WO2010127939A1 - Recombinant human alpha1-antitrypsin - Google Patents

Recombinant human alpha1-antitrypsin Download PDF

Info

Publication number
WO2010127939A1
WO2010127939A1 PCT/EP2010/055177 EP2010055177W WO2010127939A1 WO 2010127939 A1 WO2010127939 A1 WO 2010127939A1 EP 2010055177 W EP2010055177 W EP 2010055177W WO 2010127939 A1 WO2010127939 A1 WO 2010127939A1
Authority
WO
WIPO (PCT)
Prior art keywords
rhaat
per
glycans
aat
linked glycans
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2010/055177
Other languages
French (fr)
Inventor
Elisabeth C. M. Brinkman
Cornelis Erik Hack
Ingrid Van Den Nieuwenhof
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Janssen Vaccines and Prevention BV
Original Assignee
Crucell Holand BV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BRPI1015341-1A priority Critical patent/BRPI1015341B1/en
Priority to EA201171275A priority patent/EA025021B1/en
Priority to DK10716318.0T priority patent/DK2421895T3/en
Priority to ES10716318.0T priority patent/ES2559007T3/en
Priority to US13/138,912 priority patent/US8357661B2/en
Priority to AU2010244592A priority patent/AU2010244592B2/en
Priority to PL10716318T priority patent/PL2421895T3/en
Priority to CN201080017593.2A priority patent/CN102439037B/en
Priority to EP10716318.0A priority patent/EP2421895B1/en
Priority to CA2756591A priority patent/CA2756591C/en
Application filed by Crucell Holand BV filed Critical Crucell Holand BV
Priority to JP2012506465A priority patent/JP5711215B2/en
Publication of WO2010127939A1 publication Critical patent/WO2010127939A1/en
Priority to IL215537A priority patent/IL215537A/en
Priority to ZA2011/07416A priority patent/ZA201107416B/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81Protease inhibitors
    • C07K14/8107Endopeptidase (E.C. 3.4.21-99) inhibitors
    • C07K14/811Serine protease (E.C. 3.4.21) inhibitors
    • C07K14/8121Serpins
    • C07K14/8125Alpha-1-antitrypsin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system

