WO2010115629A2 - Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy - Google Patents

Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy Download PDF

Info

Publication number
WO2010115629A2
WO2010115629A2 PCT/EP2010/002205 EP2010002205W WO2010115629A2 WO 2010115629 A2 WO2010115629 A2 WO 2010115629A2 EP 2010002205 W EP2010002205 W EP 2010002205W WO 2010115629 A2 WO2010115629 A2 WO 2010115629A2
Authority
WO
WIPO (PCT)
Prior art keywords
target
binding moiety
amatoxin
linker
amanitin
Prior art date
Application number
PCT/EP2010/002205
Other languages
French (fr)
Other versions
WO2010115629A3 (en
Inventor
Heinz Faulstich
Gerhard Moldenhauer
Simon Werner
Jan Anderl
Christoph Muller
Original Assignee
Deutsches Krebsforschungszentrum
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2758201A priority Critical patent/CA2758201C/en
Priority to EP18214020.2A priority patent/EP3485912A1/en
Priority to EP17158119.2A priority patent/EP3192529B1/en
Priority to AU2010234334A priority patent/AU2010234334B2/en
Priority to US13/263,287 priority patent/US9233173B2/en
Priority to ES10713429.8T priority patent/ES2621104T3/en
Application filed by Deutsches Krebsforschungszentrum filed Critical Deutsches Krebsforschungszentrum
Priority to PL17158119T priority patent/PL3192529T3/en
Priority to EP10713429.8A priority patent/EP2416804B1/en
Publication of WO2010115629A2 publication Critical patent/WO2010115629A2/en
Publication of WO2010115629A3 publication Critical patent/WO2010115629A3/en
Priority to US14/954,266 priority patent/US10513559B2/en
Priority to CY20201100329T priority patent/CY1122855T1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817—Toxins
    • A61K47/6831—Fungal toxins, e.g. alpha sarcine, mitogillin, zinniol or restrictocin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/06—Antipsoriatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/18—Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/02—Antineoplastic agents specific for leukemia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06—Antianaemics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the invention relates to tumour therapy.
  • the present invention relates to conjugates of a toxin and a target-binding moiety, e.g. an antibody, which are useful in the treatment of cancer.
  • the toxin is an amatoxin
  • the target-binding moiety is preferably directed against tumour-associated antigens.
  • the amatoxin is conjugated to the antibody by linker moieties.
  • the linker moieties are covalently bound to functional groups located in positions of the amatoxin proved as preferred positions for the attachment of linkers with respect to optimum antitumor activity.
  • the invention relates to pharmaceutical compositions comprising such target-binding moiety toxin conjugates and to the use of such target-binding moiety toxin conjugates for the preparation of such pharmaceutical compositions.
  • the target-binding moiety toxin conjugates and pharmaceutical compositions of the invention are useful for the treatment of cancer.
  • ADC antibody-drug conjugates
  • cytotoxic or cytostatic agents i. e. drugs to kill or inhibit tumor cells in the treatment of cancer
  • cytotoxic or cytostatic agents i. e. drugs to kill or inhibit tumor cells in the treatment of cancer
  • cytotoxic or cytostatic agents i. e. drugs to kill or inhibit tumor cells in the treatment of cancer
  • cytostatic agents i. e. drugs to kill or inhibit tumor cells in the treatment of cancer
  • systemic administration of these unconjugated drug agents may result in unacceptable levels of toxicity to normal cells as well as the tumor cells sought to be. Maximal efficacy with minimal toxicity is sought thereby.
  • Efforts to design and refine ADC have focused on the selectivity of monoclonal antibodies (mAbs) as well as drug-linking and drug-releasing properties. Both polyclonal antibodies and monoclonal antibodies have been reported as useful in these strategies.
  • Amatoxins are cyclic peptides composed of 8 amino acids. They can be isolated from
  • Epithelial cell adhesion molecule (EpCAM, CD326) is one of the best-studied target antigens on human tumors (Trzpis et al., 2007; Baeuerle and Gires, 2007). It represents a type I membrane glycoprotein of 314 amino acids with an apparent molecular weight of 40 kDa (Balzar et al., 1999). It is overexpressed in the majority of adenocarcinomas (Winter et al., 2003; Went et al., 2004). In particular, EpCAM expression is enhanced in node-positive breast cancer, epithelial ovarian cancer, cholangiocarcinoma, pancreatic adenocarcinoma and squamous cell head and neck cancer.
  • EpCAM is expressed by tumor initiating or cancer stem cells in mammary, colorectal and pancreatic carcinomas (Al-Hajj et al., 2003; Dalerba et al., 2007; Li et al., 2007).
  • EpCAM-specific monoclonal antibodies have been used as a diagnostic tool for the detection of rare circulating tumor cells in cancer patients (Allard et al., 2004; Nagrath et al., 2007). A couple of engineered anti-EpCAM antibodies are currently investigated in clinical studies.
  • HER2 Her2/neu; ErbB2
  • HER2 a receptor tyrosine kinase with an apparent molecular weight of 185 kDa is overexpressed in about 25-30% of human breast cancers and gastric cancers.
  • This overexpression which is often due to amplification of the receptor-encoding gene, generally represents a poor prognosis, often involving progressive disease in the years after the initial diagnosis is made.
  • Trastuzumab is an IgGl kappa antibody that contains human framework regions with the complementarity-determining regions of a murine antibody (4D5) that binds to HER2.
  • Trastuzumab binds to the HER2 antigen and thus inhibits the growth of cancerous cells.
  • trastuzumab is a humanized antibody, it minimizes any HAMA response in patients.
  • Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumor cells that overexpress HER2.
  • Trastuzumab is a mediator of antibody-dependent cellular cytotoxicity, ADCC.
  • HERCEPTIN ® is clinically active in patients with ErbB2-overexpressing metastatic breast cancers that have received extensive prior anti-cancer therapy. Although HERCEPTIN ® is a breakthrough in treating patients with ErbB2-overexpressing breast cancers that have received extensive prior anti-cancer therapy, the majority of the patients in this population fail to respond or respond only poorly to HERCEPTIN ® treatment. Therefore, there is a significant clinical need for developing further HER2-directed cancer therapies for those patients with HER2-overexpressing tumors or other diseases associated with HER2 expression that do not respond, or respond poorly, to HERCEPTIN ® treatment.
  • target-binding moiety toxin conjugates that exert their toxic effects to target cells or tissues at much lower concentration so that the conjugates may be administered at lower concentrations and harmful side effects to non-target cells are minimized.
  • the present invention fulfils these and other needs.
  • the inventors found out in the experiments underlying the present invention that very effective target-binding moiety toxin conjugates, in particular antibody amatoxin conjugates, can be constructed by choosing particular linkage points in the amatoxin part of the conjugate and by choosing particular linker compounds.
  • target-binding moiety toxin conjugates are very effective in that they exert their toxic activity to the target cells at very low concentrations (IC 50 of about 5xlO '12 M) as well as by being highly specific for their target cells.
  • IC 50 concentration of about 5xlO '12 M
  • these advantages might be explained in that the linkage between the target-binding moiety and the amatoxin or, if present, between the linker and the amatoxin is efficiently cleaved inside the target cell and to a much lesser degree outside the cell.
  • the present invention relates to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) at least one amatoxin; and (iii) optionally a linker L2; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker L2 via the 6' C-atom of amatoxin amino acid 4.
  • the present invention relates to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) at least one amatoxin; and (iii) optionally a linker L3; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via the ⁇ C-atom of amatoxin amino acid 3.
  • the present invention relates to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) at least one amatoxin; and (iii) optionally a linker Ll; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker Ll via the ⁇ C-atom of amatoxin amino acid 1.
  • the present invention relates to the target-binding moiety toxin conjugate according to the first, the second, or the third aspect for use in medicine.
  • the present invention relates to the target-binding moiety toxin conjugate according to the first, the second, the third or the fourth aspect for the treatment of cancer or of an autoimmune disease in a patient, wherein the cancer is preferably selected from the group consisting of pancreatic cancer, cholangiocarcinoma, breast cancer, colorectal cancer, lung cancer, prostate cancer, ovarian cancer, stomach cancer, kidney cancer, head and neck cancer, brain tumors, childhood neoplasms, soft tissue sarcomas, epithelial skin cancer, malignant melanoma, leukemia, and malignant lymphoma and wherein the autoimmune disease is preferably selected from the group consisting of Ankylosing Spondylitis, Chagas disease, Crohns Disease, Dermatomyositis, Diabetes mellitus type 1, Goodpasture's syndrome
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising at least one type of target-binding moiety toxin conjugate according to the first, the second, and/or the third aspect and further comprising one or more pharmaceutically acceptable diluents, carriers, excipients, fillers, binders, lubricants, glidants, disintegrants, adsorbents; and/or preservatives.
  • Fig. 1 shows the structural formulae of different amatoxins. The numbers in bold type
  • (1 to 8) designate the standard numbering of the eight amino acids forming the amatoxin.
  • the standard designations of the atoms in amino acids 1 , 3 and 4 are also shown (Greek letters ⁇ to ⁇ , Greek letters ⁇ to ⁇ , and numbers from 1 ' to 7', respectively).
  • Fig. 2 shows a comparison of the binding affinities of huHEA125-Ama and huHEA125 to target cells by a binding competition analysis.
  • EpCAM-expressing Colo205 cells were incubated with a fixed amount of directly FITC-labeled mouse HEAl 25 antibody. Binding to target cells was analyzed by flow cytometry. Competition of binding with increasing amounts of huHEA125-Ama or huHEA125 revealed a very similar affinity towards the target antigen.
  • Fig. 3 shows the surface expression of EpCAM antigen on various carcinoma cell lines detected by indirect immunofluorescence: Fig. 3 A Capan-1; Fig. 3B Colo205; Fig. 3C OZ; and Fig. 3D MCF-7.
  • the grey-shaded histograms on the left side of each diagram show the results obtained with control antibody Xolair®; the histograms having a white area on the right side of each diagram show the results obtained with antibody huHEA125.
  • the abbreviation FLl-H stands for "fluorescence 1 height" which means the intensity of fluorescence 1, i.e. the green channel for FITC.
  • Fig. 4 shows the binding of huHEA125-Amanitin and huHEA125-Phalloidin conjugates to MCF-7 breast cancer cells analyzed by flow cytometry.
  • the abbreviation FLl- H stands for "fluorescence 1 height" which means the intensity of fluorescence 1, i.e. the green channel for FITC.
  • A bold histogram, huHEA125-Amanitinl; shaded histogram, huHEA125; dotted histogram, Xolair (negative control);
  • B bold histogram, huHEA125-Amanitin4; shaded histogram, huHEA125; dotted histogram, Xolair (negative control);
  • Fig. 5 shows a comparison of the inhibition of MCF-7 cell proliferation caused by the conjugate huHEA125-Amanitinl, the non-binding control conjugate Xolair-Amanitinl, and free Amanitin.
  • Fig. 6 shows a comparison of the inhibition of MCF-7 cell proliferation caused by the conjugate huHEA125-Amanitin4, the conjugate alpha-phalloidin-huHEA125, and free Amanitin.
  • Fig. 7 shows a comparison of the inhibition of Capan-1 cell proliferation caused by conjugate huHEA125-Amanitin3, Amanitin-armed control antibody Xolair®, and free Amanitin.
  • Fig. 8 shows a comparison of the inhibition of Colo205 cell proliferation caused by conjugate huHEA125-Amanitin3, Amanitin-armed control antibody Xolair®, and free Amanitin.
  • Fig. 9 shows a comparison of the inhibition of MCF-7 cell proliferation caused by conjugate huHEA125-Amanitin3, Amanitin-armed control antibody Xolair®, and free Amanitin.
  • Fig. 10 shows a comparison of the inhibition of OZ cell proliferation caused by conjugate huHEA125-Amanitin3, Amanitin-armed control antibody Xolair®, and free Amanitin.
  • Fig 11 A to D show a comparison of the inhibition on cell proliferation exerted by various ⁇ -amanitin conjugates at different amanitin concentrations using the Her2/neu positive cell lines SKO V-3, SKBR-3 and NCI-N87 as well as the Her2/neu negative cell line MDA-MB231.
  • Fig. 12 shows the antitumor activity of various ⁇ -amanitin conjugates at two different concentrations (A: 30 ⁇ g/kg and B: 150 ⁇ g/kg body weight) in an in vivo SKOV-3 xenograft tumor model.
  • target-binding moiety refers to any molecule or part of a molecule that can specifically bind to a target molecule or target epitope.
  • Preferred target- binding moieties in the context of the present application are (i) antibodies or antigen-binding fragments thereof; (ii) antibody-like proteins; and (iii) nucleic acid aptamers.
  • “Target-binding moieties” suitable for use in the present invention typically have a molecular mass of at least 15 kDa, at least 20 kDa, at least 30 kDa or of at least 40 kDa or more.
  • an "antibody toxin conjugate” refers to a target-binding moiety toxin conjugate in which the target-binding moiety is an antibody or antigen-binding fragment thereof according to above alternative (i).
  • an "antibody-like protein toxin conjugate” refers to a target-binding moiety toxin conjugate in which the target-binding moiety is an antibody-like protein according to above alternative (ii).
  • an "aptamer conjugate” refers to a target-binding moiety toxin conjugate in which the target-binding moiety is a nucleic acid aptamer according to above alternative (iii).
  • target molecule and “target epitope”, respectively, refers to an antigen and an epitope of an antigen, respectively, that is specifically bound by a target-binding moiety, preferably the target molecule is a tumour- associated antigen, in particular an antigen or an epitope which is present on the surface of one or more tumour cell types in an increased concentration and/or in a different steric configuration as compared to the surface of non-tumour cells or an antigen preferentially expressed on cells involved in autoimmune diseases, examples of such antigens are Immunoglobulin G Fc-part, Thyreotropin-receptor, Type IV Collagen, Proteinase 3, DNA Topoisomerase I, Placoglobin.
  • said antigen or epitope is present on the surface of one or more tumour cell types but not on the surface of non-tumour cells.
  • tumour associated antigen comprises all substances, which elicit an immune response against a tumour.
  • Particular suitable substances are those which are enriched in a tumour cell in comparison to a healthy cell. These substances are preferably present within and/or are accessible on the outside of the tumour cell. If the tumour antigen is only present within a tumour cell, it will still be accessible for the immune system, since the antigen or fragments thereof will be presented by the MHC system at the surface of the cell. In a preferred aspect tumour antigen is almost exclusively present on and/or in the tumour cell and not in a healthy cell of the same cell type.
  • Suitable tumour antigens can be identified, for example, by analyzing the differential expression of proteins between tumour and healthy cells of the same cell type using a microarray-based approach (Russo et al, Oncogene. 2003,22 : 6497-507), by PCR- or microarray-based screening for tumor specific mutated cellular genes (Heller, Annu. Rev.
  • tumour antigens are selected, which elicit a strong immune response, preferentially a MHC class I immune response.
  • Antigens eliciting a strong immune response will induce at least 1%, preferably at least 5%, more preferably at least 10% and most preferably at least 15% IFN- ⁇ -producing CD8 + T or CD4 + T cells isolated from mice previously immunized with the antigen, upon challenge with the antigen and/or will induce preferably at least 5%, and most preferably at least 15% of B-cells cells isolated from mice previously immunized with the antigen, upon challenge with the antigen to proliferate.
  • Antigens fulfilling these criterions are candidates for use in therapeutic and/or prophylactic cancer vaccines.
  • tumour antigen is selected from the group consisting of T-cell or B-cell-defined cancer-associated antigens belonging to unique gene products of mutated or recombined cellular genes, in particular cyclin-dependent kinases (e.g.
  • tumour antigens are antigens derived from HER-2 and EpCAM.
  • fragment refers to C- terminally and/or N-terminally deleted proteins, which comprise at least one epitope which can be specifically bound by a target-binding moiety.
  • antibody or antigen binding fragment thereof refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e. molecules that contain an antigen binding site that immunospecifically binds an antigen. Also comprised are immunoglobulin-like proteins that are selected through techniques including, for example, phage display to specifically bind to a target molecule, e.g. to the target protein EpCAM or Her2.
  • the immunoglobulin molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
  • Antibodies and antigen-binding fragments thereof suitable for use in the present invention include, but are not limited to, polyclonal, monoclonal, monovalent, bispecific, heteroconjugate, multispecific, human, humanized (in particular CDR-grafted), deimmunized, or chimeric antibodies, single chain antibodies (e.g.
  • scFv fragments
  • F(ab') 2 fragments fragments produced by a Fab expression library
  • diabodies or tetrabodies Holliger P. et al., 1993
  • nanobodies anti- idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above.
  • the antigen-binding fragments are human antigen-binding antibody fragments of the present invention and include, but are not limited to, Fab, Fab' and F(ab') 2> Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (dsFv) and fragments comprising either a VL or VH domain.
  • Antigen-binding antibody fragments, including single-chain antibodies may comprise the variable domain(s) alone or in combination with the entirety or a portion of the following: hinge region, CL, CHl, CH2, and CH3 domains. Also included in the invention are antigen-binding fragments also comprising any combination of variable domain(s) with a hinge region, CL, CHl, CH2, and CH3 domains.
  • Antibodies usable in the invention may be from any animal origin including birds and mammals.
  • the antibodies are from human, rodent (e.g. mouse, rat, guinea pig, or rabbit), chicken, pig, sheep, goat, camel, cow, horse, donkey, cat, or dog origin. It is particularly preferred that the antibodies are of human or murine origin.
  • "human antibodies” include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin and that do not express endogenous immunoglobulins, as described for example in U.S. Patent No. 5,939,598 by Kucherlapati & Jakobovits.
  • antibody-like protein refers to a protein that has been engineered (e.g. by mutagenesis of loops) to specifically bind to a target molecule.
  • an antibody-like protein comprises at least one variable peptide loop attached at both ends to a protein scaffold. This double structural constraint greatly increases the binding affinity of the antibody-like protein to levels comparable to that of an antibody.
  • the length of the variable peptide loop typically consists of 10 to 20 amino acids.
  • the scaffold protein may be any protein having good solubility properties.
  • the scaffold protein is a small globular protein.
  • Antibody-like proteins include without limitation affibodies, anticalins, designed ankyrin repeat proteins (for review see: Binz et al.
  • Antibody-like proteins can be derived from large libraries of mutants, e.g. be panned from large phage display libraries and can be isolated in analogy to regular antibodies. Also, antibody-like binding proteins can be obtained by combinatorial mutagenesis of surface-exposed residues in globular proteins.
  • nucleic acid aptamer refers to a nucleic acid molecule that has been engineered through repeated rounds of in vitro selection or SELEX (systematic evolution of ligands by exponential enrichment) to bind to a target molecule (for a review see: Brody and Gold, 2000).
  • the nucleic acid aptamer may be a DNA or RNA molecule.
  • the aptamers may contain modifications, e.g. modified nucleotides such as 2 '-fluorine-substituted pyrimidines.
  • amatoxin includes all cyclic peptides composed of 8 amino acids as isolated from the genus Amanita and described in ref. (Wieland, T. and Faulstich H., 1978); further all chemical derivatives thereof; further all semisynthetic analogs thereof; further all synthetic analogs thereof built from building blocks according to the master structure of the natural compounds (cyclic, 8 amino acids), further all synthetic or semisynthetic analogs containing non-hydroxylated amino acids instead of the hydroxylated amino acids, further all synthetic or semisynthetic analogs, in which the thioether sulfoxide moiety is replaced by a sulfide, sulfone, or by atoms different from sulfur, e.g.
  • amatoxins are defined as peptides or depsipeptides that inhibit mammalian RNA polymerase II.
  • Preferred amatoxins are those with a functional group (e.g. a carboxylic group, an amino group, a hydroxy group, a thiol or a thiol-capturing group) that can be reacted with linker molecules or target-binding moieties as defined above.
  • Amatoxins which are particularly suitable for the conjugates of the present invention are ⁇ -amanitin, ⁇ - amanitin, ⁇ -amanitin, ⁇ -amanitin, amanin, amaninamide, amanullin, and amanullinic acid as shown in Fig. 1 as well as salts, chemical derivatives, semisynthetic analogs, and synthetic analogs thereof.
  • Particularly preferred amatoxins for use in the present invention are ⁇ - amanitin, ⁇ -amanitin, and amaninamide.
  • a “chemical derivative” (or short: a “derivative”) of a compound refers to a species having a chemical structure that is similar to the compound, yet containing at least one chemical group not present in the compound and/or deficient of at least one chemical group that is present in the compound.
  • the compound to which the derivative is compared is known as the "parent” compound.
  • a “derivative” may be produced from the parent compound in one or more chemical reaction steps.
  • an “analog” of a compound is structurally related but not identical to the compound and exhibits at least one activity of the compound.
  • the compound to which the analog is compared is known as the "parent” compound.
  • the afore-mentioned activities include, without limitation: binding activity to another compound; inhibitory activity, e.g. enzyme inhibitory activity; toxic effects; activating activity, e.g. enzyme-activating activity. It is not required that the analog exhibits such an activity to the same extent as the parent compound.
  • a compound is regarded as an analog within the context of the present application, if it exhibits the relevant activity to a degree of at least 1% (more preferably at least 5%, more preferably at least 10%, more preferably at least 20%, more preferably at least 30%, more preferably at least 40%, and more preferably at least 50%) of the activity of the parent compound.
  • an "analog of an amatoxin” refers to a compound that is structurally related to any one of ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, ⁇ - amanitin, amanin, amaninamide, amanullin, and amanullinic acid as shown in Fig.
  • RNA polymerase II that exhibits at least 1% (more preferably at least 5%, more preferably at least 10%, more preferably at least 20%, more preferably at least 30%, more preferably at least 40%, and more preferably at least 50%) of the inhibitory activity against mammalian RNA polymerase II as compared to at least one of ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, amanin, amaninamide, amanullin, and amanullinic acid.
  • An "analog of an amatoxin" suitable for use in the present invention may even exhibit a greater inhibitory activity against mammalian RNA polymerase II than any one of ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, amanin, amaninamide, amanullin, or amanullinic acid.
  • the inhibitory activity might be measured by determining the concentration at which 50% inhibition occurs (IC 50 value).
  • the inhibitory activity against mammalian RNA polymerase II can be determined indirectly by measuring the inhibitory activity on cell proliferation. A suitable assay for measuring inhibition of cell proliferation is described in Example 3.
  • a “semisynthetic analog” refers to an analog that has been obtained by chemical synthesis using compounds from natural sources (e.g. plant materials, bacterial cultures, or cell cultures) as starting material. Typically, a “semisynthetic analog” of the present invention has been synthesized starting from a compound isolated from a mushroom of the Amanita family. In contrast, a “synthetic analog” refers to an analog synthesized by so-called total synthesis from small (typically petrochemical) building blocks. Usually, this total synthesis is carried out without the aid of biological processes.
  • a “linker” in the context of the present application refers to a molecule that increases the distance between two components, e.g. to alleviate steric interference between the target- binding moiety and the amatoxin, which may otherwise decrease the ability of the amatoxin to interact with RNA polymerase II.
  • the linker may serve another purpose as it may facilitate the release of the amatoxin specifically in the cell being targeted by the target binding moiety. It is preferred that the linker and preferably the bond between the linker and the amatoxin on one side and the bond between the linker and the antibody on the other side is stable under the physiological conditions outside the cell, e.g. the blood, while it can be cleaved inside the cell, in particular inside the target cell, e.g.
  • the linker may comprise functionalities that are preferably pH-sensitive to generate pH-sensitive linkers as described, e.g. in S. Fletcher, M. R. Jorgensens and A. D. Miller; Org. Lett. 2004, 6(23), pp 4245-4248, or protease sensitive to generate protease sensitive linkers as described, e.g. in L. DA Ibsen, Blood 2003, 102, 1458-65 or Francisco JA, Cerreny CG, Meyer DL, Nat. Biotechnol 2003, 21, 778-84.
  • the bond linking the linker to the target binding moiety may provide the selective stability.
  • a linker has a length of at least 1, preferably of 1-20 atoms length (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 atoms) wherein one side of the linker has been reacted with the amatoxin and, the other side with a target-binding moiety.
  • 1-20 atoms length e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 atoms
  • a linker preferably is a C 1-20 -alkyl, C 1-20 -heteroalkyl, C 2-20 -alkenyl, C 2-20 -heteroalkenyl, C 2-20 - alkynyl, C 2-20 -heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, aralkyl, or a heteroaralkyl group, optionally substituted.
  • the linker may contain one or more structural elements such as amide, ester, ether, thioether, disulfide, hydrocarbon moieties and the like. The linker may also contain combinations of two or more of these structural elements.
  • each one of these structural elements may be present in the linker more than once, e.g. twice, three times, four times, five times, or six times.
  • the linker may comprise a disulfide bond. It is understood that the linker has to be attached either in a single step or in two or more subsequent steps to the amatoxin and the target binding moiety. To that end the linker to be will carry two groups, preferably at a proximal and distal end, which can (i) form a covalent bond to a group, preferably an activated group on an amatoxin or the target binding-peptide or (ii) which is or can be activated to form a covalent bond with a group on an amatoxin.
  • linker if the linker is present, it is preferred that chemical groups are at the distal and proximal end of the linker, which are the result of such a coupling reaction, e.g. an ester, an ether, a urethane, a peptide bond etc.
  • the presence of a "linker” is optional, i.e. the toxin may be directly linked to a residue of the target-binding moiety in some embodiments of the target-binding moiety toxin conjugate of the present invention. It is preferred that the linker is connected directly via a bond to the targeting moiety, preferably at its terminus. If the target-binding moiety comprises free amino, carboxy or sulfhydryl groups, e.g. in the form of Asp, GIu, Arg, Lys, Cys residues, which may be comprised in a polypeptide, then it is preferred that the linker is coupled to such a group.
  • a first compound e.g. an antibody
  • a second compound e.g. an antigen, such as a target protein
  • K D dissociation constant K D to said second compound of 100 ⁇ M or less, preferably 50 ⁇ M or less, preferably 30 ⁇ M or less, preferably 20 ⁇ M or less, preferably 10 ⁇ M or less, preferably 5 ⁇ M or less, more preferably 1 ⁇ M or less, more preferably 900 nM or less, more preferably 800 nM or less, more preferably 700 nM or less, more preferably 600 nM or less, more preferably 500 nM or less, more preferably 400 nM or less, more preferably 300 nM or less, more preferably 200 nM or less, even more preferably 100 nM or less, even more preferably 90 nM or less, even more preferably 80 nM or less, even more preferably 70 nM or less, even more preferably
  • a "patient” means any mammal or bird who may benefit from a treatment with the target-binding moiety toxin conjugates described herein.
  • a “patient” is selected from the group consisting of laboratory animals (e.g. mouse or rat), domestic animals (including e.g. guinea pig, rabbit, chicken, pig, sheep, goat, camel, cow, horse, donkey, cat, or dog), or primates including human beings. It is particularly preferred that the "patient” is a human being.
  • treat means accomplishing one or more of the following: (a) reducing the severity of the disorder; (b) limiting or preventing development of symptoms characteristic of the disorder(s) being treated; (c) inhibiting worsening of symptoms characteristic of the disorder(s) being treated; (d) limiting or preventing recurrence of the disorder(s) in patients that have previously had the disorder(s); and (e) limiting or preventing recurrence of symptoms in patients that were previously symptomatic for the disorder(s).
  • administering includes in vivo administration, as well as administration directly to tissue ex vivo, such as vein grafts.
  • an “effective amount” is an amount of a therapeutic agent sufficient to achieve the intended purpose.
  • the effective amount of a given therapeutic agent will vary with factors such as the nature of the agent, the route of administration, the size and species of the animal to receive the therapeutic agent, and the purpose of the administration.
