WO2010135813A1 - Increased seed oil and abiotic stress tolerance mediated by hsi2 - Google Patents

Increased seed oil and abiotic stress tolerance mediated by hsi2 Download PDF

Info

Publication number
WO2010135813A1
WO2010135813A1 PCT/CA2010/000754 CA2010000754W WO2010135813A1 WO 2010135813 A1 WO2010135813 A1 WO 2010135813A1 CA 2010000754 W CA2010000754 W CA 2010000754W WO 2010135813 A1 WO2010135813 A1 WO 2010135813A1
Authority
WO
WIPO (PCT)
Prior art keywords
hsi2
plant
protein
expression
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CA2010/000754
Other languages
French (fr)
Inventor
Nirmala Sharma
Pierre R. J. A. Fobert
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
National Research Council of Canada
Original Assignee
National Research Council of Canada
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by National Research Council of Canada filed Critical National Research Council of Canada
Priority to CA2762204A priority Critical patent/CA2762204A1/en
Priority to US13/320,813 priority patent/US20120066794A1/en
Publication of WO2010135813A1 publication Critical patent/WO2010135813A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • C12N15/8247Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine involving modified lipid metabolism, e.g. seed oil composition
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8262Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield involving plant development
    • C12N15/8266Abscission; Dehiscence; Senescence
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • C12N15/8273Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for drought, cold, salt resistance