Definitions

  • the invention relates to the field of pharmaceutical products, in particular to recombinant human ⁇ l -antitrypsin, that can be used for inter alia the prevention and/or treatment of ⁇ 1 -antitrypsin deficiency related emphysema.
  • ⁇ i-Antitrypsin or ⁇ i-protease inhibitor ( ⁇ lPI) is a natural inhibitor of proteases released by activated neutrophils.
  • AAT is a glycoprotein consisting of 394 amino acids and having a molecular weight of 52 kD. Human AAT is expressed as a 418 amino acid precursor from which a 24 amino acid precursor is clipped to yield the 394 amino acid final product.
  • AAT is synthesized primarily in the liver, but expression has also been demonstrated in neutrophils, monocytes and macrophages.
  • Low or zero plasma levels of AAT constitute a risk factor for the development of emphysema due to the unopposed and destructive action of neutrophil proteases in the lungs.
  • AAT augmentation therapy has been developed (Mulgrew et al., 2007).
  • Human plasma derived AAT contains three N-linked glycans at Asn residues 46, 83 and 247. These glycans consist of mostly di- and tri-antennary structures. A high degree of sialylation of the glycans on recombinant proteins is of importance for optimal pharmacokinetics (PK).
  • PK pharmacokinetics
  • rhAAT human ⁇ i-antitrypsin
  • the present invention therefore provides recombinant human ⁇ l -antitrypsin (rhAAT) comprising N-linked glycans, wherein:
  • the degree of capping with sialic acid on said N-linked glycans (Z/A) is at least 50%.
  • at least 20% of said N-linked glycans are tetra- antennary glycans.
  • the degree of capping with sialic acid on said N- linked glycans that are tetra-antennary is at least 30%.
  • at least 50% of the total sialylation on said N- linked glycans is ⁇ -2,3-sialylation.
  • at least 90% of the total sialylation on said N-linked glycans is ⁇ -2, 3 -sialylation.
  • the invention provides preparations and pharmaceutical compositions comprising said rhAAT, and optionally one or more pharmaceutically acceptable excipients.
  • the invention relates to the use of said rhAAT, preparations and/or pharmaceutical compositions, comprising said rhAAT, for the prevention and/or treatment of inter alia AAT-associated emphysema and/or inflammatory diseases with neutrophil-mediated tissue damage.
  • the invention provides a method for producing recombinant human ⁇ l -antitrypsin, comprising the steps of providing a PER.C6 cell with a nucleic acid encoding human ⁇ l -antitrypsin in such a way that said PER.C6 cell harbours said nucleic acid in an expressible form; and culturing said PER.C6 cell under conditions conducive to the production of said recombinant human AAT, wherein said PER.C6 cell is modified to co-express ⁇ 2,3 sialyltransferase or ⁇ 2,6-sialyltransferase.
  • FIG. 1 Frequency distribution of the specific productivities of the batch cultures, both for cell lines overexpressing ⁇ 2,3 sialyltransferase (A: PER.C6-AAT-ST3) and cell overexpressing ⁇ 2,6-sialyltransferase (B: PER.C6-AAT-ST6).
  • FIG. 2 4-12% BIS-Tris SDS-PAGE gel with cell culture harvests of PER.C6-rAAT (non-purified) samples, stained with colloidal blue.
  • FIG. 3 Schematic overview of the assay to determine the degree of sialylation of the glycans on AAT by Z/A ratio.
  • FIG. 5 Sialylation (Fig. 5A) and antennarity (Fig. 5B) of the glycans of PER.C6-rAAT from ECL negative samples in comparison with the glycans of PER.C6- rAAT from ECL positive FIG samples and Prolastin R .
  • FIG. 6 Degree of sialylation on all glycans (Fig. 6A) and on the tetra- antennary glycans (Fig. 6B) of PER.C6-rAAT-ST3 in comparison with the glycans of PER.C6-rAAT-ST6 and Prolastin ® .
  • FIG. 7 Plasma concentration-time profiles for various doses of Prolastin R in buffer (PBS/T) or in PER.C6-CM following i.v. bolus administration to rats.
  • Prolastin® in PER.C6-CM, 50 ⁇ g/kg; ⁇ : Prolastin® in PER.C6-CM, 100 ⁇ g/kg: • : Prolastin® in PER.C6-CM, 200 ⁇ g/kg; o :Prolastin® in PBS/T, 2000 ⁇ g/kg.
  • FIG. 8 Plasma concentration-time profiles for PER.C6-rAAT-ST3, PER.C6-rAAT-ST6 and Prolastin ® .
  • PER.C6-rAAT-ST3, MRT -18-23 hr;
  • PER.C6-rAAT-ST6, MRT -4-4 hr, •: Prolastin, MRT -11-12 hr.
  • FIG. 9 Plasmid maps of the AAT expression vectors pAATopt-ST3 (A) and pAATopt-ST6 (B).
  • CMV Cytomegalovirus promoter
  • BGHp(A) Bovine Growth Hormone polyadenylation sequence
  • fl ori fl origin of replication
  • SV40 Simian Virus 40 promotor
  • Neo Neomycin resistance marker
  • SV40p(A) Simian Virus 40 polyadenylation sequence
  • AAT alphai-antitrypsin
  • COIEI COIEI origin of replication
  • Amp ampicillin resistance marker
  • Alphai-antitrypsin is a natural inhibitor of proteases released by activated neutrophils. AAT is secreted into the blood plasma but its primarily site of action is in the lung parenchyma.
  • Human leukocyte elastase (also known as human neutrophil elastase (HNE) is a serine protease released from azurophilic granules of the neutrophils as part of the normal inflammatory response. Under normal homeostatic conditions AAT serves as an important regulator of proteolysis by human leukocyte elastase (HLE), thereby preventing damage of the lung alveolar matrix.
  • HLE human leukocyte elastase
  • AAT also inhibits two other proteases released into the lungs by neutrophils, namely cathepsin G (catG) and protease 3 (Pr3).
  • Plasma-derived AAT products have been developed and are currently being used for the treatment of patients suffering from AAT-deficiency (i.e. having low or zero plasma AAT levels) related emphysema, such as Prolastin®, (Talecris), Aralast® (Baxter) and Zemaira® (ZLB). High amounts (approximately 60 mg/kg/ week) of this product are generally needed per patient.
  • AAT is also a (potential) therapy for inflammatory diseases with neutrophil-mediated damage
  • AAT Recombinant production of AAT in for example E.coli has been hampered by low expression in most recombinant platforms (Karnaukhova et al., 2006). Recombinant AAT has been produced at high level in transgenic systems, but clinical development thereof has been stopped because of suboptimal pharmacokinetics (PK) and safety issues due to non-human contaminants (Spencer et al., 2005).
  • PK suboptimal pharmacokinetics
  • the present invention now provides a recombinant human ⁇ l -antitrypsin (rhAAT) having suitable pharmacokinetic properties and that can be produced in large quantities in for example PER.C6 cells.
  • the recombinant AAT of the present invention has been shown to be functionally active, as determined by a chromogenic assay based on inhibition of human neutrophil elastase, and to have promising pharmacokinetic properties, as compared to plasma-derived AAT products, such as Prolastin ® .
  • the present invention thus provides rhAAT comprising N-linked glycans, wherein a) at least 10% of said N-linked glycans are tetra-antennary glycans; and b) the degree of capping with sialic acid on said N-linked glycans (Z/ A) is at least 50%.
  • N-linked glycans are sugar chains that are covalently linked to asparagine residues of a polypeptide (Varki et al. 1999). The process of N-glycosylation starts with the attachment of a dolichol oligosaccharide precursor to the asparagines precursor. This precursor is subsequently modified into a high-mannose, hybrid, or complex-type oligosaccharide. In complex type N-linked sugars, both the ⁇ 3- and ⁇ 6-linked mannose residues are substituted by N-acetyl-glucosamine (GIcNAc) residues.
  • GIcNAc N-acetyl-glucosamine
  • Complex type N- glycans may contain two to five GlcNAc-bearing branches that are referred to as antennae.
  • the ultimate structure of complex type N-linked sugars may vary extensively and depends on the protein to which they are attached, on the host cell and on the conditions under which the host cell is cultured.
  • the GlcNAc-bearing branches may be modified with galactose (Gal) or N-acetyl-galactosamine (GaINAc) forming so-called LacNAc or LacdiNAc structures.
  • GlcNAc-bearing branches may contain multiple LacNAc structures forming so-called polylactosamine structures.
  • Terminal galactoses may be modified with an ⁇ 2,3- or an ⁇ 2,6-linked sialic acid whereas terminal N-acetyl- galactosomines may only be modified with an ⁇ 2,6-linked sialic acid.
  • sialyltransferases The addition of sialic acids to terminal Gal or GaINAc is mediated by sialyltransferases. Probably more than 20 different sialyltransferases are encoded by the human genome (Harduin-Lepers et al., 2001). They differ in substrate specificity, tissue distribution and various biochemical parameters.
  • Native AAT has three glycosylation sites.
  • AAT comprises three N- linked glycans in which branching can occur. These glycans may have 2,3 or 4 so-called "antennae” or branches.
  • at least 10%, preferably from about 10% to about 50%, of said N-linked glycans of the rhAAT of the invention are tetra-antennary glycans.
  • at least 20 % of said N-linked glycans are tetra-antennary glycans, preferably from about 20 to 40% of said N-linked glycans are tetra-antennary glycans.
  • the glycosylation profile for example in terms of antennarity, as well as the pharmacokinetic properties, e.g. the mean residence time of the rhAAT of the invention differ from plasma-derived AAT, such as Prolastin®.
  • the rhAAT of the present invention is expressed in PER.C6 cells in combination with a sialyltransferase to achieve highly sialylated isoforms of rhAAT.
  • PER.C6 cells thus were co-transfected with either an ⁇ 2,3 sialyltransferase (PER.C6-ST3) or an ⁇ 2,6 sialyltransferase (PER.C6-ST6).
  • At least 50% of the total sialylation on said N- linked glycans is ⁇ -2, 3 -sialylation
  • at least 50, 70 or 80% of the total sialylation on said N-linked glycans is ⁇ -2,3-sialylation.
  • at least 90% of the total sialylation on said N-linked glycans is ⁇ -2,3-sialylation. It has surprisingly been shown that in these embodiments the rhAAT of the present invention has different pharmacokinetic properties, as compared to plasma-derived AAT, such as Prolastin®, in particular a prolonged mean residence time.
  • sialylation is meant the amount of sialic residues present on the AAT carbohydrate structures: ⁇ -2, 3 -sialylation means sialylation at the 2,3 position, i.e. an ⁇ 2,3- linked sialic acid (as is well known in the art) and ⁇ -2 ,6 -sialylation means sialylation at the 2,6 position, i.e an or an ⁇ 2,6-linked sialic acid (also known in the art).
  • At least 50% of the total sialylation on said N- linked glycans is ⁇ -2,3 -sialylation
  • rhAAT-ST6 the MRT in rats of rhAAT-ST6 is reduced as compared to that of Prolastin ® (approximately 3-4 hours).
  • the use of rhAAT - ST6 of the present invention may be advantageous due to the "more natural" 2,6-linkage of the sialic acid, which corresponds to the sialic acid linkage on plasma-derived AAT, such as Prolastin®.
  • the use of rhAAT-ST6 may furthermore be advantageous in cases where a reduced MRT may be beneficial.
  • the degree of sialylation of the glycans on recombinant proteins is of importance for optimal pharmacokinetic properties.
  • the overall degree of capping with sialic acid on said N-linked glycans (as calculated by the Z/A ratio) of the rhAAT of the present invention therefore is at least 70%. More preferably, the degree of capping with sialic acid on said N-linked glycans (ZIK) is at least 80%, even more preferably the degree of capping with sialic acid on said N-linked glycans (Z/A) is at least 90%.
  • the degree of capping with sialic acid on said N- linked glycans that are tetra-antennary is at least 20%, for example between 20% and 65%.
  • a relatively low degree of sialylation on said tetra-antennary N-glycans may yield a rhAAT product having a reduced MRT, as compared to plasma derived AAT.
  • the degree of capping with sialic acid on said tetra-antennary N-linked glycans is at least 50%, for example between 50% and 97%, preferably at least 60%, more preferably between 70 and 95%. The higher level of sialylation in this embodiment may contribute to the prolonged MRT, as compared to plasma derived AAT.
  • the invention furthermore provides preparations and pharmaceutical compositions, comprising said rhAAT and optionally one or more pharmaceutically acceptable excipients.
  • pharmaceutically acceptable excipient is meant any inert substance that is combined with an active molecule (such as a drug, agent, or protein) for preparing a suitable or convenient dosage form.
  • active molecule such as a drug, agent, or protein
  • pharmaceutically acceptable excipient is an excipient that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation comprising the active molecule.
  • compositions of the invention can be formulated into various compositions for any route of administrations, well-known to the skilled person.
  • the choice of the optimal route of administration of the pharmaceutical compositions will be influenced by several factors, including e.g. the physico-chemical properties of the active molecules within the compositions, the urgency of the clinical situation and the relationship of the plasma concentrations of the active molecules to the desired therapeutic effect.
  • the preparations and pharmaceutical compositions of the present invention are preferably formulated for intravenous administration or aerosol administration.
  • Pharmaceutically suitable formulations of rhAAT can be prepared according to methods known to the person skilled in the art (see Remington 's Pharmaceutical Sciences, 18th edition, A. R.
  • compositions must be sterile and stable under the conditions of manufacture and storage.
  • the preparations and/or pharmaceutical compositions comprising the rhAAT of the invention can be in powder form for reconstitution in the appropriate pharmaceutically acceptable excipient before or at the time of delivery.
  • the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the rhAAT of the present invention can be in solution and the appropriate pharmaceutically acceptable excipient can be added and/or mixed before or at the time of delivery to provide a unit dosage injectable form.
  • the rhAAT, the preparations or pharmaceutical compositions, comprising said rhAAT can be used as medicaments.
  • the rhAAT, the preparations and pharmaceutical compositions can be suitably used in the prevention and/or treatment of diseases and/or disorders for which the administration of AAT has been proven beneficial. They can inter alia be used in the prevention and/or treatment, or combination thereof, of AAT-deficiency-associated emphysema.