  • the effective amount in each individual case may be determined empirically by a skilled artisan according to established methods in the art.
  • “Pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
  • the present invention is directed to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) an amatoxin; and (iii) optionally a linker L2; wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker L2 via the 6' C-atom of amatoxin amino acid 4 (see Fig. 1).
  • said amino acid 4 is 2'-sulfur-substituted tryptophan or 2'-sulfur- substituted 6 '-hydroxy-tryptophan.
  • the amatoxin is connected to the target- binding moiety or, if present, to the linker L2 via an oxygen atom bound to the 6' C-atom of amatoxin amino acid 4. It is further preferred that the amatoxin is connected to the target- binding moiety or, if present, to the linker L2 via an ether linkage (i.e. amatoxin-O-L2 or amatoxin-0-target-binding moiety). In these embodiments, it is preferred that amino acid 4 is 6 ' -hydroxy-tryptophan.
  • the linker L2 is present and the conjugate has the following structure: amatoxin-6'C-O-L2-C(O)-NH-target-binding moiety.
  • the present invention is directed to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) an amatoxin; and (iii) optionally a linker L3; wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via the ⁇ C-atom of amatoxin amino acid 3 (see Fig. 1).
  • said amino acid 3 is isoleucine, ⁇ -hydroxy-isoleucine or ⁇ , ⁇ - dihydroxy-isoleucine.
  • the amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via an oxygen atom bound to the ⁇ C- atom of amatoxin amino acid 3. It is further preferred that the amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via an ester linkage preferably in the form of an amatoxin-O-C(O)-L3 -target binding boiety or an amatoxin-O-C(O)-target-binding moiety, more preferably an amatoxin- ⁇ C-O-C(O)-L3 -target-binding moiety or an amatoxin- ⁇ C-O-C(O)-target-binding moiety, i.e.
  • amino acid 3 is ⁇ , ⁇ -dihydroxy-isoleucine.
  • the linker L3 is present and the conjugate has one of the following structures: (i) amatoxin- ⁇ C-O-C(O)-L3-C(O)-NH-target- binding moiety; (ii) amatoxin- ⁇ C-O-L3-C(O)-NH-target-binding moiety; or (iii) amatoxin- ⁇ C-O-C(O)-NH-L3-C(O)-NH-target-binding moiety, i.e.
  • amatoxin- ⁇ CH 2 -O-C(O)-L3- C(O)-NH-target-binding moiety (i) amatoxin- ⁇ CH 2 -O-C(O)-L3- C(O)-NH-target-binding moiety; (ii) amatoxin- ⁇ CH 2 -O-L3-C(O)-NH-target-binding moiety; or (iii) amatoxin- ⁇ CH 2 -O-C(O)-NH-L3-C(O)-NH-target-binding moiety.
  • the present invention is directed to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) an amatoxin; and (iii) optionally a linker Ll; wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker Ll via the ⁇ C-atom of amatoxin amino acid 1 (see Fig. 1).
  • said amino acid 1 is asparagine or aspartic acid.
  • the amatoxin is connected to the target- binding moiety or, if present, to the linker Ll via a nitrogen atom bound to the ⁇ C-atom of amatoxin amino acid 1. It is further preferred that the amatoxin is connected to the target- binding moiety or, if present, to the linker Ll via an amide linkage (i.e. amatoxin-C(O)-NH- Ll or amatoxin-C(O)-NH-target-binding moiety; the C-atom in the aforementioned C(O)- moiety is the ⁇ C-atom of amatoxin amino acid 1). In these embodiments, it is preferred that amino acid 1 is asparagine.
  • the linker Ll is present and the conjugate has the following structure: amatoxin- ⁇ C(O)-NH-Ll-C(O)-NH-target-binding moiety.
  • the amide on the target-binding moiety side of the conjugate is the product of a reaction with a free amino group that was present in the target-binding moiety.
  • the target-binding moiety is connected to the amatoxin or, if present, to the linker Ll, L2, or L3 via an amino group present in the target-binding moiety.
  • the amatoxin is selected from ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, amanin, amaninamide, amanullin, or amanullinic acid (all shown in Fig. 1), as well as salts, chemical derivatives, semisynthetic analogs, and synthetic analogs thereof.
  • Particularly preferred amatoxins are ⁇ - amanitin, ⁇ -amanitin, and amaninamide, as well as salts, chemical derivatives, semisynthetic analogs, and synthetic analogs thereof.
  • the target binding moiety is in preferred embodiments a protein, in particular an antibody.
  • Proteins and in particular antibodies will comprise several amino acids, which allow the coupling of amatoxins.
  • Preferred amino acids have free amino, hydroxy, or carbonyl- groups, including Lys, GIn, GIu, Asp, Asn, Thr, and Ser. Accordingly, it is possible to couple more than one amatoxin molecules to one protein molecule.
  • An increase of the number of amatoxins per molecule will also increase the toxicity.
  • the ratio of protein to amatoxin is between 1 protein molecule to between 1 and 15 amatoxin molecules, preferably 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15.
  • the dimmer is considered as one molecule. Similar ratios are preferred, if the target binding moiety is not a protein.
  • the linker Ll, L2, or L3 has above indicated meaning and preferred meanings.
  • the linker Ll, L2, or L3 comprises a disulfide bond.
  • the linker Ll, L2, or L3 has a length of 1 to 20 atoms, e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 atoms.
  • the length of the linker is defined as the shortest connection - as measured by the number of atoms or bonds - between the toxin moiety and the target-binding moiety.
  • the target-binding moiety specifically binds to an epitope that is present on a tumour cell. It is particularly preferred that the target-binding moiety specifically binds to an epitope of T-cell- or B-CeIl- defined cancer-associated antigen belonging to unique gene products of mutated or recombined cellular genes, in particular cyclin-dependent kinases (e.g.
  • the target-binding moiety is selected from the group consisting of: (i) antibody or antigen-binding fragment thereof; (ii) antibody-like protein; and (iii) nucleic acid aptamer.
  • the antibody or the antigen-binding fragment thereof is selected from a diabody, a tetrabody, a nanobody, a chimeric antibody, a deimmunized antibody, a humanized antibody or a human antibody.
  • the antigen binding fragment is selected from the group consisting of Fab, F(ab') 2 , Fd, Fv, single-chain Fv, and disulf ⁇ de-linked Fvs (dsFv).
  • the antibody or the antigen binding fragment thereof comprises (a) either the membrane-bound form of the heavy chain of huHEA125 (SEQ ID NO: 1) or the soluble form of the heavy chain of huHEA125 (SEQ ID NO: 2); and/or (b) the light chain of huHEA125 (SEQ ID NO: 11).
  • the target-binding moiety toxin conjugate comprises (i) an antibody or an antigen binding fragment thereof specifically binding to epithelial cell adhesion molecule (EpCAM), wherein the antibody or an antigen binding fragment thereof comprises: (a) the heavy chain of huHEA125, wherein the heavy chain is selected from the group consisting of: (al) the membrane-bound form of the heavy chain according to SEQ ID NO: 1, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g.
  • EpCAM epithelial cell adhesion molecule
  • amino acid deletions and/or between 0 and 10 amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 26 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g.
  • variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VH
  • the constant domain of the heavy chain as shown in SEQ ID NO: 27 comprises between 0 and 10 (e.g.
  • amino acid exchanges between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions; and (b) the light chain of huHEA125 according to SEQ ID NO: 11, wherein the variable domain of the light chain VL as shown in SEQ ID NO: 12 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g.
  • the constant domain of the light chain CL as shown in SEQ ID NO: 28 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions; (ii) an amatoxin; and (iii) optionally a linker Ll, L2, or L3.
  • the target-binding moiety toxin conjugate comprises: (a) the heavy chain of huHEA125, wherein the heavy chain is selected from the group consisting of: (al) the membrane-bound form of the heavy chain according to SEQ ID NO: 1, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g.
  • variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VH; and (b) the light chain of huHEA125 according to SEQ ID NO:
  • variable domain of the light chain VL as shown in SEQ ID NO: 12 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0,
  • the target-binding moiety toxin conjugate comprises: (a) the heavy chain of huHEA125, wherein the heavy chain is selected from the group consisting of: (al) the membrane-bound form of the heavy chain according to SEQ ID NO: 1, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 26 comprises between 0 and 10 (e.g.
  • variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 27 comprises between 0 and 10 (e.g.
  • variable domain of the light chain VL as shown in SEQ ID NO: 12 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions positioned in the framework regions of VL
  • constant domain of the light chain CL as shown in SEQ ID NO: 28 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions.
  • the target-binding moiety toxin conjugate comprises: (a) the heavy chain of huHEA125, wherein the heavy chain is selected from the group consisting of: (al) the membrane-bound form of the heavy chain according to SEQ ID NO: 1, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 26 comprises between 0 and 10 (e.g.
  • variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 27 comprises between 0 and 10 (e.g.
  • variable domain of the light chain VL as shown in SEQ ID NO: 12 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges positioned in the framework regions of VL
  • constant domain of the light chain CL as shown in SEQ ID NO: 28 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges.
  • the target-binding moiety comprises the heavy chain of huHEA125 (membrane-bound form, SEQ ID NO: 1) and/or the light chain of huHEA125 (SEQ ID NO: 11).
  • the heavy chain of huHEA125 and/or the light chain of huHEA125 each comprise independently from each other up to 20 (e.g.
  • amino acid exchanges, deletions, or additions wherein these amino acid exchanges, deletions, or additions may be positioned in the constant domains of the heavy chain and/or in the constant domain of the light chain and/or in the framework regions of the variable domain of the heavy chain and/or in the framework regions of the variable domain of the light chain.
  • the antibody is a complete IgG antibody comprising two heavy chains of huHEA125 (SEQ ID NO: 1) and two light chains of huHEA125 (SEQ ID NO: 11), wherein one heavy chain is connected to one light chain via a disulfide linkage and wherein the heavy chains are connected to each other by one or two (preferably two) disulfide linkages.
  • the target-binding moiety comprises the heavy chain of huHEA125 (soluble form, SEQ ID NO: 2) and/or the light chain of huHEA125 (SEQ ID NO: 11).
  • the heavy chain of huHEA125 and/or the light chain of huHEA125 each comprise independently from each other up to 20 (e.g.
  • amino acid exchanges, deletions, or additions wherein these amino acid exchanges, deletions, or additions may be positioned in the constant domains of the heavy chain and/or in the constant domain of the light chain and/or in the framework regions of the variable domain of the heavy chain and/or in the framework regions of the variable domain of the light chain.
  • the antibody is a complete IgG antibody comprising two heavy chains of huHEA125 (SEQ ID NO: 2) and two light chains of huHEA125 (SEQ ID NO: 11), wherein one heavy chain is connected to one light chain via a disulfide linkage and wherein the heavy chains are connected to each other by one or two (preferably two) disulfide linkages.
  • the present invention is directed to the target-binding moiety toxin conjugate according to the first, the second, or the third aspect for use in medicine.
  • the present invention is directed to the target-binding moiety toxin conjugate according to the first, the second, the third or the fourth aspect for the treatment of cancer or an autoimmune disease in a patient, wherein the cancer is preferably selected from the group consisting of pancreatic cancer, cholangiocarcinoma, breast cancer, colorectal cancer, lung cancer, prostate cancer, ovarian cancer, stomach cancer, kidney cancer, head and neck cancer, brain tumors, childhood neoplasms, soft tissue sarcomas, epithelial skin cancer, malignant melanoma, leukemia, and malignant lymphoma and wherein the autoimmune disease is preferably selected from the group consisting of Ankylosing Spondylitis, Chagas disease, Crohns Disease, Dermatomyositis, Diabetes mellitus type 1, Goodpasture's syndrome,
  • the present invention is directed to a pharmaceutical composition
  • a pharmaceutical composition comprising at least one type of the target-binding moiety toxin conjugate according to the first, the second, or the third aspect and further comprising one or more pharmaceutically acceptable diluents, carriers, excipients, fillers, binders, lubricants, glidants, disintegrants, adsorbents; and/or preservatives.
  • the pharmaceutical composition may comprise two or more different target-binding moiety toxin conjugates.
  • the target binding moieties bind to different targets..
  • the pharmaceutical composition of the seventh aspect or as prepared in the sixth aspect can be used in the form of systemically administered medicaments.
  • parenterals which comprise among others injectables and infusions.
  • injectables are formulated either in the form of ampoules or as so called ready-for- use injectables, e.g. ready-to-use syringes or single-use syringes and aside from this in puncturable flasks for multiple withdrawal.
  • the administration of injectables can be in the form of subcutaneous (s.c), intramuscular (i.m.), intravenous (i.v.) or intracutaneous (i.e.) application.
  • Injectable formulations can further be produced as concentrates, which can be dissolved or dispersed with aqueous isotonic diluents.
  • the infusion can also be prepared in form of isotonic solutions, fatty emulsions, liposomal formulations and micro-emulsions. Similar to injectables, infusion formulations can also be prepared in the form of concentrates for dilution. Injectable formulations can also be applied in the form of permanent infusions both in in-patient and ambulant therapy, e.g. by way of mini-pumps.
  • parenteral drug formulations for example, albumin, plasma, expander, surface-active substances, organic diluents, pH-influencing substances, complexing substances or polymeric substances, in particular as substances to influence the adsorption of the target-binding moiety toxin conjugates of the invention to proteins or polymers or they can also be added with the aim to reduce the adsorption of the target-binding moiety toxin conjugates of the invention to materials like injection instruments or packaging-materials, for example, plastic or glass.
  • parenteral drug formulations for example, albumin, plasma, expander, surface-active substances, organic diluents, pH-influencing substances, complexing substances or polymeric substances, in particular as substances to influence the adsorption of the target-binding moiety toxin conjugates of the invention to proteins or polymers or they can also be added with the aim to reduce the adsorption of the target-binding moiety toxin conjugates of the invention to materials like injection instruments or packaging-materials, for example, plastic or glass.
  • target-binding moiety toxin conjugates of the invention can be bound to microcarriers or nanoparticles in parenterals like, for example, to finely dispersed particles based on poly(meth)acrylates, polylactates, polyglycolates, polyamino acids or polyether urethanes.
  • Parenteral formulations can also be modified as depot preparations, e.g.
  • the target-binding moiety toxin conjugates of the invention are introduced in finely dispersed, dispersed and suspended form, respectively, or as a suspension of crystals in the medicament or based on the "single unit principle” if the target-binding moiety toxin conjugate of the invention is enclosed in a formulation, e.g. in a tablet or a rod which is subsequently implanted.
  • a formulation e.g. in a tablet or a rod which is subsequently implanted.
  • implants or depot medicaments in single unit and multiple unit formulations often consist of so called biodegradable polymers like e.g. polyesters of lactic acid and glycolic acid, polyether urethanes, polyamino acids, poly(meth)acrylates or polysaccharides.
  • Adjuvants and carriers added during the production of the pharmaceutical compositions of the present invention formulated as parenterals are preferably aqua sterilisata (sterilized water), pH value influencing substances like, e.g. organic or inorganic acids or bases as well as salts thereof, buffering substances for adjusting pH values, substances for isotonization like e.g. sodium chloride, sodium hydrogen carbonate, glucose and fructose, tensides and surfactants, respectively, and emulsifiers like, e.g. partial esters of fatty acids of polyoxyethylene sorbitans (for example, Tween ® ) or, e.g.
  • aqua sterilisata sterilized water
  • pH value influencing substances like, e.g. organic or inorganic acids or bases as well as salts thereof
  • buffering substances for adjusting pH values e.g. sodium chloride, sodium hydrogen carbonate, glucose and fructose, tensides and surfactants, respectively
  • fatty acid esters of polyoxyethylenes for example, Cremophor ®
  • fatty oils like, e.g. peanut oil, soybean oil or castor oil
  • synthetic esters of fatty acids like, e.g. ethyl oleate, isopropyl myristate and neutral oil (for example, Miglyol ® ) as well as polymeric adjuvants like, e.g. gelatine, dextran, polyvinylpyrrolidone, additives which increase the solubility of organic solvents like, e.g. propylene glycol, ethanol, N,N-dimethylacetamide, propylene glycol or complex forming substances like, e.g.
  • organic solvents e.g. propylene glycol, ethanol, N,N-dimethylacetamide, propylene glycol or complex forming substances like, e.g.
  • citrate and urea preservatives like, e.g. benzoic acid hydroxypropyl ester and methyl ester, benzyl alcohol, antioxidants like e.g. sodium sulfite and stabilizers like e.g. EDTA.
  • preservatives like, e.g. benzoic acid hydroxypropyl ester and methyl ester, benzyl alcohol, antioxidants like e.g. sodium sulfite and stabilizers like e.g. EDTA.
  • thickening agents to prevent the setting of the target- binding moiety toxin conjugates of the invention or, tensides and polyelectrolytes to assure the resuspendability of sediments and/or complex forming agents like, for example, EDTA are added. It is also possible to achieve complexes of the active ingredient with various polymers. Examples of such polymers are polyethylene glycol, polystyrol, carboxymethyl cellulose, Pluronics ® or polyethylene glycol sorbit fatty acid ester.
  • the target-binding moiety toxin conjugates of the invention can also be incorporated in liquid formulations in the form of inclusion compounds e.g. with cyclodextrins. In particular embodiments dispersing agents can be added as further adjuvants. For the production of lyophilisates scaffolding agents like mannite, dextran, saccharose, human albumin, lactose, PVP or varieties of gelatine can be used.
  • the present invention is directed to a method of treating cancer, or an autoimmune disease
  • the cancer is preferably selected from pancreatic cancer, cholangiocarcinoma, breast cancer, colorectal cancer, lung cancer, prostate cancer, ovarian cancer, stomach cancer, kidney cancer, head and neck cancer, brain tumors, childhood neoplasms, soft tissue sarcomas, epithelial skin cancer, malignant melanoma, leukemia, or malignant lymphoma
  • the autoimmune disease is preferably selected from the group consisting of Ankylosing Spondylitis, Chagas disease, Crohns Disease, Dermatomyositis, Diabetes mellitus type 1, Goodpasture's syndrome, Graves' disease, Guillain-Barre syndrome (GBS), Hashimoto's disease, Hidradenitis suppurativa, Idiopathic thrombocytopenic purpura, Lupus erythematosus, Mixed Connective Tissue Disease, Myasthenia
  • Nucleic acid sequence (annotated according to the IMGT-nomenclature, IGHV/IGHD/IGHJ; IGHD underlined; IGHJ doubly underlined): FRl (SEQ ID NO: 4):
  • CDRl (SEQ ID NO: 5): GGATTCGATTTTAGTAGATTCTGG
  • TCAAGAGGTATTTCTATGGACTAC FR4 (SEQ ID NO: 10):
  • huHEA125 light chain Peptide sequence light chain (IGKV/IGKJ/IGKC; IGKC is underlined) (SEQ ID NO: 11):
  • Nucleic acid sequence (annotated according to the IMGT-nomenclature, IGKV/IGKJ; IGKV is underlined; IGKJ is doubly underlined):
  • FRI GACATCTTGCTGACTCAGTCTCCAGCCATCCTGTCTGTGAGTCCAGGAGAAAGAGTCA GTTTCTCCTGCAGGGCCAGT
  • CDRl (SEQIDNO: 14): CAGAGCATTGGCATAAGT
  • CDR2 (SEQ ID NO: 16): TATGCTTCT
  • CDR3 (SEQ ID NO: 18: CAACAAAGTAATATCTGGCCAACCACG
  • control antibody Xolair® (Omalizumab, human IgGl antibody directed against human IgE immunoglobulin) was produced by Novartis, Germany.
  • carcinoma cell lines The following carcinoma cell lines were used for growth inhibition studies with huHE A 125 -amatoxin conj ugates :
  • Colo205 colon cancer metastasis
  • carcinoma cell lines were used for growth inhibition studies or mouse xenograft studies with HERCEPTIN-amatoxin conjugates:
  • MDA-MB231 breast carcinoma Cells were obtained from the American Type Culture Collection (Manassas, USA).
  • reaction mixture was applied to 4 tic silica plates (20 x 20 cm) and developed in chloroform/methanol/water (65:25:5).
  • ⁇ -amanitin-hexamethylendiamide (II) was dissolved in 144 ⁇ l molecular sieve dried DMF.
  • 16.0 ⁇ l solution of DSS (disuccinimidyl suberate; 3.7 mg DSS/lOO ⁇ l DMF) or 16.0 ⁇ l solution of DSP (dithiobis(succinimidyl) propionate; 3.4 mg DSP/lOO ⁇ l DMF) and 3.7 ⁇ l triethylamine have been added respectively. Reaction was performed over night at RT. Reaction products have been precipitated by 2x 30ml dried diethylether and resolubilized in 133 ⁇ l dried DMF.
  • the ⁇ -amanitin conjugate with the control antibody Xolair (2mg/ml) was prepared according to the huHEA125 conjugate.
  • Ratio toxin : IgG was ca 1 : 1.
  • the precipitate of (I) was dissolved in 0.2 ml of DMF, added to 4 ml of huHEA125 (2 mg/ml) in PBS and rotated slowly over night at 5°C. Applied to a Sephadex G25 column (100 x 2cm) developed with PBS, the reaction product was separated from unreacted ⁇ -amanitin and N-hydroxysuccinimide. The toxin load was ca. 1 amanitin per IgG molecule.
  • DMSO dimethyl sulfoxide
  • Solvent A 95% water: 5% methanol 0.05% trifluoroacetic acid.
  • Solvent B 10% water: 90% methanol 0.05% trifluoroacetic acid.
  • Gradient 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A ; 27-30 min 100% A.
  • the fractions with the same retention time were collected and the solvents evaporated.
  • Solvent A 95% water: 5% methanol 0.05% trifluoroacetic acid.
  • Solvent B 10% water: 90% methanol 0.05% trifluoroacetic acid.
  • the fractions with the same retention time were collected and the solvents evaporated. 9.10mg (99% yield) of a white powder.
  • MS 1019 M+H+; 1041 M+Na+
  • DMF 59 ⁇ l (DSS) or 173 ⁇ l (DSP) of the DMF solutions were added to 6.0ml antibody solution (2 mg/ml in PBS). Reaction was performed over night at RT on a rotating shaker. Isolation of the antibody-conjugates (3) and (4) was performed by separation of macromolecular components on a G25-gelfiltration column.
  • Solvent A 95% water : 5% methanol 0.05% trifluoroacetic acid.
  • Solvent B 10% water: 90% methanol 0.05% trifluoroacetic acid.
  • Gradient 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A ; 27-35 min 100% A. The fractions with the same retention time (20.2 min) were collected and the solvent evaporated.
  • Solvent A 95% water : 5% methanol 0.05% trifluoroacetic acid.
  • Solvent B 10% water: 90% methanol 0.05% trifluoroacetic acid.
  • DCCi N,N-dicyclohexylcarbodimide; 3.4 mg DCCi/80 ⁇ l DMF
  • Reaction was performed over night at RT.
  • Reaction product was precipitated by 2x 30 ml dried diethylether and resolubilized in 800 ⁇ l dried DMF.
  • 266 ⁇ l of the DMF solution was added to 5.0 ml antibody solution (6mg/ml in PBS). Reaction was performed over night at RT on a rotating shaker. Isolation of the antibody-conjugate (7) was performed by separation of macromolecular components on a G25-gelf ⁇ ltration column.
  • DMF 122 ⁇ l (DSS) or 176 ⁇ l (DSP) of the DMF solutions were added to 6.0 ml of a solution of Her-2 specific Herceptin antibody (2 mg/ml in PBS). The reaction was performed over night at RT on a rotating shaker. The isolation of the antibody-conjugate (10) and (11), respectively, was performed by separation of macromolecular components on a G25-gelfiltration column.
  • ⁇ -amanitin (12) cat.: dibutyl dilaurylstannate n-bu 2 Sn[OCO(CH 2 )i 0 CH 3 ] 2
  • Solvent A 95% water : 5% acetonitrile.
  • Solvent B 5% water: 95% acetonitrile. Gradient: 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A; 27-35 min 100%A. The fractions with the same retention time 12-17min were collected and the solvents evaporated .
  • HDP compound (13) 10.0 mg HDP compound (13) was dissolved in 100 ⁇ l molecular sieve dried DMF. 80.0 ⁇ l solution of N-hydroxysuccinimide (7.4 mg N-OH-Succ/80 ⁇ l DMF) and 80.0 ⁇ l solution of DCCi (N,N-dicyclohexylcarbodimide; 3.4 mg DCCi/80 ⁇ l DMF) were added. The reaction was performed over night at RT. The reaction product was precipitated by 2x 30 ml dried diethylether and resolubilized in 800 ⁇ l dried DMF. 266 ⁇ l of the DMF solution was added to 5.0 ml antibody solution (6 mg/ml in PBS). Reaction was performed over night at RT on a rotating shaker. The isolation of the antibody-conjugate (14) was performed by separation of macromolecular components on a G25-gelfiltration column.
  • the plate was centrifuged (2 min at 2000 rpm) and the supernatant was removed from the cells.
  • Cells were re-suspended in 150 ⁇ l of FACS buffer and centrifuged again. After two washing steps by centrifugation, cells were taken up in 100 ⁇ l/well of propidium iodide solution (1 ⁇ g/ml in FACS buffer) allowing discrimination of dead cells. Analysis was performed on a FACScan cytometer (Becton and Dickinson, Heidelberg, Germany) using CellQuest software.
  • Binding of huHEA125-amanitin and huHEA125-phalloidin conjugates versus non- conjugated huHEA125 antibody was analyzed by flow cytometry.
  • MCF-7 target cells were washed twice in FACS buffer (Dulbecco's PBS with 1 % heat-inactivated fetal calf serum and 0.1 % sodium azide) counted and adjusted to 2x10 7 cells per ml. Fifty ⁇ l of cell suspension was given to each well of a 96 well U-bottom microtiter plate.
  • Immunotoxins huHEA125- amanitinl, huHEA125-amanitin4 and huHEA125-phalloidin as well as unconjugated huHEA125 antibody were added at a concentration of 1 ⁇ g/ml in a volume of 100 ⁇ l per well and incubated for 1 h on ice. The plate was centrifuged (2 min at 2000 rpm) and the supernatant was removed from the cells. Cells were re-suspended in 150 ⁇ l of FACS buffer and centrifuged again.
  • Example 3 Specific growth inhibition of carcinoma cells by immunoconjugates composed of huHEA125 antibody and amanitin at different binding sites
  • Figures 5, 6, and 9 Three examples of growth inhibition induced by different amanitin-IgG conjugates are depicted in Figures 5, 6, and 9.
  • Figure 5 shows a comparison of huHEA 125- Amanitin 1 with the non-binding control Xolair- Amanitin 1 and with free Amanitin.
  • huHEA125-Amanitin4 was compared with an alpha-phalloidin huHEA125 conjugate and with free Amanitin.
  • Figure 9 shows a comparison of huHEA125-Amanitin3 with Amanitin-armed control antibody Xolair and with free Amanitin.
  • the IC 5 o of conjugates huHEA125-amanitinl and huHEA125-amanitin4 were both approximately 5xlO '12 M ( Figures 5 and 6) and the IC 5O of conjugate huHEA125-amanitui3 was approximately 2x10 "12 M ( Figure 9).
  • the phalloidin-huHEA125 preparation exhibited virtually no effect at least at the dose levels tested (Fig. 6).
  • the IC 50 of Amanitin alone is in the range of 10 ' M ( Figures 5, 6, and 9).
  • Example 4 Specific growth inhibition of carcinoma cells by immunoconjugates composed of Herceptin antibody and amanitin at different binding sites and using different linking chemistry
  • Non conjugated Herceptin showed no cytotoxicity on any cell line while the various amanitin conjugates showed a marked toxicity on the Her2/neu positive cell lines with an EC 50 in the pico- to nanomolar range, no siginifcant toxicity was observed on the Her2/neu negative cell line. (See Figures HA to HD).
  • the indicated molar concentration is indicated on the basis of the entire amanitin comprised in the respective conjugate.
  • a mouse tumor xenograft model wherein 2.5 x 10 & SKO V-3 ovarial carcinoma cells are implated sub-cutaneously (s.c.) into SCID mice and allowed to grow for 10 days. After 10 days a single dose of 30 ⁇ g/kg body weight (see Figure 12A) or at 150 ⁇ g/kg body weight (see Figure 12B) of various ⁇ -amanitin-Herceptin conjugates (Compounds (15), (3), (4) , (10), (11), and (7)) and non-conjugated Herceptin (Control) were administered intravenously. A clear concentration dependent reduction of tumor growth was observed. Conjugates (7), (10) and (15) led to full tumor remission within the period of observation, i.e. 87 days from the initiation of the experiment.
  • Ep-CAM epithelial cell adhesion molecule
  • SEQ ID NO: 1 chimeric antibody huHEA125, heavy chain, membrane-bound form
  • SEQ ID NO: 2 chimeric antibody huHE A 125, heavy chain, secreted form
  • SEQ ID NO: 3 chimeric antibody huHEA125, heavy chain, VH domain
  • SEQ ID NO: 4 chimeric antibody huHEA125, heavy chain, FRl segment
  • SEQ ID NO: 5 chimeric antibody huHEA125, heavy chain, CDRl segment
  • SEQ ID NO: 6 chimeric antibody huHEA125, heavy chain, FR2 segment
  • SEQ ID NO: 7 chimeric antibody huHEA125, heavy chain, CDR2 segment
  • SEQ ID NO: 8 chimeric antibody huHEA125, heavy chain, FR3 segment
  • SEQ ID NO: 9 chimeric antibody huHEA125, heavy chain, CDR3 segment
  • SEQ ID NO: 10 chimeric antibody huHEA125, heavy chain, FR4 segment
  • SEQ ID NO: 11 chimeric antibody huHEA125
  • light chain SEQ ID NO: 12 chimeric antibody huHE A 125, light chain, VL domain
  • SEQ ID NO: 13 chimeric antibody huHEA125, light chain, FRl segment
  • SEQ ID NO: 14 chimeric antibody huHEA125, light chain, CDRl segment
  • SEQ ID NO : 15 chimeric antibody huHE A 125 , light chain, FR2 segment
  • SEQ ID NO: 16 chimeric antibody huHEA125, light chain, CDR2 segment
  • SEQ ID NO: 17 chimeric antibody huHEA125, light chain, FR3 segment
  • SEQ ID NO : 18 chimeric antibody huHE A 125, light chain, CDR3 segment
  • SEQ ID NO: 19 chimeric antibody huHEA125, light chain, FR4 segment
  • SEQ ID NO: 20 chimeric antibody huHEA125, heavy chain, CDRl domain
  • SEQ ID NO : 21 chimeric antibody huHE A 125, heavy chain, CDR2 domain
  • SEQ ID NO: 22 chimeric antibody huHEA 125, heavy chain, CDR3 domain
  • SEQ ID NO: 23 chimeric antibody huHEA125, light chain, CDRl domain
  • SEQ ID NO: 24 chimeric antibody huHEA125, light chain, CDR2 domain
  • SEQ ID NO: 25 chimeric antibody huHEA125, light chain, CDR3 domain
  • SEQ ID NO: 26 chimeric antibody huHEA125, heavy chain, constant domain, membrane bound form
  • SEQ ID NO: 27 chimeric antibody huHEA125, heavy chain, constant domain, secreted form
  • SEQ ID NO: 28 chimeric antibody huHEA125, light chain, constant domain

