 minutes, then has been transferred to a thermostated bath at 42°C for 90 seconds. Then it was cooled down to 00C for 1-2 minutes and then 1 mL of a standard culture medium (SOC) was added and it was left to incubate at 37°C for 1 h. The suspension was then transferred into a centrifuge tube and centrifuged at 6000 G for 5 minutes at room temperature. 800 μl of supernatant was removed by siphoning and the pellet was resuspended in the remaining 400 μl . Two plates of LB agar containing 50 μg/mL kanamycin (SOLUTION A) were prepared and pre-heated at 37°C.
[0039] The first plate was loaded with 360 μl of the cell suspension and the second plate (diluted) with the remaining 40 μl of the cell suspension. The plates were incubated at 37°C overnight (about 14 hours) under stirring at 190 rpm.
[0040] In a 2 L sterile flask 300 mL of liquid LB containing 50 μg/mL kanamycin (SOLUTION B) was loaded. With a sterile loop several colonies were collected from the plate with individual colonies and were transferred in a flask (about 1 to 5 dead space): CULTURE 1. This was left to incubate at 370C overnight (about 14 h) at 190 rpm.
[0041] 3 6L flasks were prepared and 2 L SOLUTION B was loaded into each one of them. 100 mL of CULTURE 1 was inoculated in each of them and this was left to incubate at 37°C and 190 rpm.
[0042] By means of IPC, the optical density (OD) value was measured every 10 minutes at 600 nm (up to an absorbance value of about 1 the LB solution not inoculated being the blank) .
[0043] 0,4 mL SOLUTION C was loaded into each flask in order to induce protein expression thereby obtaining a final concentration of IPTG (isopropyl-b-D- thiogalactopyranoside) in the 0.1 mM flask. This was left to incubate for 18 hours at 37°C and 200 rpm. After 18 hours this was left to cool at 4°C, which temperature was maintained for the remaining procedure .
[0044] The optical density (OD) value was measured and 1/OD mL milliliter suspension amount was taken. This aliquot was centrifuged in 1.5 mL Eppendorf, the supernatant was eliminated and the pellet was resuspended in 100 μl SB-IX (SOLUTION D) . This sample was then loaded in the final gel. The culture broth obtained was collected and centrifuged at 6000 G for 10 minutes at 4°C. The supernatant was eliminated, the total bacterial pellet was gathered and resuspended in 800 mL phosphate buffer 100 mM at pH 7.4. This was again centrifuged at 6000 G for 10 minutes at 4°C.
[0045] The supernatant was eliminated and the residue was resuspended in 100 mL phosphate buffer 100 mM at pH 7,4. The lysis of the cells was then carried out by means of sonication with 10 sonications lasting 15 seconds at 1 minute intervals at 00C. This was centrifuged again at 12000 G for 10 minutes at 4°C. The supernatant was recovered.
[0046] 100 μl supernatant was taken and diluted with 50 μl SB3X (SOLUTION E) . This sample was loaded in the final gel.
[0047] The pellet was resuspended (which would be then eliminated) in 100 mL SOLUTION F. 100 μl suspension was taken up and diluted with 50 μl SB3X (SOLUTION E) . This sample would be loaded in the final gel.
[0048] The supernatant could be stored at 40C and had to be purified as soon as possible.
[0049] In order to carry out the purification, a chromatography column was loaded with 50 mL Ni2+ resin for proteins provided with His-tag. The column was equilibrated by causing 500 mL solution 20 mM phosphate buffer pH 7.4, 500 mM NaCl and 5 mM imidazole (SOLUTION F) to flow and it was hold at 1 mL/min flow until at the UV/Vis the spectrum of the incoming SOLUTION F resulted to be equal to that of SOLUTION F exiting from the column at 280 nm. When the equilibration was completed this was loaded and the previously recovered solution of supernatant was eluted at 1 mL/min flow. The elute should be without the wanted enzyme.
[0050] Accordingly, 100 μl sample was taken and diluted with 50 μl SB3X (SOLUTION E) . This sample would be loaded in the final gel. The column was washed with the bound enzyme by flowing 500 mL buffer SOLUTION (SOLUTION F) .
[0051] The column was washed until when the incoming UV/Vis spectrum (SOLUTION F) was equal to the SOLUTION F spectrum outgoing from the column at 280 nm.
[0052] The protein was thus eluted with 100 mL SOLUTION 20 mM Na phosphate buffer at pH 7,4, 500 nM NaCl and 500 mM imidazole (SOLUTION G) .