  • the rhAAT, preparations or pharmaceutical compositions of the present invention can further be used in the prevention and/or treatment of smoking-related emphysema, cystic fibrosis (CF), chronic obstructive pulmonary disease (COPD).
  • CF cystic fibrosis
  • COPD chronic obstructive pulmonary disease
  • AAT has been described to have antiinflammatory and antiapoptotic effects
  • the rhAAT, preparations or pharmaceutical compositions of the present invention may also be used as anti-inflammatory agents. (Lewis et al, 2008; Koulmanda et al, 2008)
  • the invention provides a method for producing recombinant human ⁇ l -antitrypsin, comprising the steps of providing a PER.C6 cell with a nucleic acid encoding human ⁇ l -antitrypsin in such a way that said PER.C6 cell harbors said nucleic acid in an expressible form; and culturing said PER.C6 cell under conditions conducive to the production of said recombinant human ⁇ l -antitrypsin, wherein said cell further contains a nucleic acid sequence encoding a sialyltransferase, preferably an alpha-2,6-sialyltransferase or an alpha-2,3-sialyltransferase, under control of a heterologous promoter.
  • the sialyltransferase is a human sialyltransferase.
  • the rhAAT of the present invention may, however, also be produced in other mammalian cells, optionally co-expressing a sialyltransferase, such as for example 293 cells.
  • the invention provides a method for producing recombinant human ⁇ l -antitrypsin, comprising the steps of providing a PER.C6 cell with a nucleic acid encoding human ⁇ l -antitrypsin in such a way that said PER.C6 cell harbors said nucleic acid in an expressible format, wherein said cell further contains a nucleic acid sequence encoding a sialyltransferase, preferably an alpha-2,6- sialyltransferase or an alpha-2,3-sialyltransferase, under control of a heterologous promoter; culturing said PER.C6 cell in a serum-free medium and allowing expression of said human ⁇ l -antitrypsin in said cell; harvesting the expressed human ⁇ l -antitrypsin from said cell and/or from said culture medium; and optionally purifying said human ⁇ l- antitrypsin.
  • PER.C6 cells as a production platform for proteins of interest has been described in WO 00/63403 the disclosure of which is incorporated herein by reference. As shown in WO 00/63403, PER.C6 can be suitably used for the production of recombinant proteins. In order to achieve large-scale (continuous) production of recombinant proteins through cell culture, it is preferred to have cells capable of growing without the necessity of anchorage. The cells of the present invention have that capability.
  • a PER.C6 cell according to this invention is a cell from an upstream or downstream passage or a descendent of an upstream or downstream passage of cells as deposited at the Center for Applied Microbiology and Research & European Collection of Cell Cultures (ECACC) on 29 February 2006 under ECACC no. 96022940 (see, e.g., U.S. Patent 5,994,128).
  • ECACC Microbiology and Research & European Collection of Cell Cultures
  • the cells according to the invention have the additional advantage that they can be cultured in the absence of animal- or human- derived serum or animal- or human -derived serum components.
  • isolation is easier, while the safety is enhanced due to the absence of additional human or animal proteins in the culture, and the system is very reliable (synthetic media are the best in reproducibility).
  • ElA Early region IA
  • El A as a transcriptional activator is known to enhance transcription from the enhancer/promoter of the CMV Immediate Early genes (Olive et al., 1990, Gorman et al., 1989).
  • expression levels increase in the cells and not in cells that lack ElA.
  • the production of a recombinant protein, such as rhAAT, in a host cell, such as a PER.C6 cell comprises the introduction of nucleic acid in expressible format into the host cell, culturing the cells under conditions conducive to expression of the nucleic acid and allowing expression of the said nucleic acid in said cells.
  • a protein that is naturally expressed in desired host cells, but not at sufficient levels may be expressed at increased levels by introducing suitable regulation sequences such as a strong promoter in operable association with the desired gene (see e.g. WO 99/05268, where the endogenous EPO gene is over-expressed by introduction of a strong promoter upstream of the gene in human cells).
  • Nucleic acid encoding AAT in expressible format may be in the form of an expression cassette, and usually requires sequences capable of bringing about expression of the nucleic acid, such as enhancer(s), promoter, polyadenylation signal, and the like.
  • promoters can be used for expression of recombinant nucleic acid, and these may comprise viral, mammalian, synthetic promoters, and the like.
  • a promoter driving the expression of the nucleic acid of interest is the CMV immediate early promoter, for instance comprising nt.
  • the nucleic acid of interest may be a genomic DNA, a cDNA, synthetic DNA, a combination of these, etc.
  • Cell culture media are available from various vendors, and serum-free culture media are nowadays often used for cell culture, because they are more defined than media containing serum.
  • the cells of the present invention grow well in serum- containing media as well as in serum-free media.
  • the cells of the invention in general grow adherently in serum-containing media, but are very proficient in growing in suspension to high cell densities (10x10 6 cells/ml and higher) in serum-free culture media, which means that they do not need a surface to adhere to, but remain relatively free from each other and from the walls of the culture vessel during most of the time. Processes for culturing the cells of the invention to high densities and/or for obtaining very high product yields from these cells have been described (WO 2004/099396).
  • nucleic acid encoding the desired glycosylation enzyme in expressible format is or has been introduced into the cells according to the invention, and the desired glycosylation enzyme is expressed during the culturing of the cells according to the invention when the protein of interest is expressed. This results in an altered glycosylation pattern of the protein of interest as compared to the situation when no recombinant glycosylation enzyme is expressed in the cells.
  • the glycosylation enzyme is a sialyltransferase, more preferred an alfa- 2,3-sialyltransferase and/or an alfa-2,6-sialyltransferase.
  • the encoded sialyltransferase is a mammalian sialyltransferase, more preferably a human sialyltransferase.
  • the nucleic acid encoding the sialyltransferase preferably is under control of a heterologous promoter, which should be active or have the possibility of being regulated in the cells of the invention.
  • the nucleic acid encoding the sialyltransferase is integrated into the genome of the cells, to ensure stable inheritance, and provide for stable expression of the sialyltransferase in subsequent generations of the cells.
  • the invention furthermore provides recombinant human AAT, obtainable by the methods according to the invention.
  • the rhAAT has a human glycosylation pattern different from the isolated natural human counterpart protein.
  • the present invention in particular provided rhAAT comprising N-linked glycans, wherein at least 10% of said N-linked glycans are tetra-antennary glycans.
  • the rhAAT obtainable according to the present invention has surprising pharmacokinetic properties.
  • Recombinant human AAT includes full-length human AAT, but also may encompass biologically active polypeptide fragments, such as fragments of human AAT with one or more amino acid deletions at e.g. the N-terminus of the protein, as well as biologically active variants of human AAT, such as AAT with one or more amino acid substitutions (e.g. conservative substitutions), one or more deletions or additions of amino acids, which do not significantly change the functional activity of the protein.
  • the rhAAT of the present invention comprises an amino acid sequence provided herein as SEQ ID NO: 1.
  • amino acid sequences of AAT variants are at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homologous to SEQ ID NO: 1.
  • PER.C6 cell lines expressing human AAT and co-expressing either an ⁇ 2,6-sialyltransferase (SIATl ; NM_003032) or an ⁇ 2,3- sialyltransferase (SIAT4C; L23767) were generated under serum-free conditions, as described in WO 2006/070011.
  • AAT-ST3 Forty-seven serum-free PER.C6 cell lines producing either AAT-ST3 (27 cell lines) or AAT-ST6 (20 cell lines) were selected based on highest yield as determined by ELISA (AAT Elisa Kit, US Biologicals) from independent cell line generation programs using nucleofection as transfection tool.
  • the expression plasmid contained the coding sequence for human AAT
  • the cell lines were cryo-preserved in Proper- 1 medium (Lonza) (6 vials, 3-5xlO 6 cells/ml), meeting all acceptance criteria (viability > 80%, good growth two passages post resuscitation). Batch cultures were generated (in Proper- 1 medium), which were used for biochemical analysis (see Example 2).
  • the supernatants of the 47 batch cultures were analyzed on SDS-PAGE stained with colloidal blue.
  • Cell culture harvest of the PER.C6-rAAT (non-purified) samples showed AAT as the main protein band on SDS-PAGE.
  • the gels showed intact AAT bands (shown in Figure 2) indicating the integrity of the material.
  • an indication for activity was determined by analyzing the formation of a complex of PER.C6-rAAT with human neutrophil elastase.
  • cell culture harvests of PER.C6-rAAT samples were incubated with 0, 0.1 , 0.2 and 0.4 ⁇ g elastase for 30 min at 37°C and subsequently applied on a 4-12% BIS-Tris SDS-PAGE and stained with colloidal blue).
  • AU PER.C6- rAAT samples tested formed a complex with elastase (data not shown), indicating activity of the preparations.
  • the extended glycan profiling method is schematically shown in Figure 3 and involves the release of the N-linked glycans from AAT with the enzyme N- glycosidase F (PNGaseF), and labelling the glycans with fluorescent 2-anthranilic acid (2-aa). Subsequently, the glycans are separated by anion exchange chromatography (AEX) into groups according to their negative charge, i.e. separation of glycans with different numbers of sialic acid. From this profile a Z-number, representing the degree of charge (i.e. sialylation) of the N-linked glycans, is determined.
  • AEX anion exchange chromatography
  • the desialylated glycans are separated by normal phase chromatography (NP) into groups according to their size, i.e. separation of glycans with different degree of branching (antennarity). From this profile an A-number, representing the degree of branching of the N-linked glycans, is determined.
  • NP normal phase chromatography
  • the ECL positive rAAT contain a lower level of charge (sialylation) (Z-number range: 0-124) versus the ECL negative PER.
  • C6 -rAAT Z- number range: 151-253 (difference is significant as tested by the Mann-Whitney test, p ⁇ 0.001) (see Figure 5).
  • the glycans of ECL-positive PER.C6-rAAT contain a higher level of antennarity (A-number range: 299-322) versus the ECL-negative PER.C6-rAAT (A-number range: 266-307) (difference is significant as tested by the Mann -Whitney test, p ⁇ 0.001) (see Figure 5).
  • the lower preference of ST6 for higher branched glycans may be the cause of the lower degree of sialylation on the tetra-antennary glycans of PER.C6-rAAT-ST6 versus PER.C6-rAAT- ST3.
  • the glycan profiles indicate a tendency for a higher degree of branching on the glycans of PER.C6-rAAT in comparison to plasma derived AAT (Prolastin ® ), as the profile for Prolastin R is: 80% di-antennae, 18% tri-antennae and 2% tetra-antennae (Tables 1 and 2). This phenomenon is also clear from comparison of the A-numbers ( Figure 5 and Tables 1 and 2). The degree of capping of the glycans by sialic acid of Prolastin ® is 96% (Tables 1 and 2). EXAMPLE 3
  • a rat model was established to determine the pharmacokinetics (PK) of PER.C6-rAAT.
  • the model should be able to detect AAT present in unpurified PER.C6- conditioned medium (CM) at concentrations of about 40-100 ⁇ g/mL (at 2 mL/kg resulting in doses of about 80-200 ⁇ g/kg).
  • CM unpurified PER.C6- conditioned medium
  • the residual AAT concentration in the plasma samples was subsequently determined by ELISA (AAT Elisa Kit, Affinity Biologicals).
  • the data obtained were modelled per rat with a 2-compartment model and PK parameters were subsequently determined.
  • the model was found suitable to determine the PK profile in unpurified samples because the plasma concentration versus time curves of Prolastin ® spiked in PER.C6-CM and buffer control (PBS, 0.01% w/v Tween-80 (PT) (doses 200 ⁇ g/kg) are similar.
  • PBS 0.01% w/v Tween-80
  • PER.C6 cell lines have been generated that produce human AAT with a high yield (up to 22 pcd) and with an acceptable quality, i.e. the preparations were active in an in vitro assay.
  • PK profiles were demonstrated in a rat model.
  • PER.C6 cells thus form a suitable platform for the production of human recombinant AAT for use in inter alia AAT-deficiency related emphysema or for use in other inflammatory diseases with neutrophil-mediated tissue damage.
  • the rhAAT of the present invention may however also suitably be produced in other mammalian cell types co-expressing a 2,3- or 2,6-sialyltransferases.
  • the human cytomegalovirus major immediate early promoter can be transactivated by adenovirus early proteins. Virology 171 : 377-385.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pulmonology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present invention relates recombinant human α1-antitrypsin (rhAAT) comprising N-linked glycans, wherein at least 10% of said N-linked glycans are tetra-antennary glycans; and the degree of capping with sialic acid on said N-linked glycans (Z/A) is at least 50%.The invention further relates to rhAAT for use as a medicament, in particular for use in the prevention and/or treatment of a disease associated with AAT deficiency, and/or a disease involving neutrophil-mediated tissue damage.