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Oncology (AREA)
  • Toxicology (AREA)
  • Diabetes (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Hematology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Rheumatology (AREA)
  • Neurology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Psychiatry (AREA)
  • Biomedical Technology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Neurosurgery (AREA)
  • Pain & Pain Management (AREA)
  • Dermatology (AREA)
  • Transplantation (AREA)
  • Gastroenterology & Hepatology (AREA)

Abstract

The invention relates to tumour therapy. In one aspect, the present invention relates to conjugates of a toxin and a target-binding moiety, e.g. an antibody, which are useful in the treatment of cancer. In particular, the toxin is an amatoxin, and the target-binding moiety is preferably directed against tumour-associated antigens. In particular, the amatoxin is conjugated to the antibody by linker moieties. In particular the linker moieties are covalently bound to functional groups located in positions of the amatoxin proved as preferred positions for the attachment of linkers with respect to optimum antitumor activity. In a further aspect the invention relates to pharmaceutical compositions comprising such target-binding moiety toxin conjugates and to the use of such target-binding moiety toxin conjugates for the preparation of such pharmaceutical compositions. The target-binding moiety toxin conjugates and pharmaceutical compositions of the invention are useful for the treatment of cancer.

Description

AMATOXIN-ARMED THERAPEUTIC CELL SURFACE BINDING COMPONENTS DESIGNED FOR
TUMOUR THERAPY
FIELD OF THE INVENTION The invention relates to tumour therapy. In one aspect, the present invention relates to conjugates of a toxin and a target-binding moiety, e.g. an antibody, which are useful in the treatment of cancer. In particular, the toxin is an amatoxin, and the target-binding moiety is preferably directed against tumour-associated antigens. In particular, the amatoxin is conjugated to the antibody by linker moieties. In particular the linker moieties are covalently bound to functional groups located in positions of the amatoxin proved as preferred positions for the attachment of linkers with respect to optimum antitumor activity. In a further aspect the invention relates to pharmaceutical compositions comprising such target-binding moiety toxin conjugates and to the use of such target-binding moiety toxin conjugates for the preparation of such pharmaceutical compositions. The target-binding moiety toxin conjugates and pharmaceutical compositions of the invention are useful for the treatment of cancer.
BACKGROUND OF THE INVENTION AND STATE OF THE ART
Antibody therapy has been established for the targeted treatment of patients with cancer, immunological and angiogenic disorders. The use of antibody-drug conjugates (ADC), i. e. immunoconjugates, for the local delivery of cytotoxic or cytostatic agents, i. e. drugs to kill or inhibit tumor cells in the treatment of cancer theoretically allows targeted delivery of the drug moiety to tumors, and intracellular accumulation therein, where systemic administration of these unconjugated drug agents may result in unacceptable levels of toxicity to normal cells as well as the tumor cells sought to be. Maximal efficacy with minimal toxicity is sought thereby. Efforts to design and refine ADC have focused on the selectivity of monoclonal antibodies (mAbs) as well as drug-linking and drug-releasing properties. Both polyclonal antibodies and monoclonal antibodies have been reported as useful in these strategies.
Amatoxins Amatoxins are cyclic peptides composed of 8 amino acids. They can be isolated from
Amanita phalloides mushrooms or prepared from the building blocks by synthesis. Amatoxins specifically inhibit the DNA-dependent RNA polymerase II of mammalian cells, and thereby also the transcription and protein biosynthesis of the affected cells. Inhibition of transcription in a cell causes stop of growth and proliferation. Though not covalently bound, the complex between amanitin and RNA-polymerase II is very tight (KD = 3nM). Dissociation of amanitin from the enzyme is a very slow process what makes recovery of an affected cell unlikely. When the inhibition of transcription lasts too long, the cell will undergo programmed cell death (apoptosis).
Conjugates of amatoxins and target-binding moieties
Earlier patent application EP 1 859 811 Al (published November 28, 2007) by the inventors describes conjugates, in which β-amanitin is coupled to albumin or to the monoclonal antibodies HEA125, OKT3, and PA-I. Furthermore, the inhibitory effect of these conjugates on the proliferation of breast cancer cells (MCF-7), Burkitt's lymphoma cells
(Raji), and T-lymphoma cells (Jurkat) was studied.
Epithelial cell adhesion molecule (EpCAM*) antigen
Epithelial cell adhesion molecule (EpCAM, CD326) is one of the best-studied target antigens on human tumors (Trzpis et al., 2007; Baeuerle and Gires, 2007). It represents a type I membrane glycoprotein of 314 amino acids with an apparent molecular weight of 40 kDa (Balzar et al., 1999). It is overexpressed in the majority of adenocarcinomas (Winter et al., 2003; Went et al., 2004). In particular, EpCAM expression is enhanced in node-positive breast cancer, epithelial ovarian cancer, cholangiocarcinoma, pancreatic adenocarcinoma and squamous cell head and neck cancer. Increased EpCAM expression is indicative for a poor prognosis in breast and gallbladder carcinomas (Gastl et al., 2000; Varga et al., 2004; Spizzo et al., 2002; Spizzo et al., 2004). Importantly, EpCAM is expressed by tumor initiating or cancer stem cells in mammary, colorectal and pancreatic carcinomas (Al-Hajj et al., 2003; Dalerba et al., 2007; Li et al., 2007).
EpCAM-specific monoclonal antibodies have been used as a diagnostic tool for the detection of rare circulating tumor cells in cancer patients (Allard et al., 2004; Nagrath et al., 2007). A couple of engineered anti-EpCAM antibodies are currently investigated in clinical studies.
HER2 antigen
HER2 (Her2/neu; ErbB2), a receptor tyrosine kinase with an apparent molecular weight of 185 kDa is overexpressed in about 25-30% of human breast cancers and gastric cancers. This overexpression, which is often due to amplification of the receptor-encoding gene, generally represents a poor prognosis, often involving progressive disease in the years after the initial diagnosis is made.
Monoclonal antibody therapy has been established for the targeted treatment of patients with Her2/neu-positive cancers. HERCEPTIN® (trastuzumab) is a recombinant DNA- derived humanized monoclonal antibody that selectively binds with high affinity in a cell- based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor 2 protein, HER2 (ErbB2). Trastuzumab is an IgGl kappa antibody that contains human framework regions with the complementarity-determining regions of a murine antibody (4D5) that binds to HER2. Trastuzumab binds to the HER2 antigen and thus inhibits the growth of cancerous cells. Because trastuzumab is a humanized antibody, it minimizes any HAMA response in patients. Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumor cells that overexpress HER2. Trastuzumab is a mediator of antibody-dependent cellular cytotoxicity, ADCC. HERCEPTIN® is clinically active in patients with ErbB2-overexpressing metastatic breast cancers that have received extensive prior anti-cancer therapy. Although HERCEPTIN® is a breakthrough in treating patients with ErbB2-overexpressing breast cancers that have received extensive prior anti-cancer therapy, the majority of the patients in this population fail to respond or respond only poorly to HERCEPTIN® treatment. Therefore, there is a significant clinical need for developing further HER2-directed cancer therapies for those patients with HER2-overexpressing tumors or other diseases associated with HER2 expression that do not respond, or respond poorly, to HERCEPTIN® treatment.
TECHNICAL PROBLEMS UNDERLYING THE PRESENT INVENTION
There was a need in the prior art for target-binding moiety toxin conjugates that exert their toxic effects to target cells or tissues at much lower concentration so that the conjugates may be administered at lower concentrations and harmful side effects to non-target cells are minimized. Furthermore, there was a need in the prior art for the treatment of other types of cancer, particularly those being therapy resistant, or poorly responding to actual tumour therapies. The present invention fulfils these and other needs. For example, the inventors found out in the experiments underlying the present invention that very effective target-binding moiety toxin conjugates, in particular antibody amatoxin conjugates, can be constructed by choosing particular linkage points in the amatoxin part of the conjugate and by choosing particular linker compounds. Such target-binding moiety toxin conjugates are very effective in that they exert their toxic activity to the target cells at very low concentrations (IC50 of about 5xlO'12 M) as well as by being highly specific for their target cells. Without wishing to be bound by a particular theory, these advantages might be explained in that the linkage between the target-binding moiety and the amatoxin or, if present, between the linker and the amatoxin is efficiently cleaved inside the target cell and to a much lesser degree outside the cell.
The above overview does not necessarily describe all problems solved by the present invention.
SUMMARY OF THE INVENTION
In a first aspect the present invention relates to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) at least one amatoxin; and (iii) optionally a linker L2; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker L2 via the 6' C-atom of amatoxin amino acid 4. In a second aspect the present invention relates to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) at least one amatoxin; and (iii) optionally a linker L3; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via the δ C-atom of amatoxin amino acid 3.
In a third aspect the present invention relates to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) at least one amatoxin; and (iii) optionally a linker Ll; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker Ll via the γ C-atom of amatoxin amino acid 1.
In a fourth aspect the present invention relates to the target-binding moiety toxin conjugate according to the first, the second, or the third aspect for use in medicine. In a fifth aspect the present invention relates to the target-binding moiety toxin conjugate according to the first, the second, the third or the fourth aspect for the treatment of cancer or of an autoimmune disease in a patient, wherein the cancer is preferably selected from the group consisting of pancreatic cancer, cholangiocarcinoma, breast cancer, colorectal cancer, lung cancer, prostate cancer, ovarian cancer, stomach cancer, kidney cancer, head and neck cancer, brain tumors, childhood neoplasms, soft tissue sarcomas, epithelial skin cancer, malignant melanoma, leukemia, and malignant lymphoma and wherein the autoimmune disease is preferably selected from the group consisting of Ankylosing Spondylitis, Chagas disease, Crohns Disease, Dermatomyositis, Diabetes mellitus type 1, Goodpasture's syndrome, Graves' disease, Guillain-Barre syndrome (GBS), Hashimoto's disease, Hidradenitis suppurativa, Idiopathic thrombocytopenic purpura, Lupus erythematosus, Mixed Connective Tissue Disease, Myasthenia gravis, Narcolepsy, Pemphigus vulgaris, Pernicious anaemia, Psoriasis, Psoriatic Arthritis, Polymyositis, Primary biliary cirrhosis, Relapsing polychondritis, Rheumatoid arthritis, Schizophrenia, Sjogren's syndrome, Temporal arteritis, Ulcerative Colitis, Vasculitis Wegener's granulomatosis, in particular Rheumatoid arthritis.
In a sixth aspect the present invention relates to a pharmaceutical composition comprising at least one type of target-binding moiety toxin conjugate according to the first, the second, and/or the third aspect and further comprising one or more pharmaceutically acceptable diluents, carriers, excipients, fillers, binders, lubricants, glidants, disintegrants, adsorbents; and/or preservatives.
This summary of the invention does not necessarily describe all features of the invention.
BRIEF DESCRIPTION OF THE DRAWINGS Fig. 1 shows the structural formulae of different amatoxins. The numbers in bold type
(1 to 8) designate the standard numbering of the eight amino acids forming the amatoxin. The standard designations of the atoms in amino acids 1 , 3 and 4 are also shown (Greek letters α to γ, Greek letters α to δ, and numbers from 1 ' to 7', respectively).
Fig. 2 shows a comparison of the binding affinities of huHEA125-Ama and huHEA125 to target cells by a binding competition analysis. EpCAM-expressing Colo205 cells were incubated with a fixed amount of directly FITC-labeled mouse HEAl 25 antibody. Binding to target cells was analyzed by flow cytometry. Competition of binding with increasing amounts of huHEA125-Ama or huHEA125 revealed a very similar affinity towards the target antigen. Fig. 3 shows the surface expression of EpCAM antigen on various carcinoma cell lines detected by indirect immunofluorescence: Fig. 3 A Capan-1; Fig. 3B Colo205; Fig. 3C OZ; and Fig. 3D MCF-7. The grey-shaded histograms on the left side of each diagram show the results obtained with control antibody Xolair®; the histograms having a white area on the right side of each diagram show the results obtained with antibody huHEA125. The abbreviation FLl-H stands for "fluorescence 1 height" which means the intensity of fluorescence 1, i.e. the green channel for FITC.
Fig. 4 shows the binding of huHEA125-Amanitin and huHEA125-Phalloidin conjugates to MCF-7 breast cancer cells analyzed by flow cytometry. The abbreviation FLl- H stands for "fluorescence 1 height" which means the intensity of fluorescence 1, i.e. the green channel for FITC.
A: bold histogram, huHEA125-Amanitinl; shaded histogram, huHEA125; dotted histogram, Xolair (negative control); B: bold histogram, huHEA125-Amanitin4; shaded histogram, huHEA125; dotted histogram, Xolair (negative control);
C: bold histogram, huHEA125-α-Phalloidin; shaded histogram, huHEA125; dotted histogram, Xolair (negative control).
Fig. 5 shows a comparison of the inhibition of MCF-7 cell proliferation caused by the conjugate huHEA125-Amanitinl, the non-binding control conjugate Xolair-Amanitinl, and free Amanitin.
Fig. 6 shows a comparison of the inhibition of MCF-7 cell proliferation caused by the conjugate huHEA125-Amanitin4, the conjugate alpha-phalloidin-huHEA125, and free Amanitin. Fig. 7 shows a comparison of the inhibition of Capan-1 cell proliferation caused by conjugate huHEA125-Amanitin3, Amanitin-armed control antibody Xolair®, and free Amanitin.
Fig. 8 shows a comparison of the inhibition of Colo205 cell proliferation caused by conjugate huHEA125-Amanitin3, Amanitin-armed control antibody Xolair®, and free Amanitin.
Fig. 9 shows a comparison of the inhibition of MCF-7 cell proliferation caused by conjugate huHEA125-Amanitin3, Amanitin-armed control antibody Xolair®, and free Amanitin.
Fig. 10 shows a comparison of the inhibition of OZ cell proliferation caused by conjugate huHEA125-Amanitin3, Amanitin-armed control antibody Xolair®, and free Amanitin.
Fig 11 A to D show a comparison of the inhibition on cell proliferation exerted by various α-amanitin conjugates at different amanitin concentrations using the Her2/neu positive cell lines SKO V-3, SKBR-3 and NCI-N87 as well as the Her2/neu negative cell line MDA-MB231.
Fig. 12 shows the antitumor activity of various α-amanitin conjugates at two different concentrations (A: 30 μg/kg and B: 150 μg/kg body weight) in an in vivo SKOV-3 xenograft tumor model. DETAILED DESCRIPTION OF THE INVENTION
Definitions
Before the present invention is described in detail below, it is to be understood that this invention is not limited to the particular methodology, protocols and reagents described herein as these may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention which will be limited only by the appended claims. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art. Preferably, the terms used herein are defined as described in "A multilingual glossary of biotechnological terms: (IUPAC Recommendations)", Leuenberger, H.G.W, Nagel, B. and Kolbl, H. eds. (1995), Helvetica Chimica Acta, CH-4010 Basel, Switzerland).
Throughout this specification and the claims which follow, unless the context requires otherwise, the word "comprise", and variations such as "comprises" and "comprising", will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step.
Several documents are cited throughout the text of this specification. Each of the documents cited herein (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, GenBank Accession Number sequence submissions etc.), whether supra or infra, is hereby incorporated by reference in its entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention.
The term "target-binding moiety", as used herein, refers to any molecule or part of a molecule that can specifically bind to a target molecule or target epitope. Preferred target- binding moieties in the context of the present application are (i) antibodies or antigen-binding fragments thereof; (ii) antibody-like proteins; and (iii) nucleic acid aptamers. "Target-binding moieties" suitable for use in the present invention typically have a molecular mass of at least 15 kDa, at least 20 kDa, at least 30 kDa or of at least 40 kDa or more.
As used herein, an "antibody toxin conjugate" refers to a target-binding moiety toxin conjugate in which the target-binding moiety is an antibody or antigen-binding fragment thereof according to above alternative (i).
As used herein, an "antibody-like protein toxin conjugate" refers to a target-binding moiety toxin conjugate in which the target-binding moiety is an antibody-like protein according to above alternative (ii). As used herein, an "aptamer conjugate" refers to a target-binding moiety toxin conjugate in which the target-binding moiety is a nucleic acid aptamer according to above alternative (iii).
In the context of the present application the terms "target molecule" and "target epitope", respectively, refers to an antigen and an epitope of an antigen, respectively, that is specifically bound by a target-binding moiety, preferably the target molecule is a tumour- associated antigen, in particular an antigen or an epitope which is present on the surface of one or more tumour cell types in an increased concentration and/or in a different steric configuration as compared to the surface of non-tumour cells or an antigen preferentially expressed on cells involved in autoimmune diseases, examples of such antigens are Immunoglobulin G Fc-part, Thyreotropin-receptor, Type IV Collagen, Proteinase 3, DNA Topoisomerase I, Placoglobin. Preferably, said antigen or epitope is present on the surface of one or more tumour cell types but not on the surface of non-tumour cells.
Preferably the term "tumour associated antigen" comprises all substances, which elicit an immune response against a tumour. Particular suitable substances are those which are enriched in a tumour cell in comparison to a healthy cell. These substances are preferably present within and/or are accessible on the outside of the tumour cell. If the tumour antigen is only present within a tumour cell, it will still be accessible for the immune system, since the antigen or fragments thereof will be presented by the MHC system at the surface of the cell. In a preferred aspect tumour antigen is almost exclusively present on and/or in the tumour cell and not in a healthy cell of the same cell type.
Suitable tumour antigens can be identified, for example, by analyzing the differential expression of proteins between tumour and healthy cells of the same cell type using a microarray-based approach (Russo et al, Oncogene. 2003,22 : 6497-507), by PCR- or microarray-based screening for tumor specific mutated cellular genes (Heller, Annu. Rev.
Biomed. Eng. 2002, 4: 129-53) or by serological identification of antigens by recombinant expression cloning (SEREX; Tureci et al, MoI Med Today. 1997,3 : 342-349). The skilled artisan is aware of a large number of substances which are preferentially or exclusively present on and/or in tumor cell, which include for example, oncogenes like, for example truncated epidermal growth factor, folate binding protein, melanoferrin, carcinoembryonic antigen, prostate-specific membrane antigen, HER2-neu and certain sugar chains like, for example, epithelial mucins.
It is preferred that tumour antigens are selected, which elicit a strong immune response, preferentially a MHC class I immune response. Antigens eliciting a strong immune response will induce at least 1%, preferably at least 5%, more preferably at least 10% and most preferably at least 15% IFN-γ-producing CD8+ T or CD4+ T cells isolated from mice previously immunized with the antigen, upon challenge with the antigen and/or will induce preferably at least 5%, and most preferably at least 15% of B-cells cells isolated from mice previously immunized with the antigen, upon challenge with the antigen to proliferate. Antigens fulfilling these criterions are candidates for use in therapeutic and/or prophylactic cancer vaccines.
