WO2010116055A1 - Additif pour la cristallisation de protéines, utilisation et procédé - Google Patents

Additif pour la cristallisation de protéines, utilisation et procédé Download PDF

Info

Publication number
WO2010116055A1
WO2010116055A1 PCT/FR2010/000285 FR2010000285W WO2010116055A1 WO 2010116055 A1 WO2010116055 A1 WO 2010116055A1 FR 2010000285 W FR2010000285 W FR 2010000285W WO 2010116055 A1 WO2010116055 A1 WO 2010116055A1
Authority
WO
WIPO (PCT)
Prior art keywords
group
protein
polar
positively charged
integer
Prior art date
Application number
PCT/FR2010/000285
Other languages
English (en)
Inventor
Pierre Guy Falson
Anthony William Coleman
Rima Matar Merheb
Antoine Leydier
Frédéric HUCHÉ
Original Assignee
Centre National De La Recherche Scientifique - Cnrs
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centre National De La Recherche Scientifique - Cnrs filed Critical Centre National De La Recherche Scientifique - Cnrs
Priority to US13/263,032 priority Critical patent/US9180386B2/en
Priority to EP10714909.8A priority patent/EP2416859B9/fr
Publication of WO2010116055A1 publication Critical patent/WO2010116055A1/fr

Links

Classifications

    • B—PERFORMING OPERATIONS; TRANSPORTING
    • B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01D—SEPARATION
    • B01D9/00—Crystallisation
    • C—CHEMISTRY; METALLURGY
    • C30—CRYSTAL GROWTH
    • C30B—SINGLE-CRYSTAL GROWTH; UNIDIRECTIONAL SOLIDIFICATION OF EUTECTIC MATERIAL OR UNIDIRECTIONAL DEMIXING OF EUTECTOID MATERIAL; REFINING BY ZONE-MELTING OF MATERIAL; PRODUCTION OF A HOMOGENEOUS POLYCRYSTALLINE MATERIAL WITH DEFINED STRUCTURE; SINGLE CRYSTALS OR HOMOGENEOUS POLYCRYSTALLINE MATERIAL WITH DEFINED STRUCTURE; AFTER-TREATMENT OF SINGLE CRYSTALS OR A HOMOGENEOUS POLYCRYSTALLINE MATERIAL WITH DEFINED STRUCTURE; APPARATUS THEREFOR
    • C30B29/00—Single crystals or homogeneous polycrystalline material with defined structure characterised by the material or by their shape
    • C30B29/54—Organic compounds
    • C30B29/58—Macromolecular compounds
    • C—CHEMISTRY; METALLURGY
    • C30—CRYSTAL GROWTH
    • C30B—SINGLE-CRYSTAL GROWTH; UNIDIRECTIONAL SOLIDIFICATION OF EUTECTIC MATERIAL OR UNIDIRECTIONAL DEMIXING OF EUTECTOID MATERIAL; REFINING BY ZONE-MELTING OF MATERIAL; PRODUCTION OF A HOMOGENEOUS POLYCRYSTALLINE MATERIAL WITH DEFINED STRUCTURE; SINGLE CRYSTALS OR HOMOGENEOUS POLYCRYSTALLINE MATERIAL WITH DEFINED STRUCTURE; AFTER-TREATMENT OF SINGLE CRYSTALS OR A HOMOGENEOUS POLYCRYSTALLINE MATERIAL WITH DEFINED STRUCTURE; APPARATUS THEREFOR
    • C30B7/00—Single-crystal growth from solutions using solvents which are liquid at normal temperature, e.g. aqueous solutions
    • C30B7/14—Single-crystal growth from solutions using solvents which are liquid at normal temperature, e.g. aqueous solutions the crystallising materials being formed by chemical reactions in the solution