Description

RECOMBINANT HUMAN ALPHAl -ANTITRYPSIN
[0001] The invention relates to the field of pharmaceutical products, in particular to recombinant human αl -antitrypsin, that can be used for inter alia the prevention and/or treatment of α 1 -antitrypsin deficiency related emphysema.
BACKGROUND OF THE INVENTION
[0002] αi-Antitrypsin (AAT) or αi-protease inhibitor (αlPI) is a natural inhibitor of proteases released by activated neutrophils. AAT is a glycoprotein consisting of 394 amino acids and having a molecular weight of 52 kD. Human AAT is expressed as a 418 amino acid precursor from which a 24 amino acid precursor is clipped to yield the 394 amino acid final product. AAT is synthesized primarily in the liver, but expression has also been demonstrated in neutrophils, monocytes and macrophages. [0003] Low or zero plasma levels of AAT constitute a risk factor for the development of emphysema due to the unopposed and destructive action of neutrophil proteases in the lungs. For the prevention and/or treatment of AAT deficiency-related emphysema AAT augmentation therapy has been developed (Mulgrew et al., 2007).
[0004] Currently, patients with AAT-deficiency-associated emphysema are treated with a high dose of plasma-derived (pd)AAT (60mg/kg/week; ProlastinR from Talecris, AralastR from Baxter and ZemairaR from ZLB). Large quantities and frequent injections of AAT are required to relieve AAT-deficiency related emphysema. Major concern with the plasma-derived material is the safety of the preparations. As with all human-derived material, potential risk of pdAAT is contamination with prions or other adventitious agents. A second concern is the limited availability of the plasma material.
[0005] Human plasma derived AAT contains three N-linked glycans at Asn residues 46, 83 and 247. These glycans consist of mostly di- and tri-antennary structures. A high degree of sialylation of the glycans on recombinant proteins is of importance for optimal pharmacokinetics (PK). [0006] Until now recombinant production of AAT has been hampered by low expression in most recombinant platforms (Karnaukhova et al., 2006). Recombinant AAT has been produced at high level in transgenic systems, but clinical development thereof has been stopped because of suboptimal pharmacokinetics (PK) and safety issues due to non-human contaminants (Spencer et al., 2005).
[0007] There thus remains a need for recombinant human AAT (rhAAT) that is active, can be obtained in sufficient quantities, and that has useful pharmacokinetic properties.
BRIEF SUMMARY OF THE INVENTION
[0008] According to the present invention, it has been shown that recombinant human αi-antitrypsin (rhAAT) having a suitable pharmacokinetic profile can be produced in large quantities in PER.C6 cells.
[0009] In the research that led to the invention, cell lines expressing human AAT and co-expressing an α-2,3-sialyltransferase (ST3) or an α-2,6-sialyltransferase (ST6) were generated under serum- free conditions. The cell lines were capable of expressing high levels of rhAAT. Thus, yields of up to 22 picogram rhAAT per cell per day (pcd) were reached. Importantly, the rhAAT of the invention was shown to be active as a neutrophil elastase inhibitor. Analysis of the glycan profiles showed a good overall degree of capping with sialic acid. Interestingly, an increase in tetra-antennary glycans was noted on the rhAAT of the invention, as compared to plasma-derived AAT
(ProlastinR). Furthermore, rhAAT produced in cells co-expressing ST3 showed an increased mean residence time (MRT) in rats, as compared to plasma derived AAT. RhAAT produced in cells co-expressing ST6 showed a decreased mean residence time as compared to plasma-derived AAT. [0010] In one aspect, the present invention therefore provides recombinant human αl -antitrypsin (rhAAT) comprising N-linked glycans, wherein:
(a) at least 10% of said N-linked glycans are tetra-antennary glycans; and
(b) the degree of capping with sialic acid on said N-linked glycans (Z/A) is at least 50%. [0011] In another embodiment, at least 20% of said N-linked glycans are tetra- antennary glycans.
[0012] In a further embodiment, the degree of capping with sialic acid on said N- linked glycans that are tetra-antennary is at least 30%. [0013] In a further embodiment at least 50% of the total sialylation on said N- linked glycans is α-2,3-sialylation. Preferably, at least 90% of the total sialylation on said N-linked glycans is α-2, 3 -sialylation.
[0014] In a further aspect, the invention provides preparations and pharmaceutical compositions comprising said rhAAT, and optionally one or more pharmaceutically acceptable excipients.
[0015] In another aspect, the invention relates to the use of said rhAAT, preparations and/or pharmaceutical compositions, comprising said rhAAT, for the prevention and/or treatment of inter alia AAT-associated emphysema and/or inflammatory diseases with neutrophil-mediated tissue damage. [0016] In a further embodiment, the invention provides a method for producing recombinant human αl -antitrypsin, comprising the steps of providing a PER.C6 cell with a nucleic acid encoding human αl -antitrypsin in such a way that said PER.C6 cell harbours said nucleic acid in an expressible form; and culturing said PER.C6 cell under conditions conducive to the production of said recombinant human AAT, wherein said PER.C6 cell is modified to co-express α2,3 sialyltransferase or α2,6-sialyltransferase.
BRIEF DESCRIPTION OF THE FIGURES
[0017] FIG. 1. Frequency distribution of the specific productivities of the batch cultures, both for cell lines overexpressing α2,3 sialyltransferase (A: PER.C6-AAT-ST3) and cell overexpressing α2,6-sialyltransferase (B: PER.C6-AAT-ST6).
[0018] FIG. 2. 4-12% BIS-Tris SDS-PAGE gel with cell culture harvests of PER.C6-rAAT (non-purified) samples, stained with colloidal blue.
[0019] FIG. 3. Schematic overview of the assay to determine the degree of sialylation of the glycans on AAT by Z/A ratio. [0020] FIG. 4. Specific productivities of the PER.C6 cell lines expressing AAT are not correlated with the degree of sialylation of the glycans of PER.C6-rAAT (Spearman's r=-0.024, p=0.893). (0: PER.C6-AAT-ST3; o: PER.C6-AAT-ST6).
[0021] FIG. 5. Sialylation (Fig. 5A) and antennarity (Fig. 5B) of the glycans of PER.C6-rAAT from ECL negative samples in comparison with the glycans of PER.C6- rAAT from ECL positive FIG samples and ProlastinR.
[0022] FIG. 6. Degree of sialylation on all glycans (Fig. 6A) and on the tetra- antennary glycans (Fig. 6B) of PER.C6-rAAT-ST3 in comparison with the glycans of PER.C6-rAAT-ST6 and Prolastin®. [0023] FIG. 7. Plasma concentration-time profiles for various doses of ProlastinR in buffer (PBS/T) or in PER.C6-CM following i.v. bolus administration to rats. ■ : Prolastin® in PER.C6-CM, 50 μg/kg; ▲ : Prolastin® in PER.C6-CM, 100 μg/kg: • : Prolastin® in PER.C6-CM, 200 μg/kg; o :Prolastin® in PBS/T, 2000 μg/kg.
[0024] FIG. 8. Plasma concentration-time profiles for PER.C6-rAAT-ST3, PER.C6-rAAT-ST6 and Prolastin®. ▲ : PER.C6-rAAT-ST3, MRT -18-23 hr; ■: PER.C6-rAAT-ST6, MRT -4-4 hr, •: Prolastin, MRT -11-12 hr.
[0025] FIG. 9. Plasmid maps of the AAT expression vectors pAATopt-ST3 (A) and pAATopt-ST6 (B). CMV=Cytomegalovirus promoter, BGHp(A)= Bovine Growth Hormone polyadenylation sequence, fl ori= fl origin of replication, SV40=Simian Virus 40 promotor, Neo=Neomycin resistance marker, SV40p(A)=Simian Virus 40 polyadenylation sequence, AAT= alphai-antitrypsin, COIEI =COIEI origin of replication, Amp=ampicillin resistance marker, SIAT4C=gene coding for ST3=human sialyltransferase IV (L23767) (Fig. 9A), SIATl=gene coding for ST6=human sialyltransferase I (NM_003032). .
DETAILED DESCRIPTION OF THE INVENTION
[0026] Alphai-antitrypsin (AAT) is a natural inhibitor of proteases released by activated neutrophils. AAT is secreted into the blood plasma but its primarily site of action is in the lung parenchyma. Human leukocyte elastase (HLE), (also known as human neutrophil elastase (HNE) is a serine protease released from azurophilic granules of the neutrophils as part of the normal inflammatory response. Under normal homeostatic conditions AAT serves as an important regulator of proteolysis by human leukocyte elastase (HLE), thereby preventing damage of the lung alveolar matrix. Besides HLE, AAT also inhibits two other proteases released into the lungs by neutrophils, namely cathepsin G (catG) and protease 3 (Pr3).
[0027] Plasma-derived AAT products have been developed and are currently being used for the treatment of patients suffering from AAT-deficiency (i.e. having low or zero plasma AAT levels) related emphysema, such as Prolastin®, (Talecris), Aralast® (Baxter) and Zemaira® (ZLB). High amounts (approximately 60 mg/kg/ week) of this product are generally needed per patient. Besides emphysema, AAT is also a (potential) therapy for inflammatory diseases with neutrophil-mediated damage
[0028] Recombinant production of AAT in for example E.coli has been hampered by low expression in most recombinant platforms (Karnaukhova et al., 2006). Recombinant AAT has been produced at high level in transgenic systems, but clinical development thereof has been stopped because of suboptimal pharmacokinetics (PK) and safety issues due to non-human contaminants (Spencer et al., 2005).
[0029] The present invention now provides a recombinant human αl -antitrypsin (rhAAT) having suitable pharmacokinetic properties and that can be produced in large quantities in for example PER.C6 cells. The recombinant AAT of the present invention has been shown to be functionally active, as determined by a chromogenic assay based on inhibition of human neutrophil elastase, and to have promising pharmacokinetic properties, as compared to plasma-derived AAT products, such as Prolastin®.
[0030] The present invention thus provides rhAAT comprising N-linked glycans, wherein a) at least 10% of said N-linked glycans are tetra-antennary glycans; and b) the degree of capping with sialic acid on said N-linked glycans (Z/ A) is at least 50%.
[0031] N-linked glycans are sugar chains that are covalently linked to asparagine residues of a polypeptide (Varki et al. 1999). The process of N-glycosylation starts with the attachment of a dolichol oligosaccharide precursor to the asparagines precursor. This precursor is subsequently modified into a high-mannose, hybrid, or complex-type oligosaccharide. In complex type N-linked sugars, both the α3- and α6-linked mannose residues are substituted by N-acetyl-glucosamine (GIcNAc) residues. Complex type N- glycans may contain two to five GlcNAc-bearing branches that are referred to as antennae. The ultimate structure of complex type N-linked sugars may vary extensively and depends on the protein to which they are attached, on the host cell and on the conditions under which the host cell is cultured. The GlcNAc-bearing branches may be modified with galactose (Gal) or N-acetyl-galactosamine (GaINAc) forming so-called LacNAc or LacdiNAc structures. Also, GlcNAc-bearing branches may contain multiple LacNAc structures forming so-called polylactosamine structures. Terminal galactoses may be modified with an α2,3- or an α2,6-linked sialic acid whereas terminal N-acetyl- galactosomines may only be modified with an α2,6-linked sialic acid. The addition of sialic acids to terminal Gal or GaINAc is mediated by sialyltransferases. Probably more than 20 different sialyltransferases are encoded by the human genome (Harduin-Lepers et al., 2001). They differ in substrate specificity, tissue distribution and various biochemical parameters.
[0032] Native AAT has three glycosylation sites. Thus, AAT comprises three N- linked glycans in which branching can occur. These glycans may have 2,3 or 4 so-called "antennae" or branches. Surprisingly, it has been shown that at least 10%, preferably from about 10% to about 50%, of said N-linked glycans of the rhAAT of the invention are tetra-antennary glycans. In another embodiment at least 20 % of said N-linked glycans are tetra-antennary glycans, preferably from about 20 to 40% of said N-linked glycans are tetra-antennary glycans. According to the present invention, it has surprisingly been shown that the glycosylation profile, for example in terms of antennarity, as well as the pharmacokinetic properties, e.g. the mean residence time of the rhAAT of the invention differ from plasma-derived AAT, such as Prolastin®.
[0033] Since full sialylation of the glycans on recombinant proteins is of importance for optimal pharmacokinetic properties, the rhAAT of the present invention is expressed in PER.C6 cells in combination with a sialyltransferase to achieve highly sialylated isoforms of rhAAT. PER.C6 cells thus were co-transfected with either an α2,3 sialyltransferase (PER.C6-ST3) or an α2,6 sialyltransferase (PER.C6-ST6). In a preferred embodiment of the invention at least 50% of the total sialylation on said N- linked glycans is α-2, 3 -sialylation For example, at least 50, 70 or 80% of the total sialylation on said N-linked glycans is α-2,3-sialylation. In yet another embodiment at least 90% of the total sialylation on said N-linked glycans is α-2,3-sialylation. It has surprisingly been shown that in these embodiments the rhAAT of the present invention has different pharmacokinetic properties, as compared to plasma-derived AAT, such as Prolastin®, in particular a prolonged mean residence time. By sialylation is meant the amount of sialic residues present on the AAT carbohydrate structures: α-2, 3 -sialylation means sialylation at the 2,3 position, i.e. an α2,3- linked sialic acid (as is well known in the art) and α-2 ,6 -sialylation means sialylation at the 2,6 position, i.e an or an α2,6-linked sialic acid (also known in the art). With "at least 50% of the total sialylation on said N- linked glycans is α-2,3 -sialylation", it is thus meant that at least 50% of the total number of sialic acid residues present in the rhAAT is sialylated in the 2,3 position.
[0034] According to the invention it has been shown in PK studies in rat that the mean residence time (MRT) of both rhAAT produced by PER.C6-ST3 (rhAAT-ST3) and rhAAT produced by PER.C6-ST6 (rhAAT-ST6) differs significantly from that of plasma- derived AAT (Prolastin®). It has thus been shown that the MRT in rats of rhAAT-ST3 ranges from approximately 18-23 hours, whereas the MRT in rats of Prolastin R is approximately 11-12 hours. Using rhAAT having a prolonged MRT may for example reduce the dosage needed per patient. In contrast, the MRT in rats of rhAAT-ST6 is reduced as compared to that of Prolastin® (approximately 3-4 hours). The use of rhAAT - ST6 of the present invention may be advantageous due to the "more natural" 2,6-linkage of the sialic acid, which corresponds to the sialic acid linkage on plasma-derived AAT, such as Prolastin®. The use of rhAAT-ST6 may furthermore be advantageous in cases where a reduced MRT may be beneficial.
[0035] As stated above, the degree of sialylation of the glycans on recombinant proteins is of importance for optimal pharmacokinetic properties. In a preferred embodiment, the overall degree of capping with sialic acid on said N-linked glycans (as calculated by the Z/A ratio) of the rhAAT of the present invention therefore is at least 70%. More preferably, the degree of capping with sialic acid on said N-linked glycans (ZIK) is at least 80%, even more preferably the degree of capping with sialic acid on said N-linked glycans (Z/A) is at least 90%.