In a particular preferred embodiment the tumour antigen is selected from the group consisting of T-cell or B-cell-defined cancer-associated antigens belonging to unique gene products of mutated or recombined cellular genes, in particular cyclin-dependent kinases (e.g. CDC2, CDK2, CDK4), pl5Ink4b, p53, AFP, β-catenin, caspase 8, p53, Bcr-abl fusion product, MUM-I MUM-2, MUM-3, ELF2M, HSP70-2M, HST-2, KIAA0205, RAGE, myosin/m, 707- AP, CDC27/m, ETV6/AML, TEL/Amll, Dekcain, LDLR/FUT, PmI-RARa, TEL/AMLI; Cancer-testis (CT) antigens, in particular NY-ESO- 1, members of the MAGE-family (MAGE-Al, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-10, MAGE-12), BAGE, DAM-6, DAM-IO, members of the GAGE- family (GAGE-I, GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7B, GAGE- 8), NY-ESO-I, NA-88A, CAG-3, RCC- associated antigen G250; Tumour virus antigens, in particular human papilloma virus (HPV) - derived E6 or E7 oncoproteins, Epstein Barr virus EBNA2-6, LMP-I, LMP -2; overexpressed or tissue-specific differentiation antigens, in particular gp77, gplOO, MART-1/Melan-A, p53, tyrosinase, tyrosinase-related protein (TRP-I and TPR-2), PSA, PSM, MClR ; widely expressed antigens, in particular ART4, CAMEL, CEA, CypB, EpCAM, HER2/neu, hTERT, hTRT, ICE, Mucl, Muc2, PRAME RUl, RU2, SART-I, SART-2, SART-3, and WTl; and fragments and derivatives thereof. Particular preferred tumour antigens are antigens derived from HER-2 and EpCAM. In the context of this section the term fragment refers to C- terminally and/or N-terminally deleted proteins, which comprise at least one epitope which can be specifically bound by a target-binding moiety.
The term "antibody or antigen binding fragment thereof, as used herein, refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e. molecules that contain an antigen binding site that immunospecifically binds an antigen. Also comprised are immunoglobulin-like proteins that are selected through techniques including, for example, phage display to specifically bind to a target molecule, e.g. to the target protein EpCAM or Her2. The immunoglobulin molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule. "Antibodies and antigen-binding fragments thereof suitable for use in the present invention include, but are not limited to, polyclonal, monoclonal, monovalent, bispecific, heteroconjugate, multispecific, human, humanized (in particular CDR-grafted), deimmunized, or chimeric antibodies, single chain antibodies (e.g. scFv), Fab fragments, F(ab')2 fragments, fragments produced by a Fab expression library, diabodies or tetrabodies (Holliger P. et al., 1993), nanobodies, anti- idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above.
In some embodiments the antigen-binding fragments are human antigen-binding antibody fragments of the present invention and include, but are not limited to, Fab, Fab' and F(ab')2> Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (dsFv) and fragments comprising either a VL or VH domain. Antigen-binding antibody fragments, including single-chain antibodies, may comprise the variable domain(s) alone or in combination with the entirety or a portion of the following: hinge region, CL, CHl, CH2, and CH3 domains. Also included in the invention are antigen-binding fragments also comprising any combination of variable domain(s) with a hinge region, CL, CHl, CH2, and CH3 domains.
Antibodies usable in the invention may be from any animal origin including birds and mammals. Preferably, the antibodies are from human, rodent (e.g. mouse, rat, guinea pig, or rabbit), chicken, pig, sheep, goat, camel, cow, horse, donkey, cat, or dog origin. It is particularly preferred that the antibodies are of human or murine origin. As used herein, "human antibodies" include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin and that do not express endogenous immunoglobulins, as described for example in U.S. Patent No. 5,939,598 by Kucherlapati & Jakobovits.
The term "antibody-like protein" refers to a protein that has been engineered (e.g. by mutagenesis of loops) to specifically bind to a target molecule. Typically, such an antibody- like protein comprises at least one variable peptide loop attached at both ends to a protein scaffold. This double structural constraint greatly increases the binding affinity of the antibody-like protein to levels comparable to that of an antibody. The length of the variable peptide loop typically consists of 10 to 20 amino acids. The scaffold protein may be any protein having good solubility properties. Preferably, the scaffold protein is a small globular protein. Antibody-like proteins include without limitation affibodies, anticalins, designed ankyrin repeat proteins (for review see: Binz et al. 2005) and proteins with ubiquitine based scaffolds. Antibody-like proteins can be derived from large libraries of mutants, e.g. be panned from large phage display libraries and can be isolated in analogy to regular antibodies. Also, antibody-like binding proteins can be obtained by combinatorial mutagenesis of surface-exposed residues in globular proteins.
The term "nucleic acid aptamer" refers to a nucleic acid molecule that has been engineered through repeated rounds of in vitro selection or SELEX (systematic evolution of ligands by exponential enrichment) to bind to a target molecule (for a review see: Brody and Gold, 2000). The nucleic acid aptamer may be a DNA or RNA molecule. The aptamers may contain modifications, e.g. modified nucleotides such as 2 '-fluorine-substituted pyrimidines.
The term "amatoxin" includes all cyclic peptides composed of 8 amino acids as isolated from the genus Amanita and described in ref. (Wieland, T. and Faulstich H., 1978); further all chemical derivatives thereof; further all semisynthetic analogs thereof; further all synthetic analogs thereof built from building blocks according to the master structure of the natural compounds (cyclic, 8 amino acids), further all synthetic or semisynthetic analogs containing non-hydroxylated amino acids instead of the hydroxylated amino acids, further all synthetic or semisynthetic analogs, in which the thioether sulfoxide moiety is replaced by a sulfide, sulfone, or by atoms different from sulfur, e.g. a carbon atom as in a carbaanalog of amanitin. Functionally, amatoxins are defined as peptides or depsipeptides that inhibit mammalian RNA polymerase II. Preferred amatoxins are those with a functional group (e.g. a carboxylic group, an amino group, a hydroxy group, a thiol or a thiol-capturing group) that can be reacted with linker molecules or target-binding moieties as defined above. Amatoxins which are particularly suitable for the conjugates of the present invention are α-amanitin, β- amanitin, γ-amanitin, ε-amanitin, amanin, amaninamide, amanullin, and amanullinic acid as shown in Fig. 1 as well as salts, chemical derivatives, semisynthetic analogs, and synthetic analogs thereof. Particularly preferred amatoxins for use in the present invention are α- amanitin, β-amanitin, and amaninamide.
As used herein, a "chemical derivative" (or short: a "derivative") of a compound refers to a species having a chemical structure that is similar to the compound, yet containing at least one chemical group not present in the compound and/or deficient of at least one chemical group that is present in the compound. The compound to which the derivative is compared is known as the "parent" compound. Typically, a "derivative" may be produced from the parent compound in one or more chemical reaction steps. As used herein, an "analog" of a compound is structurally related but not identical to the compound and exhibits at least one activity of the compound. The compound to which the analog is compared is known as the "parent" compound. The afore-mentioned activities include, without limitation: binding activity to another compound; inhibitory activity, e.g. enzyme inhibitory activity; toxic effects; activating activity, e.g. enzyme-activating activity. It is not required that the analog exhibits such an activity to the same extent as the parent compound. A compound is regarded as an analog within the context of the present application, if it exhibits the relevant activity to a degree of at least 1% (more preferably at least 5%, more preferably at least 10%, more preferably at least 20%, more preferably at least 30%, more preferably at least 40%, and more preferably at least 50%) of the activity of the parent compound. Thus, an "analog of an amatoxin", as it is used herein, refers to a compound that is structurally related to any one of α-amanitin, β-amanitin, γ-amanitin, ε- amanitin, amanin, amaninamide, amanullin, and amanullinic acid as shown in Fig. 1 and that exhibits at least 1% (more preferably at least 5%, more preferably at least 10%, more preferably at least 20%, more preferably at least 30%, more preferably at least 40%, and more preferably at least 50%) of the inhibitory activity against mammalian RNA polymerase II as compared to at least one of α-amanitin, β-amanitin, γ-amanitin, ε-amanitin, amanin, amaninamide, amanullin, and amanullinic acid. An "analog of an amatoxin" suitable for use in the present invention may even exhibit a greater inhibitory activity against mammalian RNA polymerase II than any one of α-amanitin, β-amanitin, γ-amanitin, ε-amanitin, amanin, amaninamide, amanullin, or amanullinic acid. The inhibitory activity might be measured by determining the concentration at which 50% inhibition occurs (IC50 value). The inhibitory activity against mammalian RNA polymerase II can be determined indirectly by measuring the inhibitory activity on cell proliferation. A suitable assay for measuring inhibition of cell proliferation is described in Example 3.
A "semisynthetic analog" refers to an analog that has been obtained by chemical synthesis using compounds from natural sources (e.g. plant materials, bacterial cultures, or cell cultures) as starting material. Typically, a "semisynthetic analog" of the present invention has been synthesized starting from a compound isolated from a mushroom of the Amanita family. In contrast, a "synthetic analog" refers to an analog synthesized by so-called total synthesis from small (typically petrochemical) building blocks. Usually, this total synthesis is carried out without the aid of biological processes.
A "linker" in the context of the present application refers to a molecule that increases the distance between two components, e.g. to alleviate steric interference between the target- binding moiety and the amatoxin, which may otherwise decrease the ability of the amatoxin to interact with RNA polymerase II. The linker may serve another purpose as it may facilitate the release of the amatoxin specifically in the cell being targeted by the target binding moiety. It is preferred that the linker and preferably the bond between the linker and the amatoxin on one side and the bond between the linker and the antibody on the other side is stable under the physiological conditions outside the cell, e.g. the blood, while it can be cleaved inside the cell, in particular inside the target cell, e.g. cancer cell or immune cell. To provide this selective stability the linker may comprise functionalities that are preferably pH-sensitive to generate pH-sensitive linkers as described, e.g. in S. Fletcher, M. R. Jorgensens and A. D. Miller; Org. Lett. 2004, 6(23), pp 4245-4248, or protease sensitive to generate protease sensitive linkers as described, e.g. in L. DA Ibsen, Blood 2003, 102, 1458-65 or Francisco JA, Cerreny CG, Meyer DL, Nat. Biotechnol 2003, 21, 778-84. Alternatively, the bond linking the linker to the target binding moiety may provide the selective stability. Preferably a linker has a length of at least 1, preferably of 1-20 atoms length (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 atoms) wherein one side of the linker has been reacted with the amatoxin and, the other side with a target-binding moiety. In the context of the present invention, a linker preferably is a C1-20-alkyl, C1-20-heteroalkyl, C2-20-alkenyl, C2-20-heteroalkenyl, C2-20- alkynyl, C2-20-heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, aralkyl, or a heteroaralkyl group, optionally substituted. The linker may contain one or more structural elements such as amide, ester, ether, thioether, disulfide, hydrocarbon moieties and the like. The linker may also contain combinations of two or more of these structural elements. Each one of these structural elements may be present in the linker more than once, e.g. twice, three times, four times, five times, or six times. In some embodiments the linker may comprise a disulfide bond. It is understood that the linker has to be attached either in a single step or in two or more subsequent steps to the amatoxin and the target binding moiety. To that end the linker to be will carry two groups, preferably at a proximal and distal end, which can (i) form a covalent bond to a group, preferably an activated group on an amatoxin or the target binding-peptide or (ii) which is or can be activated to form a covalent bond with a group on an amatoxin. Accordingly, if the linker is present, it is preferred that chemical groups are at the distal and proximal end of the linker, which are the result of such a coupling reaction, e.g. an ester, an ether, a urethane, a peptide bond etc. The presence of a "linker" is optional, i.e. the toxin may be directly linked to a residue of the target-binding moiety in some embodiments of the target-binding moiety toxin conjugate of the present invention. It is preferred that the linker is connected directly via a bond to the targeting moiety, preferably at its terminus. If the target-binding moiety comprises free amino, carboxy or sulfhydryl groups, e.g. in the form of Asp, GIu, Arg, Lys, Cys residues, which may be comprised in a polypeptide, then it is preferred that the linker is coupled to such a group.
As used herein, a first compound (e.g. an antibody) is considered to "specifically bind" to a second compound (e.g. an antigen, such as a target protein), if it has a dissociation constant KD to said second compound of 100 μM or less, preferably 50 μM or less, preferably 30 μM or less, preferably 20 μM or less, preferably 10 μM or less, preferably 5 μM or less, more preferably 1 μM or less, more preferably 900 nM or less, more preferably 800 nM or less, more preferably 700 nM or less, more preferably 600 nM or less, more preferably 500 nM or less, more preferably 400 nM or less, more preferably 300 nM or less, more preferably 200 nM or less, even more preferably 100 nM or less, even more preferably 90 nM or less, even more preferably 80 nM or less, even more preferably 70 nM or less, even more preferably 60 nM or less, even more preferably 50 nM or less, even more preferably 40 nM or less, even more preferably 30 nM or less, even more preferably 20 nM or less, and even more preferably 10 nM or less.
As used herein, a "patient" means any mammal or bird who may benefit from a treatment with the target-binding moiety toxin conjugates described herein. Preferably, a "patient" is selected from the group consisting of laboratory animals (e.g. mouse or rat), domestic animals (including e.g. guinea pig, rabbit, chicken, pig, sheep, goat, camel, cow, horse, donkey, cat, or dog), or primates including human beings. It is particularly preferred that the "patient" is a human being.
As used herein, "treat", "treating" or "treatment" of a disease or disorder means accomplishing one or more of the following: (a) reducing the severity of the disorder; (b) limiting or preventing development of symptoms characteristic of the disorder(s) being treated; (c) inhibiting worsening of symptoms characteristic of the disorder(s) being treated; (d) limiting or preventing recurrence of the disorder(s) in patients that have previously had the disorder(s); and (e) limiting or preventing recurrence of symptoms in patients that were previously symptomatic for the disorder(s).
As used herein, "administering" includes in vivo administration, as well as administration directly to tissue ex vivo, such as vein grafts.
An "effective amount" is an amount of a therapeutic agent sufficient to achieve the intended purpose. The effective amount of a given therapeutic agent will vary with factors such as the nature of the agent, the route of administration, the size and species of the animal to receive the therapeutic agent, and the purpose of the administration. The effective amount in each individual case may be determined empirically by a skilled artisan according to established methods in the art.
"Pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
Embodiments of the Invention
The present invention will now be further described. In the following passages different aspects of the invention are defined in more detail. Each aspect so defined may be combined with any other aspect or aspects unless clearly indicated to the contrary. In particular, any feature indicated as being preferred or advantageous may be combined with any other feature or features indicated as being preferred or advantageous.
In a first aspect the present invention is directed to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) an amatoxin; and (iii) optionally a linker L2; wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker L2 via the 6' C-atom of amatoxin amino acid 4 (see Fig. 1). In preferred amatoxins usable in the first aspect said amino acid 4 is 2'-sulfur-substituted tryptophan or 2'-sulfur- substituted 6 '-hydroxy-tryptophan.
In a preferred embodiment of the first aspect the amatoxin is connected to the target- binding moiety or, if present, to the linker L2 via an oxygen atom bound to the 6' C-atom of amatoxin amino acid 4. It is further preferred that the amatoxin is connected to the target- binding moiety or, if present, to the linker L2 via an ether linkage (i.e. amatoxin-O-L2 or amatoxin-0-target-binding moiety). In these embodiments, it is preferred that amino acid 4 is 6 ' -hydroxy-tryptophan. In preferred embodiments of the first aspect the linker L2 is present and the conjugate has the following structure: amatoxin-6'C-O-L2-C(O)-NH-target-binding moiety.
In a second aspect the present invention is directed to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) an amatoxin; and (iii) optionally a linker L3; wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via the δ C-atom of amatoxin amino acid 3 (see Fig. 1). In preferred amatoxins usable in the second aspect said amino acid 3 is isoleucine, γ-hydroxy-isoleucine or γ,δ- dihydroxy-isoleucine.
In a preferred embodiment of the second aspect the amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via an oxygen atom bound to the δ C- atom of amatoxin amino acid 3. It is further preferred that the amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via an ester linkage preferably in the form of an amatoxin-O-C(O)-L3 -target binding boiety or an amatoxin-O-C(O)-target-binding moiety, more preferably an amatoxin-δC-O-C(O)-L3 -target-binding moiety or an amatoxin- δC-O-C(O)-target-binding moiety, i.e. an amatoxin-δCH2-O-C(O)-L3 -target-binding moiety or an amatoxin-δCH2-O-C(O)-target-binding moiety; an ether linkage preferably in the form of an amatoxin-O-L3 or an amatoxin-O-target-binding moiety preferably an amatoxin-δC-O- L3 -target binding moiety or an amatoxin-δC-O-target binding moiety, more preferably an amatoxin-δCH2-O-L3 -target binding moiety or an amatoxin-δCH2-O-target binding moiety; or a urethane linkage preferably in the form of an amatoxin-O-C(O)-NH-L3 or amatoxin-O- C(O)-NH-target-binding moiety, preferably an amatoxin-δC-O-C(O)-NH-L3 -target-binding moiety or an amatoxin-δC-O-C(O)-NH-target-binding moiety, i.e. an amatoxin-δCH2-O- C(O)-NH-L3-target-binding moiety or an amatoxin-δCH2-O-C(O)-NH-target-binding moiety. In these embodiments, it is preferred that amino acid 3 is γ,δ-dihydroxy-isoleucine. In preferred embodiments of the second aspect the linker L3 is present and the conjugate has one of the following structures: (i) amatoxin-δC-O-C(O)-L3-C(O)-NH-target- binding moiety; (ii) amatoxin-δC-O-L3-C(O)-NH-target-binding moiety; or (iii) amatoxin- δC-O-C(O)-NH-L3-C(O)-NH-target-binding moiety, i.e. (i) amatoxin-δCH2-O-C(O)-L3- C(O)-NH-target-binding moiety; (ii) amatoxin-δCH2-O-L3-C(O)-NH-target-binding moiety; or (iii) amatoxin-δCH2-O-C(O)-NH-L3-C(O)-NH-target-binding moiety.
In a third aspect the present invention is directed to a target-binding moiety toxin conjugate comprising: (i) a target-binding moiety; (ii) an amatoxin; and (iii) optionally a linker Ll; wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker Ll via the γ C-atom of amatoxin amino acid 1 (see Fig. 1). In preferred amatoxins usable in the third aspect said amino acid 1 is asparagine or aspartic acid.
In a preferred embodiment of the third aspect the amatoxin is connected to the target- binding moiety or, if present, to the linker Ll via a nitrogen atom bound to the γ C-atom of amatoxin amino acid 1. It is further preferred that the amatoxin is connected to the target- binding moiety or, if present, to the linker Ll via an amide linkage (i.e. amatoxin-C(O)-NH- Ll or amatoxin-C(O)-NH-target-binding moiety; the C-atom in the aforementioned C(O)- moiety is the γ C-atom of amatoxin amino acid 1). In these embodiments, it is preferred that amino acid 1 is asparagine.
In preferred embodiments of the third aspect the linker Ll is present and the conjugate has the following structure: amatoxin-γC(O)-NH-Ll-C(O)-NH-target-binding moiety. In this context it is preferred that the amide on the target-binding moiety side of the conjugate is the product of a reaction with a free amino group that was present in the target-binding moiety.