Definitions

  • the present invention relates to the use and to a process involving at least one calix [n] arenic derivative substituted by at least one acid function on the upper face and at least one aliphatic chain of variable length on the other as a crystallization additive of a polar and / or positively charged molecule.
  • the present invention is for example in the production and marketing of crystallization kit.
  • references in brackets ([]) refer to the list of references at the end of the text.
  • X-ray diffraction is the most widely used method for determining the spatial structure of proteins at the atomic scale, with up to today more than 47,500 structures solved out of a total of 55,000 (source Protein Data Bank: www.rcsb .org / bp / statisitcs).
  • This method requires obtaining the protein in a crystalline state, a relatively easy step to overcome for soluble proteins but particularly difficult for membrane proteins (Caffrey M. (2003) Membrane Protein Crystallization J Struct Biol 142, 108-32 [1]).
  • the difficulty in crystallizing membrane proteins stems mainly from two problems specific to this type of protein.
  • a first problem is the difficulty of obtaining a population of membrane proteins extracted and stabilized in solution with structurally homogeneous detergents.
  • the use of detergent is necessary on the one hand to extract these proteins from their membrane environment (Garavito RM and Ferguson-Miller S. (2001) Detergents as Tools in Membrane Biochemistry J Biol Chem 276, 32403-6 [2]) and on the other hand to keep them in solution for several weeks.
  • these detergents do not have the same physicochemical characteristics as lipids and therefore tend to destabilize the structure of the membrane domains, which is a source of structural heterogeneity.
  • the present invention precisely addresses all of the above-mentioned technical problems and disadvantages of the prior art by using at least one calix [n] arenic derivative substituted with at least one acid function on the upper face and at least one an aliphatic chain of variable length on the other side, as a crystallization additive of a polar molecule and / or positively charged, and providing a method involving this calix [n] arenic derivative.
  • the present invention relates in particular to the use of at least one calix [n] arenic derivative, n being an integer ranging from 4 to 12, substituted at least by an acid function on one side and at least one aliphatic chain on one side. other side, as a crystallization additive of a polar molecule and / or positively charged.
  • Crystallization is understood to mean a physical operation consisting in isolating a product in solution, by passing from a gaseous or solid liquid disordered state to a solid ordered state.
  • Protein crystallization is understood to mean a method that promotes the ordered stacking in the 3 dimensions of the space of a homogeneous population of protein polymers having a common conformation, and leading to the formation of a crystal. Proteins are distinguished from minerals in that they are infinitely more complex, polyatomic polymers, composed of carbon, hydrogen, oxygen, nitrogen and possibly sulfur.
  • calixarene means a cyclic macromolecule forming a hydrophobic cavity.
  • calix [n] arenic derivative means a calixarene composed of n arenic rings.
  • acid function is meant a hydrogen ion donor function.
  • the acid function can be an acid group carboxylic acid (-COOH), a - (CH2) y-COOH group where y is an integer from 1 to 12 or a benzoic acid (-C 6 H 4 -COOH).
  • aliphatic chain means a carbon chain, linear or branched, cyclic or acyclic, saturated or unsaturated.
  • the aliphatic chain may be linear, for example a group - ⁇ C m H2 m + i) where m is an integer ranging from 1 to 12, for example a methyl, ethyl, propyl, butyl, pentyl or hexyl group. , heptyl, octyl, nonyl, decyl, undecyl, dodecyl, tetradecyl, hexadecyl or octadecyl.
  • the aliphatic chain may also be branched, for example it may be methylpropane, 2-methylbutane, 2,2-methylpropane, 2-methylpentane, 3-methylpentane, 2,2-dimethylbutane, 2,3-dimethylbutane, 2- methylhexane, 3-methylhexane, 3-ethylpentane, 2,2-dimethylpentane, 2,3-dimethylpentane, 2,4-dimethylpentane, 2,2,3-trimethylbutane, 2-methylheptane, 3-methylheptane, 4-methylheptane, 3- ethylhexane, 2,2-dimethylhexane, 3,3-dimethylhexane or 2,3-dimethylhexane.
  • the aliphatic chain may also be unsaturated, for example it may be a propene, pentene, hexene, heptene, octene, nonene, decene, undecene, dodecene.tetradene, hexadecene or octadecene group having one or more unsaturation, regardless of cis or trans.
  • additive means a compound introduced into a solution or a mixture and providing a specific property.
  • polar molecule means a molecule whose barycenters of positive and negative charge do not converge.
  • the polar molecule may be a protein, for example a soluble protein or a membrane protein.
  • the polar molecule may be an entire protein or corresponding to fragments or domains thereof.
  • positively charged molecule means a molecule having at least one positive charge in solution.
  • the positively charged molecule may be a protein, for example a soluble protein or a membrane protein.
  • the molecule positively charged may be an entire protein or corresponding to fragments or domains thereof.
  • the at least one calix [n] arenic derivative may, for example, satisfy the following formula (I):
  • R 1 , R 2 , R 3 and R 4 represent, independently of one another, a hydrogen or one of the aforementioned aliphatic chains, for example a linear group - (C m H2m + i), or branched, wherein m is an integer from 1 to 12 or 16 or 18;
  • X 1 , X 2 , X 3 and X 4 represent, independently of each other, a hydrogen atom or one of the abovementioned acid functional groups, for example a carboxylic group or a - (CHbVCOOH) group; wherein y is an integer from 1 to 12.
  • the at least one calix [n] arenic derivative may correspond to formula (I) in which: "p is an integer equal to 1
  • a radical from R 1 , R 2 , R 3 and R 4 represents a linear or branched group - (C m H2m + i) in which m is an integer between 1 to 12 inclusive or equal to 16 or 18; radicals among R 1 , R 2 , R 3 and R 4 represent a hydrogen atom
  • a radical from X 1 , X 2 , X 3 and X 4 represents a hydrogen atom; "three of X 1 , X 2 , X 3 or X 4 are carboxylic or - (CH 2 ) yCOOH wherein y is an integer from 1 to 12;
  • the group - (C m H 2m + i) may, for example, be selected from the group consisting of methyl, ethyl, propyl, butyl, pentyl, hexyl, heptyl, octyl, nonyl, decyl, undecyl and dodecyl.
  • the polar and / or positively charged molecule may be selected from the group consisting of proteins, peptides, protein complexes, protein domains, glycoproteins, phosphoglycoproteins.
  • Protein is understood to mean a linear polymer of amino acids bound by a covalent peptide bond.
  • Peptide is understood to mean a linear amino acid polymer covalently bound by a peptide bond of 2 to 100 amino acids.
  • protein complexes means a homo- or hetero-oligomeric assembly of proteins of a soluble or membrane nature.
  • protein domain is meant a spatially folded and functional protein element of a protein.
  • the polar and / or positively charged molecule may, for example, be a membrane protein or an entire soluble protein or fragments or domains thereof. Fragments or domains of proteins may, for example, be produced by enzymatic digestion or by molecular biology, for example by genetic recombination.
  • protein fragment means a peptide element that is not necessarily folded in space and functional of a protein.
  • soluble protein is understood to mean a miscible protein in aqueous solution, in an aqueous physiological medium and free of diffusion.
  • membrane protein means a protein associated with biological membranes either anchored or integral, and not free of diffusion in aqueous media and unstable in these media. Membrane proteins are often classified according to the structures that allow them to interact with membranes and how these structures work together. Membrane proteins can be polytopic proteins or monotopic proteins.
  • polytopic proteins means proteins that pass through the membrane one or more times.
  • Monotopic proteins are proteins that interact with only one side of the membrane.
  • Membrane proteins can also be classified according to their difficulty in being extracted from membranes. They can be integral or peripheral.
  • integral proteins is understood to mean monotopic or polytopic proteins that interact strongly with the membrane, in particular by hydrophobic interactions. These proteins are also called “intrinsic proteins”. Peripheral proteins are understood to mean monotopic proteins which interact weakly with the membrane, that is to say either by electrostatic bonds or by means of other membrane proteins. These proteins are also called “extrinsic proteins”.
  • the membrane protein may be selected from the group consisting of G protein receptors, channels, symporters, anti-carriers, electron carriers, protons, anion pumps, cation pumps, metal pumps, peptide pumps, BmrA type effiux pumps.
  • the polar and / or positively charged molecule may also be one of the different versions of primary structures modified and / or generated by molecular biology, for example H 6 BmrA.
  • the membrane protein is previously extracted from the membrane by conventional extraction techniques for the skilled person.
  • the polar and / or positively charged molecule may be, for example, any natural or native protein, whether or not it undergoes post-translational modifications, of any species or any artificial protein.
  • natural protein is meant a protein produced by an organism or a cell whose DNA has been modified by genetic recombination.
  • native protein means a protein in the functional state and structurally correctly folded.
  • post-translational modifications is understood to mean modifications made to a protein after synthesis: glycosylation, famesylation, phosphorylation, GPI anchor, acylations, proteolysis, and addressing.
  • the protein may be a recombinant protein.
  • "Recombinant protein” is understood to mean a protein produced by an organism or a cell in which a sequence coding for the protein has been introduced so as to make said protein express by this organism or this cell.
  • the protein species defined above can be produced in an organism of natural origin, in a host organism or in a recombinant acellular system, by chemical or hemichemical synthesis.
  • the present invention also relates to a method of crystallization of a polar molecule and / or positively charged comprising a contacting step: at. an aqueous solution comprising a molecule to be crystallized and b. at least one calixfn] arenic derivative, where n is 4, substituted at least by an acid function on one side and at least one aliphatic chain on the other side.
  • the calix [n] arenic derivatives, the polar molecule, the aliphatic chain, the polar molecule and / or positively charged are defined above.
  • the polar and / or positively charged molecule is first purified, for example by chromatography.
  • the method of the present invention may, for example, comprise a preliminary step of extraction of these membrane proteins.
  • This step may be a conventional extraction for the skilled person. It may include the use of conventional detergents.
  • the contacting of the process of the present invention may, for example, be carried out at a pH of between 5.0 and 14.0, for example between 6 and 9, as the preferred, narrower range, for example between 6.5 and
  • the contacting of the process of the present invention may, for example, be carried out at a temperature of between -40 ° C. and 80 ° C., for example between 4 ° C. and 40 ° C., for example between 15 ° C. and 30 ° C. 0 C, for example at a temperature of 20 ° C.
  • the contacting of the process of the present invention may, for example, be carried out at a calixarene concentration of between 1 nM and 100 mM, for example between 0.1 mM and 10 mM, for example between 1 and 10 mM, for example at a concentration of 1 mM.
  • the present invention makes it possible to promote, that is to say, enable, facilitate and / or accelerate the crystallization of polar and / or positively charged molecules, in particular membrane proteins in particular. solution or soluble, hitherto very difficult to crystallize. Crystallization in particular is improved thanks to the formation of a state of aggregation organized polar molecules and / or positively charged in space, leading to the formation of crystals.
  • the present invention advantageously allows the calix [n] arenic derivatives to be organized so as to generate supramolecular clusters exposing on their surface the acid functions, maintained by the hydrophobic region of the aliphatic chains, for example, as illustrated in FIG. Figure 1B.
  • siramolecular cluster of calix [n] arenic derivatives means an organization of several calix [n] arenic derivatives of micellar type. These supramolecular clusters are intercalated between the membrane proteins via ionic interactions, for example, as illustrated in FIG. 1C. These interactions make it possible to reinforce the cohesion of the building and facilitate its crystalline organization, for example, as illustrated in FIG. 1D. These interactions apply with the same efficiency to all polar and / or positively charged molecules.
  • the use and process of the present invention may, for example, involve several of the calix [n] arene derivatives defined above.
  • the speed of crystallization of the protein is all the more rapid as the size of the aliphatic chain of the calix [n] arene used is short (figures
  • FIG. 1B represents examples of supramolecular organization of these molecules in supramolecular clusters (defined by the letter "a") exposing the charged functions (small dash in a circle) to the surface with a cohesion maintained by the hydrophobic groups (small sticks) clustered within the cluster.
  • FIG. 1C represents a model for the insertion of supramolecular clusters, defined by the letter “a”, between membrane proteins, defined by the letter “b”, whose hydrophobic regions are surrounded by a detergent crown, defined by the letter “c”.
  • FIG. 1D represents a crystalline stacking model of cluster-proteins for which the letter "a” represents supramolecular clusters, the letter “b” represents membrane proteins and the letter “c” represents detergent crowns.
  • FIG. 2 represents a chromatography of H ⁇ SmrA, after S200 gel filtration, the protein is deposited on SDSPAGE 10% gel and colored with Coomassie blue.
  • the band defined by "H 6 BmrA, dim” corresponds to the H 6 BmrA protein in the form of a dimer and the band defined by "H 6 BmrA, mono” corresponds to the H 6 BmrA protein in monomeric form.
  • FIG. 3 represents crystallization tests of H ⁇ mrA in the absence or in the presence of p (HOOC) 3Ar4 oX. The concentrations used are such that they correspond to ⁇ ⁇ x, 1x and 2x the critical micellar concentration of each of the compounds, these having a surfactant behavior.
  • FIGS. 3A to 3E show drops “dr” and details of these drops "From”:
  • FIG. 4A represents crystallization tests of H ⁇ mrA in the absence or in the presence of p (HOOC) 3Ar4 oX.
  • concentrations used are such that they correspond to 4x, 1x and 2x the critical micelle concentration of each of the compounds, these having a surfactant behavior.
  • the left panel at the top corresponds to the drop deposited in the absence of calixarenic derivative.
  • FIG. 6A a chromatography of H 6 Bm rA, extracted either without detergent (-), or with a nondenaturing detergent dodecyl maltoside type (DDM), or a denaturing detergent sodium dodecyl sulfate (SDS), or a calixarenic derivative p (HOOC) 3 Ar 4 o ((CH 2 ) 6 CH 3 ) (C 4 C 7).
  • DDM nondenaturing detergent dodecyl maltoside type
  • SDS denaturing detergent sodium dodecyl sulfate
  • the suspension is centrifuged and the supernatant (S) and the pellet (C) are deposited on 10% SDSPAGE gel and stained with Coomassie blue. The supernatant is then dialyzed in the presence of lipids to both eliminate the detergent and allow the protein to find a lipid environment, essential
  • FIG. 6B shows a membrane protein model hydrolyzing ATP to ADP in the presence of magnesium (Mg), where the letter “b” represents a membrane protein and the letter “d” represents a cell membrane.
  • Mg magnesium
  • FIG. 6C represents the specific activity (AS) of H ⁇ nrirA in ⁇ mol Pi / min / mg prot, when this is extracted with either dodecyl maltoside (DDM) or sodium docecyl sulphate (SDS), or calixarenic derivative P (HOOC) 3 ⁇ O o ((CH 2 ) 6 CH 3 ) (C 4 C 7).
  • FIG. 7 represents: A.: a crystal of H ⁇ SmrA obtained in the presence of 1 mM P (HOOC) 3 A ⁇ o ((CH 2 ) 2 CH 3 ). B.
  • FIG. 8A represents diffraction spots obtained from a crystal of H ⁇ BmrA obtained in the presence of 1 mM p (HOOC) 3 Ar 4 o ((CH 2 ) 2 CH 3 ).
  • FIG. 8B represents a crystal of H ⁇ mrA obtained in the presence of 1 mM p (HOOC) 3 Ar 4 o ((CH 2 ) 2 CH 3 ).
  • the medium 2TY comes from the company Bio101 (1070 Joshua Way Vista CA92083 USA)
  • BmrA is a "1/2" ABC transporter (ATP-Binding Cassette) of Bacillus subtilis. It belongs to the family of ABC transporters of multiple resistance to chemotherapeutic agents (Chami M., Steinfels E., Orelle C, Jault JM, Di Pietro A., Rigaud JL and Marco S. (2002) Three- dimensional structure by cryo- electron microscopy of YvcC, an homodimeric ATP-binding cassette transporter from Bacillus subtilis.
  • PCR Polymerase Chain Reaction
  • a preculture of 200 ml of 2TY medium 1 100 ⁇ g / ml of ampicillin is carried out with a strain of Escherichia coli BI21-DE3, freshly transformed with the plasmid pET15B-His 6 -BmrA.
  • the bacteria are sedimented by centrifugation at 7500 g for 10 minutes in a Beckman J2-21 centrifuge to form a pellet. The supernatant was removed, and the bacteria were suspended in 50 mM Tris-HCl (tris (hydroxymethyl) -aminomethane hydrochloride) pH 8.0 0.5 mM MgCl 2 , 1 mM dithiothreitol (DTT), antiprotease cocktail ( Roche, 1 pellet / 50 ml).
  • Tris-HCl tris (hydroxymethyl) -aminomethane hydrochloride
  • Protein concentration is determined by colorimetric titration with BCA reagent (Smith PK, Krohn IR, Hermanson GT, Mallia AK, Gartner FH, Provenzano MD, Fujimoto EK, Goeke NM, Oison BJ and Klenk DC (1985) Measurement of protein using bicinchoninic Anal Biochem 150, 76-85 [16]). Aliquots of 0.5 mL (equivalent to 1 liter of culture) are frozen and stored in liquid nitrogen until use. His ⁇ -BmrA represents approximately 10% of the total proteins and 50% of the membrane proteins.
  • a membrane aliquot is rapidly thawed and diluted to 2 mg / ml protein in 20 mM Tris-HCl pH 8.0, 20 mM NaCl, 0.02 mM EDTA, 0.1 mM DTT, antiprotease cocktail (Roche, 1 tablet per 100 mL).
  • His ⁇ -BmrA is extracted with 10 mg / ml of Foscholine 12 (Anatrace, FC12) for 2 hours at 8 ° C and under slow rotation. H ⁇ BmrA is then separated by centrifugation for 1 hour at 100,000 g and 283 K.
  • the supernatant is passed through a column of 5 ml of anion exchange, Q-sepharose highflow (GE Healthcare), previously cleaned with 2 column volumes (CV) with buffer QB (20 mM Tris-HCl pH 8.0, 1 M NaCl , 5 mg / mL FC12, antiprotease cocktail: 1 pellet / 100 ml), then equilibrated with 5 CV of buffer QA (buffer Q B without salt).
  • buffer QB 20 mM Tris-HCl pH 8.0, 1 M NaCl , 5 mg / mL FC12, antiprotease cocktail: 1 pellet / 100 ml
  • the solubilisate is loaded at 5 ml / min, then the resin is washed with 10 CV of Q Buffer.
  • the elution is carried out with a linear gradient (QA - QB) of NaCl (0 - 1 M) of 6 HP.
  • the fraction containing H 6 BmrA is deposited at 5 ml / minute on a 5 ml column of affinity-metal of the Nickel-nitriloacetic acid-agarose high trap chelating hp type (GE Healthcare).
  • the resin is pre-equilibrated with 3 CV of Ni A buffer (20 mM Tris-HCl pH 8.0, 0.2 M NaCl, 10 mM imidazole, 5 mg / mL FC12, antiprotease cocktail: 1 pellet / 100 mL) .
  • the resin is washed with 10 CV of NIA buffer and the protein is then eluted with a linear gradient of imidazole (10-250 mM).
  • the fractions containing H ⁇ BmrA are combined and concentrated by ultrafiltration on Amicon membrane, Ultra4 50,000 (Millipore Corporate Headquarters, 290 Concord Road, Billerica, MA 01821, USA) to a volume of 1 mL.
  • the solution is deposited on a molecular sieve resin
  • the fractions containing H ⁇ BmrA are combined and concentrated by ultrafiltration on Amicon membrane, Ultra4 50,000 to a concentration of 11-12 mg / ml.
  • the quality of the purification is monitored at each step by electrophoresis (FIG. 2) of the SDS-PAGE type with a 10% acrylamide gel (Laemmli UK (1970) Cleavage of structural proteins during the assembly of the bacteriophage T4. , 680-5 [17]), by preparing the protein samples as described in (Lenoir G., Menguy T., Corre F., Montigny C, Pedersen PA, Thinippo D., Mayor M. and Falson P. (2002). ) Overproduction in yeast and rapid efficient purification of the rabbit SERCAIA Ca 2+ -ATPaSe. Biochim Biophys Acta 1560, 67-83 [18]).
  • Example 2 Crystallization of H 6 BmrA Crystallization tests of H 6 BiDrA are carried out from the concentrated protein solution in its filter gel buffer. The solution is supplemented with 5 mM ATP, 5 mM MgCb, 2 mM sodium orthovanadate. The final protein concentration is 10 mg / mL. The tests are carried out in droplets suspended in a Linbro type 24-well crystallization plate (Hampton Research, 34 Journey, Aliso Viejo, CA 92656-3317).
  • Each drop is made by adding respectively 2 .mu.l of the protein-solute mixture described above, 0.4 .mu.l of the calix [4] arene prepared beforehand at a concentration 10X and neutralized at pH 8.0, and 1.6 .mu.l of a solution 0.2M LiNO 3 /22% PEG 2000 MS.
  • the reservoir of each well is filled with 500 ⁇ l of this solution.
  • the plates are then stored at 18 ° C.
  • the drops are photographed with a SV11 magnifier (Zeiss) and a 1, 4 Mp CCD acquisition system, and analyzed with the Zeiss vision image software.
  • the crystals are removed, washed in the reservoir solution and mounted on cryo loop (Hampton res.), Then frozen and stored in liquid nitrogen.
  • the crystals are analyzed at the ESRF, on the microfocus line ID23-2 and the diffraction patterns generated by an ADSC Quantum 315R CCD detector.
  • Example 6 Functional reconstitution of H 6 BmrA after treatment with p (HOOC) 3 Ar 4 O ((CH 2 ) 6 CH 3 ) ("C 4 C 7")
  • the calixarene derivatives used in the present invention are not deleterious for the enzymatic activity of the protein H 6 Bm rA. This is illustrated with the derivative p (HOOC) 3 Ar 4 o ((CH 2 ) 6 CH 3 ), which has a surfactant activity and allows the extraction of the protein.
  • the protein retains its activity after the extraction / reconstitution phase, as with a mild dodecyl maltoside detergent (DDM).
  • DDM dodecyl maltoside detergent
  • SDS sodium dodecyl sulphate
  • EXAMPLE 7 Synchrotron Test of the European Synchrotron Radiation Facility (ESRF) of the crystal of H 6 BmrA in the presence of p (HOOC) 3Ar 4 o ((CH 2 ) 2 CH 3 )
  • FIG. 8 shows a diffraction pattern of the H 6 BmrA crystal obtained.
  • Example 8 Example of a crystallization kit
  • a crystallization kit comprising a solution comprising at least one calixarenic derivative defined above.
  • This kit may further comprise a user manual, a suitable washing buffer, or any other suitable solution or device or a combination of these elements.
  • the present invention thus forms a remarkable tool, especially for the structural determination at the atomic scale of these molecules.
  • MRP1 recent advances in the discovery of reversal agents. Med Res Rev 25, 453-72.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Materials Engineering (AREA)
  • Metallurgy (AREA)
  • Organic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Peptides Or Proteins (AREA)