[0036] In a further embodiment, the degree of capping with sialic acid on said N- linked glycans that are tetra-antennary is at least 20%, for example between 20% and 65%. A relatively low degree of sialylation on said tetra-antennary N-glycans may yield a rhAAT product having a reduced MRT, as compared to plasma derived AAT. In another embodiment, the degree of capping with sialic acid on said tetra-antennary N-linked glycans is at least 50%, for example between 50% and 97%, preferably at least 60%, more preferably between 70 and 95%. The higher level of sialylation in this embodiment may contribute to the prolonged MRT, as compared to plasma derived AAT.
[0037] The invention furthermore provides preparations and pharmaceutical compositions, comprising said rhAAT and optionally one or more pharmaceutically acceptable excipients. By "pharmaceutically acceptable excipient" is meant any inert substance that is combined with an active molecule (such as a drug, agent, or protein) for preparing a suitable or convenient dosage form. The "pharmaceutically acceptable excipient" is an excipient that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation comprising the active molecule.
[0038] The pharmaceutical compositions of the invention can be formulated into various compositions for any route of administrations, well-known to the skilled person. The choice of the optimal route of administration of the pharmaceutical compositions will be influenced by several factors, including e.g. the physico-chemical properties of the active molecules within the compositions, the urgency of the clinical situation and the relationship of the plasma concentrations of the active molecules to the desired therapeutic effect. The preparations and pharmaceutical compositions of the present invention are preferably formulated for intravenous administration or aerosol administration. Pharmaceutically suitable formulations of rhAAT can be prepared according to methods known to the person skilled in the art (see Remington 's Pharmaceutical Sciences, 18th edition, A. R. Gennaro, Ed., Mack Publishing Company (1990); Pharmaceutical Formulation Development of Peptides and Proteins, S. Frokjaer and L. Hovgaard, Eds., Taylor & Francis (2000); and Handbook of Pharmaceutical Excipients, 3rd edition, A. Kibbe, Ed., Pharmaceutical Press (2000)).
[0039] Typically, pharmaceutical compositions must be sterile and stable under the conditions of manufacture and storage. The preparations and/or pharmaceutical compositions comprising the rhAAT of the invention can be in powder form for reconstitution in the appropriate pharmaceutically acceptable excipient before or at the time of delivery. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0040] Alternatively, the rhAAT of the present invention can be in solution and the appropriate pharmaceutically acceptable excipient can be added and/or mixed before or at the time of delivery to provide a unit dosage injectable form.
[0041] The rhAAT, the preparations or pharmaceutical compositions, comprising said rhAAT, can be used as medicaments. The rhAAT, the preparations and pharmaceutical compositions can be suitably used in the prevention and/or treatment of diseases and/or disorders for which the administration of AAT has been proven beneficial. They can inter alia be used in the prevention and/or treatment, or combination thereof, of AAT-deficiency-associated emphysema. The rhAAT, preparations or pharmaceutical compositions of the present invention can further be used in the prevention and/or treatment of smoking-related emphysema, cystic fibrosis (CF), chronic obstructive pulmonary disease (COPD). Since AAT has been described to have antiinflammatory and antiapoptotic effects, the rhAAT, preparations or pharmaceutical compositions of the present invention may also be used as anti-inflammatory agents. (Lewis et al, 2008; Koulmanda et al, 2008)
[0042] In a further embodiment, the invention provides a method for producing recombinant human αl -antitrypsin, comprising the steps of providing a PER.C6 cell with a nucleic acid encoding human αl -antitrypsin in such a way that said PER.C6 cell harbors said nucleic acid in an expressible form; and culturing said PER.C6 cell under conditions conducive to the production of said recombinant human αl -antitrypsin, wherein said cell further contains a nucleic acid sequence encoding a sialyltransferase, preferably an alpha-2,6-sialyltransferase or an alpha-2,3-sialyltransferase, under control of a heterologous promoter. In an embodiment, the sialyltransferase is a human sialyltransferase. The rhAAT of the present invention may, however, also be produced in other mammalian cells, optionally co-expressing a sialyltransferase, such as for example 293 cells.
[0043] In an embodiment, the invention provides a method for producing recombinant human αl -antitrypsin, comprising the steps of providing a PER.C6 cell with a nucleic acid encoding human αl -antitrypsin in such a way that said PER.C6 cell harbors said nucleic acid in an expressible format, wherein said cell further contains a nucleic acid sequence encoding a sialyltransferase, preferably an alpha-2,6- sialyltransferase or an alpha-2,3-sialyltransferase, under control of a heterologous promoter; culturing said PER.C6 cell in a serum-free medium and allowing expression of said human αl -antitrypsin in said cell; harvesting the expressed human αl -antitrypsin from said cell and/or from said culture medium; and optionally purifying said human αl- antitrypsin.
[0044] The use of PER.C6 cells as a production platform for proteins of interest has been described in WO 00/63403 the disclosure of which is incorporated herein by reference. As shown in WO 00/63403, PER.C6 can be suitably used for the production of recombinant proteins. In order to achieve large-scale (continuous) production of recombinant proteins through cell culture, it is preferred to have cells capable of growing without the necessity of anchorage. The cells of the present invention have that capability. A PER.C6 cell according to this invention is a cell from an upstream or downstream passage or a descendent of an upstream or downstream passage of cells as deposited at the Center for Applied Microbiology and Research & European Collection of Cell Cultures (ECACC) on 29 February 2006 under ECACC no. 96022940 (see, e.g., U.S. Patent 5,994,128). The use of PER.C6 cells for industrial processes has been extensively described, e.g. in Nichols et al, 2002, and more in particular for recombinant protein production, e.g. in Yallop et al, 2005a and 2005b.
[0045] The cells according to the invention, in particular PER.C6 cells, have the additional advantage that they can be cultured in the absence of animal- or human- derived serum or animal- or human -derived serum components. Thus isolation is easier, while the safety is enhanced due to the absence of additional human or animal proteins in the culture, and the system is very reliable (synthetic media are the best in reproducibility). Furthermore, the presence of the Early region IA ("ElA") of adenovirus adds another level of advantages as compared to (human) cell lines that lack this particular gene. El A as a transcriptional activator is known to enhance transcription from the enhancer/promoter of the CMV Immediate Early genes (Olive et al., 1990, Gorman et al., 1989). When the recombinant protein to be produced is under the control of the CMV enhancer/promoter, expression levels increase in the cells and not in cells that lack ElA.
[0046] In general, the production of a recombinant protein, such as rhAAT, in a host cell, such as a PER.C6 cell, comprises the introduction of nucleic acid in expressible format into the host cell, culturing the cells under conditions conducive to expression of the nucleic acid and allowing expression of the said nucleic acid in said cells. Alternatively, a protein that is naturally expressed in desired host cells, but not at sufficient levels, may be expressed at increased levels by introducing suitable regulation sequences such as a strong promoter in operable association with the desired gene (see e.g. WO 99/05268, where the endogenous EPO gene is over-expressed by introduction of a strong promoter upstream of the gene in human cells).
[0047] Nucleic acid encoding AAT in expressible format may be in the form of an expression cassette, and usually requires sequences capable of bringing about expression of the nucleic acid, such as enhancer(s), promoter, polyadenylation signal, and the like. Several promoters can be used for expression of recombinant nucleic acid, and these may comprise viral, mammalian, synthetic promoters, and the like. In certain embodiments, a promoter driving the expression of the nucleic acid of interest is the CMV immediate early promoter, for instance comprising nt. -735 to +95 from the CMV immediate early gene enhancer/promoter, as this promoter has been shown to give high expression levels in cells expressing ElA of an adenovirus (see e.g. WO 03/051927). The nucleic acid of interest may be a genomic DNA, a cDNA, synthetic DNA, a combination of these, etc.
[0048] Cell culture media are available from various vendors, and serum-free culture media are nowadays often used for cell culture, because they are more defined than media containing serum. The cells of the present invention grow well in serum- containing media as well as in serum-free media. The cells of the invention in general grow adherently in serum-containing media, but are very proficient in growing in suspension to high cell densities (10x106 cells/ml and higher) in serum-free culture media, which means that they do not need a surface to adhere to, but remain relatively free from each other and from the walls of the culture vessel during most of the time. Processes for culturing the cells of the invention to high densities and/or for obtaining very high product yields from these cells have been described (WO 2004/099396).
[0049] The concept of genetic engineering to alter glycosylation of recombinant proteins produced in a cell has been amply established, and is for instance discussed in detail in e.g US 2005/0164386. To this purpose, nucleic acid encoding the desired glycosylation enzyme in expressible format is or has been introduced into the cells according to the invention, and the desired glycosylation enzyme is expressed during the culturing of the cells according to the invention when the protein of interest is expressed. This results in an altered glycosylation pattern of the protein of interest as compared to the situation when no recombinant glycosylation enzyme is expressed in the cells. In the present invention, the glycosylation enzyme is a sialyltransferase, more preferred an alfa- 2,3-sialyltransferase and/or an alfa-2,6-sialyltransferase. Preferably, the encoded sialyltransferase is a mammalian sialyltransferase, more preferably a human sialyltransferase. The nucleic acid encoding the sialyltransferase preferably is under control of a heterologous promoter, which should be active or have the possibility of being regulated in the cells of the invention. Preferably, the nucleic acid encoding the sialyltransferase is integrated into the genome of the cells, to ensure stable inheritance, and provide for stable expression of the sialyltransferase in subsequent generations of the cells. [0050] The invention furthermore provides recombinant human AAT, obtainable by the methods according to the invention. According to the invention the rhAAT has a human glycosylation pattern different from the isolated natural human counterpart protein. The present invention in particular provided rhAAT comprising N-linked glycans, wherein at least 10% of said N-linked glycans are tetra-antennary glycans. In addition, the rhAAT obtainable according to the present invention has surprising pharmacokinetic properties. [0051] Recombinant human AAT according to the invention includes full-length human AAT, but also may encompass biologically active polypeptide fragments, such as fragments of human AAT with one or more amino acid deletions at e.g. the N-terminus of the protein, as well as biologically active variants of human AAT, such as AAT with one or more amino acid substitutions (e.g. conservative substitutions), one or more deletions or additions of amino acids, which do not significantly change the functional activity of the protein. In an embodiment, the rhAAT of the present invention comprises an amino acid sequence provided herein as SEQ ID NO: 1. In some embodiments, amino acid sequences of AAT variants are at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homologous to SEQ ID NO: 1.
[0052] The present invention is further illustrated by the following non-limiting examples.
EXAMPLES
EXAMPLE 1
Cell line generation and specific productivities
[0053] Seven hundred PER.C6 cell lines expressing human AAT and co- expressing either an α2,6-sialyltransferase (SIATl ; NM_003032) or an α2,3- sialyltransferase (SIAT4C; L23767) (PER.C6-AAT-ST3/ PER.C6-AAT.ST6) were generated under serum-free conditions, as described in WO 2006/070011. Forty-seven serum-free PER.C6 cell lines producing either AAT-ST3 (27 cell lines) or AAT-ST6 (20 cell lines) were selected based on highest yield as determined by ELISA (AAT Elisa Kit, US Biologicals) from independent cell line generation programs using nucleofection as transfection tool. The expression plasmid contained the coding sequence for human AAT
(SEQ ID NO:2) and the coding sequence for human ST3GalIV, both driven by a cytomegalovirus promoter that has been modified to achieve high levels of gene expression in PER.C6 cells (Yallop et al, 2005). The plasmid maps of the AAT expression vectors (pAATopt-ST3 and pAATopt-ST6) are shown in Figure 9. [0054] The productivity of the cell lines varied between 8-22 picogram per cell per day (pcd) (PER.C6-AAT-ST3) and 7-19 pcd (PER.C6-AAT-ST6) (see Figure 1 and Tables 1 and 2). The cell lines were cryo-preserved in Proper- 1 medium (Lonza) (6 vials, 3-5xlO6 cells/ml), meeting all acceptance criteria (viability > 80%, good growth two passages post resuscitation). Batch cultures were generated (in Proper- 1 medium), which were used for biochemical analysis (see Example 2).
EXAMPLE 2
Biochemical analysis
[0055] Integrity of PER.C6-r AAT
The supernatants of the 47 batch cultures were analyzed on SDS-PAGE stained with colloidal blue. Cell culture harvest of the PER.C6-rAAT (non-purified) samples showed AAT as the main protein band on SDS-PAGE. Furthermore, the gels showed intact AAT bands (shown in Figure 2) indicating the integrity of the material.
[0056] Activity of PER.C6-rAAT
Initially (in lieu of a chromogenic activity assay), an indication for activity was determined by analyzing the formation of a complex of PER.C6-rAAT with human neutrophil elastase. To this end, cell culture harvests of PER.C6-rAAT samples were incubated with 0, 0.1 , 0.2 and 0.4 μg elastase for 30 min at 37°C and subsequently applied on a 4-12% BIS-Tris SDS-PAGE and stained with colloidal blue). AU PER.C6- rAAT samples tested formed a complex with elastase (data not shown), indicating activity of the preparations. Further activity testing was done with a chromogenic assay based on inhibition of human neutrophil elastase using ProlastinR as reference (adapted from Bruin et al, 2005)). AU PER.C6-rAAT samples tested, except for one (PER.C6- rAAT-ST3-234c), were at least as active as Prolastin® (>90%) (Tables 1 and 2).