In preferred embodiments of the first, the second, or the third aspect the target-binding moiety is connected to the amatoxin or, if present, to the linker Ll, L2, or L3 via an amino group present in the target-binding moiety.
In preferred embodiments of the first, the second, or the third aspect the amatoxin is selected from α-amanitin, β-amanitin, γ-amanitin, ε-amanitin, amanin, amaninamide, amanullin, or amanullinic acid (all shown in Fig. 1), as well as salts, chemical derivatives, semisynthetic analogs, and synthetic analogs thereof. Particularly preferred amatoxins are α- amanitin, β-amanitin, and amaninamide, as well as salts, chemical derivatives, semisynthetic analogs, and synthetic analogs thereof.
The target binding moiety is in preferred embodiments a protein, in particular an antibody. Proteins and in particular antibodies will comprise several amino acids, which allow the coupling of amatoxins. Preferred amino acids have free amino, hydroxy, or carbonyl- groups, including Lys, GIn, GIu, Asp, Asn, Thr, and Ser. Accordingly, it is possible to couple more than one amatoxin molecules to one protein molecule. An increase of the number of amatoxins per molecule will also increase the toxicity. Accordingly, in a preferred embodiment the ratio of protein to amatoxin is between 1 protein molecule to between 1 and 15 amatoxin molecules, preferably 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15. For the purpose of the calculation of the ratio in case of dimmers like IgGs the dimmer is considered as one molecule. Similar ratios are preferred, if the target binding moiety is not a protein.
In preferred embodiments of the first, the second, or the third aspect the linker Ll, L2, or L3 has above indicated meaning and preferred meanings. In further preferred embodiments of the first, the second, or the third aspect the linker Ll, L2, or L3 comprises a disulfide bond. In preferred embodiments of the first, the second, or the third aspect the linker Ll, L2, or L3 has a length of 1 to 20 atoms, e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 atoms. The length of the linker is defined as the shortest connection - as measured by the number of atoms or bonds - between the toxin moiety and the target-binding moiety. In preferred embodiments of the first, the second, or the third aspect the target-binding moiety specifically binds to an epitope that is present on a tumour cell. It is particularly preferred that the target-binding moiety specifically binds to an epitope of T-cell- or B-CeIl- defined cancer-associated antigen belonging to unique gene products of mutated or recombined cellular genes, in particular cyclin-dependent kinases (e.g. CDC2, CDK2, CDK4), pl5Ink4b, p53, AFP, β-catenin, caspase 8, p53, Bcr-abl fusion product, MUM-I MUM-2, MUM-3, ELF2M, HSP70-2M, HST-2, KIAA0205, RAGE, myosin/m, 707-AP, CDC27/m, ETV6/AML, TEL/Amll, Dekcain, LDLR/FUT, PmI-RARa, TEL/AMLI; Cancer- testis (CT) antigens, in particular NY-ESO- 1, members of the MAGE-family (MAGE-Al, MAGE-A2, MAGE- A3, MAGE-A4, MAGE-A6, MAGE-IO, MAGE- 12), BAGE, DAM-6, DAM-IO, members of the GAGE- family (GAGE-I, GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7B, GAGE- 8), NY-ESO-I, NA-88A, CAG-3, RCC-associated antigen G250; Tumour virus antigens, in particular human papilloma virus (HPV) -derived E6 or E7 oncoproteins, Epstein Barr virus EBNA2-6, LMP-I, LMP-2; overexpressed or tissue-specific differentiation antigens, in particular gp77, gplOO, MART-1/Melan-A, p53, tyrosinase, tyrosinase-related protein (TRP-I and TPR-2), PSA, PSM, MClR ; widely expressed antigens, in particular ART4, CAMEL, CEA, CypB, EpCAM, HER2/neu, hTERT, hTRT, ICE, Mucl, Muc2, PRAME RUl, RU2, SART-I, SART-2, SART-3, and WTl; and fragments and derivatives thereof. Particular preferred tumour antigens are antigens derived from the HER-2 and EpCAM proteins.
In preferred embodiments of the first, the second, or the third aspect the target-binding moiety is selected from the group consisting of: (i) antibody or antigen-binding fragment thereof; (ii) antibody-like protein; and (iii) nucleic acid aptamer. In preferred embodiments the antibody or the antigen-binding fragment thereof is selected from a diabody, a tetrabody, a nanobody, a chimeric antibody, a deimmunized antibody, a humanized antibody or a human antibody. In preferred embodiments the antigen binding fragment is selected from the group consisting of Fab, F(ab')2, Fd, Fv, single-chain Fv, and disulfϊde-linked Fvs (dsFv). In preferred embodiments the antibody or the antigen binding fragment thereof comprises (a) either the membrane-bound form of the heavy chain of huHEA125 (SEQ ID NO: 1) or the soluble form of the heavy chain of huHEA125 (SEQ ID NO: 2); and/or (b) the light chain of huHEA125 (SEQ ID NO: 11).
In preferred embodiments of the first, the second, or the third aspect the target-binding moiety toxin conjugate comprises (i) an antibody or an antigen binding fragment thereof specifically binding to epithelial cell adhesion molecule (EpCAM), wherein the antibody or an antigen binding fragment thereof comprises: (a) the heavy chain of huHEA125, wherein the heavy chain is selected from the group consisting of: (al) the membrane-bound form of the heavy chain according to SEQ ID NO: 1, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 26 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions; and (a2) the soluble form of the heavy chain according to SEQ ID NO: 2, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 27 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions; and (b) the light chain of huHEA125 according to SEQ ID NO: 11, wherein the variable domain of the light chain VL as shown in SEQ ID NO: 12 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VL, and wherein the constant domain of the light chain CL as shown in SEQ ID NO: 28 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions; (ii) an amatoxin; and (iii) optionally a linker Ll, L2, or L3.
In preferred embodiments of the first, the second, or the third aspect the target-binding moiety toxin conjugate comprises: (a) the heavy chain of huHEA125, wherein the heavy chain is selected from the group consisting of: (al) the membrane-bound form of the heavy chain according to SEQ ID NO: 1, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VH; and (a2) the soluble form of the heavy chain according to SEQ ID NO: 2, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VH; and (b) the light chain of huHEA125 according to SEQ ID NO:
11, wherein the variable domain of the light chain VL as shown in SEQ ID NO: 12 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid deletions and/or between 0 and 10 (e.g. 0,
1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid additions positioned in the framework regions of VL.
In preferred embodiments of the first, the second, or the third aspect the target-binding moiety toxin conjugate comprises: (a) the heavy chain of huHEA125, wherein the heavy chain is selected from the group consisting of: (al) the membrane-bound form of the heavy chain according to SEQ ID NO: 1, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 26 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions; and (a2) the soluble form of the heavy chain according to SEQ ID NO: 2, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 27 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions; and (b) the light chain of huHEA125 according to SEQ ID NO: 11, wherein the variable domain of the light chain VL as shown in SEQ ID NO: 12 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions positioned in the framework regions of VL, and wherein the constant domain of the light chain CL as shown in SEQ ID NO: 28 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges, amino acid deletions and/or amino acid additions.
In preferred embodiments of the first, the second, or the third aspect the target-binding moiety toxin conjugate comprises: (a) the heavy chain of huHEA125, wherein the heavy chain is selected from the group consisting of: (al) the membrane-bound form of the heavy chain according to SEQ ID NO: 1, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 26 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges; and (a2) the soluble form of the heavy chain according to SEQ ID NO: 2, wherein the variable domain of the heavy chain VH as shown in SEQ ID NO: 3 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges positioned in the framework regions of VH, and wherein the constant domain of the heavy chain as shown in SEQ ID NO: 27 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges; and (b) the light chain of huHEA125 according to SEQ ID NO: 11, wherein the variable domain of the light chain VL as shown in SEQ ID NO: 12 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges positioned in the framework regions of VL, and wherein the constant domain of the light chain CL as shown in SEQ ID NO: 28 comprises between 0 and 10 (e.g. 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acid exchanges.
Within further preferred embodiments of the first, the second, or the third aspect the target-binding moiety comprises the heavy chain of huHEA125 (membrane-bound form, SEQ ID NO: 1) and/or the light chain of huHEA125 (SEQ ID NO: 11). In one embodiment of the first, the second, or the third aspect, the heavy chain of huHEA125 and/or the light chain of huHEA125 each comprise independently from each other up to 20 (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20) amino acid exchanges, deletions, or additions, wherein these amino acid exchanges, deletions, or additions may be positioned in the constant domains of the heavy chain and/or in the constant domain of the light chain and/or in the framework regions of the variable domain of the heavy chain and/or in the framework regions of the variable domain of the light chain. In a particularly preferred embodiment of the first, the second, or the third aspect, the antibody is a complete IgG antibody comprising two heavy chains of huHEA125 (SEQ ID NO: 1) and two light chains of huHEA125 (SEQ ID NO: 11), wherein one heavy chain is connected to one light chain via a disulfide linkage and wherein the heavy chains are connected to each other by one or two (preferably two) disulfide linkages.
Within further preferred embodiments of the first, the second, or the third aspect the target-binding moiety comprises the heavy chain of huHEA125 (soluble form, SEQ ID NO: 2) and/or the light chain of huHEA125 (SEQ ID NO: 11). In one embodiment of the first, the second, or the third aspect, the heavy chain of huHEA125 and/or the light chain of huHEA125 each comprise independently from each other up to 20 (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20) amino acid exchanges, deletions, or additions, wherein these amino acid exchanges, deletions, or additions may be positioned in the constant domains of the heavy chain and/or in the constant domain of the light chain and/or in the framework regions of the variable domain of the heavy chain and/or in the framework regions of the variable domain of the light chain. In a particularly preferred embodiment of the first, the second, or the third aspect, the antibody is a complete IgG antibody comprising two heavy chains of huHEA125 (SEQ ID NO: 2) and two light chains of huHEA125 (SEQ ID NO: 11), wherein one heavy chain is connected to one light chain via a disulfide linkage and wherein the heavy chains are connected to each other by one or two (preferably two) disulfide linkages.
In a fourth aspect the present invention is directed to the target-binding moiety toxin conjugate according to the first, the second, or the third aspect for use in medicine. In a fifth aspect the present invention is directed to the target-binding moiety toxin conjugate according to the first, the second, the third or the fourth aspect for the treatment of cancer or an autoimmune disease in a patient, wherein the cancer is preferably selected from the group consisting of pancreatic cancer, cholangiocarcinoma, breast cancer, colorectal cancer, lung cancer, prostate cancer, ovarian cancer, stomach cancer, kidney cancer, head and neck cancer, brain tumors, childhood neoplasms, soft tissue sarcomas, epithelial skin cancer, malignant melanoma, leukemia, and malignant lymphoma and wherein the autoimmune disease is preferably selected from the group consisting of Ankylosing Spondylitis, Chagas disease, Crohns Disease, Dermatomyositis, Diabetes mellitus type 1, Goodpasture's syndrome, Graves' disease, Guillain-Barre syndrome (GBS), Hashimoto's disease, Hidradenitis suppurativa, Idiopathic thrombocytopenic purpura, Lupus erythematosus, Mixed Connective Tissue Disease, Myasthenia gravis, Narcolepsy, Pemphigus vulgaris, Pernicious anaemia, Psoriasis, Psoriatic Arthritis, Polymyositis, Primary biliary cirrhosis, Relapsing polychondritis, Rheumatoid arthritis, Schizophrenia, Sjogren's syndrome, Temporal arteritis, Ulcerative Colitis, and Vasculitis Wegener's granulomatosis, in particular Rheumatoid arthritis.
In a sixth aspect the present invention is directed to a pharmaceutical composition comprising at least one type of the target-binding moiety toxin conjugate according to the first, the second, or the third aspect and further comprising one or more pharmaceutically acceptable diluents, carriers, excipients, fillers, binders, lubricants, glidants, disintegrants, adsorbents; and/or preservatives. It is envisioned that the pharmaceutical composition may comprise two or more different target-binding moiety toxin conjugates. Preferably the target binding moieties bind to different targets.. In particular in tumour therapy it has be recognized that it may be advantageous to administer two or more target-binding moieties directed against two different targets on the same tumour cell thereby increasing the likelihood that all tumour cells are killed by the administration of the therapeutic and decreasing the likelihood of development of resistance.
It is particularly preferred that the pharmaceutical composition of the seventh aspect or as prepared in the sixth aspect can be used in the form of systemically administered medicaments. These include parenterals, which comprise among others injectables and infusions. Injectables are formulated either in the form of ampoules or as so called ready-for- use injectables, e.g. ready-to-use syringes or single-use syringes and aside from this in puncturable flasks for multiple withdrawal. The administration of injectables can be in the form of subcutaneous (s.c), intramuscular (i.m.), intravenous (i.v.) or intracutaneous (i.e.) application. In particular, it is possible to produce the respectively suitable injection formulations as a suspension of crystals, solutions, nanoparticular or a colloid dispersed systems like, e.g. hydrosols.
Injectable formulations can further be produced as concentrates, which can be dissolved or dispersed with aqueous isotonic diluents. The infusion can also be prepared in form of isotonic solutions, fatty emulsions, liposomal formulations and micro-emulsions. Similar to injectables, infusion formulations can also be prepared in the form of concentrates for dilution. Injectable formulations can also be applied in the form of permanent infusions both in in-patient and ambulant therapy, e.g. by way of mini-pumps.
It is possible to add to parenteral drug formulations, for example, albumin, plasma, expander, surface-active substances, organic diluents, pH-influencing substances, complexing substances or polymeric substances, in particular as substances to influence the adsorption of the target-binding moiety toxin conjugates of the invention to proteins or polymers or they can also be added with the aim to reduce the adsorption of the target-binding moiety toxin conjugates of the invention to materials like injection instruments or packaging-materials, for example, plastic or glass.
The target-binding moiety toxin conjugates of the invention can be bound to microcarriers or nanoparticles in parenterals like, for example, to finely dispersed particles based on poly(meth)acrylates, polylactates, polyglycolates, polyamino acids or polyether urethanes. Parenteral formulations can also be modified as depot preparations, e.g. based on the "multiple unit principle", if the target-binding moiety toxin conjugates of the invention are introduced in finely dispersed, dispersed and suspended form, respectively, or as a suspension of crystals in the medicament or based on the "single unit principle" if the target-binding moiety toxin conjugate of the invention is enclosed in a formulation, e.g. in a tablet or a rod which is subsequently implanted. These implants or depot medicaments in single unit and multiple unit formulations often consist of so called biodegradable polymers like e.g. polyesters of lactic acid and glycolic acid, polyether urethanes, polyamino acids, poly(meth)acrylates or polysaccharides.
Adjuvants and carriers added during the production of the pharmaceutical compositions of the present invention formulated as parenterals are preferably aqua sterilisata (sterilized water), pH value influencing substances like, e.g. organic or inorganic acids or bases as well as salts thereof, buffering substances for adjusting pH values, substances for isotonization like e.g. sodium chloride, sodium hydrogen carbonate, glucose and fructose, tensides and surfactants, respectively, and emulsifiers like, e.g. partial esters of fatty acids of polyoxyethylene sorbitans (for example, Tween®) or, e.g. fatty acid esters of polyoxyethylenes (for example, Cremophor®), fatty oils like, e.g. peanut oil, soybean oil or castor oil, synthetic esters of fatty acids like, e.g. ethyl oleate, isopropyl myristate and neutral oil (for example, Miglyol®) as well as polymeric adjuvants like, e.g. gelatine, dextran, polyvinylpyrrolidone, additives which increase the solubility of organic solvents like, e.g. propylene glycol, ethanol, N,N-dimethylacetamide, propylene glycol or complex forming substances like, e.g. citrate and urea, preservatives like, e.g. benzoic acid hydroxypropyl ester and methyl ester, benzyl alcohol, antioxidants like e.g. sodium sulfite and stabilizers like e.g. EDTA.
When formulating the pharmaceutical compositions of the present invention as suspensions in a preferred embodiment thickening agents to prevent the setting of the target- binding moiety toxin conjugates of the invention or, tensides and polyelectrolytes to assure the resuspendability of sediments and/or complex forming agents like, for example, EDTA are added. It is also possible to achieve complexes of the active ingredient with various polymers. Examples of such polymers are polyethylene glycol, polystyrol, carboxymethyl cellulose, Pluronics® or polyethylene glycol sorbit fatty acid ester. The target-binding moiety toxin conjugates of the invention can also be incorporated in liquid formulations in the form of inclusion compounds e.g. with cyclodextrins. In particular embodiments dispersing agents can be added as further adjuvants. For the production of lyophilisates scaffolding agents like mannite, dextran, saccharose, human albumin, lactose, PVP or varieties of gelatine can be used.
In a further aspect the present invention is directed to a method of treating cancer, or an autoimmune disease, wherein the cancer is preferably selected from pancreatic cancer, cholangiocarcinoma, breast cancer, colorectal cancer, lung cancer, prostate cancer, ovarian cancer, stomach cancer, kidney cancer, head and neck cancer, brain tumors, childhood neoplasms, soft tissue sarcomas, epithelial skin cancer, malignant melanoma, leukemia, or malignant lymphoma and wherein the autoimmune disease is preferably selected from the group consisting of Ankylosing Spondylitis, Chagas disease, Crohns Disease, Dermatomyositis, Diabetes mellitus type 1, Goodpasture's syndrome, Graves' disease, Guillain-Barre syndrome (GBS), Hashimoto's disease, Hidradenitis suppurativa, Idiopathic thrombocytopenic purpura, Lupus erythematosus, Mixed Connective Tissue Disease, Myasthenia gravis, Narcolepsy, Pemphigus vulgaris, Pernicious anaemia, Psoriasis, Psoriatic Arthritis, Polymyositis, Primary biliary cirrhosis, Relapsing polychondritis, Rheumatoid arthritis, Schizophrenia, Sjogren's syndrome, Temporal arteritis, Ulcerative Colitis, and Vasculitis Wegener's granulomatosis, in a patient in need thereof, comprising administering to the patient an effective amount of a target-binding moiety toxin conjugate as defined in the first, the second, or the third aspect.
EXAMPLES
In the following, the invention is explained in more detail by non-limiting examples:
Example 1: Materials and Methods
1.1 Chimeric antibody huHEA125
Several years ago, the inventors have established a hybridoma cell line secreting the anti-EpCAM mouse monoclonal antibody HEAl 25 (Moldenhauer et al., 1987; Momburg et al., 1987). Using molecular biology techniques this hybridoma line was reconstructed to produce a chimeric version of the antibody consisting of the mouse variable domains hooked up to human kappa constant light chain and human IgGl constant heavy chain. The resulting antibody huHEA125 binds to EpCAM-expressing cells with high affinity (Kd = 2.2x10"9 M) and high specificity. The gene sequences and the amino acid sequences of huHEA125 immunoglobulin are shown below:
huHEA125 heavy chain
Peptide sequence heavy chain, membrane bound form (IGHV/IGHD/IGHJ/IGHG1; IGHGl is underlined) (SEQ ID NO: 1):
EVKLLESGGGLVQPGGSLKLSCAASGFDFSRFWMTWVRQAPGKGLEWIGEINLDSSTI