Abstract

La présente invention se rapporte à l'utilisation et à un procédé faisant intervenir au moins un dérivé calix[n]arènique substitué par au moins une fonction acide sur la face supérieure et au moins une chaîne aliphatique de longueur variable sur l'autre face, en tant qu'additif de cristallisation d'une molécule polaire et/ou chargée positivement. L'utilisation et le procédé de la présente invention présentent l'avantage de permettre, faciliter et/ou accélérer la cristallisation de molécules polaires et/ou chargées positivement, notamment de protéines membranaires en solution ou solubles, jusque-là très difficilement.

Description

ADDITIF POUR LA CRISTALLISATION DE PROTÉINES, UTILISATION
ET PROCÉDÉ
Domaine technique La présente invention se rapporte à l'utilisation et à un procédé faisant intervenir au moins un dérivé calix[n]arènique substitué par au moins une fonction acide sur la face supérieure et au moins une chaîne aliphatique de longueur variable sur l'autre face, en tant qu'additif de cristallisation d'une molécule polaire et/ou chargée positivement. La présente invention s'inscrit par exemple dans la production et la commercialisation de kit de cristallisation.
Dans la description ci-dessous, les références entre crochets ([ ]) renvoient à la liste des références présentée à la fin du texte.
Etat de la technique
La diffraction des rayons X est la méthode la plus utilisée pour déterminer la structure spatiale des protéines à l'échelle atomique, avec jusqu'à aujourd'hui plus de 47500 structures résolues sur un total de 55000 (source Protein Data Bank : www.rcsb.org/pdb/statisitcs). Cette méthode nécessite d'obtenir la protéine dans un état cristallin, une étape incontournable relativement aisée à franchir pour les protéines solubles mais particulièrement difficile pour les protéines membranaires (Caffrey M. (2003) Membrane protein crystallization. J Struct Biol 142, 108- 32 [1]). De fait, il y a plus de 15000 structures non redondantes de protéines solubles et seulement moins de 200 structures non redondantes de protéines membranaires.
La difficulté à cristalliser des protéines membranaires provient principalement de deux problèmes propres à ce type de protéines.
Un premier problème est la difficulté d'obtenir une population de protéines membranaires extraites et stabilisées en solution avec des détergents structuralement homogènes. L'utilisation de détergent est nécessaire d'une part pour extraire ces protéines de leur environnement membranaire (Garavito R. M. and Ferguson-Miller S. (2001) Détergents as Tools in Membrane Biochemistry. J Biol Chem 276, 32403-6 [2]), et d'autre part pour les maintenir en solution plusieurs semaines. Cependant, ces détergents ne présentent pas les mêmes caractéristiques physico-chimiques que les lipides et donc tendent à déstabiliser la structure des domaines membranaires, ce qui est une source d'hétérogénéité structurale.
Un autre problème est que la formation de contacts protéine- protéine, nécessaires à la cristallisation de celle-ci, est nettement défavorisée dans le cas des protéines membranaires (Nollert P. (2005) Membrane protein crystallization in amphiphile phases: practical and theoretical considérations. Prog Biophys Mol Biol 88, 339-57 [3]).
Les détergents sont encore une fois en cause, car pour maintenir en solution la protéine membranaire extraite des membranes ils masquent la région lipophile de celle-ci. Cela conduit à former une couronne autour du domaine membranaire dont la taille est suffisamment grande pour empêcher les régions hydrophiles de créer les contacts protéine-protéine nécessaires à la formation et la stabilisation des cristaux. L'intérêt pour les protéines membranaires est particulièrement grand. Elles représentent environ 30% du protéome, tous organismes confondus, et sont donc largement sous représentées dans la Protein Data Bank. Plus important encore, elles représentent chez l'homme 70% des cibles thérapeutiques (Lundstrom K. (2004) Structural genomics on membrane proteins: the MePNet approach. Curτ Opin Drug Discov Devel 7, 342-6 [4]), en particulier la famille des transporteurs ABC de résistance multiples aux agents chimiothérapeutiques (Dean M., Hamon Y. and Chimini G. (2001) The human ATP-binding cassette (ABC) transporter superfamily. J Lipid Res 42, 1007-17 [5] ; Efferth T. (2003) Adenosine triphosphate-binding cassette transporter gènes in ageing and age-related diseases. Ageing Res Rev 2, 11-24 [6] ; Kim R. B. (2003) Drug transporters in HIV Therapy. Top HIV Med 11 , 136-9 [7] ; Rajagopal A. and Simon S. M. (2003) Subcellular localization and activity of multidrug résistance proteins. Mol Biol CeII 14, 3389-99 [8] ; Boumendjel A., Baubichon-Cortay H., Trompier D., Perrotton T. and Di Pietro A. (2005) Anticancer multidrug résistance mediated by MRP1: récent advances in the discovery of reversai agents. Med Res Rev 25, 453-72 [9] ; Frelet A. and Klein M. (2006) Insight in eukaryotic ABC transporter function by mutation analysis. FEBS Lett 580, 1064-84 [10] ; Shirasaka Y., Onishi Y., Sakurai A., Nakagawa H., Ishikawa T. and Yamashita S. (2006) Evaluation of Human P-Glycoprotein (MDR1/ABCB1) ATPase Activity Assay Method by Comparing with in Vitro Transport Measurements: Michaelis-Menten Kinetic Analysis to Estimate the Affinity of P-Glycoprotein to Drugs. Biol Pharm Bull 29, 2465-71 [11] ; Szakacs G., Paterson J. K., Ludwig J. A., Booth-Genthe C. and Gottesman M. M. (2006) Targeting multidrug résistance in cancer. Nat Rev Drug Discov 5, 219-34 [12] ; Enokizono J., Kusuhara H., Ose A., Schinkel A. H. and Sugiyama Y. (2008) Quantitative Investigation of the RoIe of Breast Cancer Résistance Protein (Bcrp/Abcg2) in Limiting Brain and Testis Pénétration of Xenobiotic Compounds. Drug Metab Dispos, dmd.107.019257 [13]).
Sur le plan pratique, il est établi que des petites molécules permettent d'améliorer la probabilité de cristallisation des protéines (McPherson A. and Cudney B. (2006) Searching for silver bullets: an alternative strategy for crystallizing macromolecules. J Struct Biol 156, 387- 406 [14]). Plusieurs kits d'additifs, tels que des kits à base de détergent, sont commercialisés depuis ces dernières années, notamment par Hampton Research (nom commercial), ou Jena Biosciences (nom commercial). Ils sont visiblement d'une efficacité limitée car le nombre de protéines membranaires cristallisées n'a sensiblement pas augmenté depuis leur commercialisation.
Il existe donc un réel besoin de mettre au point des additifs promouvant la cristallisation de molécules polaires et/ou chargées positivement, notamment des protéines membranaires, palliant les défauts, inconvénients et obstacles de l'art antérieur. Il est en outre nécessaire de mettre au point un procédé efficace de cristallisation de molécules polaires et/ou chargées positivement, notamment des protéines membranaires.
Exposé de l'invention La présente invention répond précisément à l'ensemble des problèmes techniques et inconvénients précités de l'art antérieur en utilisant au moins un dérivé calix[n]arènique substitué par au moins une fonction acide sur la face supérieure et au moins une chaîne aliphatique de longueur variable sur l'autre face, en tant qu'additif de cristallisation d'une molécule polaire et/ou chargée positivement, et en fournissant un procédé faisant intervenir ce dérivé calix[n]arènique.
La présente invention est notamment relative à l'utilisation d'au moins un dérivé calix[n]arènique, n étant un entier allant de 4 à 12, substitué au moins par une fonction acide sur une face et au moins une chaîne aliphatique sur l'autre face, en tant qu'additif de cristallisation d'une molécule polaire et/ou chargée positivement.
On entend par « cristallisation » une opération physique consistant à isoler un produit en solution, par un passage d'un état désordonné liquide gazeux ou solide à un état ordonné solide. On entend par « cristallisation des protéines » une méthode favorisant l'empilement ordonné dans les 3 dimensions de l'espace d'une population homogène de polymères protéiques présentant une conformation commune, et conduisant à la formation d'un cristal. Les protéines se distinguent des minéraux en ce sens qu'elles sont des polymères infiniment plus complexes, polyatomiques, composés à la fois de carbone, hydrogène, oxygène, azote et éventuellement de soufre.
On entend par « calixarène » une macromolécule cyclique formant une cavité hydrophobe.
On entend par « dérivé calix[n]arènique » un calixarène composé de n cycles arèniques.
On entend par « fonction acide » une fonction donneuse d'ion hydrogène. Par exemple, la fonction acide peut être un groupe acide carboxylique (-COOH), un groupe -(CH2)y-COOH où y est un nombre entier allant de 1 à 12 ou un acide benzoïque (-C6H4-COOH).
On entend par « chaîne aliphatique » une chaîne carbonée, linéaire ou ramifiée, cyclique ou acyclique, saturée ou insaturée. Par exemple, la chaîne aliphatique peut être linéaire, par exemple un groupe -<CmH2m+i) où m est un nombre entier allant de 1 à 12, par exemple un groupe méthyle, éthyle, propyle, butyle, pentyle, hexyle, heptyle, octyle, nonyle, decyle, undécyle, dodécyle, tetradécyl, hexadécyl ou octadécyl. La chaîne aliphatique peut également être ramifiée, par exemple, elle peut être un groupe méthylpropane, 2-méthylbutane, 2,2-méthylpropane, 2- méthylpenthane, 3-méthylpentane, 2,2-diméthylbutane, 2,3- diméthylbutane, 2-méthylhexane, 3-méthylhexane, 3-éthylpentane, 2,2- diméthylpentane, 2,3-diméthylpentane, 2,4-dimétylpentane, 2,2,3- triméthylbutane, 2-méthylheptane, 3-méthylheptane, 4-méthylheptane, 3- éthylhexane, 2,2-diméthylhexane, 3,3-diméthylhexane ou 2,3- diméthylhexane. La chaîne aliphatique peut aussi être insaturée, par exemple, elle peut être un groupe propène, pentène, hexène, heptène, octène, nonène, décène, undecène, dodecène.tetradcène, hexadecène ou octadecène ayant une ou plusieurs insaturation, indépendamment de type cis ou trans.
On entend par « additif » un composé introduit dans une solution ou un mélange et apportant une propriété spécifique.
On entend par « molécule polaire » une molécule dont les barycentres de charge positive et négative ne convergent pas. Par exemple, la molécule polaire peut être une protéine, par exemple une protéine soluble ou une protéine membranaire. Par exemple la molécule polaire peut être une protéine entière ou correspondant à des fragments ou domaines de celle-ci.