Definitions

  • This invention is related to genetic manipulation of plants to alter plant phenotype
  • the present invention is related to altering expression of a HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein in a plant to alter seed oil content and abiotic stress responses
  • canola is the top Canadian cash crop, generating some $11 B of economic activity Canola is valued for its superior oil quality and seed oil represents an estimated 80% of the worth of the crop
  • Recent changes to the registration standards for Canadian canola focus upon an increase in oil content for new varieties and the Canadian industry is targeting a 2 5% increase of seed oil levels to 45% by 2015 Economically, it has been estimated that a 1% increase in seed oil yield translates to an annual value of $80 M CAD
  • increasing seed oil content has been identified by the industry as an important research objective Achieving this goal is a considerable challenge when one considers that the general trend in the past has been towards a slow upward drift in oil content
  • harvest surveys dating back to 1956 show a linear rise (nonsignificant) of only 0 05% in oil
  • lipid biosynthetic genes such as diacylglycerol acyltransferase (DGAT) or genes encoding regulatory elements including kinases such as pyruvate dehydrogenase complex kinase (PDCK) and transcription factors such as WRINKLED1 (WRH )
  • DGAT diacylglycerol acyltransferase
  • PDCK pyruvate dehydrogenase complex kinase
  • WRINKLED1 WRINKLED1
  • Increases in seed oil modification using the existing approaches are often modest necessitating the use of multiple genes in combination
  • Stacking genes with different modes of action may be advantageous resulting in additive or synergist effects HSI2 (HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE GENE 2 AT2G30470) also known as VAL1 ⁇ VIVIPAROUS ABA INSENSTIVE3-LIKE), is an Arabidopsis gene that encodes a
  • a method of increasing seed oil content in a plant comprising introducing into the plant means for encoding a HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein to thereby increase expression of HSI2 protein in the plant to thereby increase seed oil content in the plant compared to a plant grown under similar conditions in which the means for encoding the HSI2 protein has not been introduced
  • a method of decreasing abscisic acid sensitivity and/or increasing drought resistance in a plant comprising reducing expression of HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein in the plant to thereby decrease abscisic acid sensitivity and/or increase drought resistance in the plant compared to a plant grown under similar conditions in which expression of the HSI2 protein has not been reduced
  • nucleic acid construct comprising means for encoding a HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein operably linked to one or more nucleic acid sequences required for transforming the construct into a cell and/or for expressing or overexpressing the HSI2 protein encoding means in the cell
  • Fig 1 depicts a vector map for a binary T-DNA HSI2 transformation vector
  • Fig 2A depicts a graph showing seed oil content in the hs ⁇ 2 Arabidopsis thaliana T-DNA insertion mutant line ⁇ hs ⁇ 2-5) and the wild type CoI-O
  • Fig 2B depicts a graph showing seed oil content of hs ⁇ 2 mutants (hs ⁇ 2-3 and hs ⁇ 2- 5) and three HSI2 complementation lines (complementation in hs ⁇ 2-5, HSI2 comp-18-3-1 , HSI2 comp-12-2-1 and HSI2 comp-19-3-1) compared to wild type (Col-2 and Col-0-1) hs ⁇ 2-5 is in columb ⁇ a-0 background and hs ⁇ 2-3 is in columb ⁇ a-2 background
  • Fig 3A depicts a graph showing germination of hs ⁇ 2 T-DNA insertion mutant lines and their corresponding wild types on half-strength MS medium supplemented with various concentrations of ABA, 72 hrs after stratification hs ⁇ 2-5 compares with the CoI-O wild type and hs ⁇ 2-3 compares with the Col-2 wild type
  • Fig 3B depicts a graph showing ABI3 and ABI5 gene expression in the absence of ABA 96 hr post-stratification in hs ⁇ 2-3 seedlings compared to the wild type (Col-2)
  • Fig 4A depicts a bar graph showing drought tolerance after 10 days of withholding water for hs ⁇ 2 T-DNA insertion mutant lines compared to their corresponding wild types hs ⁇ 2-5 compares with the CoI-O wild type and hs ⁇ 2-3 compares with the Col-2 wild type
  • Fig 4B depicts a line graph showing drought tolerance during the period of 14-16 days after withholding water for hs ⁇ 2-5 compared with the CoI-O wild type Experiments were repeated three times using different pot sizes potting mixes and different growth cabinets
  • Fig 4C depicts a line graph showing drought tolerance during the period of 17-19 days after withholding water for hs ⁇ 2-3 compared with the Col-2 wild type Experiments were repeated three times using different pot sizes, potting mixes and different growth cabinets
  • Fig. 4D depicts a bar graph showing the relative water content after 19 days of withholding water for hsi2 T-DNA insertion mutant lines compared to their corresponding wild types.
  • hsi2-5 compares with the CoI-O wild type and hsi2-3 compares with the Col-2 wild type.
  • Fig. 4E depicts a graph showing expression of Myb-like transcription factor gene in hsi2 T-DNA insertion mutant lines compared to their corresponding wild types approaching visible wilting.
  • hsi2-5 compares with the CoI-O wild type and hsi2-3 compares with the Col-2 wild type.
  • SUGAR-INDUCIBLE 2 (HSI2) protein is an Arabidopsis nucleic acid molecule (HSI2) (SEQ ID NO: 1 ). This nucleic acid molecule encodes a putative chromatin remodeling factor and transcriptional repressor protein (SEQ ID NO: 2).
  • HSI2 protein includes, for example, nucleic acid molecules that encode proteins having at least 80% sequence identity to SEQ ID NO: 2.
  • Arabidopsis plants containing T-DNA insertions in HSI2 display greater tolerance to the plant hormone abscisic acid (ABA), which is involved in regulating many physiological processes, including seed maturation and tolerance to abiotic stresses including drought.
  • ABA abscisic acid
  • Complementary nucleotide sequence "Complementary nucleotide sequence" of a sequence is understood as meaning any DNA whose nucleotides are complementary to those of sequence of the disclosure, and whose orientation is reversed (antiparallel sequence).
  • degree or percentage of sequence homology refers to degree or percentage of sequence identity between two sequences after optimal alignment. Percentage of sequence identity (or degree or identity) is determined by comparing two optimally aligned sequences over a comparison window, where the portion of the peptide or polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
  • the percentage is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • isolated refers to polypeptides or nucleic acids that have been “isolated” from their native environment.
  • Nucleotide, polynucleotide, or nucleic acid sequence will be understood as meaning both a double-stranded or single-stranded DNA in the monomeric and dimeric (so-called in tandem) forms and the transcription products of said DNAs.
  • sequences of amino-acids or nucleotidic residues in the two sequences are typically performed by comparing sequences of two optimally aligned sequences over a segment or "comparison window" to identify and compare local regions of sequence similarity
  • Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman (Smith 1981), by the homology alignment algorithm of Neddleman and Wunsch (Neddleman 1970), by the search for similarity method of Pearson and Lipman (Pearson 1988), by computerized implementation of these algorithms (GAP, BESTFIT 1 FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr , Madison, Wis ), or by visual inspection
  • Isolated and/or purified sequences of the present invention may have a percentage identity with the bases of a nucleotide sequence, or
  • sequence identity is the definition that would be used by one of skill in the art
  • the definition by itself does not need the help of any algorithm, said algorithms being helpful only to achieve the optimal alignments of sequences, rather than the calculation of sequence identity
  • BLAST N or BLAST P "BLAST 2 sequence”
  • software which is available in the web site http //www ncbi nlm nih gov/gorf/bl2 html, and habitually used by the inventors and in general by the skilled man for comparing and determining the identity between two sequences, gap cost which depends on the sequence length to be compared is directly selected by the software ( ⁇ e 11 2 for substitution matrix BLOSUM-62 for length>85)
  • HSI2 nucleotide sequences can be expressed in alternate plant hosts to impart characteristics of improved agronomic performance via recombinant means.
  • the methods to construct DNA expression vector and to transform and express foreign genes in plant and plant cells are well known in the art.
  • sequences can be used in the construction of a construct or an expression vector. It is well known that nucleotide sequences encoding HSI2 can be inserted within an expression vector for heterologous expression in diverse host cells and organisms, for example plant cells and plant, by conventional techniques. These methods, which can be used in the invention, have been described elsewhere (Potrykus 1991 ; Vasil 1994; Walden 1995; Songstad 1995), and are well known to persons skilled in the art. As known in the art, there are a number of ways by which genes and gene constructs can be introduced into plants and a combination of transformation and tissue culture techniques have been successfully integrated into effective strategies for creating transgenic plants.
  • Agrobacterium Ti-plasmid mediated transformation e.g., hypocotyl (DeBlock 1989) or cotyledonary petiole (Moloney 1989) wound infection
  • particle bombardment/biolistic methods Sanford 1987; Nehra 1994; Becker 1994
  • polyethylene glycol-assisted, protoplast transformation Raster 1988; Shimamoto 1989
  • promoters to direct any intended regulation of transgene expression using constitutive promoters (e.g., those based on CaMV35S), or by using promoters which can target gene expression to particular cells, tissues (e.g., napin promoter for expression of transgenes in developing seed cotyledons), organs (e.g., roots), to a particular developmental stage, or in response to a particular external stimulus (e.g., heat shock).
  • Promoters for use herein may be inducible, constitutive, or tissue-specific or cell specific or have various combinations of such characteristics.
  • Useful promoters include, but are not limited to constitutive promoters such as carnation etched ring virus (CERV), cauliflower mosaic virus (CaMV) 35S promoter, or more particularly the double enhanced cauliflower mosaic virus promoter, comprising two CaMV 35S promoters in tandem (referred to as a "Double 35S" promoter).
  • CERV carnation etched ring virus
  • CaMV cauliflower mosaic virus
  • Double 35S double enhanced cauliflower mosaic virus promoter, comprising two CaMV 35S promoters in tandem
  • Meristem specific promoters include, for example, STM, BP, WUS, CLV gene promoters.
  • Seed specific promoters include, for example, the napin promoter.
  • Other cell and tissue specific promoters are well known in the art.
  • Promoter and termination regulatory regions that will be functional in the host plant cell may be heterologous (that is, not naturally occurring) or homologous (derived from the plant host species) to the plant cell and the gene. Suitable promoters which may be used are described above.
  • the termination regulatory region may be derived from the 3' region of the gene from which the promoter was obtained or from another gene. Suitable termination regions which may be used are well known in the art and include Agrobacterium tumefaciens nopaline synthase terminator (Tnos), A. tumefaciens mannopine synthase terminator (Tmas) and the CaMV 35S terminator (T35S).
  • termination regions for use herein include the pea ribulose bisphosphate carboxylase small subunit termination region (TrbcS) or the Tnos termination region.
  • TrbcS pea ribulose bisphosphate carboxylase small subunit termination region
  • Such gene constructs may suitably be screened for activity by transformation into a host plant via Agrobacterium and screening for the desired activity using known techniques.
  • a nucleic acid molecule construct for use herein is comprised within a vector, most suitably an expression vector adapted for expression in an appropriate plant cell.
  • a vector most suitably an expression vector adapted for expression in an appropriate plant cell.
  • any vector which is capable of producing a plant comprising the introduced nucleic acid sequence will be sufficient.
  • Suitable vectors are well known to those skilled in the art and are described in general technical references.
  • Particularly suitable vectors include the Ti plasmid vectors. After transformation of the plant cells or plant, those plant cells or plants into which the desired nucleic acid molecule has been incorporated may be selected by such methods as antibiotic resistance, herbicide resistance, tolerance to amino-acid analogues or using phenotypic markers.
  • RNA samples may be used to determine whether the plant cell shows an increase in gene expression, for example, Northern blotting or quantitative reverse transcriptase PCR (RT-PCR).
  • RT-PCR quantitative reverse transcriptase PCR
  • Whole transgenic plants may be regenerated from the transformed cell by conventional methods. Such plants produce seeds containing the genes for the introduced trait and can be grown to produce plants that will produce the selected phenotype.
  • genes encoding HSI2 may be done in combination with overexpression or expression of one or more other genes involved in seed oil production and/or abiotic stress tolerance, for example, lipid biosynthetic genes such as diacylglycerol acyltransferase (DGAT) or genes encoding regulatory elements including kinases such as pyruvate dehydrogenase complex kinase (PDCK) and transcription factors such as WRINKLED1 (WRM)
  • DGAT diacylglycerol acyltransferase
  • PDCK pyruvate dehydrogenase complex kinase
  • WRM WRINKLED1
  • Preferred plants in which HSI2 activity may be expressed or overexpressed include crop species, especially oilseed plant species
  • Some examples include Brassicaceae spp (e g rapeseed and Canola), Borago spp (borage), Ricinus spp (e g Ricinus communis (castor)), Theobroma spp (e g Theobroma cacao (cocoa bean)), Gossypium spp (cotton), Crambe spp , Cuphea spp , Linum spp (flax), Lesquerella spp , Limnanthes spp , Linola, Tropaeolum spp (nasturtium), Olea spp (olive), EIaeis spp (palm), Arachis spp (peanut), Carthamus spp (safflower), Glycine spp (soybean), Soya spp (so
  • RNA interference RNA interference
  • VGS virus-induced gene silencing
  • RNAi techniques involve stable transformation using RNA interference (RNAi) plasmid constructs (Helliwell 2005) Such plasmids are composed of a fragment of the target gene to be silenced in an inverted repeat structure The inverted repeats are separated by a spacer, often an intron
  • RNAi construct driven by a suitable promoter for example, the Cauliflower mosaic virus (CaMV) 35S promoter, is integrated into the plant genome and subsequent transcription of the transgene leads to an RNA molecule that folds back on itself to form a double-stranded hairpin RNA This double-stranded
  • RNA structure is recognized by the plant and cut into small RNAs (about 21 nucleotides long) called small interfering RNAs (siRNAs) siRNAs associate with a protein complex
  • RISC which goes on to direct degradation of the mRNA for the target gene
  • amiRNA Artificial microRNA
  • miRNA microRNA pathway that functions to silence endogenous genes in plants and other eukaryotes
  • RNAi silencing techniques Two factors can influence the choice of length of the fragment The shorter the fragment the less frequently effective silencing will be achieved, but very long hairpins increase the chance of recombination in bacterial host strains
  • the effectiveness of silencing also appears to be gene dependent and could reflect accessibility of target mRNA or the relative abundances of the target mRNA and the hpRNA in cells in which the gene is active
  • a fragment length of between 100 and 800 bp, preferably between 300 and 600 bp, is generally suitable to maximize the efficiency of silencing obtained
  • the other consideration is the part of the gene to be targeted 5' UTR coding region, and 3' UTR fragments can be used with equally good results
  • the mechanism of silencing depends on sequence homology there is potential for cross- silen ⁇ ng of related mRNA sequences Where this is not desirable a region with low sequence similarity to other sequences, such as a 5' or 3' UTR, should be chosen
  • the rule for avoiding cross-homology silencing appears to
  • VIGS Virus-induced gene silencing
  • TRV tobacco rattle virus
  • Antisense techniques involve introducing into a plant an antisense oligonucleotide that will bind to the messenger RNA (mRNA) produced by the gene of interest
  • mRNA messenger RNA
  • the "antisense” oligonucleotide has a base sequence complementary to the gene's messenger RNA (mRNA), which is called the “sense” sequence Activity of the sense segment of the mRNA is blocked by the anti-sense mRNA segment, thereby effectively inactivating gene expression
  • mRNA messenger RNA
  • Sense co-suppression techniques involve introducing a highly expressed sense transgene into a plant resulting in reduced expression of both the transgene and the endogenous gene (Depicker 1997). The effect depends on sequence identity between transgene and endogenous gene.
  • Targeted mutagenesis techniques for example TILLING (Targeting Induced Local Lesions IN Genomes) and "delete-a-gene” using fast-neutron bombardment, may be used to knockout gene function in a plant (Henikoff 2004; Li 2001).
  • TILLING involves treating seeds or individual cells with a mutagen to cause point mutations that are then discovered in genes of interest using a sensitive method for single-nucleotide mutation detection. Detection of desired mutations (e.g. mutations resulting in the inactivation of the gene product of interest) may be accomplished, for example, by PCR methods.
  • oligonucleotide primers derived from the gene of interest may be prepared and PCR may be used to amplify regions of the gene of interest from plants in the mutagenized population.
  • Amplified mutant genes may be annealed to wild-type genes to find mismatches between the mutant genes and wild-type genes. Detected differences may be traced back to the plants which had the mutant gene thereby revealing which mutagenized plants will have the desired expression (e.g. silencing of the gene of interest). These plants may then be selectively bred to produce a population having the desired expression.
  • TILLING can provide an allelic series that includes missense and knockout mutations, which exhibit reduced expression of the targeted gene.
  • TILLING is advocated as a possible approach to gene knockout that does not involve introduction of transgenes, and therefore may be more acceptable to consumers.
  • Fast-neutron bombardment induces mutations, i.e. deletions, in plant genomes that can also be detected using PCR in a manner similar to TILLING.
  • the genomic protein coding region of At2g30470 was cloned from the bacterial artificial chromosome T6B20 into cloning vector pJM1 by recombination as described by Liu et al. (Liu 2003) and subsequently into the binary T-DNA vectors pDMC32:At2S3 and pER330 using Gateway technology (Invitrogen).
  • Agrobacterium strain GV3101 (MP90) harboring the T-DNA vector was used to transform the At2S3 (napin):HSI2 and cauliflower mosaic virus 35S: HSI2 gene constructs into Arabidopsis thaliana (Columbia-0 ecotype) by floral dipping.
  • the vectors were also transformed into Brassica napus (DH 12075) as described by Zou et al. (Zou 1997).
  • the At2S3 (napin):HSI2 vector map is shown in Fig. 1.
  • Two putative hsi2 T-DNA insertion lines were identified in Arabidopsis thaliana (Columbia-0 and Columbia-2 backgrounds) from the SaIk Institute Genomic Laboratory Genomic database (http://signal.salk.edu) and seeds were obtained from the Arabidopsis Biological Resource Centre (ABRC). Homozygote T-DNA insertion lines were identified though PCR genotyping.
  • hsi2-5 (Salk_088606) was identified in Columbia-0 background and hsi2-3 (WiscDsLox388F10) was identified in Columbia-2 background.
  • the insertion lines were analyzed for seed oil content, fatty acid profile, and ABA responses during germination and drought tolerance in juvenile plants.
  • Seeds of T-DNA insertion mutant lines of HSI2 and the wild type were stratified in the dark for 3 days at 4 0 C and sown on SunshineTM Mix4 germination medium (Sun Gro Horticulture, Canada). Plants were germinated and grown in a growth chamber (Conviron) under 16-hr photoperiod, 21/18 0 C day/night temperature cycle and about 250 ⁇ E light intensity. Secondary shoots were trimmed out and siliques on primary shoots were allowed to dry on plants before moving to a finishing chamber for another 2 weeks to ensure complete ripening of seeds. Seeds were harvested only from main shoots and allowed to dry at room temperature for 2-3 weeks before analyzing for seed oil content and fatty acid profiles.
  • Total lipids were extracted by grinding seeds in chloroform:isopropanol (2:1). The solvent was evaporated off at room temperature under a stream of nitrogen gas and total lipids were transmethylated by heating samples with 3 N methanolic HCI at 8O 0 C for 3 hrs. Fatty acids methyl esters (FAMES) were then extracted with GC grade hexane in presence of 0.9% NaCI. The solvent (hexane) was evaporated under a stream of nitrogen gas and FAMES were re-dissolved in 500 ⁇ l of methyl esters standards (17:0 M. E. and 23:0 M. E.) in hexane and analyzed by GC. Seed oil content and fatty acid profiles were calculated as a percentage (%) of dry seed weight.
  • Fatty acids methyl esters Fatty acids methyl esters
  • Oil content was measured on the Arabidopsis hs ⁇ ' 2-5 T-DNA insertion mutant lines along with its wild type at four separate times, and the mutant shows a decrease in seed oil content (Fig. 2A). However, profiles of fatty acids were not altered in the mutant line. On the other hand, preliminary oil analysis on primary transformants in Brassica napus (DH 12075) over expressing HSI2 in seeds under the control of napin and 35S promoters indicated a slight increase in seed oil content (data not shown).
  • Seeds were surface-sterilized with 30% bleach (0 01 % TweenTM-20), rinsed several times with sterilized water, and sown on 1 5% agar plates containing half-strength
  • Murashige and Skoog (MS) salt solution supplemented or not with 0 ⁇ M, 0 25 ⁇ M or 0 3 ⁇ M ABA ( ⁇ ABA, Toray batch, PBI 58, NRC/PBI Saskatoon)
  • ABA ⁇ ABA, Toray batch, PBI 58, NRC/PBI Saskatoon
  • the plates were transferred to a tissue culture room after a cold treatment of 2 days at 4°C in the dark, and incubated at 20°C/16°C day/night temperatures under a 16 hrs/8 hrs light/dark regime and 80 -100 ⁇ E irradiance
  • Germination (defined as endosperm rupture and radical emergence) was scored starting 24 hrs after seed stratification Germination events are expressed as a percentage of the total number of seeds per plate Germination experiments were repeated at least three times using three different seed batches of wild type and T-DNA insertion mutant lines (hs ⁇ 2-5 and hs ⁇ 2-3) grown in parallel
  • Both of the T-DNA insertion mutant liens showed a decreased sensitivity to ABA during germination as indicated by faster and higher overall germination than in the corresponding wild type in presence of ABA in the germination medium (Fig 3A)
  • ABI3 and ABI5 are two genes known to inhibit seed germination by arresting embryo growth Both hs ⁇ 2 alleles show minimal or no expression of these genes during seed germination 96 hr after stratification (Fig 3B) This could explain why these mutants germinate better in presence of ABA
  • Leaf relative water content at 19 days of withholding water was also determined for his2 mutants compared to their wild type (Fig. 4D).
  • Leaf relative water content is an indicator of how well a plant is able to maintain its water status during a stress.
  • the his2 mutants maintain higher leaf relative water content during drought stress than their wild types.
  • Myb-like transcription factor is one of the genes involved in regulating stomatal aperture and hence potentially involved in plant water use. Expression of Myb-like transcription factor gene in hsi2 mutant plants approaching visible wilting was determined. hsi2 mutants express higher levels of this gene in their leaves (Fig. 4E) than their wild types, which may help in regulating water loss through transpiration and hence more drought tolerance.
  • HSI2 - nucleotide sequence (SEQ ID NO: 1) - Arabidopsis thaliana (2373 bp)