[0057] Glycan analysis of PER.C6-rAAT To screen for PER.C6-rAAT samples of which the glycans have a relative high degree of capping with sialic acid, needed for an optimal PK profile, a lectin assay was applied, using Erythrina cristagalli lectin (ECL) for detection of exposed galactoses (see Figure 3 for a schematic overview of the used assay). From the 47 samples tested 15 showed a signal at OD405 with ECL > blank + 0.2, indicating a relatively high degree of exposure of terminal galactoses on the glycans of these AAT samples. For a few of these samples the low degree of capping of the glycans by sialic acid was confirmed by further glycan analysis using an HPLC-based method (Hermentin et al., 1996; Gervais et al., 2003). Therefore, the rhAAT samples with an ECL signal at OD405 > blank + 0.2 were not further subjected to extended glycan analysis and not tested in PK studies.
[0058] The extended glycan profiling method is schematically shown in Figure 3 and involves the release of the N-linked glycans from AAT with the enzyme N- glycosidase F (PNGaseF), and labelling the glycans with fluorescent 2-anthranilic acid (2-aa). Subsequently, the glycans are separated by anion exchange chromatography (AEX) into groups according to their negative charge, i.e. separation of glycans with different numbers of sialic acid. From this profile a Z-number, representing the degree of charge (i.e. sialylation) of the N-linked glycans, is determined.
The formula for Z:
Z = (AAS1aiox0)+(AMonoSiaioXl )(ADlsiaiox2)+(AτπSiaiox3)+(ATetraSiaiox4) (A= area, Hermentin et ai, 1996).
[0059] Furthermore, the desialylated glycans are separated by normal phase chromatography (NP) into groups according to their size, i.e. separation of glycans with different degree of branching (antennarity). From this profile an A-number, representing the degree of branching of the N-linked glycans, is determined.
The formula for A:
Figure imgf000016_0001
[0060] Finally, by calculating the Z/A ratio, the degree (percentage) of capping by sialic acid of the N-linked glycans of a glycoprotein is obtained (Gervais et al., 2003). [0061] The glycan profiles of PER.C6-rAAT are shown in Tables 1 and 2. The overall profiles of PER.C6-rAAT samples (Tables 1 and 2) show 12-54% di-antennae, 13-39% tri-antennae and 22-48% tetra-antennae and 0-55% di-sialo, 0-30% tri-sialo, 0- 29% tetra-sialo. The degree of capping of the glycans by sialic acid of PER.C6-rAAT ranges from 0 to 92%, this degree of capping with sialic acid is not correlated with the specific productivities of the PER.C6-rAAT cell lines (Spearman's r=-0.024, p=0.893) (Tables 1 and 2 and Figure 4).
[0062] As expected the glycans the ECL positive rAAT contain a lower level of charge (sialylation) (Z-number range: 0-124) versus the ECL negative PER. C6 -rAAT (Z- number range: 151-253) (difference is significant as tested by the Mann-Whitney test, p<0.001) (see Figure 5). The glycans of ECL-positive PER.C6-rAAT contain a higher level of antennarity (A-number range: 299-322) versus the ECL-negative PER.C6-rAAT (A-number range: 266-307) (difference is significant as tested by the Mann -Whitney test, p<0.001) (see Figure 5). Furthermore, there is a lower degree of sialylation on the tetra- antennary glycans of PER.C6-rAAT-ST6 (ECL negative), ranging from 6 to 62% versus PER.C6-rAAT-ST3 (ECL negative), ranging from 35 to 106% (difference is significant as tested by the Mann-Whitney test, p<0.001), while this is not the case for the overall degree of sialylation (Tables 1 and 2, Figure 6). The lower preference of ST6 for higher branched glycans (Joziasse et al, 1987) may be the cause of the lower degree of sialylation on the tetra-antennary glycans of PER.C6-rAAT-ST6 versus PER.C6-rAAT- ST3.
[0063] The glycan profiles indicate a tendency for a higher degree of branching on the glycans of PER.C6-rAAT in comparison to plasma derived AAT (Prolastin®), as the profile for ProlastinR is: 80% di-antennae, 18% tri-antennae and 2% tetra-antennae (Tables 1 and 2). This phenomenon is also clear from comparison of the A-numbers (Figure 5 and Tables 1 and 2). The degree of capping of the glycans by sialic acid of Prolastin® is 96% (Tables 1 and 2). EXAMPLE 3
Pharmacokinetics of PER.C6-rAAT in a rat model
[0064] A rat model was established to determine the pharmacokinetics (PK) of PER.C6-rAAT. The model should be able to detect AAT present in unpurified PER.C6- conditioned medium (CM) at concentrations of about 40-100 μg/mL (at 2 mL/kg resulting in doses of about 80-200 μg/kg).
[0065] Four experiments were performed: the first two to set-up the model and the second, third and fourth experiments to select the PER.C6-rAAT cell lines producing rAAT with most optimal PK characteristics. In these studies, human pdAAT (Prolastin®) was used to establish the model and as reference. The experimental procedure was as follows: rats (male Wistar, age 8 weeks) were dosed i.v. in the tail vein with the AAT test samples (dose volume 2 ml/kg, dose range 50-200 μg/kg, n=3 rats per group). Blood was sampled from the tail tip pre-dose and at various time points following dose administration. The blood was collected in K2EDTA microvettes and plasma was prepared. The residual AAT concentration in the plasma samples was subsequently determined by ELISA (AAT Elisa Kit, Affinity Biologicals). The data obtained were modelled per rat with a 2-compartment model and PK parameters were subsequently determined. [0066] As shown by the data from experiment 1 (see Figure 7) the model was found suitable to determine the PK profile in unpurified samples because the plasma concentration versus time curves of Prolastin® spiked in PER.C6-CM and buffer control (PBS, 0.01% w/v Tween-80 (PT) (doses 200 μg/kg) are similar. A similar result was found with Prolastin® doses of 100 μg/kg (data not shown). In Figure 7 it is also shown that an increased response is observed with doses of Prolastin® spiked in CM from 50- 200 μg/kg. From the data it was calculated that Prolastin® has a mean residence time (MRT) of 1 1-12 hr. Also the PER.C6-rAAT samples were detected, with PER.C6-rAAT- ST3-202c showing a slower clearance (MRT ~ 20.5 hr) as compared to Prolastin® and PER.C6-rAAT-ST6-530 showing a faster clearance (MRT -3.6 hr) compared to Prolastin® (Table 1 and 2). Based on these observations, it was therefore concluded that the model could be used for the unpurified PER.C6-rAAT samples, which were tested in experiments 2-4 at a dose level of 100 μg/kg for all samples. In Figure 8 representative PK profiles for PER.C6-rAAT-ST3 and PER.C6-rAAT-ST6 in comparison to Prolastin® are shown.
[0067] The last column in Tables 1 and 2 shows the MRT values obtained in the PK experiments. Statistical testing on differences between samples and groups of samples with regard to the MRT was done by ANOVA on log transformed values. The MRTs of both the PER.C6-rAAT-ST3 and PER.C6-rAAT-ST6 preparations tested were significantly different from that of Prolastin®. The MRT for 8 out of 10 PER.C6-rAAT- ST3 preparations tested were significantly higher than that of Prolastin R and ranged from 18-23 hr. Between these 8 PER.C6-rAAT-ST3 preparations the differences in MRT were not significant.
[0068] The MRTs of PER.C6-rAAT-ST3-053b and -539 were significantly lower than that of Prolastin®. For PER.C6-rAAT-ST3-0539 this is due to the relatively low degree of sialylation (49%) as confirmed by the rescue of the PK profile of this preparation in the first hour during blocking of the asialoglycoprotein receptor by co- injection with asialofetuin (data not shown). The glycan profile for PER.C6-rAAT-ST3- 053b was inconclusive (no clear peak assignments possible), however, also in this case undersialylation is most likely the cause of the low MRT.
[0069] For all PER.C6-rAAT-ST6 preparations tested the MRT was significantly lower than that of ProlastinR ranging from 3.4-3.9 hr. This may be explained by the relative low degree of sialylation of the tetra-antennary glycans on PER.C6-rAAT-ST6 (ranging from 6 to 62%) and/or by a potential different mechanism of clearance for α2,3 sialylated AAT versus α 2,6 sialylated AAT.
[0070] Conclusions
According to the present invention PER.C6 cell lines have been generated that produce human AAT with a high yield (up to 22 pcd) and with an acceptable quality, i.e. the preparations were active in an in vitro assay. Surprisingly and interestingly, promising
PK profiles were demonstrated in a rat model. PER.C6 cells thus form a suitable platform for the production of human recombinant AAT for use in inter alia AAT-deficiency related emphysema or for use in other inflammatory diseases with neutrophil-mediated tissue damage. The rhAAT of the present invention may however also suitably be produced in other mammalian cell types co-expressing a 2,3- or 2,6-sialyltransferases.
to
O
Figure imgf000021_0001
Tf inconclusive glycan profile
AAT αl antitrypsin, Qp specific productivity, pcd picogram per cell per day, Cr chromogenic assay, Ag antigen ELISA, Sia sialic acid, MRT mean residence time, hr hours, Ε,CLΞrythnna cnstagalh lectin, PK pharmacokinetics
to
Figure imgf000022_0001
Tf inconclusive glycan profile
AAT αl antitrypsin, Qp specific productivity, pcd picogram per cell per day, Cr chromogenic assay, Ag antigen ELISA, Sia sialic acid, MRT mean residence time, hr hour, ECL Erythnna cnεtagalh lectin, PIC pharmacokinetics
??
SEQ ID NO: 1
Amino acid sequence of AAT
Mpssvswgilllaglcclvpvslaedpqgdaaqktdtshhdqdhptfnkitpnlaefafs lyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfnlteipeaqihegf qellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftvnfgdteeakkq indyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhvdqvttv kvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlenelthdiitkf1 enedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeaplklskavhka vltidekgteaagamfleaipmsippevkfnkpfvflmieqntksplfmgkvvnptqk*
SEQ ID NO: 2 Optimized CDS of AAT (based on NM_000295)
atgcccagcagcgtgagctggggcatcctgctgctggccggcctgtgctgcctggtgccc gtgagcctggccgaggacccccagggcgacgccgcccagaaaaccgacaccagccaccac gaccaggaccaccccaccttcaacaagatcacccccaacctggccgagttcgccttcagc ctgtaccggcagctggcccaccagagcaacagcaccaacatctttttcagccccgtgagc atcgccaccgccttcgccatgctgtccctgggcaccaaggccgacacccacgacgagatc ctggaaggcctgaacttcaacctgaccgagatccccgaggcccagatccacgagggcttc caggaactgctgcggaccctgaaccagcccgacagccagctccagctcaccaccggcaac ggcctgtttctgagcgagggcctgaaactggtggacaagtttctcgaagatgtgaagaag ctgtaccacagcgaggccttcaccgtgaacttcggcgacaccgaggaagccaagaagcag atcaacgactacgtggagaagggcacccagggcaagatcgtggacctggtgaaagagctg gaccgggacaccgtgttcgccctggtgaactacatcttcttcaagggcaagtgggagcgg cctttcgaggtgaaggataccgaggaagaggacttccacgtggaccaggtgaccaccgtg aaggtgcccatgatgaagcggctgggcatgttcaacatccagcactgcaagaagctgtcc agctgggtcctgctgatgaagtacctgggcaacgccaccgccatcttttttctgcccgac gagggcaagctgcagcacctggaaaacgagctgacccacgacatcatcaccaagtttctg gaaaatgaggaccggcggagcgccagcctgcacctgcccaagctgtccatcaccggcacc tacgacctgaagagcgtgctgggccagctgggcatcaccaaggtgttcagcaacggcgcc gacctgagcggcgtgaccgaagaggcccccctgaagctgtctaaggccgtgcacaaggcc gtgctgaccatcgacgagaaggggaccgaagccgccggagccatgtttctggaagccatc cccatgagcatcccccccgaggtgaagttcaacaagcccttcgtgttcctgatgatcgag cagaacaccaagagccccctgttcatgggcaaggtggtgaaccccacccaaaagtga REFERENCES
A Gervais, YA Hammel, S Pelloux, P Lepage, G Baer, N Carte, O Sorokine, JM Strub, R Koerner, E Leize and A Van Dorsselaer. 2003. Glycosylation of human recombinant gonadotrophins: characterization and batch-to-batch consistency. Glycobiology, 13: 179-189.
P Hermentin, R Witzel, EJ Kanzy, G Diderich, D Hoffmann, H Metzner, J Vorlop and H Haupt. 1996. The hypothetical N-glycan charge: a number that characterisizes protein glycosylation. Glycobiology, 6: 217-230.
DH Joziasse, WE Schiphorst, DH Van den Eijnden, JA Van Kuik, H Van Halbeek and JF Vliegenthart. 1987. Branch specificity of bovine colostrum CMP-sialic acid: Gal beta 1-4GIcNAc-R alpha 2-6-sialyltransferase. Sialylation of bi-, tri-, and tetraantennary oligosaccharides and glycopeptides of the N- acetyllactosamine type. J. Biol. Chem. 262: 2025-2033.
E Karnaukhova, Y. Ophir and B. Golding. 2006. Recombinant human alpha-1 proteinase inhibitor: towards therapeutic use. Amino Acids 30: 317-332.
AT Mulgrew, CC Taggart and NG McElvaney. 2007. Alpha-1 -Antitrypsin
Deficiency-Current Concepts. Lung 185: 191-201.
TL Spencer, JE Humphries and ML Brantly. 2005. Antibody Response to Aerosolized Transgenic Human Alphal Antitrypsin NEJM 352: 30-31.
CA Yallop, J Crowley, J Cote, K Hegmans-Brouwer, F Lagerwerf, R Gagne, JC Martin, N Oosterhuis, DJ Opstelten and A Bout. 2005a. PER.C6 cells for the manufacture of biopharmaceutical proteins. In "Modern Biopharmaceuticals. Volume 3. Design, Development and Optimization", pp 779-807. Wiley- VCH, Germany. C. Yallop, M. Raadsman, M. Zuiderwijk, Y. Van Noordenburg, A. Vooys, R. Keehnen, B. Van Montfort, M. Jansen, F. Lagerwerf, R. Dijkstra and others. 2005b. High level production of recombinant IgG in the human cell line PER.C6. In: Godia F. Fussenegger M., editors. Animal cell technology meets genomics: Springer. P. 533-536.
E. C. Bruin, D. Roem, I. Bulder, M. Dieker, G. Voerman, CE. Hack. 2005. Production, purification and characterisation of recombinant Fahsin, a novel antistasin- type proteinase inhibitor. FEMS Yeast Res. 5(11): 1069-1077.
A. Varki, R Cummings, J. Esko, H. Freeze, G. Hart, J. Marth. 1999. Essentials of glycobiology. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA.
A. Harduin-Lepers, V. Vallejo-Ruiz, Krzewinsky-Recchi Mass., B. Samyn-Petit, S. Julien, P. Delannoy. 2001. The human sialyltransferase family. Biochimie 83: 727- 737.
E. C. Lewis, M. Mizrahi, M. Toledano, N. DeFelice, J.L. Wright, A. Churg, L. Shapiro, CA. Dinarello. 2008. αl -Antitrypsin monotherapy induces immune tolerance during islet allograft transplantation in mice. PNAS 105: 16236-16241.
M. Koulmanda, M. Bhasin, L. Hoffman, Z. Fan, A. Qipo, H. Shi, S. Bonner-Weir, P. Putheti, N. Degauque, T. A. Libermann, H. Auchincloss, Jr., J. S. Flier, T. B. Strom. 2008. Curative and β cell regenerative effects of αl -antitrypsin treatment in autoimmune diabetic NOD mice. PNAS 105: 16242-16247.
W.W. Nichols, R. Lardenoie, BJ. Ledwith, K. Brouwer, S. Manam, R. Vogels, D. Kaslow, D. Zuidgeest, AJ. Bett, J. Chen and others. 2002. Propagation of adenoviral vectors: use of PER.C6 cells. In: Curiel D. Douglas J. T. editors. Adenoviral vectors for gene therapy. San Diego: Elsevier. P. 129-167. D.M. Olive, W. Al-Mulla, M. Simsek, S. Zarban, W. al-Nakib. 1990. The human cytomegalovirus immediate early enhancer-promotor is responsive to activation by the adenovirus-5 13S ElA gene. Arch. Virol. 112: 67-80.
CM. Gorman, D . Gies, G. McGray, M . Huang . 1 989. The human cytomegalovirus major immediate early promoter can be transactivated by adenovirus early proteins. Virology 171 : 377-385.
1/1
PCT
Print Out (Original in Electronic Form) (This sheet is not part of and does not count as a sheet of the international application)
Figure imgf000027_0001
FOR RECEIVING OFFICE USE ONLY
0-4 This form was received with the international application: yes
(yes or no)
0-4-1 Authorized officer
Rossi, Cinzia
FOR INTERNATIONAL BUREAU USE ONLY
0-5 This form was received by the international Bureau on:
0-5-1 Authorized officer