On entend par « molécule chargée positivement » une molécule présentant au moins une charge positive en solution. Par exemple, la molécule chargée positivement peut être une protéine, par exemple une protéine soluble ou une protéine membranaire. Par exemple la molécule chargée positivement peut être une protéine entière ou correspondant à des fragments ou domaines de celle-ci.
L'au moins un dérivé calix[n]arènique peut, par exemple, répondre à la formule (I) suivante :
Figure imgf000008_0001
dans laquelle :
> p est un nombre entier allant de 1 à 9 ; " R1, R2, R3 et R4 représentent, indépendamment les uns des autres, un hydrogène ou une des chaînes aliphatiques précitées. Il peut s'agir par exemple d'un groupe - (CmH2m+i), linéaire ou ramifié, dans lequel m est un nombre entier allant de 1 à 12 ou valant 16 ou 18 ;
" X1, X2, X3 et X4 représentent, indépendamment les uns des autres, un atome d'hydrogène ou une des fonctions acides précitées. Il peut s'agir par exemple d'un groupe carboxylique ou un groupe -(CHbVCOOH dans lequel y est un nombre entier allant de 1 à 12.
Par exemple, l'au moins un dérivé calix[n]arènique peut répondre à la formule(l) dans laquelle : " p est un nombre entier égal à 1
" un radical parmi R1, R2, R3 et R4 représente un groupe - (CmH2m+i) linéaire ou ramifié dans lequel m est un nombre entier compris entre 1 à 12 inclus ou valant 16 ou 18 ; " trois radicaux parmi R1, R2, R3 et R4 représentent un atome d'hydrogène
• un radical parmi X1, X2, X3 et X4 représente un atome d'hydrogène ; " trois radicaux parmi X1, X2, X3 ou X4 représentent, un groupe carboxylique ou un groupe -(CH2)yCOOH dans lequel y est un nombre entier allant de 1 à 12 ;
À titre d'exemple, selon la formule I ci-dessus, lorsque n vaut 4, p vaut 1. Si n vaut 6, p vaut 3, etc.
Le groupe - (CmH2m+i) peut, par exemple, être choisi dans le groupe comprenant le groupe méthyle, éthyle, propyle, butyle, pentyle, hexyle, heptyle, octyle, nonyle, decyle, undécyle et dodécyle.
Par exemple, la molécule polaire et/ou chargée positivement peut être choisie dans le groupe comprenant les protéines, les peptides, les complexes protéiques, les domaines protéiques, les glycoprotéines, les phosphoglycoprotéines. On entend par « protéine » un polymère linéaire d'acides aminés liés par liaison peptidique covalente.
On entend par « peptide » un polymère linéaire d'acides aminés liés de façon covalente par liaison peptidique de 2 à 100 acides aminés.
On entend par « complexes protéiques » un assemblage homo- ou hétéro-oligomériques de protéines de nature soluble ou membranaire.
On entend par « domaine protéique» un élément protéique replié dans l'espace et fonctionnel d'une protéine.
La molécule polaire et/ou chargée positivement peut, par exemple, être une protéine membranaire ou une protéine soluble, entière ou bien des fragments ou domaines de celles-ci. Les fragments ou domaines de protéines peuvent, par exemple, être produits par digestion enzymatique ménagée ou par biologie moléculaire, par exemple par recombinaison génétique.
On entend par « fragment protéique» un élément peptidique non nécessairement replié dans l'espace et fonctionnel d'une protéine. On entend par « protéine soluble » une protéine miscible en solution aqueuse, en milieu physiologique aqueux et libre de diffusion.
On entend par « protéine membranaire » une protéine associée aux membranes biologiques soit ancrées, soit intégrales, et non libre de diffusion dans les milieux aqueux et instable dans ces milieux. Les protéines membranaires sont souvent classées en fonction des structures qui leur permettent d'interagir avec les membranes et de la manière dont ces structures s'agencent. Les protéines membranaires peuvent être des protéines polytopiques ou des protéines monotopiques.
On entend par « protéines polytopiques » des protéines qui traversent une ou plusieurs fois la membrane.
On entend par « protéines monotopiques » des protéines qui interagissent avec un seul coté de la membrane.
Les protéines membranaires peuvent également être classées en fonction de leur difficulté à être extraite des membranes. Elles peuvent être intégrales ou périphériques.
On entend par « protéines intégrales » des protéines monotopiques ou polytopiques qui interagissent fortement avec la membrane, notamment par des interactions hydrophobes. Ces protéines sont aussi appelées « protéines intrinsèques ». On entend par « protéines périphériques » des protéines monotopiques qui interagissent faiblement avec la membrane, c'est-à-dire soit par des liaisons électrostatiques, soit par l'intermédiaire d'autres protéines membranaires. Ces protéines sont aussi appelées « protéines extrinsèques ». Par exemple, la protéine membranaire peut être choisie dans le groupe comprenant les récepteurs à protéines G, les canaux, les symporteurs, les antiporteurs, les transporteurs d'électrons, de protons, les pompes à anions, les pompes à cations, à métaux, à peptides, les pompes d'effiux du type BmrA. La molécule polaire et/ou chargée positivement peut également être une des différentes versions de structures primaires modifiée et/ou générée par biologie moléculaire, par exemple H6BmrA. Par exemple, la protéine membranaire est préalablement extraite de la membrane par des techniques d'extraction classique pour l'homme du métier.
La molécule polaire et/ou chargée positivement peut être, par exemple, toute protéine naturelle ou native, ayant ou non subit des modifications post-traductionnelles, de toute espèce ou toute protéine artificielle.
On entend par « protéine naturelle » une protéine produite par un organisme ou une cellule dont l'ADN a été modifié par recombinaison génétique. On entend par « protéine native » une protéine à l'état fonctionnel et structuralement correctement repliée.
On entend par « modifications post-traductionnelles » des modifications effectuées à une protéine après synthèse : glycosylation, famésylation, phosphorylation, ancre GPI, acylations, protéolyses, adressages.
Par exemple, la protéine peu être une protéine recombinante. On entend par « protéine recombinante » une protéine produite par un organisme ou une cellule dans laquelle une séquence codant pour la protéine a été introduite de manière à faire exprimer ladite protéine par cet organisme ou cette cellule.
Les espèces protéiques définies ci-dessus, peuvent être produites dans un organisme d'origine naturelle, dans un organisme hôte ou dans un système acellulaire recombinants, par synthèse chimique ou hémichimique. La présente invention concerne également un procédé de cristallisation d'une molécule polaire et/ou chargée positivement comprenant une étape de mise en contact : a. d'une solution aqueuse comprenant une molécule à cristalliser et b. au moins un dérivé calixfn]arènique, où n vaut 4, substitué au moins par une fonction acide sur une face et au moins une chaîne aliphatique sur l'autre face. Les dérivés calix[n]arèniques, la molécule polaire, la chaîne aliphatique, la molécule polaire et/ou chargée positivement sont définis ci-dessus.
Par exemple, la molécule polaire et/ou chargée positivement est préalablement purifiée, par exemple par chromatographie.
Dans le cas de cristallisation des protéines membranaires, le procédé de la présente invention peut, par exemple, comprendre une étape préalable d'extraction de ces protéines membranaires. Cette étape peut être une extraction classique pour l'homme du métier. Elle peut notamment comprendre l'utilisation de détergents classiques.
La mise en contact du procédé de la présente invention peut, par exemple, être réalisée à un pH compris entre 5,0 et 14,0, par exemple entre 6 et 9, comme gamme préférée plus étroite, par exemple entre 6,5 et
8,5 comme gamme préférée, par exemple à un pH égal à 8,0 comme valeur optimale.
La mise en contact du procédé de la présente invention peut, par exemple, être réalisée à une température comprise entre -400C et 800C, par exemple entre 4°C et 400C, par exemple entre 15°C et 300C, par exemple à une température de 200C.
La mise en contact du procédé de la présente invention peut, par exemple, être réalisée à une concentration en calixarène comprise entre 1 n M et 100 mM, par exemple entre 0,1 mM et 10 mM, par exemple entre 1 et 10 mM, par exemple à une concentration égale à 1 mM.
Au détriment de toute les techniques de l'art antérieur, la présente invention permet de promouvoir, c'est-à-dire de permettre, faciliter et/ou accélérer la cristallisation de molécules polaires et/ou chargées positivement, notamment de protéines membranaires en solution ou solubles, jusque-là très difficilement cristallisables. La cristallisation notamment est améliorée grâce à la formation d'un état d'agrégation organisée des molécules polaires et/ou chargées positivement dans l'espace, conduisant à la formation de cristaux.
En particulier, la présente invention, permet avantageusement aux dérivés calix[n]arèniques de s'organiser de façon à générer des amas supramoléculaires exposant à leur surface les fonctions acides, maintenues par la région hydrophobe des chaînes aliphatiques, par exemple, comme illustré sur la figure 1B.
On entend par « amas supramoléculaire de dérivés calix[n]arèniques » une organisation de plusieurs dérivés calix[n]arèniques de type micellaire. Ces amas supramoléculaires s'intercalent entre les protéines membranaires par l'intermédiaire d'interactions ioniques, par exemple, comme illustré sur la figure 1C. Ces interactions permettent de renforcer la cohésion de l'édifice et en facilitent l'organisation cristalline, par exemple, comme illustré sur la figure 1D. Ces interactions s'appliquent avec la même efficacité à toutes les molécules polaires et/ou chargées positivement.
L'utilisation et le procédé de la présente invention peuvent, par exemple, faire intervenir plusieurs des dérivés calix[n]arèniques définis ci- dessus. Notamment, il peut être particulièrement avantageux d'utiliser plusieurs dérivés calix[n]arèniques de la présente invention ayant des longueurs de chaîne aliphatique différentes. Cela permet avantageusement de générer des amas supramoléculaires dont la taille dépend de la longueur des chaînes aliphatiques des dérivés calix[n]arèniques utilisés. La vitesse de cristallisation de la protéine est d'autant plus rapide que la taille de la chaîne aliphatique du calix[n]arène utilisé est courte (figures
3 A-E). Les dérivés les plus longs favorisant de toute façon la cristallisation de la protéine plus rapidement qu'en abscence de ceux-ci (figures 4A-B).