[0053] 2 mL aliquots were collected. The elution was considered as finished when the spectrum of the incoming SOLUTION G was equal to the spectrum of the outgoing SOLUTION G at 280 nm.
[0054] When the moiety collection was completed, the absorbance of each one was measured at 280 and those with absorbance >0.2 were gathered. The SOLUTION G was used as the blank.
[0055] The moieties containing the protein were gathered and glycerol was added until a final concentration of 20% V/V was obtained and this was stored at -200C. Before freezing 100 μl protein solution was taken and diluted with 50 μl SB3X
(SOLUTION E) . This sample was loaded in the final gel .
[0056] 100 μl was taken to carry out the activity tests
(see the relevant experimental part) .
Estimate of the protein concentration (Bradford method)
[0057] In a 3 mL cuvette for spectrophotometer 3 mL Bradford reagent plus 100 μl BSA (bovine serum albumin) solution at known concentration (0;0.25; 0.5; 0.75; 1; 1.25 mg/mL) was added.
In a cuvette, 3 mL Bradford reactive and 100 μl of a 1:50 dilution of the unknown protein solution were added. This was stirred and left to rest for 10 minutes .
The reading at 595 nm of the cuvette with known protein content was then started. Finally, the reading of the cuvette with the unknown solution was carried out. A concentration vs 595 nm absorbance plot was drawn using the values with known concentration and the points obtained have been interpolated on a straight line. The concentration of the unknown solution has been determined therefrom by means of the previously obtained absorbance value.
The obtained value must be multiplied by 50 (dilution factor) .
Activity test of the recombinant murine type V 17β- hydroxysteroid dehydrogenase enzyme
[0058] To estimate the specific enzymatic activity of the purified protein, a kinetic study was carried out by means of a spectrophotometer. The conversion of 4- androstene-3, 17-dione into testosterone by means of the recombinant murine type V 17β-hydroxysteroid dehydrogenase enzyme involved the equimolar consumption of the NADPH cofactor, which acted as the reducing agent.
The NADPH, like the NADH, is characterized by 340 nm absorption of 6.2 mM~1cm~1, whereas the oxidized form thereof does not absorb at the same wavelength. As the transformation of the 4-androstene-3, 17-dione into testosterone is equimolar to the oxidation of NADPH, by quantifying the consumption of the latter over time as a function of the enzyme milligrams used, the activity units can be estimated, which are intended as substrate micromoles converted per minute per protein milligram (U/mg) .
[0059] A fresh saturated NADPH solution in phosphate buffer 100 mM at about pH 7 (SOLUTION Q) and a fresh saturated solution of 4-androstene-3, 17-dione in phosphate buffer 100 mM at pH 7 (SOLUTION P) were prepared. In a quartz 100 μl cuvette, 1 cm optical path, 96 μl SOLUTION P, 4 μl phosphate buffer 100 mM at pH 7 were added. The blank was measured at 340 nm. The absorbance values at 340 nm were detected every second. In a quartz 100 μl cuvette 96 μl SOLUTION P, 2 μl SOLUTION Q and finally, 2 μl protein elution quantified by Bradford assay were inserted. The solution was blended thoroughly, then the wavelength reading was started at 340 nm and the values thereof were recorded. In a plot, the absorbance values were inserted, which were obtained as a function of time and the curve was interpolated. The highest derivate value within the early seconds of measurement was thus defined.
[0060] With the values obtained, the plot illustrated in Fig. 4 was drawn, which allows to quantify the NADPH consumption rate at time zero (except the self- oxidation given by the control, consisting of the mixture without enzyme, which must be subtracted) and from the latter the enzyme activity units per protein milligram (U/mg) . To calculate the units, the following Formula was used:
Unit/mg= | derivate (s'^ ^βO (sec/min) * 1 (cm) /6220 (M-1Cm"1) *1000000 (M/M) *0.00011/ [ (mg/mL sol
enzyme*0.002 (mL) ) ] = (μmol/min) /mg
In two different preparations, the values of 0.006 and 0.007 U/mg were obtained.
[0061] The present invention is described herein below by means of several illustrating examples which should not be considered as limiting the invention in any way.