Landscapes

  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Cell Biology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Nutrition Science (AREA)
  • Botany (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

Increased seed oil content, decreased abscisic acid sensitivity and/or increased drought resistance in a plant may be accomplished by altering expression of a HIGH- LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein in the plant to thereby increase or decrease expression of HSI2 in the plant compared to a plant grown under similar conditions in which the expression of HSI2 was unaltered. Increasing expression of HSI2 increases oil content while decreasing expression of HSI2 decreases abscisic acid sensitivity and/or increases drought resistance.

Description

INCREASED SEED OIL AND ABIOTIC STRESS TOLERANCE MEDIATED BY HSI2
Cross-reference to Related Applications
This application claims the benefit of United States Provisional Patent Application USSN 61/213,314 filed May 28, 2009, the entire contents of which is herein incorporated by reference
Field of the Invention
This invention is related to genetic manipulation of plants to alter plant phenotype In particular, the present invention is related to altering expression of a HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein in a plant to alter seed oil content and abiotic stress responses
Background of the Invention
In most years, canola is the top Canadian cash crop, generating some $11 B of economic activity Canola is valued for its superior oil quality and seed oil represents an estimated 80% of the worth of the crop Recent changes to the registration standards for Canadian canola focus upon an increase in oil content for new varieties and the Canadian industry is targeting a 2 5% increase of seed oil levels to 45% by 2015 Economically, it has been estimated that a 1% increase in seed oil yield translates to an annual value of $80 M CAD Not surprisingly, increasing seed oil content has been identified by the industry as an important research objective Achieving this goal is a considerable challenge when one considers that the general trend in the past has been towards a slow upward drift in oil content According to information from the Canadian Grain Commission, harvest surveys dating back to 1956 show a linear rise (nonsignificant) of only 0 05% in oil
Several strategies can be used to increase seed oil content, including conventional breeding marker assisted breeding and transgenic modifications Previous and on-going studies using transgenics have focused on manipulation of lipid biosynthetic genes such as diacylglycerol acyltransferase (DGAT) or genes encoding regulatory elements including kinases such as pyruvate dehydrogenase complex kinase (PDCK) and transcription factors such as WRINKLED1 (WRH ) Increases in seed oil modification using the existing approaches are often modest necessitating the use of multiple genes in combination Stacking genes with different modes of action may be advantageous resulting in additive or synergist effects HSI2 (HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE GENE 2 AT2G30470) also known as VAL1 {VIVIPAROUS ABA INSENSTIVE3-LIKE), is an Arabidopsis gene that encodes a putative chromatin remodeling factor and transcriptional repressor
There remains a need in the art for approaches to modifying seed oil content and/or abiotic stress responses in a plant
Summary of the Invention
It has now been found that increasing levels of the HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein is an effective means of increasing seed oil content in a plant In addition, reducing levels of HSI2 in a plant increases tolerance of plants to various abiotic stresses
Thus, there is provided a method of increasing seed oil content in a plant comprising introducing into the plant means for encoding a HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein to thereby increase expression of HSI2 protein in the plant to thereby increase seed oil content in the plant compared to a plant grown under similar conditions in which the means for encoding the HSI2 protein has not been introduced
There is further provided a method of decreasing abscisic acid sensitivity and/or increasing drought resistance in a plant comprising reducing expression of HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein in the plant to thereby decrease abscisic acid sensitivity and/or increase drought resistance in the plant compared to a plant grown under similar conditions in which expression of the HSI2 protein has not been reduced
There is also provided a nucleic acid construct comprising means for encoding a HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein operably linked to one or more nucleic acid sequences required for transforming the construct into a cell and/or for expressing or overexpressing the HSI2 protein encoding means in the cell
There is also provided a cell, seed or plant comprising the nucleic acid construct of the present invention
Further features of the invention will be described or will become apparent in the course of the following detailed description Brief Description of the Drawings
In order that the invention may be more clearly understood, embodiments thereof will now be described in detail by way of example, with reference to the accompanying drawings, in which
Fig 1 depicts a vector map for a binary T-DNA HSI2 transformation vector
Fig 2A depicts a graph showing seed oil content in the hsι2 Arabidopsis thaliana T-DNA insertion mutant line {hsι2-5) and the wild type CoI-O
Fig 2B depicts a graph showing seed oil content of hsι2 mutants (hsι2-3 and hsι2- 5) and three HSI2 complementation lines (complementation in hsι2-5, HSI2 comp-18-3-1 , HSI2 comp-12-2-1 and HSI2 comp-19-3-1) compared to wild type (Col-2 and Col-0-1) hsι2-5 is in columbιa-0 background and hsι2-3 is in columbιa-2 background
Fig 3A depicts a graph showing germination of hsι2 T-DNA insertion mutant lines and their corresponding wild types on half-strength MS medium supplemented with various concentrations of ABA, 72 hrs after stratification hsι2-5 compares with the CoI-O wild type and hsι2-3 compares with the Col-2 wild type
Fig 3B depicts a graph showing ABI3 and ABI5 gene expression in the absence of ABA 96 hr post-stratification in hsι2-3 seedlings compared to the wild type (Col-2)
Fig 4A depicts a bar graph showing drought tolerance after 10 days of withholding water for hsι2 T-DNA insertion mutant lines compared to their corresponding wild types hsι2-5 compares with the CoI-O wild type and hsι2-3 compares with the Col-2 wild type
Fig 4B depicts a line graph showing drought tolerance during the period of 14-16 days after withholding water for hsι2-5 compared with the CoI-O wild type Experiments were repeated three times using different pot sizes potting mixes and different growth cabinets
Fig 4C depicts a line graph showing drought tolerance during the period of 17-19 days after withholding water for hsι2-3 compared with the Col-2 wild type Experiments were repeated three times using different pot sizes, potting mixes and different growth cabinets Fig. 4D depicts a bar graph showing the relative water content after 19 days of withholding water for hsi2 T-DNA insertion mutant lines compared to their corresponding wild types. hsi2-5 compares with the CoI-O wild type and hsi2-3 compares with the Col-2 wild type.
Fig. 4E depicts a graph showing expression of Myb-like transcription factor gene in hsi2 T-DNA insertion mutant lines compared to their corresponding wild types approaching visible wilting. hsi2-5 compares with the CoI-O wild type and hsi2-3 compares with the Col-2 wild type.
Description of Preferred Embodiments
An example of one means for encoding a HIGH-LEVEL EXPRESSION OF
SUGAR-INDUCIBLE 2 (HSI2) protein is an Arabidopsis nucleic acid molecule (HSI2) (SEQ ID NO: 1 ). This nucleic acid molecule encodes a putative chromatin remodeling factor and transcriptional repressor protein (SEQ ID NO: 2).
Other means for encoding a HSI2 protein include, for example, nucleic acid molecules that encode proteins having at least 80% sequence identity to SEQ ID NO: 2.
It has now been found that loss of HSI2 reduces the level of seed oil in Arabidopsis thaliana. On the other hand, preliminary oil analysis on primary transformants in Brassica napus overexpressing HSI2 indicate an increase in seed oil content indicating that HSI2 overexpression increases levels of seed oil.
Also, it has now been found that Arabidopsis plants containing T-DNA insertions in HSI2 display greater tolerance to the plant hormone abscisic acid (ABA), which is involved in regulating many physiological processes, including seed maturation and tolerance to abiotic stresses including drought. By subjecting young juvenile plants to drought stress, it is directly shown that hsi2 T-DNA insertion lines are more drought tolerant than their wild type counterparts.
Double mutants in HSI2 and its closest relative in Arabidopsis leads to the production of embryos on seedling tissues. Although this indicates that HSI2 represses embryogenic programs in vegetative tissues, it has not been previously shown that HSI2 can positively contribute to seed oil accumulation. In fact, given that HSI2 represses embryogenesis, one would predict that overexpression would have a negative impact on seed oil accumulation. Thus, it is surprising that overexpression of HSI2 does lead to increases in seed oil accumulation. Since the nucleic acid molecule is a gene involved in regulating chromatin structure, HSI2 is likely to regulate seed oil accumulation by mechanisms that are distinct from those of previously reported genes.
Terms
In order to facilitate review of the various embodiments of the disclosure, the following explanations of specific terms are provided:
Complementary nucleotide sequence: "Complementary nucleotide sequence" of a sequence is understood as meaning any DNA whose nucleotides are complementary to those of sequence of the disclosure, and whose orientation is reversed (antiparallel sequence).
Degree or percentage of sequence homology: The term "degree or percentage of sequence homology" refers to degree or percentage of sequence identity between two sequences after optimal alignment. Percentage of sequence identity (or degree or identity) is determined by comparing two optimally aligned sequences over a comparison window, where the portion of the peptide or polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
Isolated: As will be appreciated by one of skill in the art, "isolated" refers to polypeptides or nucleic acids that have been "isolated" from their native environment.
Nucleotide, polynucleotide, or nucleic acid sequence: "Nucleotide, polynucleotide, or nucleic acid sequence" will be understood as meaning both a double-stranded or single-stranded DNA in the monomeric and dimeric (so-called in tandem) forms and the transcription products of said DNAs.