Le fait de disposer d'amas supramoléculaires de tailles différentes permet un meilleur ajustement de ceux-ci dans les espaces vacants entre les protéines membranaires voisines. La cristallisation de protéines membranaires est grandement améliorée. L'utilisation selon la présente invention trouve notamment une application dans la production et la commercialisation de kit de cristallisation comprenant au moins un dérivé calix[n]arènique de la présente invention. Ce kit peut, en particulier être utilisé dans des protocoles de déterminer la structure spatiale à l'échelle atomique de protéines de grand intérêt, notamment de protéines membranaires.
D'autres avantages pourront encore apparaître à l'homme du métier à la lecture des exemples ci-dessous, illustrés par les figures annexées, donnés à titre illustratif.
Brève description des figures
- La figure 1A représente des exemples de différents calix[4]arènes, tous formés d'une couronne de 4 phénols (cycle, défini par le chiffre « 1 ») portant sur une face les groupements carboxyliques (petit tiret dans un cercle, défini par le chiffre « 2 ») et sur l'autre face, une chaîne aliphatique CnH2n+i, n= 1 , 3, 7, 10 et 12 (petits bâtonnets, défini par le chiffre « 3 »).
- La figure 1B représente des exemples d'organisation supramoléculaire de ces molécules en amas supramoléculaires (défini par la lettre « a ») exposant les fonctions chargées (petit tiret dans un cercle) à la surface avec une cohésion maintenue par les groupements hydrophobes (petits bâtonnets) regroupés à l'intérieur de l'amas.
- La figure 1C représente un modèle d'insertion d'amas supramoléculaires, défini par la lettre « a », entre des protéines membranaires, défini par la lettre « b », dont les régions hydrophobes sont entourées d'une couronne de détergent, défini par la lettre « c ».
- La figure 1D représente un modèle d'empilement cristallin d'amas-protéines pour lequel la lettre « a » représente des amas supramoléculaires, la lettre « b » représente des protéines membranaires et la lettre « c » représente des couronnes de détergent.
- La figure 2 représente une chromatographie de HβSmrA, après filtration sur gel S200, la protéine est déposée sur gel SDSPAGE 10% et coloré au bleu de Coomassie. La bande définie par « H6BmrA, dim » correspond à la protéine H6BmrA sous forme de dimère et la bande définie par « H6BmrA, mono » correspond à la protéine H6BmrA sous forme de monomère. - La figure 3 représente des essais de cristallisation de HββmrA en absence ou en présence de p(HOOC)3Ar4 oX. Les concentrations utilisées sont telles qu'elles correspondent à ΛΛx, 1x et 2x la concentration micellaire critique de chacun des composés, ceux-ci ayant un comportement surfactant.Les figures 3A à 3E représentent des gouttes « dr » et des détails de ces gouttes « de » :
• 3A. panneau de gauche : en absence (-/-), panneaux de droite : avec 1.
Figure imgf000015_0001
• 3B. avec 0.75 et 1.5 mM de p(HOOC)3Ar4 0((CHa)2CH3)
• 3C. avec 0.2, 0.4 et 0.8 mM de p(HOOC)3Ar4 o((CH2)6CH3) • 3D. avec 0.075, 0.15 et 0.3 mM de p(HOOC)3Ar4 o((CH2)9CH3)
• 3E. avec 0.04, 0.08 et 0.16 mM de p(HOOC)3Ar4 o((CH2)nCH3).
- La figure 4A représente des essais de cristallisation de HββmrA en absence ou en présence de p(HOOC)3Ar4 oX. Les concentrations utilisées sont telles qu'elles correspondent à !4x, 1x et 2x la concentration micellaire critique de chacun des composés, ceux-ci ayant un comportement surfactant. Le panneau de gauche en haut correspond à la goutte déposée en absence de dérivé calixarènique.
• 4A. avec 0,075, 0, 15 et 0,3 mM de p(HOOC)3Ar4 o((CH2)9CH3)
• 4B. avec 0,04, 0,08 et 0,16 mM de p(HOOC)3Ar4 o((CH2)nCH3) - La figure 5 représente des essais de cristallisation de H6βmrA en absence de protéines et en présence de p(HOOC)3Ar4 oX. Les concentrations utilisées sont telles qu'elles correspondent à V≥x, 1x et 2x la concentration micellaire critique de chacun des composés, ceux-ci ayant un comportement surfactant. • 5A. panneau de gauche : avec 0.16 mM de p(HOOC)3Ar4 0CH3 ; panneaux de droite avec 0.75 et 1.5 mM de p(HOOC)3Ar4 0((CHz)2CH3)
• 5B. avec 0.2, 0.4 et 0.8 mM de p(HOOC)3Ar4 0((CH2J6CH3) • 5C. avec 0.075, 0.15 et 0.3 mM de p(HOOC)3Ar4 o((CH2)9CH3)
• 5D. avec 0.04, 0.08 et 0.16 mM de p(HOOC)3Ar4 o((CH2)nCH3).
- La figure 6A une chromatographie de H6Bm rA, extraite soit sans détergent (-), soit avec un détergent non dénaturant de type dodécyl maltoside (DDM), soit un détergent dénaturant de type docécyl sulfate de sodium (SDS), soit un dérivé calixarènique p(HOOC)3Ar4 o((CH2)6CH3) (C4C7). Après 2 heures à 4°C, la suspension est centrifugée et le surnageant (S) et le culot (C) sont déposés sur gel SDSPAGE de 10% et coloré au bleu de Coomassie. Le surnageant est ensuite dialyse en présence de lipides pour à la fois éliminer le détergent et permettre à la protéine de retrouver un environnement lipidique, indispensable à son activité enzymatique.
- La figure 6B représente un modèle de protéine membranaire hydrolysant l'ATP en ADP en présence de magnésium (Mg), où la lettre « b » représente une protéine membranaire et la lettre « d » représente une membrane cellulaire.
- La figure 6C représente l'activité spécifique (AS) de HββnrirA en μmol Pi/min/mg prot, lorsque celle-ci est extraite par soit du dodécyl maltoside (DDM), soit du docécyl sulffate de sodium (SDS), soit un dérivé calixarènique P(HOOC)3A^ o((CH2)6CH3) (C4C7). - La figure 7 représente : A. : un cristal de HβSmrA obtenu en présence de 1 mM P(HOOC)3A^ o((CH2)2CH3). B. et C. : Collection à I1ESRF ID23-2 à 0° (B) et 90° (C), des taches de diffraction obtenues à partir d'un cristal de HβfîmrA obtenu en présence de 1 mM p(HOOC)3Ar4 o((CH2)2CH3). - La figure 8A représente des taches de diffraction obtenues à partir d'un cristal de HβBmrA obtenu en présence de 1 mM p(HOOC)3Ar4 o((CH2)2CH3). La figure 8B représente un cristal de HββmrA obtenu en présence de 1 mM p(HOOC)3Ar4 o((CH2)2CH3).
EXEMPLES
Dans ces exemples, le milieu 2TY provient de la société Bio101 (1070 Joshua Way Vista CA92083 USA), , la souche d'Escherichia coli BI21-DE3 provient de la société Invitrogen SARL BP 96 95613 Cergy Pontoise Cedex, l'ampicilline, l'isopropyl-beta-thio-galactoside (IPTG) et le réactif d'acide bicinchoninique (réactif BCA) proviennent de la société Sigma-AIdrich, PO Box 14508, St. Louis, MO 63178, UNITED STATES.
Exemple 1 : Clonage, production et préparation de la protéine membranaire test H6BmrA
Clonage
BmrA, est un "1/2" transporteur ABC (ATP-Binding Cassette) de Bacillus subtilis. Il appartient à la famille des transporteurs ABC de résistance multiples aux agents chimiothérapeutiques (Chami M., Steinfels E., Orelle C, Jault J. M., Di Pietro A., Rigaud J. L. and Marco S. (2002) Three- dimensional structure by cryo-electron microscopy of YvcC, an homodimeric ATP-binding cassette transporter from Bacillus subtilis. J Mol
Biol 315, 1075-85 [15]).
SmrA a été clone en laboratoire [15] et est référencé dans la banque de données des protéines Expasy par le code Q06967
(http://www.expasv.orq/cqi-bin/qet-SDrot-entrv7O06967). Sa séquence d'acides aminés est la suivante:
>tr|O06967|O06967_BACSU Putative uncharacterized protein yvcC (YvcC protein) OS=Bacillus subtilis GN=yvcC PE=3 SV=1 MPTKKQKSKSKLKPFFALVRRTNPSYGKLAFALALSWTTLVSLLIPLLTK QLVDGFSMSNLSGTQIGLIALVFFVQAGLSAYATYALNYNGQKIISGLREL LWKKLIKLPVSYFDTNASGETVSRVTNDTMWKELITTHISGFITGIISVIGS LTILFIMNWKLTLLVLWVPLAALILVPIGRKMFSISRETQDETARFTGLLNQ ILPEIRLVKASNAEDVEYGRGKMGISSLFKLGVREAKVQSLVGPLISLVLM AALVAVIGYGGMQVSSGELTAGALVAFILYLFQIIMPMGQITTFFTQLQKSI GATERMIEILAEEEEDTVTGKQIENAHLPIQLDRVSFGYKPDQLILKEVSAV IEAGKVTAIVGPSGGGKTTLFKLLERFYSPTAGTIRLGDEPVDTYSLESWR EHIGYVSQESPLMSGTIRENICYGLERDVTDAEIEKAAEMAYALNFIKELP NQFDTEVGERGIMLSGGQRQRIAIARALLRNPSILMLDEATSSLDSQSEK SVQQALEVLMEGRTTIVIAHRLSTWDADQLLFVEKGEITGRGTHHELMA
SHGLYRDFAEQQLKMNADLENKAG (SEQ ID NO. 1) Le gène correspondant à cette séquence de BmrA a été modifié par
Polymerase Chain Reaction (PCR) pour inclure à l'extrémité N-terminale une séquence MSSSHHHHHH (SEQ ID No. 2) afin de permettre la purification de la protéine par chromatographie d'affinité métal, et les sites de restriction adéquats pour introduction dans le plasmide d'expression pET23 (Novagen), en utlisant les techniques de biologie moléculaire décrites dans Molecular Cloning, a laboratory manual, second édition, Sambrook, J., Fritsch, E. F., Maniatis, T., CoId Spring Harbor Laboratory Press, New York.
Culture / Expression
Une préculture de 200 mL de milieu 2TY1 100 μg/ml d'ampicilline est réalisée avec une souche d'Escherichia coli BI21-DE3, fraîchement transformée avec le plasmide pET15B-His6-BmrA.
Elle est incubée 18h à 310 K sous agitation à 200 rotations par minute (rpm). Le matin la densité de la culture ODβoonm est de 0,6. Cette préculture est utilisée pour ensemencer 6 litres du même milieu, à une ODβoonm de 0,05. Lorsque la densité optique de la culture atteint la valeur de 0,6, l'expression de Hisβ-BmrA est induite par addition de 0,7 mM d'IPTG, et poursuivie pendant 3 heures à 298 K. Fractionnement
Les bactéries sont sédimentées par centrifugation à 7 500 g pendant 10 minutes dans une centrifugeuse Beckman J2-21 pour former un culot. On élimine le surnageant, puis on met en suspension les bactéries dans 50 mM Tris-HCI (tris(hydroxyméthyl)-aminométhane chlorhydrate) pH 8,0 0,5 mM MgCI2, 1 mM dithiothréitol (DTT), cocktail d'antiprotéase (Roche ; 1 pastille/50 ml). Trente unités/ml de Benzonase (Sigma) sont ajoutées puis les bactéries sont lysées par 2 passages successifs à la presse de French (Thermo Electron Corporation, 300 second Ave, Needham Heights, MA 02494), à 110 MPa (16 000 Psi). Dix millimolaire d'EDTA (acide éthylène-diamine-tétraacétique) est ensuite ajouté au lysat, centrifugé 30 min à 15 000 g. Le surnageant est conservé et centrifugé pendant 60 min à 200 000 g. Le culot ainsi obtenu, correspondant aux membranes et contenant la protéine membranaire d'intérêt, est suspendu dans 1,5 mL de tampon 20 mM Tris-HCI, 1 mM EDTA, 0,3 M sucrose, pour stockage.
La concentration protéique est déterminée par titration colorimétrique avec le réactif BCA (Smith P. K., Krohn R. I., Hermanson G. T., Mallia A. K., Gartner F. H., Provenzano M. D., Fujimoto E. K., Goeke N. M., Oison B. J. and Klenk D. C. (1985) Measurement of protein using bicinchoninic acid. Anal Biochem 150, 76-85 [16]). Des aliquotes de 0,5 mL (équivalent à 1 litre de culture) sont congelées et conservées dans l'azote liquide jusqu'à leur utilisation. Hisβ-BmrA représente environ 10 % des protéines totales et 50 % des protéines membranaires.
Purification