[0062] The term "inventive enzyme" or "enzyme of the invention" relates to the 17β-recombinant murine type V hydroxysteroid dehydrogenase enzyme described above, which is characterized by the amino acid sequence of SEQ. ID n. 2.
[0063] In particular, the enzyme of the invention is the purified 17β-recombinant murine type V hydroxysteroid dehydrogenase of amino acid sequence of SEQ. ID n. 2.
EXAMPLE 1
[0064] The following solutions were prepared: SOLUTION H (saturated solution of 4-androstene-3, 17- dione)
5 mg of 4-androstene-3, 17-dione in
5 mL of buffer solution (phosphate buffer 50 mM;
pH 6.5). This was stirred at 400C for 15 minutes and the suspended matter was filtered thereby obtaining a saturated solution of 4- androstene-3, 17-dione (cone. 50 μg/mL) .
SOLUTION I (NAD solution)
10 mg of NAD in
1 mL of buffer solution. A clear solution was
obtained.
SOLUTION L (NAD solution)
13 mg of GDH-103 (glucose dehydrogenase) in
1 mL of buffer solution. A clear solution was
obtained.
[0065] In a thermostated vial provided with magnetic stirring the following was loaded
5 mL of buffer solution,
100 mg of glucose (Fluka) ,
100 μl of SOLUTION I (equal to 1 mg NAD),
250 μl of SOLUTION L (equal to 1 mg GDH, 60 U) ,
This was stirred at 300C for about 30 minutes, then the following was added
1 mL SOLUTION H (equal to about 50 μg)
40 μl inventive enzyme (equal to about 0.01 U)
This was stirred at 300C for about 30 minutes .
The following was carried out:
IPC: HPLC; check of conversion.
After 30 minutes the conversion resulted completed: 100% Testosterone (HPLC A%) .
The following was added
1 mL of SOLUTION H (equal to about 50 μg)
This was stirred at 300C for about 30 minutes and analyzed by HPLC.
The conversion resulted to be completed (100% Testosterone) .
EXAMPLE 2
[0066] A similar test to Example 1 was carried out by loading
50 mg sodium formate instead of glucose,
100 μl of a NADP buffered solution (10 mg NADP dissolved in 1 mL) and
250 μl formate dehydrogenase instead of glucose dehydrogenase (about 14 U) , provided a similar result (complete conversion (100% Testosterone (HPLC A%) ) after 30 minutes).
[0067] In a thermostated vial provided with magnetic stirring the following was loaded
5.4 HiL of buffer solution (phosphate buffer 50 mM;
pH 6.5) ,
0.6 mL of isopropanol
50 mg of sodium formate,
100 μl °f NADP solution (obtained by dissolving 10 mg in 1 mL buffer) ,
250 μl °f formate dehydrogenase enzyme (1 mg enzyme equal to about 68 U) .
This was stirred at 300C for about 30 minutes, then the following was loaded 5 mg of 4-androstene-3, 17-dione and
80 μl °f the inventive enzyme (equal to about 0.02
U)
This was vigorously stirred at 300C for about
2 hours thereby obtaining 99.7% conversion
(HPLC analysis) .
EXAMPLE 4
[0068] In a thermostated vial provided with magnetic stirring the following was loaded:
6.5 mL of phosphate buffer solution 50 mM a pH 6,5; 0.5 mL of methanol;
0.6 g of glucose (Fluka) ;
300 μl of 1% NADP solution (cofactor) equal to 3 mg
NADP
100 μl of 1% enzyme glucose dehydrogenase solution
(1 mg enzyme equal to about 68 U)
This was stirred at 25°C for about 30 minutes, then the following was loaded
70 mg 4-androstene-3, 17-dione and
300 μl Inventive enzyme (equal to about 0.15 U)
This was vigorously stirred at 25°C for about 40 hours .
The reaction was monitored by HPLC and once completed (98% conversion) 10 mL methylene chloride was added. The phases were filtered to break the emulsion, then the phases were separated and the organic phase was concentrated to residue thereby obtaining Testosterone with a 98% molar yield of isolated product and 98.5% HPLC purity (A%) (contained only 1,5% (A%) 4-androstene-3, 17-dione residue).
EXAMPLE 5
[0069] The process described in the Example 4 was repeated by following the same procedure and with the same inventive enzyme, but the NADPH/NADH cofactor, co-solvent type and concentration and the temperature and reaction-time parameters were changed, as illustrated in the following Table 1:
Table 1
Figure imgf000031_0001
EXAMPLE 6 - comparative example
The process described in the Example 5 was repeated, but employing the cell paste containing wild type murine enzyme Type V 17β-hydroxysteroid dehydrogenase instead of the enzime of the invention (purified recombinant murine enzyme Type V 17β-hydroxysteroid dehydrogenase) . The results are illustrated in Table 2.
Table 2
Figure imgf000032_0001