Sequence identity: Two amino-acid or nucleotide sequences are said to be
"identical" if the sequence of amino-acids or nucleotidic residues in the two sequences is the same when aligned for maximum correspondence as described below. Sequence comparisons between two (or more) peptides or polynucleotides are typically performed by comparing sequences of two optimally aligned sequences over a segment or "comparison window" to identify and compare local regions of sequence similarity Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman (Smith 1981), by the homology alignment algorithm of Neddleman and Wunsch (Neddleman 1970), by the search for similarity method of Pearson and Lipman (Pearson 1988), by computerized implementation of these algorithms (GAP, BESTFIT1 FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr , Madison, Wis ), or by visual inspection Isolated and/or purified sequences of the present invention may have a percentage identity with the bases of a nucleotide sequence, or the amino acids of a polypeptide sequence, of at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99 5%, 99 6%, or 99 7% This percentage is purely statistical and it is possible to distribute the differences between the two nucleotide sequences at random and over the whole of their length
The definition of sequence identity given above is the definition that would be used by one of skill in the art The definition by itself does not need the help of any algorithm, said algorithms being helpful only to achieve the optimal alignments of sequences, rather than the calculation of sequence identity From the definition given above, it follows that there is a well defined and only one value for the sequence identity between two compared sequences which value corresponds to the value obtained for the best or optimal alignment In the BLAST N or BLAST P "BLAST 2 sequence", software which is available in the web site http //www ncbi nlm nih gov/gorf/bl2 html, and habitually used by the inventors and in general by the skilled man for comparing and determining the identity between two sequences, gap cost which depends on the sequence length to be compared is directly selected by the software (ι e 11 2 for substitution matrix BLOSUM-62 for length>85)
It will be appreciated that this disclosure embraces the degeneracy of codon usage as would be understood by one of ordinary skill in the art and as illustrated in Table 1 Furthermore, it will be understood by one skilled in the art that conservative substitutions may be made in the amino acid sequence of a polypeptide without disrupting the structure or function of the polypeptide Conservative substitutions are accomplished by the skilled artisan by substituting amino acids with similar hydrophobicity, polarity, and R-chain length for one another Additionally, by comparing aligned sequences of homologous proteins from different species, conservative substitutions may be identified by locating amino acid residues that have been mutated between species without altering the basic functions of the encoded proteins. Table 2 provides an exemplary list of conservative substitutions.
Table 1 Codon Degeneracies
Figure imgf000009_0001
Table 2 Conservative Substitutions
Figure imgf000009_0002
Expression
HSI2 nucleotide sequences can be expressed in alternate plant hosts to impart characteristics of improved agronomic performance via recombinant means. The methods to construct DNA expression vector and to transform and express foreign genes in plant and plant cells are well known in the art.
Additionally, it is evident that the sequences can be used in the construction of a construct or an expression vector. It is well known that nucleotide sequences encoding HSI2 can be inserted within an expression vector for heterologous expression in diverse host cells and organisms, for example plant cells and plant, by conventional techniques. These methods, which can be used in the invention, have been described elsewhere (Potrykus 1991 ; Vasil 1994; Walden 1995; Songstad 1995), and are well known to persons skilled in the art. As known in the art, there are a number of ways by which genes and gene constructs can be introduced into plants and a combination of transformation and tissue culture techniques have been successfully integrated into effective strategies for creating transgenic plants. For example, one skilled in the art will certainly be aware that, in addition to Agrobacterium-meώated transformation of Arabidopsis by vacuum infiltration (Bechtold 1993) or wound inoculation (Katavic 1994), it is equally possible to transform other plant species, using Agrobacterium Ti-plasmid mediated transformation (e.g., hypocotyl (DeBlock 1989) or cotyledonary petiole (Moloney 1989) wound infection), particle bombardment/biolistic methods (Sanford 1987; Nehra 1994; Becker 1994) or polyethylene glycol-assisted, protoplast transformation (Rhodes 1988; Shimamoto 1989) methods.
As will also be apparent to persons skilled in the art, and as described elsewhere (Meyer 1995; Datla 1997), it is possible to utilize plant promoters to direct any intended regulation of transgene expression using constitutive promoters (e.g., those based on CaMV35S), or by using promoters which can target gene expression to particular cells, tissues (e.g., napin promoter for expression of transgenes in developing seed cotyledons), organs (e.g., roots), to a particular developmental stage, or in response to a particular external stimulus (e.g., heat shock). Promoters for use herein may be inducible, constitutive, or tissue-specific or cell specific or have various combinations of such characteristics. Useful promoters include, but are not limited to constitutive promoters such as carnation etched ring virus (CERV), cauliflower mosaic virus (CaMV) 35S promoter, or more particularly the double enhanced cauliflower mosaic virus promoter, comprising two CaMV 35S promoters in tandem (referred to as a "Double 35S" promoter). Meristem specific promoters include, for example, STM, BP, WUS, CLV gene promoters. Seed specific promoters include, for example, the napin promoter. Other cell and tissue specific promoters are well known in the art.
Promoter and termination regulatory regions that will be functional in the host plant cell may be heterologous (that is, not naturally occurring) or homologous (derived from the plant host species) to the plant cell and the gene. Suitable promoters which may be used are described above. The termination regulatory region may be derived from the 3' region of the gene from which the promoter was obtained or from another gene. Suitable termination regions which may be used are well known in the art and include Agrobacterium tumefaciens nopaline synthase terminator (Tnos), A. tumefaciens mannopine synthase terminator (Tmas) and the CaMV 35S terminator (T35S). Particularly preferred termination regions for use herein include the pea ribulose bisphosphate carboxylase small subunit termination region (TrbcS) or the Tnos termination region. Such gene constructs may suitably be screened for activity by transformation into a host plant via Agrobacterium and screening for the desired activity using known techniques.
Preferably, a nucleic acid molecule construct for use herein is comprised within a vector, most suitably an expression vector adapted for expression in an appropriate plant cell. It will be appreciated that any vector which is capable of producing a plant comprising the introduced nucleic acid sequence will be sufficient. Suitable vectors are well known to those skilled in the art and are described in general technical references. Particularly suitable vectors include the Ti plasmid vectors. After transformation of the plant cells or plant, those plant cells or plants into which the desired nucleic acid molecule has been incorporated may be selected by such methods as antibiotic resistance, herbicide resistance, tolerance to amino-acid analogues or using phenotypic markers. Various assays may be used to determine whether the plant cell shows an increase in gene expression, for example, Northern blotting or quantitative reverse transcriptase PCR (RT-PCR). Whole transgenic plants may be regenerated from the transformed cell by conventional methods. Such plants produce seeds containing the genes for the introduced trait and can be grown to produce plants that will produce the selected phenotype.
Expression or overexpression of genes encoding HSI2 may done in combination with overexpression or expression of one or more other genes involved in seed oil production and/or abiotic stress tolerance, for example, lipid biosynthetic genes such as diacylglycerol acyltransferase (DGAT) or genes encoding regulatory elements including kinases such as pyruvate dehydrogenase complex kinase (PDCK) and transcription factors such as WRINKLED1 (WRM)
Preferred plants in which HSI2 activity may be expressed or overexpressed include crop species, especially oilseed plant species Some examples include Brassicaceae spp (e g rapeseed and Canola), Borago spp (borage), Ricinus spp (e g Ricinus communis (castor)), Theobroma spp (e g Theobroma cacao (cocoa bean)), Gossypium spp (cotton), Crambe spp , Cuphea spp , Linum spp (flax), Lesquerella spp , Limnanthes spp , Linola, Tropaeolum spp (nasturtium), Olea spp (olive), EIaeis spp (palm), Arachis spp (peanut), Carthamus spp (safflower), Glycine spp (soybean), Soya spp (soybean), Hehanthus spp (sunflower), Vernonia spp Plants of particular note are from the family Brassicaceae, especially Arabidopsis thaliana, Brassica napus, Brassica rapa, Brassica caπnata, Brassica juncea, and Camelina sativa Arabidopsis thaliana, Brassica spp and Glycine spp are of particular note
Silencing
Silencing of HSI2 genes may be accomplished in a number of ways generally known in the art, for example, RNA interference (RNAi) techniques, artificial microRNA techniques, virus-induced gene silencing (VIGS) techniques, antisense techniques, sense co-suppression techniques and targeted mutagenesis techniques
RNAi techniques involve stable transformation using RNA interference (RNAi) plasmid constructs (Helliwell 2005) Such plasmids are composed of a fragment of the target gene to be silenced in an inverted repeat structure The inverted repeats are separated by a spacer, often an intron The RNAi construct driven by a suitable promoter, for example, the Cauliflower mosaic virus (CaMV) 35S promoter, is integrated into the plant genome and subsequent transcription of the transgene leads to an RNA molecule that folds back on itself to form a double-stranded hairpin RNA This double-stranded
RNA structure is recognized by the plant and cut into small RNAs (about 21 nucleotides long) called small interfering RNAs (siRNAs) siRNAs associate with a protein complex
(RISC) which goes on to direct degradation of the mRNA for the target gene
Artificial microRNA (amiRNA) techniques exploit the microRNA (miRNA) pathway that functions to silence endogenous genes in plants and other eukaryotes (Schwab