NYTPSLKDKFIISRDNAKNTLFLQMSKVRSEDTALYYCSRGISMDYWGQGTSVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMI SRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGLQLDETCAEAQDGELDGLWT
TITIFISLFLLSVCYSAAVTLFKVKWIFSSWELKQTLVPEYKNMIGQAP
Peptide sequence heavy chain, secreted form (SEQ ID NO: 2):
EVKLLESGGGLVQPGGSLKLSCAASGFDFSRFWMTWVRQAPGKGLEWIGEINLDSSTI NYTPSLKDKFIISRDNAKNTLFLQMSKVRSEDTALYYCSRGISMDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Peptide sequence (IGHV/IGHD/IGHJ = VH domain; the framework regions FRl, FR2, FR3 and FR4 are underlined) (SEQ ID NO: 3): EVKLLESGGGLVQPGGSLKLSCAASGFDFSRFWMTWVRQAPGKGLEWIGEINLDSSTI NYTPSLKDKFIISRDNAKNTLFLQMSKVRSEDTALYYCSRGISMDYWGQGTSVTVSS
Nucleic acid sequence (annotated according to the IMGT-nomenclature, IGHV/IGHD/IGHJ; IGHD underlined; IGHJ doubly underlined): FRl (SEQ ID NO: 4):
GAAGTGAAGCTTCTCGAGTCTGGAGGTGGCCTGGTGCAGCCTGGAGGATCCCTGAAAC TCTCCTGTGCAGCCTCA
CDRl (SEQ ID NO: 5): GGATTCGATTTTAGTAGATTCTGG
FR2 (SEQ ID NO: 6):
ATGACTTGGGTCCGGCAGGCTCCAGGGAAAGGGCTAGAATGGATTGGAGAA CDR2 (SEQ ID NO: 7):
ATTAATCTAGATAGCAGTACGATA
FR3 (SEQ ID NO: 8):
AACTATACGCCATCTCTAAAGGATAAATTCATCATCTCCAGGGACAACGCCAAAAATA CGCTGTTCCTGCAAATGAGCAAAGTGAGATCTGAGGACACAGCCCTTTATTACTGT
CDR3 (SEQ ID NO: 9):
TCAAGAGGTATTTCTATGGACTAC FR4 (SEQ ID NO: 10):
TGGGGTCAGGGAACCTCAGTCACCGTCTCCTCA
huHEA125 light chain Peptide sequence light chain (IGKV/IGKJ/IGKC; IGKC is underlined) (SEQ ID NO: 11):
DILLTQSPAILSVSPGERVSFSCRASQSIGI SLHWYQQRPSDSPRLLIKYASESI SGI PSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNIWPTTFGAGTKLELKRTVAAPSVF IFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Peptide sequence (IGKV/IGKJ = VL domain; the framework regions FRl, FR2, FR3 and FR4 are underlined) (SEQ ID NO: 12):
DILLTQSPAILSVSPGERVSFSCRASQSIGISLHWYQQRPSDSPRLLIKYASESISGI PSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNIWPTTFGAGTKLELK
Nucleic acid sequence (annotated according to the IMGT-nomenclature, IGKV/IGKJ; IGKV is underlined; IGKJ is doubly underlined):
FRI (SEQ ID NO: 13): GACATCTTGCTGACTCAGTCTCCAGCCATCCTGTCTGTGAGTCCAGGAGAAAGAGTCA GTTTCTCCTGCAGGGCCAGT
CDRl (SEQIDNO: 14): CAGAGCATTGGCATAAGT
FR2(SEQIDNO: 15): TTACACTGGTATCAGCAAAGACCAAGTGATTCTCCAAGGCTTCTCATAAAG
CDR2 (SEQ ID NO: 16): TATGCTTCT
FR3 (SEQ ID NO: 17):
GAGTCAATCTCTGGGATCCCTTCCAGGTTTAGTGGCAGTGGATCAGGGACAGATTTTA CTCTTAGCATCAACAGTGTGGAGTCTGAAGATATTGCAGATTATTACTGT
CDR3 (SEQ ID NO: 18: CAACAAAGTAATATCTGGCCAACCACG
FR4(SEQIDNO: 19): TTCGGTGCTGGGACCAAGCTGGAGCTGAAA
1.2 Control antibody Xolair®
The control antibody Xolair® (Omalizumab, human IgGl antibody directed against human IgE immunoglobulin) was produced by Novartis, Germany.
1.3 Carcinoma cell lines The following carcinoma cell lines were used for growth inhibition studies with huHE A 125 -amatoxin conj ugates :
Capan-1 pancreatic adenocarcinoma MCF-7 human breast adenocarcinoma (derived from pleural effusion)
Colo205 colon cancer metastasis
OZ cholangiocarcinoma
The following carcinoma cell lines were used for growth inhibition studies or mouse xenograft studies with HERCEPTIN-amatoxin conjugates:
SKOV-3 ovarian carcinoma
SK-BR-3 breast adenocarcinoma
NCI-N87 gastric carcinoma
MDA-MB231 breast carcinoma Cells were obtained from the American Type Culture Collection (Manassas, USA).
1.4 Synthesis of Amanitin derivatives with linker at amino acid 1
1.4.1 Synthesis of Di-t-butyloxycarbonyl-hexamethylenediamine
Thirty g of t-butyloxycarbonylazide was dissolved in 50 ml of 1.4-dioxan and added dropwise to 12 g of hexamethylenediamine dissolved in 60 ml of 1,4-dioxane at 0°C. After 2Oh at RT diethylether was added and the precipitate isolated in a Bϋchner funnel. Recrystallized from methanol/water.
1.4.2 Synthesis of t-Butyloxycarbonyl-hexamethylenediamine hydrochloride
12.9 g of di-t-butyloxycarbonyl -hexamethylenediamine was suspended in 100 ml of diethylether containing HCl (2N) and stirred magnetically for 3h at RT. The precipitate formed was isolated and thoroughly washed with diethylether yielding a first fraction of the product. Addition of another 100 ml of diethylether containing HCl (2N) yields another fraction of the product, which is pure after several washings with diethylether. Yield ca. 3 g.
1.4.3 Synthesis of β-Amanitin-(t-butyloxy-carbonyl)-hexamethylenediamide (I)
Figure imgf000031_0001
β-amanitin (I)
20 mg of dried β-amanitin (22μmol) was dissolved in 0.3 ml of dried dimethylform- amide (DMF), and 0.005 ml of triethylamine was added. Under magnetic stirring, the reaction mixture was cooled to -18°C (ice/NaCl) and after 10 min 0.164 ml of a mixture of 0.1 ml of chloroisobutylformate and 1.0 ml of DMF (110 μmol, 5 eq.) was added. The reaction was allowed to proceed for 20 min at -180C. Fifty-five mg (220 μmol, 10 eq.) of t-butyloxy- carbonyl-hexamethylenediamine hydrochloride and 0.005 ml of triethylamine were dissolved in 0.3 ml of DMF, added to the reaction and stirred for Ih at RT.
The reaction mixture was applied to 4 tic silica plates (20 x 20 cm) and developed in chloroform/methanol/water (65:25:5). The product was identified in the u.v. light (RF = 0.49), scraped off and extracted with methanol. Yield 11.5 mg. Recovery of β-amanitin by the same procedure was 7.5 mg.
1.4.4 Synthesis of β-Amanitin-hexamethylenediamide (II)
Figure imgf000031_0002
(I) (H) 4.54 mg (4.05μmol) β-Amanitin-(t-butyloxy-carbonyl)-hexamethylenediamide (I) was stirred at room temperature in 250 μl trifluoroacetic acid. After 2 minutes the excess TFA was evaporated at 20°C and the remaining solid coevaporated 2 times with ImI acetonitrile and methanol. The crude amine was dissolved in lOOOμl dmso and prifϊed on a LaPrep-HPLC: column: Kromasil 100-C18, 10 μm, 250x20 mm, with methanol/water ( 0.05% TFA ), flow:
26 ml/min, detection at λ=295 nm. Solvent A: 95% water: 5% methanol 0.05% trifluoroacetic acid. Solvent B: 10% water: 90% methanol 0.05% trifluoroacetic acid. Gradient: 0-5 min
100% A; 5-20 25 min 0% A; 25-27 min 100% A ; 27-35 min 100% A. The fractions with the same retention time were collected and the solvents evaporated. 4.0 mg (70% yield) of a white foam. MS: 1019 M+H;
1.4.5 Synthesis of β-Amanitin-hexamethylenediamido-suberoyl-HERCEPTIN and β- Amanitin-hexamethylenediamido-dithio[bis-propionate]-HERCEPTIN
1.33 mg of β-amanitin-hexamethylendiamide (II) was dissolved in 144 μl molecular sieve dried DMF. 16.0μl solution of DSS (disuccinimidyl suberate; 3.7 mg DSS/lOOμl DMF) or 16.0 μl solution of DSP (dithiobis(succinimidyl) propionate; 3.4 mg DSP/lOOμl DMF) and 3.7 μl triethylamine have been added respectively. Reaction was performed over night at RT. Reaction products have been precipitated by 2x 30ml dried diethylether and resolubilized in 133 μl dried DMF. 133 μl of each DMF solution was added to 2.25ml HERCEPTIN solution (2 mg/ml in PBS). Reaction was performed over night at RT on a rotating shaker. Isolation of the antibody-conjugates β-amanitin-hexamethylenediamido-suberoyl-HERCEPTIN and β- amanitin-hexamethylenediamido-suberoyl-HERCEPTIN was performed by separation of macromolecular components on a G25-gelfϊltration column.
1.4.6 Synthesis of β-Amanitin-hexamethylenediamido-suberoyl-Xolair
The β-amanitin conjugate with the control antibody Xolair (2mg/ml) was prepared according to the huHEA125 conjugate. Ratio toxin : IgG was ca 1 : 1.
1.4.7 Synthesis of β-Amanitin-hexamethylenediamido-suberoyl-huHEA125
10 mg of (I) (9.0 μmol) were treated with 0.2 ml of trifluoroacetic acid for 2 min at
RT. The acid was removed in vacuo, and the residue dissolved in 0.2 ml of DMF. After the addition of 0.010 ml of triethylamine, 9.0 mg of disuccinimidylsuberate (DSS) (27 μmol) in
0.1 ml of DMF was added and reacted for 2.5 h at RT. The reaction product was precipitated with dietylether, centrifuged, and the pellet dissolved in 0.2 ml of DMF. Half of this solution was added to 8 mg of huHEA125 in 4 ml of PBS. The mixture was rotated slowly for 16 h at 5°C, and the toxin-antibody conjugate was separated from unreacted amanitin and N- hydroxy-succinimide on a Sephadex G25 column (100 x 2 cm) developed with PBS.
1.4.8 Synthesis of β-Amanitin-N-hydroxysuccinimide ester (I)
10 mg of dried β-amanitin (11 μmol) was dissolved in 0.1 ml of dry dimethylformamide (DMF). To this solution 8 mg of N-hydroxysuccinimide (70 μmol) in 0.02 ml of DMF was added, followed by 4 mg of dicyclohexylcarbodiimide (20 μmol) in 0.02 ml of DMF. The mixture was allowed to react for 16 h at RT, and the solution separated from crystallized dicyclohexylurea. β-Amanitin-N-hydroxysuccinimide ester was precipitated by the addition of 10 ml of diethylether, and the precipitate isolated by centrifugation. The pellet was macerated with another 10 ml of ether and centrifuged again. Purification was not necessary, because the following step allowed separation and recovery of unreacted β- amanitin.
1.4.9 Synthesis of β-Amanitin-huHEA125 (huHEA125-Amanitinl)
The precipitate of (I) was dissolved in 0.2 ml of DMF, added to 4 ml of huHEA125 (2 mg/ml) in PBS and rotated slowly over night at 5°C. Applied to a Sephadex G25 column (100 x 2cm) developed with PBS, the reaction product was separated from unreacted β-amanitin and N-hydroxysuccinimide. The toxin load was ca. 1 amanitin per IgG molecule.
1.5 Synthesis of Amanitin huHEA conjugate with linker at amino acid 4
1.5.1 Synthesis of α-Amanitin-6'-(t-butyl-acetate) (I)
Twenty mg of α-amanitin (22 μmol) was dissolved in 0.4 ml of dry dimethylformamide (DMF), and 1.5 eq. (33 μmol) of 0.5M sodium ethylate were added under magnetic stirring. Immediately, 18 μl (5.5 eq., 120 μmol, 23.4 mg, d = 1.3) of t-butyl bromoacetate (mwt. 195) was added and allowed to react for 10 min. The reaction mixture was applied to 2 silica tic plates (20cm x 20cm, Merck HF254) and developed in chloroform/methanol/water (65:25:4). The product (RF = 0.41) was detected in u.v. light, scraped off and eluted with methanol. Yield: 55%.
1.5.2 Synthesis of α-Amanitin-6'-acetyl-(t-butyloxycarbonyl)-ethylene diamide (II) Five mg (5 μmol) of (I) were reacted with 0.2 ml of trifluoroacetic acid for 2 min, and the acid was removed in vacuo. The residue was dissolved in 0.2 ml DMF, and 0.005 ml of triethylamine was added. Under magnetic stirring, the solution was brought to -18°C (ice/NaCl) and 3.4 mg (25 μmol, 5 eq.) of isobutylchloroformate was added. The reaction was allowed to proceed at -180C for 20 min., and 9.8 mg (50μmol, 10 eq.) of t-butyloxycarbonyl- ethylenediamine hydrochloride dissolved in 0.1 ml DMF and 0.006 ml triethylamine were added. The reaction mixture was stirred for Ih at RT. The product was precipitated with dry diethylether, and the residue developed on a silica tic plate as described above. (RF = 0.28). Yield: 85%.
1.5.3 Synthesis of α-Amanitin-6'-acetyIethylene-diamido-suberoyl-huHEA125 (huHEA125-Amanitin4)
Four mg (3.6 μmol) of (II) was dissolved in 0.2 ml of trifluoroacetic acid for 2 min and evaporated in vacuo. The residue was dissolved in 0.2 ml of dry DMF, 0.005 ml of triethylamine added, and reacted with 3 mg (8.2 μmol, 2.3 eq.) of disuccinimidyl suberate (DSS) under magnetic stirring for 2.5 h at RT. The amanitin derivative was precipitated with dry diethylether, centrifuged, macerated with ether again, and centrifuged. Dissolved in 0.15 ml of DMF it was added to 5 ml of huHEA125 (2mg/ml) in PBS and rotated slowly over night at 5°C. Developed on a Sephadex G25 column (100 x 2 cm) with PBS the antibody amanitin conjugate was separated from unreacted amanitin derivative and by-products. The ratio toxin : antibody was 3.0.
1.6 Synthesis of Amanitin Herceptin conjugates with linker at amino acid 4
1.6.1 Synthesis of 6 'O-(NH-boc-6-aminohexyl )-α-amanitin (1)
Figure imgf000034_0001
α-amanitin (1) Under argon 30.00 mg (32.6 μmol) of vacuum dried α-amanitin was dissolved in 1000 μl dry dimethyl sulfoxide (DMSO). 73.18 mg (261.2 μl, 6 eq.) NH-boc-aminohexylbromide (Fluka 89171) and 3.66 mg (32.6 μmol) potassium tert.-butylate was added. After 90 minutes at room temperature the reaction mixture was acidified to pH= 4 with acetic acid and diluted with 40 ml diethyl ether. The solid was collected and taken up in 1000 μl methanol. The methanol solution was diluted with lOOOμl water. The solution was purified on a LaPrep- HPLC: column: Kromasil 100-C18, 10 μm, 250x20 mm, with methanol/water ( 0.05% TFA ), flow: 26 ml/min, detection at λ=295 nm. Solvent A: 95% water: 5% methanol 0.05% trifluoroacetic acid. Solvent B: 10% water: 90% methanol 0.05% trifluoroacetic acid. Gradient: 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A ; 27-30 min 100% A. The fractions with the same retention time were collected and the solvents evaporated.
9.9 mg (27% yield) of a white powder. MS: 1118 M+H; 1140 M+Na+
1.6.2 Synthesis of 6'-O-(-6-aminohexyl )-α-amanitin (2)
Figure imgf000035_0001
(1) (2)
9.90 mg (8.85 μmol) 6'-(-NH-boc-6-aminohexyl-)-α-amanitin (compound (I)) was dissolved in 250 μl trifluoroacetic acid. The reaction mixture was stirred under argon at ambient temperature. After 2 minutes the acid was removed in vacuum at 20°C and the residue dried. The crude α-amanitin ether was purified on a LaPrep-HPLC: column: Kromasil 100-C18, 10 μm, 250x20 mm, with methanol/water (0.05% TFA ), flow: 26 ml/min, detection at λ=295 nm. Solvent A: 95% water: 5% methanol 0.05% trifluoroacetic acid. Solvent B: 10% water: 90% methanol 0.05% trifluoroacetic acid. Gradient: 0-5 min 100% A; 5-25 min 50% A; 25-30 min 0% A; 30-35 min 0% A ; 35-40min 100% A, 40-45 min 100% A. The fractions with the same retention time were collected and the solvents evaporated. 9.10mg (99% yield) of a white powder. MS: 1019 M+H+; 1041 M+Na+
1.6.3 Synthesis of α-amanitin-Herceptin conjugates (3) and (4)
2.0 mg of compound (2) was dissolved in 113 μl molecular sieve dried DMF. 21.8μl solution of DSS (disuccinimidyl suberate; 3.7 mg DSS/lOOμl DMF) or 23.9 μl solution of DSP (dithiobis(succinimidyl) propionate; 3.7 mg DSP/lOOμl DMF) and 5.7 μl triethylamine have been added respectively. Reaction was performed over night at RT. Reaction products have been precipitated by 2x 30ml dried diethylether and resolubilized in 200 μl dried DMF. 59 μl (DSS) or 173 μl (DSP) of the DMF solutions were added to 6.0ml antibody solution (2 mg/ml in PBS). Reaction was performed over night at RT on a rotating shaker. Isolation of the antibody-conjugates (3) and (4) was performed by separation of macromolecular components on a G25-gelfiltration column.
Figure imgf000036_0001
(3)
Figure imgf000036_0002
(4)
1.7 Synthesis of Amanitin Herceptin conjugates with linker at amino acid 4
1.7.1 Synthesis of 6'-0-(5-0-t-butyl-carboxypentyl)-α-amanitin (5)
Figure imgf000037_0001
α-amanitin (5)
Under argon 17.07 mg (18.6 μmol) of vacuum dried α-amanitin was dissolved in 1000 μl dry dimethyl sulfoxide (DMSO ). 60.1 μl (18.6 μmol, 1 eq.) potassium-tert-butanolate as a 3.09 M solution in DMSO was added at once. After the addition of the base 38 μl (148.6 μmol) of 6-bromoheptanoic acid-tert-butylester was added. The reaction mixture was stirred for 8 hours. After 8, 11, 23, 34, 50 and 52h additional amounts of potassium-tert-butanolate ( 60.1μl ) and 6-bromoheptanoic acid-tert-butylester (38 μl ) was added. After 56h the reaction mixture was quenched with lOOμl of a 0.3M solution of acetic acid in DMSO. The volatiles of the reaction mixture were removed at 40°C and 8 mbar. The crude amanitin ether was purified on a LaPrep-HPLC: column: Kromasil 100-Cig, 10 μm, 250x20 mm, with methanol/water( 0.05% TFA ), flow: 26 ml/min, detection at λ=295 nm. Solvent A: 95% water : 5% methanol 0.05% trifluoroacetic acid. Solvent B: 10% water: 90% methanol 0.05% trifluoroacetic acid. Gradient: 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A ; 27-35 min 100% A. The fractions with the same retention time (20.2 min) were collected and the solvent evaporated.
17.88 mg (53% yield) of a white powder. MS: 1089 M+H+; 1111 M+Na+
1.7.2 Synthesis of 6 '-O-(carboxypentyl)-α-amanitin (6)
Figure imgf000037_0002
(5) (6)
14.84 mg (13.64mmol) 6λ-(-carboxypentyl-)-α-amanitin (compound (5)) was dissolved under argon in 250μl trifluoro acetic acid (TFA). The reaction mixture was stirred for 2 minutes and evaporated to dryness at 200C. The residue was co-evaporated 2 times with ImI methanol. The remaining solid was purified on a LaPrep-HPLC: column: Kromasil 100-Ci8, 10 μm, 250x20 mm, with methanol/water (0.05% TFA), flow: 26 ml/min, detection at λ=295 run. Solvent A: 95% water : 5% methanol 0.05% trifluoroacetic acid. Solvent B: 10% water: 90% methanol 0.05% trifluoroacetic acid. Gradient: 0-5 min 100% A; 5-20 min 0% A; 20-40 min 0% A. The fractions with the same retention time were collected and evaporated. 7.05 mg (50% yield) of a white powder. MS: 1033 M+H+; 1056 M+Na+
1.7.3 Synthesis of α-amanitin-Herceptin conjugate (7)
10.0 mg of compound (6) was dissolved in 100 μl molecular sieve dried DMF. 80.0 μl solution of N-hydroxysuccinimide (7.4 mg N-OH-Succ/80μl DMF) and 80.0 μl solution of
DCCi (N,N-dicyclohexylcarbodimide; 3.4 mg DCCi/80μl DMF) was added. Reaction was performed over night at RT. Reaction product was precipitated by 2x 30 ml dried diethylether and resolubilized in 800μl dried DMF. 266 μl of the DMF solution was added to 5.0 ml antibody solution (6mg/ml in PBS). Reaction was performed over night at RT on a rotating shaker. Isolation of the antibody-conjugate (7) was performed by separation of macromolecular components on a G25-gelfϊltration column.
Figure imgf000038_0001
(7) 1.8 Synthesis of Amanitin huHEA conjugate with linker at amino acid 3
1.8.1 Synthesis of α-Amanitin-glutarate
3.0 mg (3.3 μmol) of α-amanitin, dried in vacuo over P4Oi0 was dissolved in 0.25 ml of dry pyridine and reacted with 0.9 mg (79 μmol) glutaric anhydride in 0.1 ml pyridine for 24h at RT in the dark. The peptide was precipitated by addition of 7 ml of dry diethylether, centrifuged, and the solid washed a second time with diethylether and centrifuged.
By way of this reaction an α-amanitin derivative is obtained wherein Ri = -OH (in Fig. 1) is replaced by Ri = -O-C(O)-(CH2)3-COOH.
1.8.2 Synthesis of α-Amanitin-glutaric acid N-hydroxysuccinimidate
3.4 mg of α-amanitin glutarate (3.3 μmol) was dissolved in 0.05 ml of dry dimethylformamide (DMF), and 2.4 mg (7 eq.) of N-hydroxy-succinimide dissolved in 0.01 ml of DMF were added. After the addition of 1.2 mg of dicyclohexylcarbodiimide in 0.01 ml of DMF the reaction was allowed to proceed for 16 h at RT. The solution was separated from the crystals formed, and the peptide precipitated by the addition of 4 ml of dry diethylether. After centrifugation, the pellet was washed with another 4 ml of ether and centrifuged. The solid was dissolved in 0.1 ml of dimethylformamide and immediately used for the reaction with the antibody solution.
1.8.3 Synthesis of α-Amanitin-glutarate-huHEA125 (huHEA125-Amanitin3)
0.1 ml of the solution of 3.0 mg of α-amanitin-glutaric acid N-hydroxysuccinimidate was added to 10 mg of hu-HEA125 antibody in 5 ml of PBS and reacted under slow rotation at 5°C in the dark. After 16h the solution was applied to a Sephadex G25 column (12O x 1.5 cm) equilibrated with PBS, and the protein fraction collected. Amanitin load was determined spectrophotometrically from the absorption difference at 310 nm of the protein solution against a blank containing the same concentration of the native antibody, using the molar extinction coefficient for amatoxins of 13.500 Cm-1 M"1. Ratio α-amanitin: IgG of this preparation was ca. 8.
1.9 Synthesis of Amanitin Herceptin conjugates with linker at amino acid 3
1.9.1 Synthesis of δ-O-( NH-boc-6-aminohexylcarbamoyl )-α-amanitin (8)
Figure imgf000040_0001
α-amanitin (8)
cat.: dibutyl dilaurylstannate n-bu2Sn[OCO(CH2)10CH3]2
Under argon 13.43 mg (14.6 μmol) vacuum dried α-amanitin was dissolved in 1000 μl dry dimethyl formamide (DMF). 7.08 mg (29.2 μmol) NH-Boc-6-isocyanato aminohexane and 18.46 mg (29.2μmol) di-Butyl dilaurylstannate was added and the reaction mixture stirred at ambient temperature. After 23 hours additional 13.43 mg (14.6 μmol) NH-Boc-6- isocyanatoaminohexane was added. After 52 hours the reaction mixture was hydrolyzed with 200μl methanol and evaporated to dryness. The residue was dissolved in 1200 μl DMSO and purified on a LaPrep-HPLCxolumn: Kromasil 100-Ci8, 10 μm, 250x20 mm, with methanol/water (0.05% TFA), flow: 26 ml/min, detection at λ=295 nm. Solvent A: 95% water : 5% methanol. Solvent B: 5% water: 95% methanol. Gradient: 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A; 27-35 min 100%A. The fractions with the same retention time were collected and the solvents evaporated.
9.06 mg (53% yield) of a white solid. MS: 1161 M+H+; 1183 M
1.9.2 Synthesis of δ-0-(6-aminohexylcarbamoyl)-α-amanitin (9)
Figure imgf000040_0002
9.06 mg (7.8 μmol) compound (8) was dissolved in 250 μl trifluoroacetic acid and stirred for 2 minutes at ambient temperature. The reaction mixture was evaporated to dryness and the residue koevaporated 2 times with 1.5 ml acetonitrile. The solid was purified on a LaPrep-HPLC: column: Kromasil 100-C18, 10 μm, 250x20 mm, with acetonitrile/water, flow: 26 ml/min, detection at λ=295 nm. Solvent A: 95% water: 5% acetonitrile. Solvent B: 5% water: 95% acetonitrile. Gradient: 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A; 27-35 min 100% A. The fractions with the retention time between 12-17 min were collected and evaporated to a white solid.
8.75 mg (95% yield). MS: 1061 M+H+; 1083 M+Na+
1.9.3 Synthesis of α-amanitin-Herceptin conjugates