Une aliquote de membrane est rapidement décongelée et dilué à 2 mg/mL de protéines dans 20 mM Tris-HCI pH 8,0, 20 mM NaCI, 0,02 mM EDTA, 0,1 mM DTT, cocktail d'antiprotéase (Roche, 1 pastille pour 100 mL). Hisβ-BmrA est extraite avec 10 mg/mL de Foscholine 12 (Anatrace, FC12) pendant 2 heures à 8°C et sous rotation lente. HβBmrA est ensuite séparée par centrifugation pendant 1 heure à 100 000 g et 283 K Le surnageant est passé sur colonne de 5 ml_ d'échange d'anions, Q- sepharose highflow (GE healthcare), préalablement nettoyée par 2 volumes de colonne (CV) avec le tampon QB (20 mM Tris-HCI pH 8.0, 1 M NaCI, 5 mg/mL FC12, cocktail d'antiprotéases : 1 pastille/100 ml_), puis équilibrée avec 5 CV de tampon QA (tampon QB sans sel).
Le solubilisât est chargé à 5 mL/minute, puis la résine est lavée avec 10 CV de tampon QA. L'élution est réalisée avec un gradient linéaire (QA - QB) de NaCI (0 - 1 M) de 6 CV. La fraction contenant H6BmrA est déposée à 5 mL/minute sur une colonne de 5 ml d'affinité-métal du type Nickel-nitriloacétique acid-agarose high trap chelating hp, (GE healthcare). La résine est préalablement équilibrée avec 3 CV de tampon NiA (20 mM Tris-HCI pH 8,0, 0,2 M NaCI, 10 mM imidazole, 5 mg/mL FC12, cocktail d'antiprotéases : 1 pastille/100 mL).
Après chargement, la résine est lavée avec 10 CV de tampon NÎA puis la protéine est éluée avec un gradient linéaire d'imidazole (10 - 250 mM). Les fractions contenant HβBmrA sont réunies et concentrées par ultrafiltration sur membrane Amicon, Ultra4 50,000 (Millipore Corporate Headquarters, 290 Concord Road, Billerica, MA 01821 , USA) jusqu'à un volume de 1 mL. Enfin, la solution est déposée sur une résine de tamis moléculaire
Superdex200, 10/300 GL (GEhealthcare, Lyon, 13 - 15 rue des draperies, Les Coteaux de Saône, 69450 Saint Cyr au Mont d'Or) équilibrée avec le tampon 20 mM Tris-HCI pH 8,0, 0,1 M NaCI, 3 mg/mL FC12).
Les fractions contenant HβBmrA sont réunies et concentrées par ultrafiltration sur membrane Amicon, Ultra4 50 000 jusqu'à une concentration de 11-12 mg/ml. La qualité de la purification est contrôlée à chaque étape par électrophorèse (figure 2) de type SDS-PAGE avec un gel de 10% acrylamide (Laemmli U. K. (1970) Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227, 680-5 [17]), en préparant les échantillons protéiques comme décrit dans (Lenoir G., Menguy T., Corre F., Montigny C, Pedersen P. A., Thinès D., le Maire M. and Falson P. (2002) Overproduction in yeast and rapid and efficient purification of the rabbit SERCAIa Ca2+-ATPaSe. Biochim Biophys Acta 1560, 67-83 [18]).
Exemple 2 : Cristallisation de H6BmrA Les essais de cristallisation de H6BiDrA sont réalisés à partir de la solution de protéine concentrée dans son tampon de gel de filtration. La solution est additionnée de 5 mM ATP, 5 mM MgCb, 2 mM d'orthovanadate de sodium. La concentration protéique finale est de 10 mg/mL. Les essais sont réalisés en gouttes suspendues dans une plaque de cristallisation 24 puits de type Linbro (Hampton Research, 34 Journey, Aliso Viejo, CA 92656-3317). Chaque goutte est faite en ajoutant respectivement 2 μl du mélange protéine-solutés décrit ci-dessus, 0,4 μl du calix[4]arène préparé préalablement à une concentration 10X et neutralisé à pH 8,0, et 1 ,6 μl d'une solution 0,2M LiNO3 / 22% PEG 2000 MME. Le réservoir de chaque puits est rempli avec 500 μl de cette solution. Les plaques sont ensuite stockées à 18°C. Les gouttes sont photographiées avec une loupe SV11 (Zeiss) et un système d'acquisition CCD 1 ,4 Mp, et analysés avec le logiciel Zeiss vision image. Les cristaux sont prélevés, lavés dans la solution de réservoir et montés sur boucle cryo (Hampton res.), puis congelés et conservés dans l'azote liquide. Les cristaux sont analysés à l'ESRF, sur la ligne microfocus ID23-2 et les clichés de diffraction générés par un détecteur ADSC Quantum 315R CCD.
Les conditions décrites dans cet exemple sont les conditions standards de cristallisation de H6Sm r A et sont celles utilisées pour les exemples 3 à 7.
Exemple 3 : Essais de cristallisation sans additifs (témoin)
En absence de calix[4]arène, les conditions standard de cristallisation de H6SrDrA permettent d'obtenir des cristaux de protéines typiquement en 3 semaines. De fait après 2 jours d'incubation à 18°C , aucun cristal n'est visible dans la goutte correspondante, tel que l'on peut le voir dans le panneau de la Figure 3A1 à gauche.
Exemple 4 : Essais de cristallisation avec additifs La présence des calix p(HOOC)3Ar4 oX dans les différents essais montre dans les mêmes conditions la présence de nombreux cristaux, bien formés et très grands, obtenus en seulement 2 jours (figure 3). Les calix[4]arènes ayant les chaînes aliphatiques les plus courtes produisent les meilleurs effets. Les mêmes conditions sont testées pendant 10 jours (figure 4), ce qui permet de voir apparaître des cristaux dans les gouttes comportant les dérivés calixarèniques les plus longs, alors qu'ils ne sont toujours pas formés en leur absence.
Exemple 5 : Essais de cristallisation sans protéines (contrôle)
La possibilité existe que les cristaux ne soient pas ceux produits avec H6BmTA mais avec les dérivés calixarèniques eux-mêmes. Pour se faire, les mêmes conditions de cristallisations ont été reproduites, cette fois sans ajouter de protéine. La figure 5 montre qu'aucun cristal n'apparaît. Il s'agit donc bien de cristaux de nature protéique qui sont obtenus dans les exemples précédents.
Exemple 6 : Reconstitution fonctionnelle de H6BmrA après traitement avec p(HOOC)3Ar4 o((CH2)6CH3) ("C4C7") Les dérivés calixarèniques utilisés dans la présente invention ne sont pas délétères pour l'activité enzymatique de la protéine H6Bm rA. Ceci est illustré avec le dérivé p(HOOC)3Ar4 o((CH2)6CH3), qui a une activité surfactante et permet l'extraction de la protéine. Comme montré dans la figure 6, la protéine conserve son activité après la phase d'extraction/reconstitution, comme avec un détergent doux du type dodécyl maltoside (DDM). À l'inverse, l'utilisation de dodécyl sulfate de sodium (SDS)1 un détergent dénaturant utilisé pour déplier les protéines, ne permet pas une reconstitution fonctionnelle.
Exemple 7 : Test au synchrotron de l'ESRF (European Synchrotron Radiation Facility) du cristal de H6BmrA en présence de p(HOOC)3Ar4 o((CH2)2CH3)
Certains des cristaux qui ont été produits dans la figure 3 ont été testés au synchrotron de l'ESRF sur la ligne microfocus ID23-2 et les clichés de diffraction générés par un détecteur ADSC Quantum 315R CCD. Comme illustré dans la figure 7, l'un d'eux a permis d'obtenir un cliché de diffraction typique d'une protéine, avec une indexation compatible avec un cristal monoclinique de maille : a = 56 A, b = 254 A, c = 128 A, alpha = 90°, beta = 108°, gamma = 90°.
La même expérience a été réalisée sur la ligne microfocus ID23-1. La figure 8 présente un cliché de diffraction du cristal de H6BmrA obtenu.
Exemple 8 : Exemple d'un kit de cristallisation
On réalise un kit de cristallisation comprenant une solution comprenant au moins un dérivé calixarènique défini ci-dessus. Ce kit peut comprendre en outre une notice d'utilisation, un tampon de lavage approprié, ou tout autre solution ou dispositif approprié ou une combinaison de ces éléments.
Ces expérimentations démontrent que la présente invention est très performante pour la cristallisation des molécules polaires et/ou chargées positivement, notamment des protéines membranaires.
La présente invention forme donc un outil remarquable, notamment pour la détermination structurale à l'échelle atomique de ces molécules. Listes des références
1. Caffrey M. (2003) Membrane protein crystallization. J Struct Biol 142, 108-32.
2. Garavito R. M. and Ferguson-Miller S. (2001) Détergents as Tools in Membrane Biochemistry. J Biol Chem 276, 32403-6.
3. Nollert P. (2005) Membrane protein crystallization in amphiphile phases: practical and theoretical considérations. Prog Biophys Mol Biol 88, 339-57.
4. Lundstrom K. (2004) Structural genomics on membrane proteins: the MePNet approach. Curr Opin Drug Discov Devel 7, 342-6.
5. Dean M., Hamon Y. and Chimini G. (2001) The human ATP-binding cassette (ABC) transporter superfamily. J Lipid Res 42, 1007-17.
6. Efferth T. (2003) Adenosine triphosphate-binding cassette transporter gènes in ageing and age-related diseases. Ageing Res Rev 2, 11-24. 7. Kim R. B. (2003) Drug transporters in HIV Therapy. Top HIV Med 11 , 136-9.
8. Rajagopal A. and Simon S. M. (2003) Subcellular localization and activity of multidrug résistance proteins. Mol Biol CeI1 14, 3389-99.
9. Boumendjel A., Baubichon-Cortay H., Trompier D., Perrotton T. and Di Pietro A. (2005) Anticancer multidrug résistance mediated by
MRP1 : récent advances in the discovery of reversai agents. Med Res Rev 25, 453-72.
10. Frelet A. and Klein M. (2006) Insight in eukaryotic ABC transporter function by mutation analysis. FESS Lett 580, 1064-84. 11. Shirasaka Y., Onishi Y., Sakurai A., Nakagawa H., Ishikawa T. and Yamashita S. (2006) Evaluation of Human P-Glycoprotein (MDR1/ABCB1) ATPase Activity Assay Method by Comparing with in Vitro Transport Measurements: Michaelis-Menten Kinetic Analysis to Estimate the Affinity of P-Glycoprotein to Drugs. Biol Pharm Bull 29, 2465-71. 12. Szakacs G., Paterson J. K., Ludwig J. A., Booth-Genthe C. and Gottesman M. M. (2006) Targeting multidrug résistance in cancer. Nat Rev Drug Discov 5, 219-34.
13. Enokizono J., Kusuhara H., Ose A., Schinkel A. H. and Sugiyama Y. (2008) Quantitative Investigation of the RoIe of Breast Cancer
Résistance Protein (Bcrp/Abcg2) in Limiting Brain and Testis Pénétration of Xenobiotic Compounds. Drug Metab Dispos, dmd.107.019257.
14. McPherson A. and Cudney B. (2006) Searching for silver bullets: an alternative strategy for crystallizing macromolecules. J Struct Biol
156, 387-406.
15. Chami M., Steinfels E., Orelle C1 Jault J. M., Di Pietro A., Rigaud J. L. and Marco S. (2002) Three-dimensional structure by cryo-electron microscopy of YvcC, an homodimeric ATP-binding cassette transporter frorn Bacillus subtilis. J Mol Biol 315, 1075-85.
16. Smith P. K., Krohn R. I., Hermanson G. T., Mallia A. K., Gartner F. H., Provenzano M. D., Fujimoto E. K., Goeke N. M., Oison B. J. and Klenk D. C. (1985) Measurement of protein using bicinchoninic acid. Anal Biochem 150, 76-85. 17. Laemmli U. K. (1970) Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227, 680-5. 18. Lenoir G., Menguy T., Corre F., Montigny C, Pedersen P. A., Thinès D., le Maire M. and Falson P. (2002) Overproduction in yeast and rapid and efficient purification of the rabbit SERCA1 a Ca2+-ATPaSe. Biochim Biophys Acta 1560, 67-83.