2006, Alvarez 2006) In this method, 21 nucleotide long fragments of the gene to be silenced are introduced into a pre-miRNA gene to form a pre-amiRNA construct The pre- miRNA construct is transferred into the plant genome using transformation methods apparent to one skilled in the art After transcription of the pre-amiRNA, processing yields amiRNAs that target genes which share nucleotide identity with the 21 nucleotide amiRNA sequence
In RNAi silencing techniques, two factors can influence the choice of length of the fragment The shorter the fragment the less frequently effective silencing will be achieved, but very long hairpins increase the chance of recombination in bacterial host strains The effectiveness of silencing also appears to be gene dependent and could reflect accessibility of target mRNA or the relative abundances of the target mRNA and the hpRNA in cells in which the gene is active A fragment length of between 100 and 800 bp, preferably between 300 and 600 bp, is generally suitable to maximize the efficiency of silencing obtained The other consideration is the part of the gene to be targeted 5' UTR coding region, and 3' UTR fragments can be used with equally good results As the mechanism of silencing depends on sequence homology there is potential for cross- silenαng of related mRNA sequences Where this is not desirable a region with low sequence similarity to other sequences, such as a 5' or 3' UTR, should be chosen The rule for avoiding cross-homology silencing appears to be to use sequences that do not have blocks of sequence identity of over 20 bases between the construct and the non- target gene sequences Many of these same principles apply to selection of target regions for designing amiRNAs
Virus-induced gene silencing (VIGS) techniques are a variation of RNAi techniques that exploits the endogenous antiviral defenses of plants Infection of plants with recombinant VIGS viruses containing fragments of host DNA leads to post- transcπptional gene silencing for the target gene In one embodiment, a tobacco rattle virus (TRV) based VIGS system can be used
Antisense techniques involve introducing into a plant an antisense oligonucleotide that will bind to the messenger RNA (mRNA) produced by the gene of interest The "antisense" oligonucleotide has a base sequence complementary to the gene's messenger RNA (mRNA), which is called the "sense" sequence Activity of the sense segment of the mRNA is blocked by the anti-sense mRNA segment, thereby effectively inactivating gene expression Application of antisense to gene silencing in plants is described in more detail by Stam 2000
Sense co-suppression techniques involve introducing a highly expressed sense transgene into a plant resulting in reduced expression of both the transgene and the endogenous gene (Depicker 1997). The effect depends on sequence identity between transgene and endogenous gene.
Targeted mutagenesis techniques, for example TILLING (Targeting Induced Local Lesions IN Genomes) and "delete-a-gene" using fast-neutron bombardment, may be used to knockout gene function in a plant (Henikoff 2004; Li 2001). TILLING involves treating seeds or individual cells with a mutagen to cause point mutations that are then discovered in genes of interest using a sensitive method for single-nucleotide mutation detection. Detection of desired mutations (e.g. mutations resulting in the inactivation of the gene product of interest) may be accomplished, for example, by PCR methods. For example, oligonucleotide primers derived from the gene of interest may be prepared and PCR may be used to amplify regions of the gene of interest from plants in the mutagenized population. Amplified mutant genes may be annealed to wild-type genes to find mismatches between the mutant genes and wild-type genes. Detected differences may be traced back to the plants which had the mutant gene thereby revealing which mutagenized plants will have the desired expression (e.g. silencing of the gene of interest). These plants may then be selectively bred to produce a population having the desired expression. TILLING can provide an allelic series that includes missense and knockout mutations, which exhibit reduced expression of the targeted gene. TILLING is touted as a possible approach to gene knockout that does not involve introduction of transgenes, and therefore may be more acceptable to consumers. Fast-neutron bombardment induces mutations, i.e. deletions, in plant genomes that can also be detected using PCR in a manner similar to TILLING.
Examples
Example 1: Transformation of plant material
The genomic protein coding region of At2g30470, was cloned from the bacterial artificial chromosome T6B20 into cloning vector pJM1 by recombination as described by Liu et al. (Liu 2003) and subsequently into the binary T-DNA vectors pDMC32:At2S3 and pER330 using Gateway technology (Invitrogen). Agrobacterium strain GV3101 (MP90) harboring the T-DNA vector was used to transform the At2S3 (napin):HSI2 and cauliflower mosaic virus 35S: HSI2 gene constructs into Arabidopsis thaliana (Columbia-0 ecotype) by floral dipping. The vectors were also transformed into Brassica napus (DH 12075) as described by Zou et al. (Zou 1997). The At2S3 (napin):HSI2 vector map is shown in Fig. 1. Two putative hsi2 T-DNA insertion lines were identified in Arabidopsis thaliana (Columbia-0 and Columbia-2 backgrounds) from the SaIk Institute Genomic Laboratory Genomic database (http://signal.salk.edu) and seeds were obtained from the Arabidopsis Biological Resource Centre (ABRC). Homozygote T-DNA insertion lines were identified though PCR genotyping. hsi2-5 (Salk_088606) was identified in Columbia-0 background and hsi2-3 (WiscDsLox388F10) was identified in Columbia-2 background. The insertion lines were analyzed for seed oil content, fatty acid profile, and ABA responses during germination and drought tolerance in juvenile plants.
Example 2: Seed oil analysis
Seeds of T-DNA insertion mutant lines of HSI2 and the wild type were stratified in the dark for 3 days at 40C and sown on Sunshine™ Mix4 germination medium (Sun Gro Horticulture, Canada). Plants were germinated and grown in a growth chamber (Conviron) under 16-hr photoperiod, 21/180C day/night temperature cycle and about 250 μE light intensity. Secondary shoots were trimmed out and siliques on primary shoots were allowed to dry on plants before moving to a finishing chamber for another 2 weeks to ensure complete ripening of seeds. Seeds were harvested only from main shoots and allowed to dry at room temperature for 2-3 weeks before analyzing for seed oil content and fatty acid profiles.
Total lipids were extracted by grinding seeds in chloroform:isopropanol (2:1). The solvent was evaporated off at room temperature under a stream of nitrogen gas and total lipids were transmethylated by heating samples with 3 N methanolic HCI at 8O0C for 3 hrs. Fatty acids methyl esters (FAMES) were then extracted with GC grade hexane in presence of 0.9% NaCI. The solvent (hexane) was evaporated under a stream of nitrogen gas and FAMES were re-dissolved in 500 μl of methyl esters standards (17:0 M. E. and 23:0 M. E.) in hexane and analyzed by GC. Seed oil content and fatty acid profiles were calculated as a percentage (%) of dry seed weight.
Oil content was measured on the Arabidopsis hsι'2-5 T-DNA insertion mutant lines along with its wild type at four separate times, and the mutant shows a decrease in seed oil content (Fig. 2A). However, profiles of fatty acids were not altered in the mutant line. On the other hand, preliminary oil analysis on primary transformants in Brassica napus (DH 12075) over expressing HSI2 in seeds under the control of napin and 35S promoters indicated a slight increase in seed oil content (data not shown). Comparing wild type (Col-2 and Col-0-1) to T-DNA insertion mutant lines (hsι2-3 and hsι2-5) and three HSI2 complementation lines (complementation in hsι2-5, HSI2 comp-18-3-1 , HSI2 comp-12-2-1 and HSI2 comp-19-3-1) (Fig 2B), it can be seen that the mutants have less oil than their corresponding wild types suggesting that HSI2 gene may positively regulate seed oil content Specificity of the mutation is shown by complementation of seed oil content of hsi2-5 The hsι2-5 mutant was transformed with the HSI2 gene under its own promoter
Example 3 Germination
Seeds were surface-sterilized with 30% bleach (0 01 % Tween™-20), rinsed several times with sterilized water, and sown on 1 5% agar plates containing half-strength
Murashige and Skoog (MS) salt solution supplemented or not with 0 μM, 0 25 μM or 0 3 μM ABA (± ABA, Toray batch, PBI 58, NRC/PBI Saskatoon) The plates were transferred to a tissue culture room after a cold treatment of 2 days at 4°C in the dark, and incubated at 20°C/16°C day/night temperatures under a 16 hrs/8 hrs light/dark regime and 80 -100 μE irradiance
Germination (defined as endosperm rupture and radical emergence) was scored starting 24 hrs after seed stratification Germination events are expressed as a percentage of the total number of seeds per plate Germination experiments were repeated at least three times using three different seed batches of wild type and T-DNA insertion mutant lines (hsι2-5 and hsι2-3) grown in parallel
Both of the T-DNA insertion mutant liens showed a decreased sensitivity to ABA during germination as indicated by faster and higher overall germination than in the corresponding wild type in presence of ABA in the germination medium (Fig 3A)
ABI3 and ABI5 are two genes known to inhibit seed germination by arresting embryo growth Both hsι2 alleles show minimal or no expression of these genes during seed germination 96 hr after stratification (Fig 3B) This could explain why these mutants germinate better in presence of ABA
Example 4 Drought responses
Wild type and the mutant seeds were germinated directly on Sunshine™ Mιx4 (Sun Gro Horticulture, Canada) and grown under regular watering and fertilization regime until the plants were three-weeks-old At that point, plants were subjected to drought stress by withholding water and wilting symptoms were monitored daily thereafter until more than 80% plants displayed some degree of wilting. Drought response was evaluated in three independent batches of plants. Results are presented as a percentage of wilted or dead plants 10 days (10 d) after imposing drought stress by withholding water. Both of the hsi2 T-DNA insertion mutant lines showed a reduced sensitivity to drought as indicated by lower percentage wilting or death of the whole plant compared to their wild types at a certain time point after imposing drought stress (Fig. 4A). The same pattern continued from 14-16 days without water for hsi2-5 (Fig. 4B) and from 17-19 days without water for hsi2-3 (Fig. 4C).