2.0 mg of compound (9) was dissolved in 113 μl molecular sieve dried DMF. 21.8 μl solution of DSS (disuccinimidyl suberate; 3.7 mg DSS/lOOμl DMF) or 23.9 μl solution of DSP (dithiobis(succinimidyl) propionate; 3.7 mg DSP/100 μl DMF) and 5.7 μl triethylamine was added respectively. The reaction was performed over night at RT. Reaction products were precipitated by 2x 30 ml dried diethylether and resolubilized in 200 μl dried DMF. 122 μl (DSS) or 176 μl (DSP) of the DMF solutions were added to 6.0 ml of a solution of Her-2 specific Herceptin antibody (2 mg/ml in PBS). The reaction was performed over night at RT on a rotating shaker. The isolation of the antibody-conjugate (10) and (11), respectively, was performed by separation of macromolecular components on a G25-gelfiltration column.
Figure imgf000041_0001
(10)
Figure imgf000042_0001
(H)
1.10 Synthesis of Amanitin Herceptin conjugates with linker at amino acid 3
1.10.1 Synthesis of δ-O-( S-O-t-butyl-carboxypentylcarbamoyl )-α-amanitin (12)
Figure imgf000042_0002
α-amanitin (12) cat.: dibutyl dilaurylstannate n-bu2Sn[OCO(CH2)i0CH3]2
Under argon 30.76 mg (33.5 μmol) vacuum dried α-amanitin was dissolved in lOOOμl dry dimethyl formamide (DMF). 14.28 mg (13.83 μl, 66.9μmol) isocyanatohexanoic acid- tert-butylester and 42.28 mg (40.26 μl, 66.9 μmol) dibutyll dilaurylstannate was added. After 23 hours stirring at room temperature additional isocyanato ester (13.83 μl) was added and the reaction mixture was quenched with methanol after 33 hours. The reaction mixture was evaporated to dryness and the remaining solid was dissolved in DMSO and purified on a LaPrep-HPLC: column: Kromasil 100-C18, 10 μm, 250x20 mm, with methanol/water (0.05% TFA), flow: 26 ml/min, detection at λ=295 nm. Solvent A: 95% water: 5% methanol 0.05% trifluoroacetic acid. Solvent B: 10% water: 90% methanol 0.05% trifluoroacetic acid. Gradient: 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A; 27-35 min 100%A. The fractions with the same retention time were collected and the solvents evaporated.
17.95 mg (47% yield) of a powder. MS: 1133 M+H+; 1155 M+Na+
1.10.2 Synthesis of δ-0-(carboxypentylcarbamoyl )-α-amanitin (13)
Figure imgf000043_0001
(12) (13)
17.95 mg (15.9 μmol) tert-butylester (Compound (12)) was dissolved in 500 μl trifluoro acetic acid (TFA) and stirred for 2 minutes at ambient temperature. Excess trifluoro acetic aceid was removed in vacuum and the remaining solid was coevaporated two times with 1.5 ml acetonitrile. The free carboxylic derivative (13) was purified on a LaPrep-HPLC: column: Kromasil 100-Ci8, d=10 mm, 10 μm, 250x20 mm, with acetonitril/water, flow: 26ml/min, detection at λ=295nm. Solvent A: 95% water : 5% acetonitrile. Solvent B: 5% water: 95% acetonitrile. Gradient: 0-5 min 100% A; 5-20 min 0% A; 20-25 min 0% A; 25-27 min 100% A; 27-35 min 100%A. The fractions with the same retention time 12-17min were collected and the solvents evaporated .
11.34 mg (66% yield) of a white slid. MS: 1076 M+H+; 1098 M+Na+
1.10.3 Synthesis of Synthesis of Herceptin-α-amanitin conjugate
10.0 mg HDP compound (13) was dissolved in 100 μl molecular sieve dried DMF. 80.0 μl solution of N-hydroxysuccinimide (7.4 mg N-OH-Succ/80 μl DMF) and 80.0 μl solution of DCCi (N,N-dicyclohexylcarbodimide; 3.4 mg DCCi/80 μl DMF) were added. The reaction was performed over night at RT. The reaction product was precipitated by 2x 30 ml dried diethylether and resolubilized in 800 μl dried DMF. 266 μl of the DMF solution was added to 5.0 ml antibody solution (6 mg/ml in PBS). Reaction was performed over night at RT on a rotating shaker. The isolation of the antibody-conjugate (14) was performed by separation of macromolecular components on a G25-gelfiltration column.
Figure imgf000044_0001
(14)
1.11 Synthesis of Amanitin Herceptin conjugates with linker at amino acid 3
1.11.1 Synthesis of α-Amanitin-glutarate 3.0 mg (3.3 μmol) of α-amanitin, dried in vacuo over P4Oj0 was dissolved in 0.25 ml of dry pyridine and reacted with 0.9 mg (79 μmol) glutaric anhydride in 0.1 ml pyridine for 24h at RT in the dark. The peptide was precipitated by addition of 7 ml of dry diethylether, centrifuged, and the solid washed a second time with diethylether and centrifuged. By way of this reaction an α-amanitin derivative is obtained wherein R1 = -OH (in Fig. 1) is replaced by Ri = -O-C(O)-(CH2)3-COOH.
1.11.2 Synthesis of α-Amanitin-glutaric acid N-hydroxysuccinimidate
3.4 mg of α-amanitin glutarate (3.3 μmol) was dissolved in 0.05 ml of dry dimethylformamide (DMF), and 2.4 mg (7 eq.) of N-hydroxy-succinimide dissolved in 0.01 ml of DMF were added. After the addition of 1.2 mg of dicyclohexylcarbodiimide in 0.01 ml of DMF the reaction was allowed to proceed for 16 h at RT. The solution was separated from the crystals formed, and the peptide precipitated by the addition of 4 ml of dry diethylether. After centrifugation, the pellet was washed with another 4 ml of ether and centrifuged. The solid was dissolved in 0.1 ml of dimethylformamide and immediately used for the reaction with the antibody solution. 1.11.3 Synthesis of α-Amanitin-glutarate-Herceptin (15)
0.1 ml of the solution of 3.0 mg of α-amanitin-glutaric acid N-hydroxysuccinimidate was added to 10 mg of Herceptin antibody in 5 ml of PBS and reacted under slow rotation at 5°C in the dark. After 16h the solution was applied to a Sephadex G25 column (120 x 1.5 cm) equilibrated with PBS, and the protein fraction collected. Amanitin load was determined spectrophotometrically from the absorption difference at 310 nm of the protein solution against a blank containing the same concentration of the native antibody, using the molar extinction coefficient for amatoxins of 13.500 cm'1 'M'1. Ratio α-amanitin: IgG of this preparation was about 4.
Figure imgf000045_0001
(15)
1.12. Synthesis of Aminophalloidin (APHD)-suberoyl-huHEA 125 Aminophalloidin was prepared from mono-tosylphalloidin by reaction with methanolic ammonia. Conjugation of aminophalloidin with huHEA125 was performed in analogy to the reaction described in 1.5.3.
Example 2: Binding studies 2.1 Binding Competition Analysis
Binding of conjugate huHEA125-amanitin3 vs. non-conjugated huHEA125 antibody was analyzed in a competition experiment by flow cytometry. The α-amanitin-huHEA125 conjugate was synthesized as described above in sections 1.6.1 to 1.6.3. Colo205 target cells (colon cancer metastasis) were washed twice in FACS buffer
(Dulbecco's PBS with 1% heat-inactivated fetal calf serum and 0.1% sodium azide) counted and adjusted to 2x107 cells per ml. Fifty μl of cell suspension was given to each well of a 96 well U-bottom microtiter plate to which 50 μl/well of FITC-labeled huHEA125 antibody was pipetted. Serial dilutions of amanitin-huHEA125 or huHEA125 ranging from 400μg/ml to lOng/ml final dilution were added in triplicates in a volume of 50 μl/well and incubated for 1 h on ice. Subsequently, the plate was centrifuged (2 min at 2000 rpm) and the supernatant was removed from the cells. Cells were re-suspended in 150 μl of FACS buffer and centrifuged again. After two washing steps by centrifugation, cells were taken up in 100 μl/well of propidium iodide solution (1 μg/ml in FACS buffer) allowing discrimination of dead cells. Analysis was performed on a FACScan cytometer (Becton and Dickinson, Heidelberg, Germany) using CellQuest software.
As shown in Figure 2 competition of binding to target cells with increasing amounts of huHEA125-amanitin conjugate or unmodified huHEA125 antibody revealed a comparable binding strength over the whole concentration range from 10ng/ml to 400μg/ml competing antibody or antibody conjugate. Therefore, the conjugation procedure did not significantly alter the affinity of huHEA125-amanitin to the target cells.
2.2 Surface expression of EpCAM antigen on various carcinoma cell lines detected by indirect immunofluorescence Cell lines Capan-1, Colo205, OZ, and MCF-7 were first incubated with either huHEA125 or Xolair®. After washing, binding of the primary antibody was visualized by FITC-labelled F(ab')2 goat anti-human IgG (H+L) as second step reagent. The results are shown in Fig. 3 A (Capan-1), Fig. 3B (Colo205), Fig. 3C (OZ), and Fig. 3D (MCF-7). The grey-shaded histograms in the left side of each diagram show the results obtained with control antibody Xolair®; the histograms having a white area in the right side of each diagram show the results obtained with antibody huHEA125. 2.3 Binding of huHEA125-amanitin and huHEA125-phalloidin conjugates to MCF-7 breast cancer cells
Binding of huHEA125-amanitin and huHEA125-phalloidin conjugates versus non- conjugated huHEA125 antibody was analyzed by flow cytometry. MCF-7 target cells were washed twice in FACS buffer (Dulbecco's PBS with 1 % heat-inactivated fetal calf serum and 0.1 % sodium azide) counted and adjusted to 2x107 cells per ml. Fifty μl of cell suspension was given to each well of a 96 well U-bottom microtiter plate. Immunotoxins huHEA125- amanitinl, huHEA125-amanitin4 and huHEA125-phalloidin as well as unconjugated huHEA125 antibody were added at a concentration of 1 μg/ml in a volume of 100 μl per well and incubated for 1 h on ice. The plate was centrifuged (2 min at 2000 rpm) and the supernatant was removed from the cells. Cells were re-suspended in 150 μl of FACS buffer and centrifuged again. Subsequently, 100 μl of FITC-labeled F(ab')2 goat anti-human IgG (H+L) secondary antibody was added per well and incubated again for 1 h on ice. After two washing steps by centrifugation, cells were taken up in 100 μl/well of propidium iodide solution (1 μg/ml in FACS buffer) allowing discrimination of dead cells. Analysis was performed on a FACScan cytometer (Becton and Dickinson, Heidelberg, Germany) using CellQuest software.
As shown in Figure 4 the binding capacity of immunotoxins to target cells was only moderately reduced by the conjugation procedure. When compared with the non-modified huHEA125 antibody showing a mean fluorescence intensity (MFI) of 1094, conjugation with amanitinl decreased binding to MFI 730, conjugation with amanitin4 resulted in a MFI of 905, whereas coupling to alpha-phalloidin reduced MFI to 604. These values were obtained with identical antibody amounts of conjugates.
Example 3: Specific growth inhibition of carcinoma cells by immunoconjugates composed of huHEA125 antibody and amanitin at different binding sites
3.1 Proliferation assay Inhibition of cell growth by amanitin-IgG conjugates was determined by incorporation of [3H]-thymidine. Serial dilutions of amanitin-huHEA125 and amanitin in complete medium (RPMI 1640 supplemented with 10% heat-inactivated FCS, 2 mM L-glutamine and 1 mM sodium pyruvate) ranging from 2xlO'5 M to 6xlO"13 M were prepared in triplicates in a volume of 100 μl in the wells of a 96 well flat-bottom tissue culture microtiter plate. In each well, cells were added in 50 μl at a density of 5x104 per ml in the experiments with huHEA125-Amanitinl and huHEA125-Amanitin4 and at a density of 2xlO4 per ml in the experiments with huHEA125-Amanitin3. Plates were incubated in a humidified atmosphere at 37 0C and 5% CO2 for 72 or 96 h. At 20 h before the end of the assay, 1 μCi of [3H]- thymidine was added. Subsequently, plates were processed with a Tomtec cell harvester and the incorporated radioactivity was determined by liquid scintillation counting (Wallac Betaplate Liquid Scintillation Counter, PerkinElmer Life and Analytical Sciences) and given as cpm.
3.2 Comparison of inhibition of carcinoma cell proliferation caused by conjugates using different linkage sites in the amanitin moiety
Three examples of growth inhibition induced by different amanitin-IgG conjugates are depicted in Figures 5, 6, and 9. In all three experiments MCF-7 cells were used. Figure 5 shows a comparison of huHEA 125- Amanitin 1 with the non-binding control Xolair- Amanitin 1 and with free Amanitin. In the experiment outlined in Figure 6 huHEA125-Amanitin4 was compared with an alpha-phalloidin huHEA125 conjugate and with free Amanitin. Figure 9 shows a comparison of huHEA125-Amanitin3 with Amanitin-armed control antibody Xolair and with free Amanitin.
The IC5o of conjugates huHEA125-amanitinl and huHEA125-amanitin4 were both approximately 5xlO'12 M (Figures 5 and 6) and the IC5O of conjugate huHEA125-amanitui3 was approximately 2x10"12 M (Figure 9). In contrast, the phalloidin-huHEA125 preparation exhibited virtually no effect at least at the dose levels tested (Fig. 6). In accordance with our previous findings, the IC50 of Amanitin alone is in the range of 10' M (Figures 5, 6, and 9).
3.3 Comparison of inhibition of carcinoma cell proliferation for different carcinoma cell lines
Four examples of growth inhibition tested in four different carcinoma cell lines are depicted in Figures 7, 8, 9, and 10. In all four experiments, the conjugate huHEA125- Amanitin3 was used. In case of the pancreatic carcinoma cell line Capan-1 the huHEA125-Amanitin3 immunotoxin induced growth arrest at amanitin concentrations of IxIO"11 to 3x10"* M as depicted in Figure 7. In case of the colon cancer cell line Colo205 the huHEA125-Amanitin3 immunotoxin induced growth arrest at amanitin concentrations of IxIO"12 to 4x10"" M as depicted in Figure 8.
In case of the breast cancer cell line MCF-7 the huHEA125-Amanitin3 immunotoxin induced growth arrest at amanitin concentrations of IxIO"12 to 1x10'11 M as depicted in Figure 9.
In case of the cholangiocarcinoma cell line OZ the huHEA125-Amanitin3 immunotoxin induced growth arrest at amanitin concentrations of Ix 10"11 to 6xlO"10 M as depicted in Figure 10.
Example 4: Specific growth inhibition of carcinoma cells by immunoconjugates composed of Herceptin antibody and amanitin at different binding sites and using different linking chemistry
Inhibition of cell growth by amanitin-Herceptin conjugates was determined by in vitro BrdU incorporation as described in Current Protocols in Immunology 1 (see chapter 7.10. Coligan, J. E. et al., eds.) John- Wiley & Sons, New York). Compounds (3), (4), (7), (10), (11), (14), non-conjugated Herceptin and α-amanitin as such were incubated for 72 h and 120 h, respectively, with three tumor cell lines expressing Her2/neu in high concentration, namely, SKO V-3, SK-BR-3 and NCI-N87 and one Her2/neu negative cell line MDA-MB231. Non conjugated Herceptin showed no cytotoxicity on any cell line while the various amanitin conjugates showed a marked toxicity on the Her2/neu positive cell lines with an EC50 in the pico- to nanomolar range, no siginifcant toxicity was observed on the Her2/neu negative cell line. (See Figures HA to HD). The indicated molar concentration is indicated on the basis of the entire amanitin comprised in the respective conjugate.
Example 5: In vivo Xenograft Tumor Model
A mouse tumor xenograft model, wherein 2.5 x 10& SKO V-3 ovarial carcinoma cells are implated sub-cutaneously (s.c.) into SCID mice and allowed to grow for 10 days. After 10 days a single dose of 30 μg/kg body weight (see Figure 12A) or at 150 μg/kg body weight (see Figure 12B) of various α-amanitin-Herceptin conjugates (Compounds (15), (3), (4) , (10), (11), and (7)) and non-conjugated Herceptin (Control) were administered intravenously. A clear concentration dependent reduction of tumor growth was observed. Conjugates (7), (10) and (15) led to full tumor remission within the period of observation, i.e. 87 days from the initiation of the experiment. REFERENCES
Al-Hajj M., Wicha M.S., Benito-Hernandez A., Morrison S. J., Clarke M.F. Prospective identification of tumorigenic breast cancer cells. Proc. Natl. Acad. Sci. USA 100(7), 3983-3988 (2003)
Allard W.J., Matera J., Miller M.C., Repollet M., Connelly M.C., Rao C, Tibbe A.G., Uhr
J.W., Terstappen L. W. Tumor cells circulate in the peripheral blood of all major carcinomas but not in healthy subjects or patients with nonmalignant diseases. Clin.
Cancer Res. 10(20), 6897-6904 (2004) Baeuerle P. A. and Gires O. EpCAM (CD326) finding its role in cancer. Br. J. Cancer 96(3),
417-423 (2007) Balzar M., Winter M.J., de Boer C.J., Litvinov S.V. The biology of the 17-1 A antigen (Ep-
CAM). J. MoI. Med. 77(10), 699-712 (1999)
Binz H.K., Amstutz P., Plϋckthun A. Engineering novel binding proteins from nonimmunoglobulin domains. Nat Biotechnol. 23(10): 1257- 1268 (2005)
Brody E.N. and Gold L., Aptamers as therapeutic and diagnostic agents. J. Biotechnol.
74(1):5-13 (2000) Dalerba P., Dylla S.J., Park I.K., Liu R., Wang X., Cho R. W., Hoey T., Gurney A., Huang
E.H., Simeone D.M., Shelton A.A., Parmiani G., Castelli C, Clarke M.F. Phenotypic characterization of human colorectal cancer stem cells. Proc. Natl. Acad. Sci. USA
104(24), 10158-10163 (2007) Gastl G., Spizzo G., Obrist P., Dϋnser M., Mikuz G. Ep-CAM overexpression in breast cancer as a predictor of survival. Lancet 356(9246), 1981-1982 (2000)
Holliger P., Prospero T., Winter G. "Diabodies": small bivalent and bispecific antibody fragments. Proc. Natl. Acad. Sci. U.S.A. 90(14), 6444-6448 (1993)
Leuenberger, H.G.W, Nagel, B. and Kolbl, H. eds. "A multilingual glossary of biotechnological terms: (IUPAC Recommendations)", Helvetica Chimica Acta, CH-
4010 Basel, Switzerland), 1995
Li C, Heidt D.G., Dalerba P., Burant C.F., Zhang L., Adsay V., Wicha M., Clarke M.F., Simeone D. M. Identification of pancreatic cancer stem cells. Cancer Res. 67(3), 1030-
1037 (2007) Moldenhauer G., Momburg F., Mϋller P., Schwartz R., Hammerling G.J. Epithelium-specific surface glycoprotein of Mr 34,000 is a widely distributed human carcinoma marker.
Br. J. Cancer 56(6), 714-721 (1987) Momburg F., Moldenhauer G., Hammerling G.J., Moller P. Immunohistochemical study of the expression of a Mr 34,000 human epithelium-specific surface glycoprotein in normal and malignant tissues. Cancer Res. 47(11), 2883-2891 (1987) Nagrath S., Sequist L.V., Maheswaran S., Bell D.W., Irimia D., Ulkus L., Smith M.R., Kwak
E. L., Digumarthy S., Muzikansky A., Ryan P., Balis U.J., Tompkins R.G., Haber D. A., Toner M. Isolation of rare circulating tumour cells in cancer patients by microchip technology. Nature 450(7173), 1235-1239 (2007) Spizzo G., Obrist P., Ensinger C, Theurl I., Dϋnser M., Ramoni A., Gunsilius E., Eibl G.,
Mikuz G., Gastl G. Prognostic significance of Ep-CAM AND Her-2/neu overexpression in invasive breast cancer. Int. J. Cancer 98(6), 883-888 (2002) Spizzo G., Went P., Dirnhofer S., Obrist P., Simon R., Spichtin H., Maurer R., Metzger U., von Castelberg B., Bart R., Stopatschinskaya S., Kochli O. R., Haas P., Mross F.,
Zuber M., Dietrich H., Bischoff S., Mirlacher M., Sauter G., Gastl G. High Ep-CAM expression is associated with poor prognosis in node-positive breast cancer. Breast
Cancer Res. Treat. 86(3), 207-213 (2004) Trzpis M., McLaughlin P.M., de Leij L.M., Harmsen M. C. Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule. Am. J. Pathol. 171(2), 386-395
(2007)
Varga M., Obrist P., Schneeberger S., Mϋhlmann G., Felgel-Farnholz C, Fong D., Zitt M., Brunhuber T., Schafer G., Gastl G., Spizzo G. Overexpression of epithelial cell adhesion molecule antigen in gallbladder carcinoma is an independent marker for poor survival. Clin. Cancer Res. 10(9), 3131-3136 (2004) Went P.T., Lugli A., Meier S., Bundi M., Mirlacher M., Sauter G., Dirnhofer S. Frequent
EpCam protein expression in human carcinomas. Hum. Pathol. 35(1), 122-128, 2004 Wieland, T. and Faulstich H. Amatoxins, phallotoxins, phallolysin, and antamanide: the biologically active components of poisonous Amanita mushrooms. CRC Crit. Rev.
Biochem. 5(3), 185-260 (1978) Winter M.J., Nagtegaal I.D., van Krieken J.H., Litvinov S.V. The epithelial cell adhesion molecule (Ep-CAM) as a morphoregulatory molecule is a tool in surgical pathology. Am. J. Pathol. 163(6), 2139-2148 (2003)
SEQUENCE LISTING - FREE TEXT INFORMATION
SEQ ID NO: 1 : chimeric antibody huHEA125, heavy chain, membrane-bound form SEQ ID NO: 2: chimeric antibody huHE A 125, heavy chain, secreted form
SEQ ID NO: 3: chimeric antibody huHEA125, heavy chain, VH domain
SEQ ID NO: 4: chimeric antibody huHEA125, heavy chain, FRl segment
SEQ ID NO: 5: chimeric antibody huHEA125, heavy chain, CDRl segment
SEQ ID NO: 6: chimeric antibody huHEA125, heavy chain, FR2 segment SEQ ID NO: 7: chimeric antibody huHEA125, heavy chain, CDR2 segment
SEQ ID NO: 8: chimeric antibody huHEA125, heavy chain, FR3 segment
SEQ ID NO: 9: chimeric antibody huHEA125, heavy chain, CDR3 segment
SEQ ID NO: 10: chimeric antibody huHEA125, heavy chain, FR4 segment
SEQ ID NO: 11 : chimeric antibody huHEA125, light chain SEQ ID NO: 12: chimeric antibody huHE A 125, light chain, VL domain
SEQ ID NO: 13: chimeric antibody huHEA125, light chain, FRl segment
SEQ ID NO: 14: chimeric antibody huHEA125, light chain, CDRl segment
SEQ ID NO : 15 : chimeric antibody huHE A 125 , light chain, FR2 segment
SEQ ID NO: 16: chimeric antibody huHEA125, light chain, CDR2 segment SEQ ID NO: 17: chimeric antibody huHEA125, light chain, FR3 segment
SEQ ID NO : 18 : chimeric antibody huHE A 125, light chain, CDR3 segment
SEQ ID NO: 19: chimeric antibody huHEA125, light chain, FR4 segment
SEQ ID NO: 20: chimeric antibody huHEA125, heavy chain, CDRl domain
SEQ ID NO : 21 : chimeric antibody huHE A 125, heavy chain, CDR2 domain SEQ ID NO: 22: chimeric antibody huHEA 125, heavy chain, CDR3 domain
SEQ ID NO: 23: chimeric antibody huHEA125, light chain, CDRl domain
SEQ ID NO: 24: chimeric antibody huHEA125, light chain, CDR2 domain
SEQ ID NO: 25: chimeric antibody huHEA125, light chain, CDR3 domain
SEQ ID NO: 26: chimeric antibody huHEA125, heavy chain, constant domain, membrane bound form
SEQ ID NO: 27: chimeric antibody huHEA125, heavy chain, constant domain, secreted form
SEQ ID NO: 28: chimeric antibody huHEA125, light chain, constant domain