The conversion does not proceed over 56% and the product contains also a mixture of by-products generated by the reduction of the ketonic function in positions 3-α, 3-β and 17-α.
EXAMPLE 7
Stability study
A study to verify the stability in water of the purified recombinant murine enzyme Type V 17β- hydroxysteroid dehydrogenase of the invention was carried out. The Figure 6 shows the activity of the enzyme as a function of the time in water at room temperature. It can be seen that the enzyme is sufficiently stable to allow industrial biocatalysis as it is still active even after 15 days (Half-life) .
EXAMPLE 8 pH study
A study to verify the optimal pH for the purified recombinant murine enzyme Type V 17β-hydroxysteroid dehydrogenase of the invention to perform the conversion of androstendione to testosterone was carried out. Figure 7 shows the activity of the enzyme as a function of the pH in water at room temperature employing two different cofactors. It can be seen that the enzyme shows the highest activity at pH comprised between 5.0 and 7.0. In particular, using NADPH as the co-factor the best pH is 5.5 and using NADH is 6.5-7.0, respectively.
EXAMPLE 9
Preparation of the enzyme
[0070] A study to optimize the process for the preparation of the purified recombinant murine enzyme Type V 17β-hydroxysteroid dehydrogenase was carried out. Figure 8 shows the activity of the enzyme as a function of the parameters applied for its preparation. It can be seen that the highest activity of the enzyme is reached performing the incubation (protein expression) at a temperature lower than 300C, particularly preferred is the range between 200C and 300C. The incubation temperature is a key parameter for the preparation of the enzyme. [0071] In view of what has been described above and, in particular the comparison of the results of Example 6 -Table 2- and those of Example 5 -Table 1 row 8-, those skilled in the art may appreciate the advantages offered by the process of the present invention .
Particularly, it may be appreciated how the recombinant murine type V 17β-hydroxysteroid dehydrogenase enzyme modified as described above enables the purification thereof and makes it is suitable for industrial purposes due to the excellent chemo- and stereoselectivity properties. In addition, the surprisingly high stability allows to obtain optimum results that can be repeated over the time.
Furthermore, the enzyme can independently use NADP(H) or NAD(H) as a cofactor, which are both advantageously used in catalytic amounts. The enzyme is capable of catalyzing also the reverse reaction, from testosterone to 4-androstene-3, 17-dione, using NAD or NADP as the cofactors.
Advantageously, the enzyme of the present invention is capable of carrying out the catalysis also in water-organic solvent mixtures, such as methanol, ethanol, isopropanol in percentages as high as 50%. This mixtures allow increasing the substrate solubility, which is as low as about 50 μg/mL in water .
In addition, the enzyme has a half-life of more than
15 days in the elution solution (SOLUTION G) at room temperature .
The enzyme activity strongly depends on temperature and solvent type.
[0072] The following Table shows the activity of the enzyme as a function of the parameters applied for its preparation.
Figure imgf000036_0001
As compared with the non purified and unmodified murine type V 17β-hydroxysteroid dehydrogenase enzyme, the enzyme of the present, invention has surprisingly shown an excellent cnemo- and regioselectivity as well as such a stability as to allow the almost complete, reproducible and exclusive conversion of 4-androstene-3, 17-dione to testosterone ,
SEQUENCE LISTING
<110> Fabbrica Italiana Sintetici
<120> Process for the preparation of testosterone <130> E0077796 <160> 4 <170> Patentln version 3.5
<210> 1
<211> 323
<212> PRT
<213> Homo sapiens
<400> 1
Met Asp Ser Lys GIn GIn Thr VaI Arg Leu Ser Asp GIy His Phe lie 1 5 10 15
Pro lie Leu GIy Phe GIy Thr Tyr Ala Pro GIn GIu VaI Pro Lys Ser
20 25 30
Lys Ala Thr GIu Ala Thr Lys lie Ala lie Asp Ala GIy Phe Arg His
35 40 45
lie Asp Ser Ala Ser Met Tyr GIn Asn GIu Lys GIu VaI GIy Leu Ala 50 55 60
lie Arg Ser Lys lie Ala Asp GIy Thr VaI Lys Arg GIu Asp lie Phe 65 70 75 80 Tyr Thr Ser Lys VaI Trp Cys Thr Phe His Arg Pro GIu Leu VaI Arg 85 90 95
VaI Cys Leu GIu GIn Ser Leu Lys GIn Leu GIn Leu Asp Tyr VaI Asp
100 105 110