Leaf relative water content at 19 days of withholding water was also determined for his2 mutants compared to their wild type (Fig. 4D). Leaf relative water content is an indicator of how well a plant is able to maintain its water status during a stress. The his2 mutants maintain higher leaf relative water content during drought stress than their wild types.
Myb-like transcription factor is one of the genes involved in regulating stomatal aperture and hence potentially involved in plant water use. Expression of Myb-like transcription factor gene in hsi2 mutant plants approaching visible wilting was determined. hsi2 mutants express higher levels of this gene in their leaves (Fig. 4E) than their wild types, which may help in regulating water loss through transpiration and hence more drought tolerance.
Free Listing of Sequences
HSI2 - nucleotide sequence (SEQ ID NO: 1) - Arabidopsis thaliana (2373 bp)
ATGTTTGAAGTCAAAATGGGGTCAAAGATGTGCATGAACGCTTCATGTGGTACGACTTCTACTGTT GAATGGAAGAAAGGTTGGCCTCTTCGATCTGGTCTTCTCGCTGATCTCTGTTATCGTTGCGGATCT GCGTATGAGAGTTCTCTATTCTGTGAACAATTTCATAAGGACCAATCTGGTTGGAGGGAATGCTAT TTGTGTAGCAAGAGACTACATTGTGGATGCATTGCTTCTAAGGTAACGATTGAGTTAATGGACTAT GGTGGTGTTGGTTGTAGTACATGTGCTTGCTGCCATCAACTCAATTTGAACACAAGGGGTGAGAAT CCAGGTGTTTTTAGCAGATTGCCAATGAAAACGTTAGCTGATAGGCAACATGTAAATGGCGAAAGC GGAGGAAGAAACGAAGGCGATCTCTTTTCTCAGCCACTAGTCATGGGCGGAGATAAAAGGGAAGAG TTCATGCCTCACCGTGGGTTTGGTAAGCTAATGAGTCCAGAAAGTACAACCACCGGGCATAGGCTG GATGCTGCTGGGGAAATGCATGAATCATCACCTTTACAGCCATCTTTAAATATGGGTTTGGCTGTG AATCCGTTTAGCCCATCTTTTGCAACCGAGGCTGTCGAGGGAATGΆAACACATCAGTCCTTCTCAG TCCAACATGGTCCATTGCTCTGCTTCTAATATACTGCAAAAGCCATCAAGACCTGCTATTTCAACT CCTCCTGTGGCTAGTAAATCCGCTCAGGCGCGGATTGGAAGGCCTCCTGTCGAAGGGCGAGGGAGA GGCCACTTGCTTCCGCGGTATTGGCCAAAATATACGGATAAAGAGGTTCAGCAGATCTCTGGAAAT TTGAATTTGAACATTGTACCTCTCTTTGAGAAAACTCTTAGTGCCAGTGATGCTGGTCGCATTGGT
CGTCTAGTTCTTCCAAAAGCCTGTGCAGAGGCATATTTTCCTCCGATTAGTCAATCCGAAGGCATT CCTTTGAAAATCCAAGATGTGAGGGGTAGGGAGTGGACGTTCCAGTTCAGATATTGGCCCAATAAC AATAGTAGAATGTATGTTTTAGAAGGTGTCACTCCATGCATACAGTCCATGATGCTACAGGCTGGT GATACAGTAACTTTCAGTCGGGTTGATCCTGGCGGAAAACTAATCATGGGTTCCAGGAAGGCAGCT AATGCTGGAGACATGCAGGGTTGTGGGCTCACCAACGGAACATCAACTGAGGACACATCATCGTCT GGTGTAACAGAAAACCCACCCTCCATAAATGGTTCCTCGTGTATTTCACTAATACCGAAAGAGTTG AATGGTATGCCTGAGAATTTGAACAGTGAGACTAACGGGGGCAGGATAGGTGATGATCCTACACGA GTTAAAGAGAAGAAGAGAACTCGAACCATTGGTGCAAAAAATAAGAGACTTCTTTTGCATAGTGAA GAATCTATGGAGCTGAGACTCACTTGGGAAGAAGCTCAGGACTTGCTTCGTCCCTCTCCTAGTGTA AAGCCTACCATCGTTGTCATTGAGGAGCAAGAAATTGAAGAATATGACGAACCTCCTGTCTTTGGA AAGAGGACTATAGTCACTACAAAACCTTCAGGTGAACAGGAACGATGGGCAACTTGCGACGACTGC TCTAAATGGAGAAGGTTACCTGTAGATGCTCTTCTTTCCTTTAAATGGACATGTATAGACAATGTT TGGGATGTGΆGTAGGTGTTCATGTTCTGCACCGGAGGAGAGTCTGAAGGAACTTGAGAATGTTCTT AAAGTAGGAAGAGAGCACAAGAAGAGAAGAACTGGGGAAAGCCAGGCAGCAAAAAGTCAGCAAGAA CCGTGTGGTTTGGACGCACTGGCGAGTGCAGCAGTCTTAGGAGACACAATAGGCGAGCCAGAGGTA GCGACCACGACCAGACATCCAAGGCACAGGGCTGGATGCTCTTGCATCGTGTGCATTCAGCCACCA AGTGGGAAAGGTAGGCACAAGCCTACATGTGGCTGCACTGTGTGTAGCACCGTGAAGAGAAGGTTC AAGACGCTTATGATGAGGAGGAAGAAGAAGCAGTTGGAGCGCGATGTAACAGCAGCAGAAGATAAG AAGAAGAAGGACATGGAACTGGCTGAGTCTGATAAGAGTAAGGAGGAGAAGGAAGTGAACACAGCG AGAATAGACCTGAACAGTGATCCATACAATAAAGAAGATGTTGAAGCTGTTGCGGTGGAGAAAGAA GAGAGTCGAAAAAGAGCAATAGGACAGTGTTCGGGCGTGGTGGCTCAAGACGCCAGTGATGTTTTA GGAGTTACAGAGTTAGAAGGAGAGGGTAAGAATGTTCGTGAAGAGCCGAGAGTTTCAAGCTGA
HSI2 - amino acid sequence (SEQ ID NO: 2) - Arabidopsis thaliana (790 aa)
MFEVKMGSKMCMNASCGTTSTVEWKKGWPLRSGLLADLCYRCGSAYESSLFCEQFHKDQSGWRECY LCSKRLHCGCIASKVTIELMDYGGVGCSTCACCHQLNLNTRGENPGVFSRLPMKTLADRQHVNGES
GGRNEGDLFSQPLVMGGDKREEFMPHRGFGKLMSPESTTTGHRLDAAGEMHESSPLQPSLNMGLAV
NPFSPSFATEAVEGMKHISPSQSNMVHCSASNILQKPSRPAISTPPVASKSAQARIGRPPVEGRGR
GHLLPRYWPKYTDKEVQQISGNLNLNIVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGI PLKIQDVRGREWTFQFRYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIMGSRKAA NAGDMQGCGLTNGTSTEDTSSSGVTENPPSINGSSCISLIPKELNGMPENLNSETNGGRIGDDPTR VKEKKRTRTIGAKNKRLLLHSEESMELRLTWEEAQDLLRPSPSVKPTIVVIEEQEIEEYDEPPVFG KRTIVTTKPSGEQERWATCDDCSKWRRLPVDALLSFKWTCIDNVWDVSRCSCSAPEESLKELENVL KVGREHKKRRTGESQAAKSQQEPCGLDALASAAVLGDTIGEPEVATTTRHPRHRAGCSCIVCIQPP SGKGRHKPTCGCTVCSTVKRRFKTLMMRRKKKQLERDVTAAEDKKKKDMELAESDKSKEEKEVNTA RIDLNSDPYNKEDVEAVAVEKEESRKRAIGQCSGVVAQDASDVLGVTELEGEGKNVREEPRVSS
References: The contents of the entirety of each of which are incorporated by this reference.
GenBank Accession No. NMJ79815, Gl 30684597, AT2G30470 (2008).
Alvarez JP, Pekker I, Goldshmidt A, Blum E, Amsellem Z, Eshed Y. (2006) Endogenous and synthetic microRNAs stimulate simultaneous, efficient, and localized regulation of multiple targets in diverse species. Plant Cell. 8: 1134-51.
Baud S, Mendoza MS, To A, Harscoet E, Lepiniec L, Dubreucq B. (2007) WR1NKLED1 specifies the regulatory action of LEAFY COTYLEDON2 towards fatty acid metabolism during seed maturation in Arabidopsis. Plant J. 50: 825-828.
Bechtold N, Ellis J, Pellefer G. (1993) In planta Agrobacterium-med\ated gene transfer by infiltration of adult Arabidopsis thaliana plants. CR Acad. Sci. Ser. /// Sc/. Vie, 316: 1 194-1 199. Becker D, Brettschneider R, Lorz H (1994) Fertile transgenic wheat from microprojectile bombardment of scutellar tissue Plant J 5 299-307
Datla R, Anderson JW, Seivaraj G (1997) Plant promoters for transgene expression Biotechnology Annual Review 3 269-296
DeBlock M, DeBrouwer D, Tenning P (1989) Transformation of Brassica napus and Brassica oleracea using Agrobacterium tumefaciens and the expression of the bar and neo genes in the transgenic plants Plant Physiol 91 694-701
Depicker A, Montagu MV (1997) Post-transcriptional gene silencing in plants Curr Opin Cell Biol 9 373-82
Gutierrez L, Van Wuytswinkel O, Castelain M, Bellini C (2007) Combined networks regulating seed maturation Trends Plant Sci 12 294-300
Helliwell CA, Waterhouse PM (2005) Constructs and methods for hairpin RNA-mediated gene silencing in plants Methods Enzymology 392 24-35
Henikoff S, Till BJ, Comai L (2004) TILLING Traditional mutagenesis meets functional genomics Plant Physiol 135 630-6
Jako C, Kumar A, Wei Y, Zou J, Barton DL, Giblin EM, Covello PS, Taylor DC (2001) Seed-specific over-expression of an Arabidopsis cDNA encoding a diacylglycerol acyltransferase enhances seed oil content and seed weight Plant Physiol 126 861-874
Katavic Y, Haughn GW, Reed D, Martin M, Kunst L (1994) In planta transformation of Arabidopsis thaliana MoI Gen Genet 245 363-370
Li X, Song Y, Century K, Straight S, Ronald P, Dong X, Lassner M, Zhang Y (2001) A fast neutron deletion mutagenesis-based reverse genetics system for plants Plant J 27 235-242
Liu P, Jenkins NA, Copeland NG (2003) A Highly Efficient Recombineeπng-Based Method for Generating Conditional Knockout Mutations Genome Res 13 (3) 476-484
Meyer P (1995) Understanding and controlling transgene expression Trends in Biotechnology 13 332-337
Moloney MM, Walker JM, Sharma KK (1989) High efficiency transformation of Brassica napus using Agrobacterium vectors Plant Cell Rep 8 238-242 Neddleman and Wunsch. (1970) J. MoI. Biol. 48: 443.
Nehra NS, Chibbar RN, Leung N, Caswell K, Mallard C, Steinhauer L, Baga M, Kartha KK. (1994) Self-fertile transgenic wheat plants regenerated from isolated scutellar tissues following microprojectile bombardment with two distinct gene constructs. Plant J. 5: 285- 297.
Pearson and Lipman. (1988) Proc. Natl. Acad. ScI. (U.S.A.) 85: 2444.
Potrykus L. (1991) Gene transfer to plants: Assessment of publish approaches and results. Annu. Rev. Plant Physiol. Plant MoI. Biol. 42: 205-225.
Rhodes CA, Pierce DA, Mettler IJ, Mascarenhas D, Detmer JJ. (1988) Genetically transformed maize plants from protoplasts. Science. 240: 204-207.
Sambrook J1 Fritsch EF, Maniatis T. (1989) Molecular Cloning: A Laboratory Manual 2nd edn. Cold Spring Harbor: Cold Spring Harbor Laboratory Press.
Sambrook J, Fritsch EF, Maniatis T. (2001) Molecular Cloning: A Laboratory Manual 3rd edn. Cold Spring Harbor: Cold Spring Harbor Laboratory Press.
Santos-Mendoza M, Dubreucq B, Baud S, Parcy F, Caboche M, Lepiniec L. (2008) Deciphering gene regulatory networks that control seed development and maturation in Arabidopsis. Plant J. 54: 608-620.
Schwab R, Ossowski S, Riester M, Warthmann N, Weigel D. (2006) Highly specific gene silencing by artificial microRNAs in Arabidopsis. Plant Cell.18: 1121-33.
Shimamoto K, Terada R, Izawa T, Fujimoto H. (1989) Fertile transgenic rice plants regenerated from transformed protoplasts. Nature. 335: 274-276.
Smith and Waterman. (1981) Ad. App. Math. 2: 482.
Songstad DD, Somers DA, Griesbach RJ. (1995) Advances in alternative DNA delivery techniques. Plant Cell, Tissue and Organ Culture. 40: 1-15.
Stam M, de Bruin R, van Blokland R, van der Hoorn RA, MoI JN, Kooter JM. (2000) Distinct features of post-transcriptional gene silencing by antisense transgenes in single copy and inverted T-DNA repeat loci. Plant J. 21: 27-42. Suzuki M, Wang HH, McCarty DR (2007) Repression of the LEAFY COTYLEDON 1/B3 regulatory network in plant embryo development by VP1 /ABSCISIC ACID INSENSITIVE 3-LIKE B3 genes Plant Physiol 143(2) 902-11
Taylor DC Zhang Y, Kumar A, Francis T, Giblin EM, Barton DL, Feme JR, Laroche A, Shah S, Zhu W, et al (2008) Molecular modification of triacylglycerol accumulation under field conditions to produce canola with increased seed oil content Botany In press
Tsukagoshi H, Saijo T, Shibata D, Moπkami A, Nakamura K (2005) Analysis of a sugar response mutant of Arabidopsis identified a novel B3 domain protein that functions as an active transcriptional repressor Plant Physiol 138(2) 902-911
Tsukagoshi H, Morikami A, Nakamura K (2007) Two B3 domain transcriptional repressors prevent sugar-inducible expression of seed maturation genes in Arabidopsis seedlings PNAS 104(7) 2543-7
Vasil IK (1994) Molecular improvement of cereals Plant MoI Biol 5 925-937
Vigeolas H, Waldeck P, Zank T, Geigenberger P (2007) Increasing seed oil content in oil-seed rape (Brassica napus L ) by over-expression of a yeast glycerol-3-phosphate dehydrogenase under the control of a seed-specific promoter Plant Biotechnol J 5 431- 441
Walden R, Wingender R (1995) Gene-transfer and plant regeneration techniques Trends in Biotechnology 13 324-331
Wang HW, Zhang B, Hao YJ, Huang J, Tian AG, ϋao Y, Zhang JS, Chen SY (2007) The soybean Dof-type transcription factor genes, GmDoU and GmDof11, enhance lipid content in the seeds of transgenic Arabidopsis plants Plant J 52 716-729
Zou J, Katavic V, Giblin EM, Barton DL, MacKenzie SL, Keller WA, Hu X, Taylor DC (1997) Modification of seed oil content and acyl composition in the brassicaceae by expression of a yeast sn-2 acyltransferase gene Plant Cell 9 909-923
Zou J, Qi Q, Katavic V, Manilla EF, Taylor DC (1999) Effects of antisense repression of an Arabidopsis thaliana pyruvate dehydrogenase kinase cDNA on plant development Plant MoI Biol 41 837-849
Other advantages that are inherent to the structure are obvious to one skilled in the art The embodiments are described herein illustratively and are not meant to limit the scope of the invention as claimed. Variations of the foregoing embodiments will be evident to a person of ordinary skill and are intended by the inventor to be encompassed by the following claims.