Claims

REVENDICATIONS
1. Utilisation d'au moins un dérivé calix[n]arènique, où n est un nombre entier allant de 4 à 12, substitué au moins par une fonction acide sur une face et au moins une chaîne aliphatique sur l'autre face, en tant qu'additif de cristallisation d'une molécule polaire et/ou chargée positivement.
2. Utilisation selon la revendication 1 , dans laquelle l'au moins un dérivé calix[n]arènique répond à la formule (I) suivante :
Figure imgf000026_0001
dans laquelle : " p est un nombre entier allant de 1 à 9 ;
• R1, R2, R3 et R4 représentent, indépendamment les uns des autres, un hydrogène, un groupe - (CmH2m+i) ou un groupe alcène, linéaire ou ramifié, dans lequel m est un nombre entier allant de 1 à 12 ou valant 16 ou 18 ; " X1, X2, X3 et X4 représentent, indépendamment les uns des autres, un atome d'hydrogène, un groupe carboxylique ou un groupe -<CH2)y-COOH dans lequel y est un nombre entier allant de 1 à 12, ou un acide benzoïque.
3. Utilisation selon la revendication 1 ou 2, dans laquelle l'au moins un dérivé calix[n]arènique répond à la formule (I) dans laquelle :
• p est un nombre entier égal à 1
" un radical parmi R1, R2, R3 et R4 représente un groupe - (CmH2m+i) linéaire ou ramifié dans lequel m est un nombre entier compris entre 1 à 12 inclus ou valant 16 ou 18 ;
• trois radicaux parmi R1, R2, R3 et R4 représentent un atome d'hydrogène
" un radical parmi X1, X2, X3 et X4 représente un atome d'hydrogène ; " trois radicaux parmi X1, X2, X3 ou X4 représentent, un groupe carboxylique ou un groupe -(CH2)y-COOH dans lequel y est un nombre entier allant de 1 à 12.
4. Utilisation selon la revendication 2 ou 3, dans laquelle le groupe - (CmH2m+i) est choisi dans le groupe comprenant le groupe méthyle, éthyle, propyle, butyle, pentyle, hexyle, heptyle, octyle, nonyle, decyle, undécyle et dodécyle.
5. Utilisation selon l'une quelconque des revendications 1 à 4, dans laquelle la molécule polaire et/ou chargée positivement est choisie dans le groupe comprenant les protéines, les peptides, les complexes protéiques, les domaines protéiques, les glycoprotéines, les phosphoglycoprotéines.
6. Utilisation selon l'une quelconque des revendications 1 à
5, dans laquelle la molécule polaire et/ou chargée positivement est une protéine membranaire ou une protéine soluble, entière ou des fragments ou domaines de celles-ci.
7. Utilisation selon l'une quelconque des revendications 1 à 6 dans laquelle la molécule polaire et/ou chargée positivement est choisie dans le groupe comprenant les récepteurs à protéines G, les canaux, les symporteurs, les antiporteurs, les transporteurs d'électrons, de protons, les pompes à anions, les pompes à cations, à métaux, à peptides, les pompes d'efflux du type BmrA.
8. Procédé de cristallisation d'une molécule polaire et/ou chargée positivement comprenant une étape de mise en contact : a. d'une solution aqueuse comprenant une molécule à cristalliser et b. au moins un dérivé calix[n]arènique substitué au moins par une fonction acide sur une face et au moins une chaîne aliphatique de longueur variable sur l'autre face.
9. Procédé selon la revendication 8, dans lequel l'au moins un dérivé calix[n]arènique répond à la formule (I) suivante :
Figure imgf000028_0001
dans laquelle :
• p est égal à 1 ,3, 5, 6. ;
" R1, R2, R3, R4 représentent, indépendamment les uns des autres un hydrogène, un groupe - (CmH2m+i) ou un groupe alcène, linéaire ou ramifié, dans lequel m est un nombre entier allant de 1 à 12 ou valant 16 ou 18 ;
" X1, X2, X3 et X4 représentent, indépendamment les uns des autres, un atome d'hydrogène, un groupe carboxylique ou un groupe -(CH2)y-COOH dans lequel y est un nombre entier allant de 1 à 12, ou un acide benzoïque.
10. Procédé selon la revendication 8 ou 9, dans lequel l'au moins un dérivé calix[n]arènique répond à la formule (I) dans laquelle : " p est un nombre entier égal à 1
• un radical parmi R1, R2, R3 et R4 représente un groupe - (CmH2m+i) linéaire ou ramifié dans lequel m est un nombre entier compris entre 1 à 12 inclus ou valant 16 ou 18 ;
" trois radicaux parmi R1, R2, R3 et R4 représentent un atome d'hydrogène ;
" un radical parmi X1, X2, X3 et X4 représente un atome d'hydrogène ;
" trois radicaux parmi X1, X2, X3 ou X4 représentent, un groupe carboxylique ou un groupe -(CHbVCOOH dans lequel y est un nombre entier allant de 1 à 12.
11. Utilisation selon la revendication 9 ou 10, dans lequel le groupe - (CmH2m+i) est choisi dans le groupe comprenant le groupe méthyle, éthyle, propyle, butyle, pentyle, hexyle, heptyle, octyle, nonyle, decyle, undécyle et dodécyle.
12. Procédé selon l'une quelconque des revendications 8 à 11 , dans lequel la molécule polaire et/ou chargée positivement est choisie dans le groupe comprenant les protéines, les peptides, les complexes protéiques, les domaines protéiques, les glycoprotéines, les phosphoglycoprotéines.
13. Procédé selon l'une quelconque des revendications 8 à 12, dans laquelle la molécule polaire et/ou chargée positivement est une protéine membranaire ou soluble.
14. Procédé selon l'une quelconque des revendications 8 à 13, dans lequel la molécule polaire et/ou chargée positivement est choisie dans le groupe comprenant les récepteurs à protéines G, les canaux, les symporteurs, les antiporteurs, les transporteurs d'électrons, de protons, les pompes à anions, les pompes à cations, à métaux, à peptides, les pompes d'efflux du type BmrA.
15. Procédé selon l'une quelconque des revendications 8 à 14, dans lequel la mise en contact est réalisée à un pH compris entre 5,0 et 14.
16. Procédé selon l'une quelconque des revendications 8 à 15 dans lequel la mise en contact est réalisée à une température comprise entre -400C et 80 0C.
17. Procédé selon l'une quelconque des revendications 8 à 16, dans lequel la mise en contact est réalisée à une concentration en calixarène comprise entre 1 nM et 100 mM.
PCT/FR2010/000285 2009-04-06 2010-04-02 Additif pour la cristallisation de protéines, utilisation et procédé WO2010116055A1 (fr)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US13/263,032 US9180386B2 (en) 2009-04-06 2010-04-02 Additive for the crystallization of proteins, use and process
EP10714909.8A EP2416859B9 (fr) 2009-04-06 2010-04-02 Utilisation d'un additif pour la cristallisation de protéines et procédé