Leu Tyr Leu lie His Phe Pro Met Ala Met Lys Pro GIy GIu Asn Tyr
115 120 125
Leu Pro Lys Asp GIu Asn GIy Lys Leu lie Tyr Asp Ala VaI Asp lie 130 135 140
Cys Asp Thr Trp GIu Ala Met GIu Lys Cys Lys Asp Ala GIy Leu Ala 145 150 155 160
Lys Ser lie GIy VaI Ser Asn Phe Asn Arg Arg GIn Leu GIu Lys lie
165 170 175
Leu Lys Lys Pro GIy Leu Lys Tyr Lys Pro VaI Cys Asn GIn VaI GIu
180 185 190
Cys His Pro Tyr Leu Asn GIn GIy Lys Leu Leu Asp Phe Cys Arg Ser
195 200 205
Lys Asp lie VaI Leu VaI Ala Tyr Ser Ala Leu GIy Ser His Arg GIu 210 215 220 Lys GIn Trp VaI Asp GIn Ser Ser Pro VaI Leu Leu Asp Asn Pro VaI 225 230 235 240
Leu GIy Ser Met Ala Lys Lys Tyr Asn Arg Thr Pro Ala Leu lie Ala
245 250 255
Leu Arg Tyr GIn Leu GIn Arg GIy VaI VaI VaI Leu Ala Lys Ser Phe
260 265 270
Ser GIu Lys Arg lie Lys GIu Asn Met GIn VaI Phe GIu Phe GIn Leu
275 280 285
Thr Ser GIu Asp Met Lys VaI Leu Asp Asp Leu Asn Lys Asn lie Arg 290 295 300
Tyr lie Ser GIy Ser Ser Phe Lys Asp His Pro Asp Phe Pro Phe Trp 305 310 315 320
Asp GIu Tyr
<210> 2
<211> 343
<212> PRT
<213> Artificial Sequence
<220>
<223> modified 17-beta-dehydrogenase
<400> 2 Met GIy Ser Ser His His His His His His Ser Ser GIy Leu VaI Pro 1 5 10 15
Arg GIy Ser His Met Asp Ser Lys GIn GIn Thr VaI Arg Leu Ser Asp
20 25 30
GIy His Phe lie Pro lie Leu GIy Phe GIy Thr Tyr Ala Pro GIn GIu
35 40 45
VaI Pro Lys Ser Lys Ala Thr GIu Ala Thr Lys lie Ala lie Asp Ala 50 55 60
GIy Phe Arg His lie Asp Ser Ala Ser Met Tyr GIn Asn GIu Lys GIu 65 70 75 80
VaI GIy Leu Ala lie Arg Ser Lys lie Ala Asp GIy Thr VaI Lys Arg
85 90 95
GIu Asp lie Phe Tyr Thr Ser Lys VaI Trp Cys Thr Phe His Arg Pro
100 105 110
GIu Leu VaI Arg VaI Cys Leu GIu GIn Ser Leu Lys GIn Leu GIn Leu
115 120 125
Asp Tyr VaI Asp Leu Tyr Leu lie His Phe Pro Met Ala Met Lys Pro 130 135 140
GIy GIu Asn Tyr Leu Pro Lys Asp GIu Asn GIy Lys Leu lie Tyr Asp 145 150 155 160 Ala VaI Asp lie Cys Asp Thr Trp GIu Ala Met GIu Lys Cys Lys Asp 165 170 175
Ala GIy Leu Ala Lys Ser lie GIy VaI Ser Asn Phe Asn Arg Arg GIn
180 185 190
Leu GIu Lys lie Leu Lys Lys Pro GIy Leu Lys Tyr Lys Pro VaI Cys
195 200 205
Asn GIn VaI GIu Cys His Pro Tyr Leu Asn GIn GIy Lys Leu Leu Asp 210 215 220
Phe Cys Arg Ser Lys Asp lie VaI Leu VaI Ala Tyr Ser Ala Leu GIy 225 230 235 240
Ser His Arg GIu Lys GIn Trp VaI Asp GIn Ser Ser Pro VaI Leu Leu
245 250 255
Asp Asn Pro VaI Leu GIy Ser Met Ala Lys Lys Tyr Asn Arg Thr Pro
260 265 270
Ala Leu lie Ala Leu Arg Tyr GIn Leu GIn Arg GIy VaI VaI VaI Leu
275 280 285
Ala Lys Ser Phe Ser GIu Lys Arg lie Lys GIu Asn Met GIn VaI Phe 290 295 300 GIu Phe GIn Leu Thr Ser GIu Asp Met Lys VaI Leu Asp Asp Leu Asn 305 310 315 320
Lys Asn lie Arg Tyr lie Ser GIy Ser Ser Phe Lys Asp His Pro Asp
325 330 335
Phe Pro Phe Trp Asp GIu Tyr
340
<210> 3
<211> 23
<212> DNA
<213> Artificial Sequence
<220>
<223> forward primer
<400> 3
gctgagaaca tatggattct aag
23
<210> 4
<211> 1269
<212> DNA
<213> Rattus norvegicus
<400> 4
gtatcttctc agttggtggg ctgagaagcc atggattcta agcagcagac agtgcgtcta 60 agtgatggtc acttcatccc tatactgggg tttggtacct atgcacctca agaggtacct 120 aagagtaagg ctacagaagc tactaaaata gccatagatg ctggtttccg ccatattgat 180 tcgcttctat gtatcaaaat gaaaaggaag taggactagc catccgaagc aagatagcag 240 atggcactgt gaagagggaa gatatatttt acacatcaaa ggtttggtgt acttttcatc 300 gtccagaact cgtacgggtc tgcttggaac agtcattgaa gcaactccag ttggactatg 360 tggacctgta cctcattcat ttcccaatgg ccatgaagcc gggagaaaat tatctcccaa 420 aagatgaaaa tggaaaatta atatatgatg ctgtggatat ctgtgacacc tgggaagcca 480 tggagaaatg caaggatgca ggattggcca agtccattgg ggtgtccaac tttaaccgca 540 ggcagctgga gaagatcctg aaaaagccgg ggctcaagta caagcctgtg tgcaaccagg 600 tagaatgtca tccttatctc aatcagggaa aacttctgga tttctgcagg tcaaaagaca 660 ttgttctggt tgcttacagt gctctgggaa gccatcgtga aaaacaatgg gttgatcaga 720 gctctcctgt tcttttggat aatccagttc ttggctcaat ggcaaaaaag tacaatcgaa 780 ctcctgcgct gattgccctt cgctaccagc tacaacgtgg ggttgtggtc ctcgccaaga 840 gtttctctga gaagaggata aaagagaata tgcaggtttt tgaatttcag ttgacttcag 900 aggacatgaa agtcctcgat gacctgaata aaaatatccg atacataagt ggttctagct 960 ttaaggacca tcctgatttt ccattttggg atgaatacta actggaggtc cattttgtgc 1020 cttgtgccag atgtcactgc attggaagag tgtataggaa gagtattctc aaaatgtgat 1080 gattacatat caccctaatc caagcttctg agcaattctg gctctgctga atctaccatt 1140 ttaaccaaga aagccaaaac tatgtatatt tctcctttct aagaaataaa agaatcgtta 1200 ttctttagca tttaaaaaaa aaaaaaaaag ggcggccgct ctagagtatc cctcgagggg 1260 cccaagctt
1269