Claims

26CLAIMS
1. Recombinant human αl -antitrypsin (rhAAT) comprising N-linked glycans, characterized in that: (a) at least 10% of said N-linked glycans are tetra-antennary glycans; and
(b) the degree of capping with sialic acid on said N-linked glycans (Z/ A) is at least 50%.
2. RhAAT according to claim 1, wherein at least 20% of said N-linked glycans are tetra-antennary glycans.
3. RhAAT according to claim 1 or 2, wherein from about 10% to 50% of said N- linked glycans are tetra-antennary glycans.
4. RhAAT according to claim 1 or 2, wherein from about 20% to 40% of said N- linked glycans are tetra-antennary glycans.
5. RhAAT according to any one of the claims 1-4, wherein at least 50% of the total sialylation on said N-linked glycans is α-2,3-sialylation.
6. RhAAT according claim 5, wherein at least 90% of the total sialylation on said N-linked glycans is α-2, 3 -sialylation.
7. RhAAT according to any one of the preceding claims, wherein the degree of capping with sialic acid on said N-linked glycans (as calculated by the Z/A ratio) is at least 70%, preferably at least 80%, more preferably at least 90%.
8. RhAAT according to any one of the preceding claims, wherein the degree of capping with sialic acid on said N-linked glycans that are tetra-antennary is at least 20%. 27
9. RhAAT according to any one of the preceding claims, wherein the degree of capping with sialic acid on said N-linked glycans that are tetra-antennary is at least 50%.
10. RhAAT according to claim 9, wherein the degree of capping with sialic acid on said N-linked glycans that are tetra-antennary is from about 50% to about 97%.
11. RhAAT according to any one of the preceding claims, wherein the degree of capping with sialic acid on said N-linked glycans that are tetra-antennary is from about 70% to about 95%.
12. RhAAT according to any one of the preceding claims for use as a medicament.
13. RhAAT according to any one of the preceding claims for use in the prevention and/or treatment of a disease associated with AAT deficiency, and/or a disease involving neutrophil-mediated tissue damage.
14. Method for producing recombinant human αl -antitrypsin (rhAAT), comprising the steps of providing a PER.C6 cell with a nucleic acid encoding human αl -antitrypsin in such a way that said PER.C6 cell harbors said nucleic acid in an expressible form; and culturing said PER.C6 cell under conditions conducive to the production of said recombinant human αl -antitrypsin, wherein said PER.C6 cell is modified to co-express a said sialyltransferase is α2,3 sialyltransferase or α2,6-sialyltransferase.
15. RhAAT obtainable by a method according to claim 14.
PCT/EP2010/055177 2009-04-23 2010-04-20 Recombinant human alpha1-antitrypsin Ceased WO2010127939A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
EP10716318.0A EP2421895B1 (en) 2009-04-23 2010-04-20 Recombinant human alpha1-antitrypsin
DK10716318.0T DK2421895T3 (en) 2009-04-23 2010-04-20 Recombinant human alpha 1-antitrypsin
ES10716318.0T ES2559007T3 (en) 2009-04-23 2010-04-20 Recombinant human antitrypsin alpha1
US13/138,912 US8357661B2 (en) 2009-04-23 2010-04-20 Recombinant human Alpha1-antitrypsin
AU2010244592A AU2010244592B2 (en) 2009-04-23 2010-04-20 Recombinant human alpha1-antitrypsin
PL10716318T PL2421895T3 (en) 2009-04-23 2010-04-20 Recombinant human alpha1-antitrypsin
CN201080017593.2A CN102439037B (en) 2009-04-23 2010-04-20 Recombinant human alpha1-antitrypsin
BRPI1015341-1A BRPI1015341B1 (en) 2009-04-23 2010-04-20 Recombinant human alpha-1 antitrypsin (rhaat) and method for producing recombinant human alpha-1 antitrypsin (rhaat)
EA201171275A EA025021B1 (en) 2009-04-23 2010-04-20 RECOMBINANT HUMAN α1-ANTITRYPSIN
CA2756591A CA2756591C (en) 2009-04-23 2010-04-20 Recombinant human alpha1-antitrypsin
JP2012506465A JP5711215B2 (en) 2009-04-23 2010-04-20 Recombinant human alpha 1-antitrypsin
IL215537A IL215537A (en) 2009-04-23 2011-10-04 Recombinant human alpha1-antitrypsin and method for its production
ZA2011/07416A ZA201107416B (en) 2009-04-23 2011-10-10 Recombinant human alpha1-antitrypsin

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US21449209P 2009-04-23 2009-04-23
EP09158640.4 2009-04-23
US61/214,492 2009-04-23
EP09158640 2009-04-23

Publications (1)

Publication Number Publication Date
WO2010127939A1 true WO2010127939A1 (en) 2010-11-11