Claims

Claims:
1. A method of decreasing abscisic acid sensitivity and/or increasing drought resistance in a plant comprising: reducing expression of HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein in the plant to thereby decrease abscisic acid sensitivity and/or increase drought resistance in the plant compared to a plant grown under similar conditions in which expression of the HSI2 protein has not been reduced.
2. A method of increasing seed oil content in a plant comprising: introducing into the plant means for encoding a HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein to thereby increase expression of HSI2 protein in the plant to thereby increase seed oil content in the plant compared to a plant grown under similar conditions in which the means for encoding the HSI2 protein has not been introduced.
3. The method according to claim 2, wherein the means for encoding comprises a nucleic acid molecule having a nucleotide sequence having at least 80% sequence identity to SEQ ID NO: 1 or a codon degenerate nucleotide sequence thereof.
4. The method according to claim 4, wherein the nucleic acid molecule has a nucleotide sequence as set forth in SEQ ID NO: 1 or a codon degenerate nucleotide sequence thereof.
5. The method according to any one of claims 1 to 4, wherein the HSI2 protein has an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 2 or a conservatively substituted amino acid sequence thereof.
6. The method according to any one of claims 1 to 4, wherein the HSI2 protein has an amino acid sequence as set forth in SEQ ID NO: 2 or a conservatively substituted amino acid sequence thereof.
7. The method according to any one of claims 1 to 6, wherein the plant is from family Brassicaceae.
8. A nucleic acid construct comprising means for encoding a HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2 (HSI2) protein operably linked to one or more nucleic acid sequences required for transforming the construct into a cell and/or for expressing or overexpressing the HSI2 protein encoding means in the cell.
9. The construct according to claim 8, wherein the HSI2 protein has an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 2 or a conservatively substituted amino acid sequence thereof.
10. The construct according to claim 8, wherein the HSI2 protein has an amino acid sequence as set forth in SEQ ID NO: 2 or a conservatively substituted amino acid sequence thereof.
11. A cell, seed or plant comprising the nucleic acid construct as defined in any one of claims 8 to 10.
PCT/CA2010/000754 2009-05-28 2010-05-19 Increased seed oil and abiotic stress tolerance mediated by hsi2 Ceased WO2010135813A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
CA2762204A CA2762204A1 (en) 2009-05-28 2010-05-19 Increased seed oil and abiotic stress tolerance mediated by hsi2
US13/320,813 US20120066794A1 (en) 2009-05-28 2010-05-19 Increased Seed Oil and Abiotic Stress Tolerance Mediated by HSI2