Claims

Claims
1. An industrial process for the synthesis of testosterone comprising the biocatalytic reduction of 4-androstene-3, 17-dione using the recombinant murine enzyme Type V 17β- hydroxysteroid dehydrogenase.
2. The process according to claim 1, wherein said recombinant murine enzyme Type V 17β- hydroxysteroid dehydrogenase has the amino acid sequence of SEQ. ID No. 2.
3. The process according to any preceding claim, further comprising the use of a cofactor selected from NADP(H) and NAD(H).
4. The process according to claim 1, wherein the cofactor is regenerated in situ.
5. The process according to claim 4, wherein the cofactor is employed in a catalytic amount.
6. The process according to claim 3, further comprising the use of a dehydrogenase enzyme for the regeneration of the cofactor and of a substrate for said dehydrogenase.
7. The process according to claim 6, wherein said dehydrogenase enzyme is selected from the group comprising glucose dehydrogenase and formate dehydrogenase.
8. The process according to claim 6 or 7, wherein said enzyme dehydrogenase for the regeneration of the cofactor is glucose dehydrogenase and said substrate is glucose.
9. The process according to claim 6 or 7, wherein said enzyme dehydrogenase for the regeneration of the cofactor is formate dehydrogenase and said substrate is sodium formate.
10. The process according to any one of the preceding claims, wherein said process comprises the use of solvents and/or co- solvents, preferably selected from the group comprising: methanol, ethanol, isopropanol, tert-butanol, glycerol, dimethyl sulfoxide, acetonitrile or dimethylformamide .
11. The process according to any preceding claim, wherein the pH is kept in the range between 4 and 9 and preferably in the range between 5 and 7.
12. The process according to any preceding claim, wherein the cofactor is NADPH and the pH is about 5.5.
13. The process according to any preceding claim, wherein the cofactor is NADH and the pH is about 6.5-7.0.
14. The process according to any preceding claim, which is carried out at a temperature between 200C and 400C.
15. A recombinant murine enzyme Type V 17β- hydroxysteroid dehydrogenase comprising the sequence of SEQ. ID No. 2.
16. The recombinant murine enzyme Type V 17β- hydroxysteroid dehydrogenase of claim 15 comprising the sequence of SEQ. ID No. 2, which is purified.
17. A purification process of a murine enzyme Type V 17β-hydroxysteroid dehydrogenase comprising the step of introducing into the enzyme amino- acidic sequence of a peptide segment composed of consecutive histidines (His-tag) .
18. Use of recombinant murine enzyme Type V 17β- hydroxysteroid dehydrogenase for the industrial biocatalytic reduction of 4- androstene-3, 17-dione to testosterone.
19. Use of recombinant murine enzyme Type V 17β- hydroxysteroid dehydrogenase, according to claim 18, wherein said enzyme comprises the amino acid sequence of SEQ. ID No. 2.
20. A process for the preparation of the recombinant murine enzyme Type V 17β- hydroxysteroid dehydrogenase of claim 15, comprising a step wherein the enzyme is expressed at the incubation temperature of between 200C and 300C.
PCT/EP2010/058411 2009-07-01 2010-06-15 Process for the preparation of testosterone Ceased WO2011000693A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
AU2010268260A AU2010268260B2 (en) 2009-07-01 2010-06-15 Process for the preparation of testosterone
CA2767052A CA2767052C (en) 2009-07-01 2010-06-15 Process for the preparation of testosterone
EP10725454.2A EP2449128B1 (en) 2009-07-01 2010-06-15 Enzymatic process for the preparation of testosterone using a "tag"
US13/119,915 US8592178B2 (en) 2009-07-01 2010-06-15 Process for the preparation of testosterone