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR0901678A FR2944105B1 (fr) 2009-04-06 2009-04-06 Addifif pour la cristallisation de proteines, utilisation et procede
FR09/01678 2009-04-06

Publications (1)

Publication Number Publication Date
WO2010116055A1 true WO2010116055A1 (fr) 2010-10-14

Family

ID=41491700

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/FR2010/000285 WO2010116055A1 (fr) 2009-04-06 2010-04-02 Additif pour la cristallisation de protéines, utilisation et procédé

Country Status (4)

Country Link
US (1) US9180386B2 (fr)
EP (1) EP2416859B9 (fr)
FR (1) FR2944105B1 (fr)
WO (1) WO2010116055A1 (fr)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2525384A (en) * 2014-04-14 2015-10-28 Calixar Synthesis of amphiphilic calixarene glycoside detergents and use of same for extracting and stabilizing native functional membrane proteins

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2899814B1 (fr) * 2006-04-18 2008-09-12 Centre Nat Rech Scient Co-cristaux de calixarenes et de molecules biologiquement actives
FR2931695B1 (fr) 2008-05-28 2010-06-25 Centre Nat Rech Scient Procede d'extraction selective de proteines membranaires avec les calixarenes

Non-Patent Citations (27)

* Cited by examiner, † Cited by third party
Title
BOUMENDJEL A.; BAUBICHON-CORTAY H.; TROMPIER D.; PERROTTON T.; DI PIETRO A.: "Anticancer multidrug resistance mediated by MRP1: recent advances in the discovery of reversal agents", MED RES REV, vol. 25, 2005, pages 453 - 72
CAFFREY M.: "Membrane protein crystallization", J STRUCT BIOL, vol. 142, 2003, pages 108 - 32
CAFFREY M.: "Membrane protein crystallization", J STRUCT BIOT, vol. 142, 2003, pages 108 - 32
CAFFREY, M.: "Membrane protein crystallization", JOURNAL OF STRUCTURAL BIOLOGY, vol. 142, 2003, pages 108 - 132, XP002563389 *
CHAMI M.; STEINFELS E.; ORELLE C.; JAULT J. M.; DI PIETRO A.; RIGAUD J. L.; MARCO S.: "Three-dimensional structure by cryo-electron microscopy of YvcC, an homodimeric ATP-binding cassette transporter from Bacillus subtilis", J MOL BIOL, vol. 315, 2002, pages 1075 - 85
DEAN M.; HAMON Y.; CHIMINI G.: "The human ATP-binding cassette (ABC) transporter superfamily", J LIPID RES, vol. 42, 2001, pages 1007 - 17
EFFERTH T.: "Adenosine triphosphate-binding cassette transporter genes in ageing and age-related diseases", AGEING RES REV, vol. 2, 2003, pages 11 - 24
ENOKIZONO J.; KUSUHARA H.; OSE A.; SCHINKEL A. H.; SUGIYAMA Y.: "Quantitative Investigation of the Role of Breast Cancer Resistance Protein (Bcrp/Abcg2) in Limiting Brain and Testis Penetration of Xenobiotic Compounds", DRUG METAB DISPOS, 2008
FERGUSON-MILLER S.: "Detergents as Tools in Membrane Biochemistry", J BIOL CHEM, vol. 276, 2001, pages 32403 - 6
FRELET A.; KLEIN M.: "Insight in eukaryotic ABC transporter function by mutation analysis", FEBS LETT, vol. 580, 2006, pages 1064 - 84
GARAVITO R. M.; FERGUSON-MILLER S.: "Detergents as Tools in Membrane Biochemistry", J BIOL CHEM, vol. 276, 2001, pages 32403 - 6
JONES, F. ET AL.: "Bio-Inspired Calix[4]arene Additives for Crystal Growth Modification of Inorganic Materials", CRYSTAL GROWTH & DESIGN, vol. 5, no. 6, 10 December 2005 (2005-12-10), pages 2336 - 2343, XP002563358 *
KIM R. B.: "Drug- transporters in HIV Therapy", TOP HIV MED, vol. 11, 2003, pages 136 - 9
KIM R. B.: "Drug transporters in HIV Therapy", TOP HIV MED, vol. 11, 2003, pages 136 - 9
LAEMMLI U. K.: "Cleavage of structural proteins during the assembly of the head of bacteriophage T4", NATURE, vol. 227, 1970, pages 680 - 5
LENOIR G.; MENGUY T.; CORRE F.; MONTIGNY C.; PEDERSEN P. A.; THINÈS D.; LE MAIRE M.; FALSON P.: "Overproduction in yeast and rapid and efficient purification of the rabbit SERCA1a Ca2+-ATPase", BIOCHIM BIOPHYS ACTA, vol. 1560, 2002, pages 67 - 83
LENOIR G.; MENGUY T.; CORRE F.; MONTIGNY C.; PEDERSEN P. A.; THINÈS D.; MAIRE M.; FALSON P.: "Overproduction in yeast and rapid and efficient purification of the rabbit SERCA1 a Ca2+-ATPase", BIOCHIM BIOPHYS ACTA, vol. 1560, 2002, pages 67 - 83
LUNDSTROM K.: "Structural genomics on membrane proteins: the MePNet approach", CURR OPIN DRUG DISCOV DEVEL, vol. 7, 2004, pages 342 - 6
MARTINEZ-ARAGON M ET AL: "Host-guest extraction of immunoglobulin G using calix[6]arenas", SEPARATION AND PURIFICATION TECHNOLOGY, ELSEVIER SCIENCE, AMSTERDAM, NL, 26 March 2008 (2008-03-26), pages 1 - 6, XP002502668, ISSN: 1383-5866 *
MCPHERSON A.; CUDNEY B.: "Searching for silver bullets: an alternative strategy for crystallizing macromolecules", J STRUCT BIOL, vol. 156, 2006, pages 387 - 406
NOLLERT P.: "Membrane protein crystallization in amphiphile phases: practical and theoretical considerations", PROG BIOPHYS MOL BIOL, vol. 88, 2005, pages 339 - 57
NOLLERT P.: "Membrane protein crystallization in amphiphile phases: practical and theoretical considerations", PROG BIOPHYS MOL BIOT, vol. 88, 2005, pages 339 - 57
OSHIMA T ET AL: "Selective Extraction and Recovery of Cytochrome c by Liquid-Liquid Extraction Using a Calix[6]arene Carboxylic Acid Derivative", LANGMUIR, AMERICAN CHEMICAL SOCIETY, WASHINGTON, DC, US, vol. 21, no. 16, 30 June 2005 (2005-06-30), pages 7280 - 7284, XP002502667, ISSN: 0743-7463 *
RAJAGOPAL A.; SIMON S. M.: "Subcellular localization and activity of multidrug resistance proteins", MOL BIOL CELL, vol. 14, 2003, pages 3389 - 99
SHIRASAKA Y.; ONISHI Y.; SAKURAI A.; NAKAGAWA H.; ISHIKAWA T.; YAMASHITA S.: "Evaluation of Human P-Glycoprotein (MDR1/ABCB1) ATPase Activity Assay Method by Comparing with in Vitro Transport Measurements: Michaelis-Menten Kinetic Analysis to Estimate the Affinity of P-Glycoprotein to Drugs", BIOL PHARM BULL, vol. 29, 2006, pages 2465 - 71
SMITH P. K.; KROHN R. I.; HERMANSON G. T.; MALLIA A. K.; GARTNER F. H.; PROVENZANO M. D.; FUJIMOTO E. K.; GOEKE N. M.; OLSON B. J.: "Measurement of protein using bicinchoninic acid", ANAL BIOCHEM, vol. 150, 1985, pages 76 - 85
SZAKACS G.; PATERSON J. K.; LUDWIG J. A.; BOOTH-GENTHE C.; GOTTESMAN M. M.: "Targeting multidrug resistance in cancer", NAT REV DRUG DISCOV, vol. 5, 2006, pages 219 - 34

Also Published As

Publication number Publication date
EP2416859B9 (fr) 2014-06-04
EP2416859A1 (fr) 2012-02-15
FR2944105B1 (fr) 2011-06-17
EP2416859B1 (fr) 2014-01-08
FR2944105A1 (fr) 2010-10-08
US9180386B2 (en) 2015-11-10
US20120123088A1 (en) 2012-05-17

Similar Documents

Publication Publication Date Title
Bieling et al. WH2 and proline‐rich domains of WASP‐family proteins collaborate to accelerate actin filament elongation
Wang et al. Mechanism of membrane-curvature generation by ER-tubule shaping proteins
Bunce et al. Molecular insights into the surface-catalyzed secondary nucleation of amyloid-β40 (Aβ40) by the peptide fragment Aβ16–22
Dörr et al. The styrene–maleic acid copolymer: a versatile tool in membrane research
Nikolaus et al. Hemagglutinin of influenza virus partitions into the nonraft domain of model membranes
US20190352639A1 (en) Genome editing reagents and their use
Kedrov et al. Elucidating the native architecture of the YidC: ribosome complex
CA2684780C (fr) Formation de proteoliposomes contenant des proteines membranaires, a l&#39;aide d&#39;un systeme de synthese proteique acellulaire
US20100240868A1 (en) Composition and Method for a Producing Stable Amyloid Beta Oligomers of High Molecular Weight
Amati et al. Current problems and future avenues in proteoliposome research
US20210214401A1 (en) Manufacturing method of nanodisc comprising an olfactory receptor protein and nanodisc comprising an olfactory receptor protein manufactured by the same
JP7460700B2 (ja) 未精製膜からのサポシンリポタンパク質粒子およびライブラリー
Alfadhli et al. Trimer enhancement mutation effects on HIV-1 matrix protein binding activities
Della Pia et al. Functionalized amphipols: a versatile toolbox suitable for applications of membrane proteins in synthetic biology
Krishnarjuna et al. Detergent-free isolation of membrane proteins and strategies to study them in a near-native membrane environment
Roy Membrane preparation and solubilization
Poetsch et al. Dye removal, catalytic activity and 2D crystallization of chloroplast H+-ATP synthase purified by blue native electrophoresis
CA3123054A1 (fr) Etiquettes peptidiques pour la degradation induite par un ligand de proteines de fusion
Zoghbi et al. Membrane protein reconstitution in nanodiscs for luminescence spectroscopy studies
EP2416859B9 (fr) Utilisation d&#39;un additif pour la cristallisation de protéines et procédé
Wong et al. A carboxy-terminal affinity tag for the purification and mass spectrometric characterization of integral membrane proteins
Gimenez et al. TDP-43 Epigenetic Facets and Their Neurodegenerative Implications
Pedersen et al. A reconstituted light-harvesting complex from the green sulfur bacterium Chlorobium tepidum containing CsmA and bacteriochlorophyll a
Hill et al. Terminal deletion mutants of myelin basic protein: new insights into self-association and phospholipid interactions
Joshi et al. Elucidating N-acyl amino acids as a model protoamphiphilic system

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10714909

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2010714909

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 13263032

Country of ref document: US