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US21331409P 2009-05-28 2009-05-28
US61/213,314 2009-05-28

Publications (1)

Publication Number Publication Date
WO2010135813A1 true WO2010135813A1 (en) 2010-12-02

Family

ID=43222084

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CA2010/000754 Ceased WO2010135813A1 (en) 2009-05-28 2010-05-19 Increased seed oil and abiotic stress tolerance mediated by hsi2

Country Status (3)

Country Link
US (1) US20120066794A1 (en)
CA (1) CA2762204A1 (en)
WO (1) WO2010135813A1 (en)

Families Citing this family (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EA028528B1 (en) 2013-03-13 2017-11-30 Пайонир Хай-Бред Интернэшнл, Инк. Glyphosate application for weed control in brassica
BR112015023285B1 (en) 2013-03-14 2022-03-03 Pioneer Hi-Bred International, Inc. Expression cassette, bacterial host cell and method for controlling a coleopteran-like plant pest
CA2901316A1 (en) 2013-03-15 2014-09-25 Pioneer Hi-Bred International, Inc. Phi-4 polypeptides and methods for their use
MX359026B (en) 2013-08-16 2018-09-12 Pioneer Hi Bred Int Insecticidal proteins and methods for their use.
US10667524B2 (en) 2013-09-13 2020-06-02 Pioneer Hi-Bred International, Inc. Insecticidal proteins and methods for their use
UA120608C2 (en) 2014-02-07 2020-01-10 Піонір Хай-Бред Інтернешнл, Інк. PURIFIED PTIP-83 POLYPEPTIDE AND METHOD OF APPLICATION
WO2015120270A1 (en) 2014-02-07 2015-08-13 Pioneer Hi Bred International, Inc. Insecticidal proteins and methods for their use
CA2961733A1 (en) 2014-09-17 2016-03-24 Pioneer Hi-Bred International, Inc. Compositions and methods to control insect pests
CN107108705B (en) 2014-10-16 2021-05-25 先锋国际良种公司 Insecticidal protein and method of use
US20170359965A1 (en) 2014-12-19 2017-12-21 E I Du Pont De Nemours And Company Polylactic acid compositions with accelerated degradation rate and increased heat stability
EP3244727B1 (en) 2015-01-15 2025-10-22 Pioneer Hi-Bred International, Inc. Insecticidal proteins and methods for their use
RU2017144238A (en) 2015-05-19 2019-06-19 Пайонир Хай-Бред Интернэшнл, Инк. INSECTICIDAL PROTEINS AND METHODS OF THEIR APPLICATION
WO2016205445A1 (en) 2015-06-16 2016-12-22 Pioneer Hi-Bred International, Inc. Compositions and methods to control insect pests
CN109475096B (en) 2015-08-06 2022-08-23 先锋国际良种公司 Plant-derived insecticidal proteins and methods of use thereof
DK3341483T3 (en) 2015-08-28 2020-03-16 Pioneer Hi Bred Int OCHROBACTRUM-MEDIATED TRANSFORMATION OF PLANTS
CN108575091A (en) 2015-12-18 2018-09-25 先锋国际良种公司 Insecticidal proteins and methods of use thereof
EA201892293A1 (en) 2016-05-04 2019-04-30 Пайонир Хай-Бред Интернэшнл, Инк. INSECTICIDAL PROTEINS AND METHODS OF THEIR APPLICATION
BR112018076047A2 (en) 2016-06-16 2019-03-26 Pioneer Hi Bred Int silencing element, dna construct, expression cassette, host cell, composition, plant cell, plant or plant part, transgenic seed, method for controlling a plant insect pest and kit
CA3026113A1 (en) 2016-07-01 2018-01-04 Pioneer Hi-Bred International, Inc. Insecticidal proteins from plants and methods for their use
WO2018013333A1 (en) 2016-07-12 2018-01-18 Pioneer Hi-Bred International, Inc. Compositions and methods to control insect pests
EP3535285B1 (en) 2016-11-01 2022-04-06 Pioneer Hi-Bred International, Inc. Insecticidal proteins and methods for their use
EP3764796B1 (en) 2018-03-14 2025-12-03 Pioneer Hi-Bred International, Inc. Insecticidal proteins from plants and methods for their use
EP3764798B1 (en) 2018-03-14 2025-12-17 Pioneer Hi-Bred International, Inc. Insecticidal proteins from plants and methods for their use
CA3186978A1 (en) 2020-07-14 2022-01-20 Pioneer Hi-Bred International, Inc. Insecticidal proteins and methods for their use

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060162006A9 (en) * 1999-11-17 2006-07-20 Sherman Bradley K Polynucleotides and polypeptides in plants
WO2007135755A1 (en) * 2006-05-23 2007-11-29 National University Corporation Nagoya University Plant body with modified program related to accumulation of storage material and the use thereof
US20090083877A1 (en) * 2002-07-30 2009-03-26 Christopher Dale Rock Transcription Factors, DNA and Methods for Introduction of Value-Added Seed Traits and Stress Tolerance

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060162006A9 (en) * 1999-11-17 2006-07-20 Sherman Bradley K Polynucleotides and polypeptides in plants
US20090083877A1 (en) * 2002-07-30 2009-03-26 Christopher Dale Rock Transcription Factors, DNA and Methods for Introduction of Value-Added Seed Traits and Stress Tolerance
WO2007135755A1 (en) * 2006-05-23 2007-11-29 National University Corporation Nagoya University Plant body with modified program related to accumulation of storage material and the use thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
TSUKAGOSHI, H. ET AL.: "Analysis of a sugar response mutant of Arabidopsis identified a novel B3 domain protein that functions as an active transcriptional repressor.", PLANT PHYSIOL., vol. 138, no. 2, 2005, pages 675 - 685 *
TSUKAGOSHI, H. ET AL.: "Two B3 domain transcriptional repressors prevent sugar-inducible expression of seed maturation genes in Arabidopsis seedlings.", PROC. NATL. ACAD. SCI. U.S.A., vol. 104, no. 7, 13 February 2007 (2007-02-13), pages 2543 - 2547 *

Also Published As

Publication number Publication date
CA2762204A1 (en) 2010-12-02
US20120066794A1 (en) 2012-03-15

Similar Documents

Publication Publication Date Title
US20120066794A1 (en) Increased Seed Oil and Abiotic Stress Tolerance Mediated by HSI2
CN107674882B (en) Spatially modified gene expression in plants
US20110010803A1 (en) Polypeptides, Such As Lipases, Capable Of Altering The Seed Storage Content In Transgenic Plants
CN110603264A (en) Methods for increasing grain yield
US20170183671A1 (en) Plants with improved agronomic traits
CA2745852C (en) Modification of plant phenotypes through tor gene expression
CN105504031B (en) Soybean-derived kernel weight-related protein and related biomaterials and applications
Kajikawa et al. Functional analysis of a β-Ketoacyl-CoA synthase gene, MpFAE2, by gene silencing in the liverwort Marchantia polymorpha L.
CN102532291B (en) NF-YAI protein and application of coding gene thereof in cultivating plant with improved content of fatty acid
CN100462369C (en) A transcription factor regulating plant fatty acid metabolism and its coding gene and application
US20190292554A1 (en) Increased production of storage compounds in seeds
CA2746892C (en) Tor-interacting proteins (tips) and genes therefor
KR101283857B1 (en) Composition for increasing seed size, or content of storage lipid in seed, comprising the abc transporter protein-coding gene
CN104178509B (en) Protein G mDREB2AL and relevant biological material application in regulation and control seed plant oils and fats and mass of 1000 kernel thereof
US8461417B2 (en) Reduction of lyso-phosphatidylcholine acyltransferase activity
CN111108206A (en) Use of glutaredoxin to enhance plant growth and yield
CN102558324B (en) Application of NF-YA9 protein and encoding gene thereof in cultivating fatty acid content increased plant
CN102070706A (en) Protein AtL1L related to seed fatty acid synthesis as well as encoding gene and applications thereof
US20130160161A1 (en) Inhibition of snl6 expression for biofuel production
WO2010132988A1 (en) Increased seed oil and abiotic stress tolerance mediated by plant chd3 protein
CN102586322B (en) NF-YA5 protein and aplication of encoding gene thereof to cultivation of plant with increased content of fatty acid
CN102071193B (en) Promoter from Brassica napus and applications thereof
CN102070708B (en) Protein BnL1L related to seed fatty acid synthesis as well as encoding gene and applications thereof
CN102604966A (en) NF-YA6 protein and application of coding gene of NF-YA6 protein in culture of plant with improved fatty acid content
BRPI0616096A2 (en) polynucleotide, vector, host cell, method for the manufacture of a polypeptide, polypeptide, antibody, transgenic non-human organism, and methods for the manufacture of a lipid or fatty acid, and for the manufacture of a plant having a modified amount of a seed storage compound

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10779956

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 13320813

Country of ref document: US

Ref document number: 2762204

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 10779956

Country of ref document: EP

Kind code of ref document: A1