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
ITMI2009A001168 2009-07-01
ITMI2009A001168A IT1398729B1 (en) 2009-07-01 2009-07-01 PROCESS FOR THE PREPARATION OF TESTOSTERONE

Publications (1)

Publication Number Publication Date
WO2011000693A1 true WO2011000693A1 (en) 2011-01-06

Family

ID=41667441

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2010/058411 Ceased WO2011000693A1 (en) 2009-07-01 2010-06-15 Process for the preparation of testosterone

Country Status (6)

Country Link
US (1) US8592178B2 (en)
EP (1) EP2449128B1 (en)
AU (1) AU2010268260B2 (en)
CA (1) CA2767052C (en)
IT (1) IT1398729B1 (en)
WO (1) WO2011000693A1 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ITMI20111338A1 (en) * 2011-07-19 2013-01-20 Italiana Sint Spa BIOENZYMATIC SYNTHESIS PROCEDURE AT HIGH CONCENTRATIONS OF TESTOSTERONE
WO2013117584A1 (en) 2012-02-07 2013-08-15 Annikki Gmbh Method for enzymatic redox cofactor regeneration
WO2013117251A1 (en) 2012-02-07 2013-08-15 Annikki Gmbh Method for enzymatic redox cofactor regeneration
US9315470B2 (en) 2013-02-20 2016-04-19 F.I.S.—Fabbrica Italiana Sintetiei S.p.A. Convenient process for the preparation of statins
EP3064589A1 (en) * 2015-07-29 2016-09-07 F.I.S.- Fabbrica Italiana Sintetici S.p.A. Enzymatic process for the preparation of testosterone and esters thereof
WO2017093980A1 (en) 2015-12-05 2017-06-08 Lupin Limited Process for preparation of testosterone

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000056879A1 (en) * 1999-03-22 2000-09-28 Universität Zürich TRANSFORMING GROWTH FACTOR (TFG) β SUPERFAMILY ANTAGONISTS
WO2007118644A1 (en) * 2006-04-11 2007-10-25 Iep Gmbh Process for the preparation of steroid derivatives by reduction of oxosteroid compounds or by oxidation of hydroxysteroid compounds using a hydroxysteroid dehydrogenase

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5643758A (en) * 1987-03-10 1997-07-01 New England Biolabs, Inc. Production and purification of a protein fused to a binding protein

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000056879A1 (en) * 1999-03-22 2000-09-28 Universität Zürich TRANSFORMING GROWTH FACTOR (TFG) β SUPERFAMILY ANTAGONISTS
WO2007118644A1 (en) * 2006-04-11 2007-10-25 Iep Gmbh Process for the preparation of steroid derivatives by reduction of oxosteroid compounds or by oxidation of hydroxysteroid compounds using a hydroxysteroid dehydrogenase

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
BRINKMANN ET AL: "Inhibition of tryptase TL2 from human T4+ lymphocytes and inhibition of HIV-1 replication in H9 cells by recombinant aprotinin and bikunin homologues", JOURNAL OF PROTEIN CHEMISTRY, vol. 16, 1997, pages 651 - 660, XP019283886 *
CÈBE ET AL: "Rapid and easy thermodynamic optimization of the 5'-end of mRNA dramatically increases the level of wild type protein expression in Escherichia coli", PROTEIN EXPRESSION AND PURIFICATION, vol. 45, 2006, pages 374 - 380, XP024908634 *
CHURCHILL ET AL: "Rapid purification of recombinant listeriolysin 0 (LL0) from Escherichia coli)", JOURNAL OF INDUSTRIAL MICROBIOLOGY AND BIOTECHNOLOGY, vol. 32, 2005, pages 355 - 363, XP019357745 *
DUFORT ET AL., ENDOCRYNOLOGY, vol. 140, no. 2, 1999, pages 568 - 574
DUFORT ET AL: "Characteristics of a highly labile human type 5 17-beta-hydroxysteroid dehydrogenase", ENDOCRINOLOGY, vol. 140, 1999, pages 568 - 574, XP002569809 *
LU ET AL: "Purification, reconstitution, and steady-state kinetics of the trans-membrane 17-beta-hydroxysteroid dehydrogenase 2", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 277, 2002, pages 22123 - 22130, XP002569506 *
NATURE, vol. 227, 1970, pages 680 - 685
STEFANO ET AL: "Biocatalyzed synthesis of testosterone", CHEMICAL ENGINEERING TRANSACTIONS, vol. 20, April 2010 (2010-04-01), pages 61 - 66, XP002594215 *