Family

ID=40929544

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2010/055177 Ceased WO2010127939A1 (en) 2009-04-23 2010-04-20 Recombinant human alpha1-antitrypsin

Country Status (14)

Country Link
US (1) US8357661B2 (en)
EP (1) EP2421895B1 (en)
JP (1) JP5711215B2 (en)
KR (1) KR101640962B1 (en)
CN (1) CN102439037B (en)
AU (1) AU2010244592B2 (en)
CA (1) CA2756591C (en)
DK (1) DK2421895T3 (en)
EA (1) EA025021B1 (en)
ES (1) ES2559007T3 (en)
IL (1) IL215537A (en)
PL (1) PL2421895T3 (en)
WO (1) WO2010127939A1 (en)
ZA (1) ZA201107416B (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8357661B2 (en) 2009-04-23 2013-01-22 Crucell Holland B.V. Recombinant human Alpha1-antitrypsin
EP2690110A1 (en) 2012-07-25 2014-01-29 Grifols, S.A. Purification of cell culture derived alpha1 protease inhibitor
CN104302312A (en) * 2011-12-19 2015-01-21 Lfb美国股份有限公司 Recombinant human alpha-1-antitrypsin for the treatment of inflammatory disorders
US10034921B2 (en) 2013-02-13 2018-07-31 Laboratoire Français Du Fractionnement Et Des Biotechnologies Proteins with modified glycosylation and methods of production thereof
EP3382014A1 (en) * 2017-03-29 2018-10-03 CEVEC Pharmaceuticals GmbH Recombinant glycoproteins with reduced antennary fucosylation
US11624080B2 (en) 2017-11-28 2023-04-11 Danmarks Tekniske Universitet Glycosylation of proteins
US12247076B2 (en) 2015-07-06 2025-03-11 Laboratoire Français Du Fractionnement Et Des Biotechnologies Use of modified Fc fragments in immunotherapy

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102994514B (en) * 2012-11-07 2015-06-10 武汉禾元生物科技股份有限公司 Method for producing, separating and purifying recombinant human antitrypsin (OsrAAT) from rice seeds
EP3205719A1 (en) * 2016-02-15 2017-08-16 CEVEC Pharmaceuticals GmbH Cell lines for producing recombinant glycoproteins with di-antennary n-glycans, methods using the same, and recombinant glycoproteins
EP3600345A4 (en) 2017-03-29 2021-01-06 Cornell University OXIDIZATION RESISTANT AAT GENE THERAPY
EP3441471A1 (en) 2017-08-08 2019-02-13 CEVEC Pharmaceuticals GmbH Use of constitutively active variants of growth factor receptors as selection makers for the generation of stable producer cell lines
CN114651005A (en) * 2019-01-24 2022-06-21 艾克赛尔吉恩公司 Methods of producing and using recombinant alpha 1-antitrypsin (AAT) and compositions thereof
US20260015410A1 (en) * 2022-10-06 2026-01-15 Kamada Ltd. Highly fucosylated recombinant human alpha 1 antitrypsin (aat) protein having immunomodulatory activity and compositions comprising the same

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006070011A1 (en) * 2004-12-30 2006-07-06 Crucell Holland B.V. Methods to obtain recombinant proteins with increased sialylation from cells that express adenovirus e1a protein, and proteins obtained thereby
WO2009009086A2 (en) * 2007-07-12 2009-01-15 Sangamo Biosciences, Inc. Methods and compositions for inactivating alpha 1,6 fucosyltransferase (fut 8) gene expression

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100470180B1 (en) 1995-06-15 2005-02-04 크루셀 홀란드 비.브이. Packaging systems for human recombinant adenovirus to be used in gene therapy
US20050164386A1 (en) 1999-04-15 2005-07-28 Uytdehaag Alphonsus G. Overexpression of enzymes involved in post-translational protein modifications in human cells
CN100457914C (en) 1999-04-15 2009-02-04 荷兰克鲁塞尔公司 Production of Recombinant Proteins in Human Cells Using the Sequence Encoding the E1 Protein of Adenovirus
JP4480398B2 (en) * 2001-12-07 2010-06-16 クルセル ホランド ベー ヴェー Method for producing virus, virus isolate and vaccine
KR101183770B1 (en) 2003-05-09 2012-09-17 크루셀 홀란드 비.브이. Cultures of E1-immortalized cells and processes for culturing the same to increase product yields therefrom
CN101090973B (en) * 2004-12-30 2012-03-28 克鲁塞尔荷兰公司 Method for obtaining recombinant protein with increased sialylation from cells expressing adenovirus E1A protein and protein obtained thereby
WO2007102432A1 (en) * 2006-03-02 2007-09-13 Kyowa Hakko Kogyo Co., Ltd. Method for producing glycoprotein composition
WO2008069244A1 (en) * 2006-12-05 2008-06-12 Kyowa Hakko Kogyo Co., Ltd. Process for producing glycoprotein composition
DK2421895T3 (en) 2009-04-23 2016-01-25 Crucell Holland Bv Recombinant human alpha 1-antitrypsin

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006070011A1 (en) * 2004-12-30 2006-07-06 Crucell Holland B.V. Methods to obtain recombinant proteins with increased sialylation from cells that express adenovirus e1a protein, and proteins obtained thereby
WO2009009086A2 (en) * 2007-07-12 2009-01-15 Sangamo Biosciences, Inc. Methods and compositions for inactivating alpha 1,6 fucosyltransferase (fut 8) gene expression

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
CHANG G-D ET AL: "Improvement of glycosylation in insect cells with mammalian glycosyltransferases", JOURNAL OF BIOTECHNOLOGY, ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM, NL, vol. 102, no. 1, 10 April 2003 (2003-04-10), pages 61 - 71, XP002387943, ISSN: 0168-1656 *
GARVER R I JR ET AL: "Production of glycosylated physiologically "normal" human alpha 1-antitrypsin by mouse fibroblasts modified by insertion of a human alpha 1-antitrypsin cDNA using a retroviral vector.", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA FEB 1987, vol. 84, no. 4, February 1987 (1987-02-01), pages 1050 - 1054, XP002540833, ISSN: 0027-8424 *
KOLARICH DANIEL ET AL: "Biochemical, molecular characterization, and glycoproteomic analyses of alpha(1)-proteinase inhibitor products used for replacement therapy", TRANSFUSION, AMERICAN ASSOCIATION OF BLOOD BANKS, BETHESDA, MD, US, vol. 46, no. 11, 1 November 2006 (2006-11-01), pages 1959 - 1977, XP002448797, ISSN: 0041-1132 *
KOLARICH DANIEL ET AL: "Comprehensive glyco-proteomic analysis of human alpha(1)-antitrypsin and its charge isoforms", PROTEOMICS, WILEY - VCH VERLAG, WEINHEIM, DE, vol. 6, no. 11, 1 June 2006 (2006-06-01), pages 3369 - 3380, XP002502192, ISSN: 1615-9853 *

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8357661B2 (en) 2009-04-23 2013-01-22 Crucell Holland B.V. Recombinant human Alpha1-antitrypsin
CN104302312A (en) * 2011-12-19 2015-01-21 Lfb美国股份有限公司 Recombinant human alpha-1-antitrypsin for the treatment of inflammatory disorders
EP2690110A1 (en) 2012-07-25 2014-01-29 Grifols, S.A. Purification of cell culture derived alpha1 protease inhibitor
US10034921B2 (en) 2013-02-13 2018-07-31 Laboratoire Français Du Fractionnement Et Des Biotechnologies Proteins with modified glycosylation and methods of production thereof
US12247076B2 (en) 2015-07-06 2025-03-11 Laboratoire Français Du Fractionnement Et Des Biotechnologies Use of modified Fc fragments in immunotherapy
EP3382014A1 (en) * 2017-03-29 2018-10-03 CEVEC Pharmaceuticals GmbH Recombinant glycoproteins with reduced antennary fucosylation
WO2018177758A1 (en) * 2017-03-29 2018-10-04 Cevec Pharmaceuticals Gmbh Recombinant glycoproteins with reduced antennary fucosylation
AU2018246903B2 (en) * 2017-03-29 2021-01-28 Cevec Pharmaceuticals Gmbh Recombinant glycoproteins with reduced antennary fucosylation
US11193156B2 (en) 2017-03-29 2021-12-07 Cevec Pharmaceutical GmbH Recombinant glycoproteins with reduced antennary fucosylation
US11624080B2 (en) 2017-11-28 2023-04-11 Danmarks Tekniske Universitet Glycosylation of proteins

Also Published As

Publication number Publication date
ES2559007T3 (en) 2016-02-10
IL215537A0 (en) 2011-12-29
CA2756591C (en) 2018-11-06
EP2421895B1 (en) 2015-11-11
EA025021B1 (en) 2016-11-30
AU2010244592B2 (en) 2016-05-19
KR20120096871A (en) 2012-08-31
US20120214747A1 (en) 2012-08-23
ZA201107416B (en) 2017-11-29
CA2756591A1 (en) 2010-11-11
JP2012524747A (en) 2012-10-18
CN102439037B (en) 2015-01-07
DK2421895T3 (en) 2016-01-25
IL215537A (en) 2016-06-30
EA201171275A1 (en) 2012-03-30
EP2421895A1 (en) 2012-02-29
PL2421895T3 (en) 2016-04-29
CN102439037A (en) 2012-05-02
KR101640962B1 (en) 2016-07-19
AU2010244592A1 (en) 2011-10-27
JP5711215B2 (en) 2015-04-30
US8357661B2 (en) 2013-01-22

Similar Documents

Publication Publication Date Title
EP2421895B1 (en) Recombinant human alpha1-antitrypsin
TWI835772B (en) Il-22 fc fusion proteins and methods of use
EP2257311B1 (en) Conjugated factor viii molecules
JP5685363B2 (en) Glycosylated IL-7, preparation and use
JP4177453B2 (en) Chimeric proteins and variants of tissue factor activity inhibitors TFPI and TFPI-2
EP2150561B1 (en) Demannosylated recombinant factor VIII for the treatment of patients with haemophilia A
KR101402702B1 (en) New alpha-1 antitrypsin variant, method for producing the same and use thereof
Kido et al. Cellular proteases involved in the pathogenicity of enveloped animal viruses, human immunodeficiency virus, influenza virus A and Sendai virus
AU2012323992A1 (en) Recombinant human alpha-1-antitrypsin for the treatment of inflammatory disorders
BRPI1015341B1 (en) Recombinant human alpha-1 antitrypsin (rhaat) and method for producing recombinant human alpha-1 antitrypsin (rhaat)
CA3163525A1 (en) Pharmaceutical preparation
JPH11502705A (en) Gene expression in mammalian cells
US20250250325A1 (en) Methods of Manufacturing Alpha-1 Antitrypsin Compositions For Treatment of Disease Disorders
JP3085704B2 (en) Expression of HIV protein in Drosophila cells
HK40035983A (en) Il-22 fc fusion proteins and methods of use
AU2013204960B2 (en) Conjugated factor VII molecules
US20040235715A1 (en) Method of producing glycosylated bikunin

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080017593.2

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10716318

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2756591

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 215537

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2010716318

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012506465

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2010244592

Country of ref document: AU

Date of ref document: 20100420

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 8575/CHENP/2011

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 20117027863

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201171275

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 13138912

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: PI1015341

Country of ref document: BR

ENP Entry into the national phase

Ref document number: PI1015341

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20111021