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ITMI20111338A1 (en) * 2011-07-19 2013-01-20 Italiana Sint Spa BIOENZYMATIC SYNTHESIS PROCEDURE AT HIGH CONCENTRATIONS OF TESTOSTERONE
WO2013117584A1 (en) 2012-02-07 2013-08-15 Annikki Gmbh Method for enzymatic redox cofactor regeneration
WO2013117251A1 (en) 2012-02-07 2013-08-15 Annikki Gmbh Method for enzymatic redox cofactor regeneration
US9644227B2 (en) 2012-02-07 2017-05-09 Annikki Gmbh Process for the enzymatic regeneration of redox cofactors
US10370691B2 (en) 2012-02-07 2019-08-06 Annikki Gmbh Process for the enzymatic regeneration of redox cofactors
US11339415B2 (en) 2012-02-07 2022-05-24 Annikki Gmbh Process for the enzymatic regeneration of redox cofactors
US9315470B2 (en) 2013-02-20 2016-04-19 F.I.S.—Fabbrica Italiana Sintetiei S.p.A. Convenient process for the preparation of statins
US9932361B2 (en) 2013-02-20 2018-04-03 F.I.S.—Fabbrica Italiana Sintetici S.p.A. Convenient process for the preparation of statins
EP3064589A1 (en) * 2015-07-29 2016-09-07 F.I.S.- Fabbrica Italiana Sintetici S.p.A. Enzymatic process for the preparation of testosterone and esters thereof
EP3124616A1 (en) * 2015-07-29 2017-02-01 F.I.S.- Fabbrica Italiana Sintetici S.p.A. Enzymatic process for the preparation of testosterone and esters thereof
WO2017093980A1 (en) 2015-12-05 2017-06-08 Lupin Limited Process for preparation of testosterone

Also Published As

Publication number Publication date
CA2767052A1 (en) 2011-01-06
EP2449128B1 (en) 2017-05-10
EP2449128A1 (en) 2012-05-09
CA2767052C (en) 2017-12-19
ITMI20091168A1 (en) 2011-01-02
AU2010268260B2 (en) 2014-07-31
IT1398729B1 (en) 2013-03-18
US20110207172A1 (en) 2011-08-25
AU2010268260A1 (en) 2012-02-02
US8592178B2 (en) 2013-11-26

Similar Documents

Publication Publication Date Title
AU2010268260B2 (en) Process for the preparation of testosterone
US20150004668A1 (en) Alkane oxidation by modified hydroxylases
US9200308B2 (en) Penicillium amagasakiense glucose oxidase mutants
JP4360786B2 (en) NADH oxidase from Lactobacillus
CN102203244A (en) Process for producing optically active amine derivative
Milhim et al. A novel NADPH-dependent flavoprotein reductase from Bacillus megaterium acts as an efficient cytochrome P450 reductase
CN102382805B (en) Polypeptide containing oxidoreductase and its use
US20110020851A1 (en) Novel glucose dehydrogenase
KR101803174B1 (en) Codon optimized cyclosporine specific P450 hydroxylase and whole cell biotransformation of cyclosporine in E. coli using thereof
Ropp et al. Cloning and expression of a member of a new cytochrome P-450 family: cytochrome P-450lin (CYP111) from Pseudomonas incognita
JP6398295B2 (en) Mutant glucose-6-phosphate dehydrogenase
Balme et al. Isolation and characterization of the flavin-binding domain of flavocytochrome b 2 expressed independently in Escherichia coli
JP2004215666A (en) Oxidoreductase
US8574882B2 (en) Thermostable 1,5-anhydroglucitol dehydrogenase, and method for measurement of 1,5-anhydroglucitol by using the same
Mennenga et al. Quinoprotein ethanol dehydrogenase from Pseudomonas aeruginosa: the unusual disulfide ring formed by adjacent cysteine residues is essential for efficient electron transfer to cytochrome c 550
Yin et al. Expression of two old yellow enzyme homologues from Gluconobacter oxydans and identification of their citral hydrogenation abilities
CN119630785A (en) Mutant ketoreductases with increased ketoreductase activity and methods and uses thereof
CN110004119B (en) -ketoester reductase mutant and application thereof in catalyzing and synthesizing (R) -alpha-lipoic acid precursor
KR20190095429A (en) Glutathione reductase
TW201043696A (en) Process for the stereoselective enzymatic reduction of keto compounds
EP4488368A1 (en) Nad(p)h oxidase
JP6476542B2 (en) Mutant glucose-6-phosphate dehydrogenase
CN111254170A (en) Method for preparing (S) -1,2,3, 4-tetrahydroisoquinoline-3-formic acid by multi-enzyme coupling
KR102023348B1 (en) Enzyme Protein BaCYP106A2, Method for Crystallization of BaCYP106A2 protein, and Use thereof
JP5724193B2 (en) Mutant reductase

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10725454

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 13119915

Country of ref document: US

REEP Request for entry into the european phase

Ref document number: 2010725454

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2767052

Country of ref document: CA

Ref document number: 2010725454

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2010268260

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2010268260

Country of ref document: AU

Date of ref document: 20100615

Kind code of ref document: A