Claims

1. A target-binding moiety toxin conjugate comprising:
(i) a target-binding moiety; (ii) at least one amatoxin; and
(iii) optionally a linker L2; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker L2 via the 6' C-atom of amatoxin amino acid 4.
2. The target-binding moiety toxin conjugate of claim 1, wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker L2 via an oxygen atom bound to the 6' C-atom of amatoxin amino acid 4.
3. The target-binding moiety toxin conjugate of claim 1 or 2, wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker L2 via an ether linkage.
4. The target-binding moiety toxin conjugate of any one of claims 1 to 3, wherein the linker L2 is present and the conjugate has the following structure: amatoxin-6'C-O- L2-C(O)-NH-target-binding moiety.
5. A target-binding moiety toxin conjugate comprising: (i) a target-binding moiety;
(ii) at least one amatoxin; and (iii) optionally a linker L3; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via the δ C-atom of amatoxin amino acid 3.
6. The target-binding moiety toxin conjugate of claim 5, wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via an oxygen atom bound to the δ C-atom of amatoxin amino acid 3.
7. The target-binding moiety toxin conjugate of claim 5 or 6, wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker L3 via an ester linkage, an ether linkage or a urethane linkage.
8. The target-binding moiety toxin conjugate of any one of claims 5 to 7, wherein the linker L3 is present and the conjugate has one of the following structures: (i) amatoxin-δC-O-C(O)-L3-C(O)-NH-target-binding moiety; (ii) amatoxin-δC-O-L3-C(O)-NH-target-binding moiety; or (iii) amatoxin-δC-O-C(O)-NH-L3-C(O)-NH-target-binding moiety.
9. A target-binding moiety toxin conjugate comprising: (i) a target-binding moiety;
(ii) at least one amatoxin; and (iii) optionally a linker Ll ; wherein the at least one amatoxin is connected to the target-binding moiety or, if present, to the linker Ll via the γ C-atom of amatoxin amino acid 1.
10. The target-binding moiety toxin conjugate of claim 9, wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker Ll via a nitrogen atom bound to the γ C-atom of amatoxin amino acid 1.
11. The target-binding moiety toxin conjugate of claim 9 or 10, wherein the amatoxin is connected to the target-binding moiety or, if present, to the linker Ll via an amide linkage.
12. The target-binding moiety toxin conjugate of any one of claims 9 to 11, wherein the linker Ll is present and the conjugate has the following structure: amatoxin-γC(O)- NH-Ll-C(O)-NH- target-binding moiety.
13. The target-binding moiety toxin conjugate of any one of claims 1 to 12, wherein the target-binding moiety is connected to the amatoxin or, if present, to the linker Ll, L2, or L3 via an amino group present in the target-binding moiety.
14. The target-binding moiety toxin conjugate of any one of claims 1 to 13, wherein the amatoxin is selected from α-amanitin, β-amanitin, γ-amanitin, ε-amanitin, amanin, amaninamide, amanullin, or amanullinic acid, or from salts or analogs thereof.
15. The target-binding moiety toxin conjugate of any one of claims 1 to 14, wherein the linker Ll, L2, or L3 is an alkyl, heteroalkyl, alkenyl, heteroalkenyl, alkynyl, heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, aralkyl, or a heteroaralkyl group, optionally substituted.
16. The target-binding moiety toxin conjugate of any one of claims 1 to 15, wherein the linker Ll, L2, or L3 comprises a disulfide bond.
17. The target-binding moiety toxin conjugate of any one of claims 1 to 16 wherein the target-binding moiety specifically binds to an epitope that is present on a tumour cell.
18. The target-binding moiety toxin conjugate of any one of claims 1 to 17 wherein the epitope that is present on a tumour cell is comprised in cell-defined cancer-associated antigens belonging to unique gene products of mutated or recombined cellular genes, in particular cyclin-dependent kinases, pl5Ink4b, p53, AFP, B-catenin, caspase 8, p53, Bcr-abl fusion product, MUM-I MUM-2, MUM-3, ELF2M, HSP70-2M, HST-2,
KIAA0205, RAGE, myosin/m, 707-AP, CDC27/m, ETV6/AML, TEL/Amll, Dekcain, LDLR/FUT, PmI-RARa, TEL/ AMLI; Cancer-testis (CT) antigens, members of the MAGE-family, BAGE, DAM-6, DAM- 10, members of the GAGE- family, NY-ESO- 1, NA-88A, CAG-3, RCC-associated antigen G250, Tumor virus antigens, in particular human papilloma virus (HPV) -derived E6 E7 oncoproteins, Epstein Ban- virus EBNA2-6, LMP-I, LMP-2; gp77, gplOO, MART-1/Melan-A, p53, tyrosinase, tyrosinase-related protein 1 and 2, PSA, PSM, MClR; ART4, CAMEL, CEA, CypB, epithelial cell adhesion molecule (EpCAM) HER2/neu, HER-3, hTERT, hTRT, ICE, Mucl, Muc2, PRAME RUl, RU2, SART-I, SART-2, SART-3, and WTl; and fragments and derivatives thereof.
19. The target-binding moiety toxin conjugate of any one of claims 1 to 18, wherein the target-binding moiety is selected from the group consisting of:
(i) antibody or antigen-binding fragment thereof; (ii) antibody-like protein; and (iii) nucleic acid aptamer.
20. The target-binding moiety toxin conjugate of claim 19, wherein the antibody or the antigen-binding fragment thereof is selected from a diabody, a tetrabody, a nanobody, a chimeric antibody, a deimmunized antibody, a humanized antibody or a human antibody.
21. The target-binding moiety toxin conjugate of claim 19 or 20, wherein the antigen binding fragment is selected from the group consisting of Fab, F(ab')2, Fd, Fv, single- chain Fv, and disulfide-linked Fvs (dsFv).
22. The target-binding moiety toxin conjugate of claim 19 to 20 wherein the antibody or the antigen binding fragment thereof comprises (a) either the membrane-bound form of the heavy chain of huHEA125 (SEQ ID
NO: 1) or the soluble form of the heavy chain of huHEA125 (SEQ ID NO: 2); and/or (b) the light chain of huHEA125 (SEQ ID NO: 11).
23. The target-binding moiety toxin conjugate of any one of claims 1 to 22 for use in medicine.
24. The target-binding moiety toxin conjugate of any one of claims 1 to 23 for the treatment of cancer or an autoimmune disease in a patient, wherein the cancer is preferably selected from the group consisting of pancreatic cancer, cholangiocarcinoma, breast cancer, colorectal cancer, lung cancer, prostate cancer, ovarian cancer, stomach cancer, kidney cancer, head and neck cancer, brain tumors, childhood neoplasms, soft tissue sarcomas, epithelial skin cancer, malignant melanoma, leukemia, and malignant lymphoma and the autoimmune disease is preferably selected from the group consisting of and wherein the autoimmune disease is selected from the group consisting of Ankylosing Spondylitis, Chagas disease, Crohns Disease, Dermatomyositis, Diabetes mellitus type 1, Goodpasture's syndrome, Graves' disease, Guillain-Barre syndrome (GBS), Hashimoto's disease, Hidradenitis suppurativa, Idiopathic thrombocytopenic purpura, Lupus erythematosus, Mixed
Connective Tissue Disease, Myasthenia gravis, Narcolepsy, Pemphigus vulgaris, Pernicious anaemia, Psoriasis, Psoriatic Arthritis, Polymyositis, Primary biliary cirrhosis, Relapsing polychondritis, Rheumatoid arthritis, Schizophrenia, Sjogren's syndrome, Temporal arteritis, Ulcerative Colitis, and Vasculitis Wegener's granulomatosis, in particular Rheumatoid arthritis..
26. Pharmaceutical composition comprising at least one type of the target-binding moiety toxin conjugate according to any one of claims 1 to 22 and further comprising one or more pharmaceutically acceptable diluents, carriers, excipients, fillers, binders, lubricants, glidants, disintegrants, adsorbents; and/or preservatives.
PCT/EP2010/002205 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy WO2010115629A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
EP18214020.2A EP3485912A1 (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
EP17158119.2A EP3192529B1 (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
AU2010234334A AU2010234334B2 (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
US13/263,287 US9233173B2 (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
ES10713429.8T ES2621104T3 (en) 2009-04-08 2010-04-08 Surface binding components of therapeutic cells provided with amatoxin designed for tumor therapy
CA2758201A CA2758201C (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
PL17158119T PL3192529T3 (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
EP10713429.8A EP2416804B1 (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
US14/954,266 US10513559B2 (en) 2009-04-08 2015-11-30 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
CY20201100329T CY1122855T1 (en) 2009-04-08 2020-04-07 AMATOXIN CELL SURFACE BINDING THERAPEUTIC INGREDIENTS FOR TUMOR THERAPY

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US16769009P 2009-04-08 2009-04-08
US61/167,690 2009-04-08
US22222709P 2009-07-01 2009-07-01
US61/222,227 2009-07-01

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/263,287 A-371-Of-International US9233173B2 (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
US14/954,266 Continuation US10513559B2 (en) 2009-04-08 2015-11-30 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy

Publications (2)

Publication Number Publication Date
WO2010115629A2 true WO2010115629A2 (en) 2010-10-14
WO2010115629A3 WO2010115629A3 (en) 2010-12-23

Family

ID=42269753

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2010/002205 WO2010115629A2 (en) 2009-04-08 2010-04-08 Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy

Country Status (14)

Country Link
US (2) US9233173B2 (en)
EP (3) EP2416804B1 (en)
AU (1) AU2010234334B2 (en)
CA (3) CA2970774C (en)
CY (1) CY1122855T1 (en)
DK (1) DK3192529T3 (en)
ES (2) ES2621104T3 (en)
HR (1) HRP20200612T1 (en)
HU (1) HUE050296T2 (en)
LT (1) LT3192529T (en)
PL (1) PL3192529T3 (en)
PT (1) PT3192529T (en)
SI (1) SI3192529T1 (en)
WO (1) WO2010115629A2 (en)

Cited By (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2436398A1 (en) * 2010-09-30 2012-04-04 Heidelberg Pharma AG Amatoxin-conjugates with improved linkers
EP2497499A1 (en) 2011-03-10 2012-09-12 Heidelberg Pharma GmbH Amatoxin-conjugates with improved linkages
EP2684865A1 (en) 2012-07-13 2014-01-15 Heidelberg Pharma GmbH Methods for synthesizing amatoxin building block and amatoxins
WO2014043403A1 (en) * 2012-09-12 2014-03-20 Agensys, Inc. Amatoxin derivatives and cell-permeable conjugates thereof as inhibitors of rna polymerase
CN103948872A (en) * 2014-05-12 2014-07-30 胡梁谱 Traditional Chinese medicinal formula for treating psoriatic arthritis
EP2774624A1 (en) 2013-03-04 2014-09-10 Heidelberg Pharma GmbH Amatoxin derivatives
RU2575854C2 (en) * 2011-03-10 2016-02-20 Хайдельберг Фарма Гмбх Amatoxin conjugates with improved bonds
CN105377304A (en) * 2014-03-10 2016-03-02 海德堡医药有限责任公司 Amatoxin derivatives
WO2016040868A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anti-cll-1 antibodies and immunoconjugates
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2016071856A1 (en) 2014-11-06 2016-05-12 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of rna polymerase
WO2017023704A1 (en) * 2015-07-31 2017-02-09 Sutro Biopharma, Inc. ANTI-EpCAM ANTIBODIES, COMPOSITIONS COMPRISING ANTI-EpCAM ANTIBODIES AND METHODS OF MAKING AND USING ANTI-EpCAM ANTIBODIES
WO2017046658A1 (en) * 2016-04-20 2017-03-23 Hangzhou Dac Biotech Co, Ltd Derivatives of amanita toxins and their conjugation to a cell binding molecule
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017089607A1 (en) 2015-11-27 2017-06-01 Heidelberg Pharma Gmbh Derivatives of gamma-amanitin
CN106810467A (en) * 2017-01-03 2017-06-09 苏州昊帆生物股份有限公司 Diamine compounds list Boc guard methods
WO2017149077A1 (en) 2016-03-03 2017-09-08 Heidelberg Pharma Gmbh Amanitin conjugates
WO2017191579A1 (en) 2016-05-05 2017-11-09 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of rna polymerase
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017219025A1 (en) * 2016-06-17 2017-12-21 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cells
WO2017219029A3 (en) * 2016-06-17 2018-01-25 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cd117+cells
WO2018027204A1 (en) 2016-08-05 2018-02-08 Genentech, Inc. Multivalent and multiepitopic anitibodies having agonistic activity and methods of use
WO2018115466A1 (en) 2016-12-23 2018-06-28 Heidelberg Pharma Research Gmbh Amanitin antibody conjugates
US20180289832A1 (en) * 2017-01-20 2018-10-11 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cd137+ cells
WO2019030171A1 (en) 2017-08-07 2019-02-14 Heidelberg Pharma Gmbh Novel method for synthesizing amanitins
WO2019030173A1 (en) 2017-08-07 2019-02-14 Heidelberg Pharma Gmbh Novel method for synthesizing amanitins
WO2019057964A1 (en) 2017-09-22 2019-03-28 Heidelberg Pharma Research Gmbh Psma-targeting amanitin conjugates
US10280225B2 (en) 2015-04-06 2019-05-07 President And Fellows Of Harvard College Compositions and methods for non-myeloablative conditioning
WO2019102435A1 (en) 2017-11-27 2019-05-31 Euro-Celtique S.A. Humanized antibodies targeting human tissue factor
EP3471771A4 (en) * 2016-05-31 2020-04-15 Sorrento Therapeutics, Inc. Antibody drug conjugates having derivatives of amatoxin as the drug
WO2020216947A1 (en) * 2019-04-24 2020-10-29 Heidelberg Pharma Research Gmbh Amatoxin antibody-drug conjugates and uses thereof
US10882915B2 (en) 2017-10-24 2021-01-05 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD117+ cells
US10899843B2 (en) 2017-10-24 2021-01-26 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD117+ cells
EP3782654A1 (en) 2014-09-12 2021-02-24 Genentech, Inc. Anti-her2 antibodies and immunoconjugates
WO2021074261A1 (en) * 2019-10-15 2021-04-22 Heidelberg Pharma Research Gmbh B-lymphocyte specific amatoxin antibody conjugates
US20210369854A1 (en) * 2017-11-29 2021-12-02 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cd5+ cells
WO2022058594A1 (en) 2020-09-18 2022-03-24 Araris Biotech Ag Transglutaminase conjugation method with amino acid-based linkers
WO2022084560A1 (en) 2020-10-25 2022-04-28 Araris Biotech Ag Means and methods for producing antibody-linker conjugates
WO2022096604A1 (en) 2020-11-04 2022-05-12 Heidelberg Pharma Research Gmbh Composition comprising a combination of immune checkpoint inhibitor and antibody-amatoxin conjugate for use in cancer therapy
WO2022194988A2 (en) 2021-03-19 2022-09-22 Heidelberg Pharma Research Gmbh B-lymphocyte specific amatoxin antibody conjugates
EP4115910A1 (en) 2015-03-09 2023-01-11 Heidelberg Pharma Research GmbH Amatoxin-antibody conjugates
WO2023072934A1 (en) 2021-10-25 2023-05-04 Araris Biotech Ag Methods for producing antibody-linker conjugates
WO2023161291A1 (en) 2022-02-22 2023-08-31 Araris Biotech Ag Peptide linkers comprising two or more payloads

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2011010469A (en) * 2009-04-08 2012-03-14 Deutsches Krebsforsch Amatoxin-armed target-binding moieties for the treatment of cancer.
US10080799B2 (en) * 2010-02-12 2018-09-25 Arizona Board Of Regents On Behalf Of Arizona State University Methods and compositions related to glycoprotein-immunoglobulin fusions
BR112019020049A2 (en) * 2017-04-06 2020-05-12 Hangzhou Dac Biotech Co., Ltd CONJUNGED COMPOUND, TUMOR CELL, PHARMACEUTICAL COMPOSITION, AND SYNERGIC AGENTS.
CN114191564A (en) * 2017-08-18 2022-03-18 四川百利药业有限责任公司 Non-natural amatoxin antibody conjugate
CN112739340A (en) 2018-07-23 2021-04-30 美真达治疗公司 Use of anti-CD 5 Antibody Drug Conjugates (ADCs) in allogeneic cell therapy
JP2022533430A (en) * 2019-05-23 2022-07-22 ハイデルベルク ファルマ リサーチ ゲゼルシャフト ミット ベシュレンクテル ハフツング Antibody drug conjugates with cleavable linkers
WO2024121632A1 (en) 2022-12-09 2024-06-13 Crispr Therapeutics Ag Use of anti-cd117 antibody drug conjugate (adc)

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE69133566T2 (en) 1990-01-12 2007-12-06 Amgen Fremont Inc. Formation of xenogenic antibodies
US7009034B2 (en) * 1996-09-23 2006-03-07 Incept, Llc Biocompatible crosslinked polymers
US7229960B2 (en) * 2000-11-03 2007-06-12 University Of Vermont And State Agricultural College Methods and compositions for inhibiting GRB7
PT1652920E (en) * 2001-10-01 2010-11-08 Deutsches Krebsforsch Methods of producing protein libraries and selection of proteins from them
US6890765B2 (en) * 2001-11-02 2005-05-10 Roche Diagnostics Operations, Inc. Particles for immunoassays and methods for treating the same
EP1661584A1 (en) * 2004-11-26 2006-05-31 Heinz Dr. Faulstich Use of conjugates of amatoxins and phallotoxins with macromolecules for cancer and inflammation therapy
EP2015782A4 (en) * 2006-04-12 2010-04-07 Crosslink Genetics Corp Compositions and methods for modulating gene expression
EP1859811B1 (en) * 2006-05-27 2011-08-24 Faulstich, Heinz, Dr. Use of conjugates of amatoxins or phallotoxins with macromolecules for tumor and inflammation therapy
EP2436398B1 (en) * 2010-09-30 2013-01-23 Heidelberg Pharma GmbH Amatoxin-conjugates with improved linkers

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
None

Cited By (94)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130259880A1 (en) * 2010-09-30 2013-10-03 Heidelberg Pharma Gmbh Amatoxin-Conjugates with Improved Linkers
RU2601411C2 (en) * 2010-09-30 2016-11-10 Хайдельберг Фарма Гмбх Amatoxin-conjugates with improved linkers
US9399681B2 (en) 2010-09-30 2016-07-26 Heldelberg Pharma GmbH Amatoxin-conjugates with improved linkers
EP2436398A1 (en) * 2010-09-30 2012-04-04 Heidelberg Pharma AG Amatoxin-conjugates with improved linkers
RU2575854C2 (en) * 2011-03-10 2016-02-20 Хайдельберг Фарма Гмбх Amatoxin conjugates with improved bonds
EP2497499A1 (en) 2011-03-10 2012-09-12 Heidelberg Pharma GmbH Amatoxin-conjugates with improved linkages
WO2012119787A1 (en) 2011-03-10 2012-09-13 Heidelberg Pharma Gmbh Amatoxin-conjugates with improved linkages
CN103442736A (en) * 2011-03-10 2013-12-11 海德堡医药有限责任公司 Amatoxin-conjugates with improved linkages
JP2014508767A (en) * 2011-03-10 2014-04-10 ハイデルベルク ファルマ ゲゼルシャフト ミット ベシュレンクテル ハフツング Amatoxin complex with improved linkage
KR20140059163A (en) * 2011-03-10 2014-05-15 하이델베르크 파마 게엠베하 Amatoxin-conjugates with improved linkages
KR101988005B1 (en) * 2011-03-10 2019-06-11 하이델베르크 파마 리서치 게엠베하 Amatoxin-conjugates with improved linkages
WO2014009025A1 (en) 2012-07-13 2014-01-16 Heidelberg Pharma Gmbh Methods for synthesizing amatoxin building block and amatoxins
CN104470891A (en) * 2012-07-13 2015-03-25 海德堡医药有限责任公司 Methods for synthesizing amatoxin building block and amatoxins
EP2684865A1 (en) 2012-07-13 2014-01-15 Heidelberg Pharma GmbH Methods for synthesizing amatoxin building block and amatoxins
CN104470891B (en) * 2012-07-13 2016-10-12 海德堡医药有限责任公司 For the method synthesizing amatoxin construction unit and amatoxin
US9676702B2 (en) 2012-07-13 2017-06-13 Heidelberg Pharma Gmbh Methods for synthesizing amatoxin building block and amatoxins
WO2014043403A1 (en) * 2012-09-12 2014-03-20 Agensys, Inc. Amatoxin derivatives and cell-permeable conjugates thereof as inhibitors of rna polymerase
US20150218220A1 (en) * 2012-09-12 2015-08-06 Brian Alan MENDELSOHN Amatoxin derivatives and cell-permeable conjugates thereof as inhibitors of rna polymerase
EP2774624A1 (en) 2013-03-04 2014-09-10 Heidelberg Pharma GmbH Amatoxin derivatives
RU2695370C2 (en) * 2013-03-04 2019-07-23 Хайдельберг Фарма Гмбх Amatoxin derivatives
WO2014135282A1 (en) * 2013-03-04 2014-09-12 Heidelberg Pharma Gmbh Amatoxin derivatives
US9982018B2 (en) 2013-03-04 2018-05-29 Heidelberg Pharma Gmbh Amatoxin derivatives
CN105377304A (en) * 2014-03-10 2016-03-02 海德堡医药有限责任公司 Amatoxin derivatives
CN105377304B (en) * 2014-03-10 2018-05-15 海德堡医药有限责任公司 Amanita hemolysin derivative
CN103948872A (en) * 2014-05-12 2014-07-30 胡梁谱 Traditional Chinese medicinal formula for treating psoriatic arthritis
EP3782654A1 (en) 2014-09-12 2021-02-24 Genentech, Inc. Anti-her2 antibodies and immunoconjugates
WO2016040868A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anti-cll-1 antibodies and immunoconjugates
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
EP3693391A1 (en) 2014-09-12 2020-08-12 Genentech, Inc. Anti-cll-1 antibodies and immunoconjugates
US9938323B2 (en) 2014-11-06 2018-04-10 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of RNA polymerase
WO2016071856A1 (en) 2014-11-06 2016-05-12 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of rna polymerase
EP4115910A1 (en) 2015-03-09 2023-01-11 Heidelberg Pharma Research GmbH Amatoxin-antibody conjugates
US10570207B2 (en) 2015-04-06 2020-02-25 President And Fellows Of Harvard College Compositions and methods for non-myeloablative conditioning
US10280225B2 (en) 2015-04-06 2019-05-07 President And Fellows Of Harvard College Compositions and methods for non-myeloablative conditioning
US10906980B2 (en) 2015-04-06 2021-02-02 President And Fellows Of Harvard College Compositions and methods for non-myeloablative conditioning
WO2017023704A1 (en) * 2015-07-31 2017-02-09 Sutro Biopharma, Inc. ANTI-EpCAM ANTIBODIES, COMPOSITIONS COMPRISING ANTI-EpCAM ANTIBODIES AND METHODS OF MAKING AND USING ANTI-EpCAM ANTIBODIES
US11098131B2 (en) 2015-07-31 2021-08-24 Sutro Biopharma, Inc. Anti-EpCAM antibodies, compositions comprising anti-EpCAM antibodies and methods of making and using anti-EpCAM antibodies
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017089607A1 (en) 2015-11-27 2017-06-01 Heidelberg Pharma Gmbh Derivatives of gamma-amanitin
EP3222292A1 (en) 2016-03-03 2017-09-27 Heidelberg Pharma GmbH Amanitin conjugates
WO2017149077A1 (en) 2016-03-03 2017-09-08 Heidelberg Pharma Gmbh Amanitin conjugates
WO2017046658A1 (en) * 2016-04-20 2017-03-23 Hangzhou Dac Biotech Co, Ltd Derivatives of amanita toxins and their conjugation to a cell binding molecule
JP2023051977A (en) * 2016-04-20 2023-04-11 ハンジョウ ディーエーシー バイオテック シーオー．，エルティディ． Derivatives of amanita toxins and their conjugation to cell binding molecule
KR102295190B1 (en) 2016-04-20 2021-08-30 항저우 디에이씨 바이오테크 씨오, 엘티디 Derivatives of Amanita Toxin and Its Binding with Cell Binding Molecules
KR20180125154A (en) * 2016-04-20 2018-11-22 항저우 디에이씨 바이오테크 씨오, 엘티디 Derivatives of amanitas toxin and its binding with cell binding molecules
US10836796B2 (en) 2016-04-20 2020-11-17 Hangzhou Dac Biotech Co., Ltd. Derivatives of amanita toxins and their conjugation to a cell binding molecule
US10464969B2 (en) 2016-05-05 2019-11-05 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of RNA polymerase
WO2017191579A1 (en) 2016-05-05 2017-11-09 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of rna polymerase
US10604547B2 (en) 2016-05-05 2020-03-31 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of RNA polymerase
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
EP3471771A4 (en) * 2016-05-31 2020-04-15 Sorrento Therapeutics, Inc. Antibody drug conjugates having derivatives of amatoxin as the drug
US11013816B2 (en) 2016-05-31 2021-05-25 Sorrento Therapeutics, Inc. Antibody drug conjugates having derivatives of amatoxin as the drug
CN109661400A (en) * 2016-06-17 2019-04-19 美真达治疗公司 For exhausting the composition and method of CD117+ cell
US10624973B2 (en) 2016-06-17 2020-04-21 Magenta Therapeutics, Inc. Methods for the depletion of cells
US10111966B2 (en) 2016-06-17 2018-10-30 Magenta Therapeutics, Inc. Methods for the depletion of CD117+ cells
WO2017219029A3 (en) * 2016-06-17 2018-01-25 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cd117+cells
CN109641051A (en) * 2016-06-17 2019-04-16 美真达治疗公司 For exhausting the composition and method of cell
WO2017219025A1 (en) * 2016-06-17 2017-12-21 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cells
US11046776B2 (en) 2016-08-05 2021-06-29 Genentech, Inc. Multivalent and multiepitopic antibodies having agonistic activity and methods of use
WO2018027204A1 (en) 2016-08-05 2018-02-08 Genentech, Inc. Multivalent and multiepitopic anitibodies having agonistic activity and methods of use
CN110099698B (en) * 2016-12-23 2023-02-17 海德堡医药研究有限责任公司 Amanitin antibody conjugates
WO2018115466A1 (en) 2016-12-23 2018-06-28 Heidelberg Pharma Research Gmbh Amanitin antibody conjugates
US11446388B2 (en) 2016-12-23 2022-09-20 Heidelberg Pharma Research Gmbh Amanitin antibody conjugates
CN110099698A (en) * 2016-12-23 2019-08-06 海德堡医药研究有限责任公司 Amanitin antibody conjugates
CN106810467A (en) * 2017-01-03 2017-06-09 苏州昊帆生物股份有限公司 Diamine compounds list Boc guard methods
US10434185B2 (en) 2017-01-20 2019-10-08 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD137+ cells
US10576161B2 (en) 2017-01-20 2020-03-03 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD137+ cells
CN110461876B (en) * 2017-01-20 2024-05-17 海德堡医药研究有限责任公司 Compositions and methods for depleting cd137+ cells
US20180289832A1 (en) * 2017-01-20 2018-10-11 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cd137+ cells
CN110461876A (en) * 2017-01-20 2019-11-15 美真达治疗公司 For exhausting the composition and method of CD137+ cell
WO2019030171A1 (en) 2017-08-07 2019-02-14 Heidelberg Pharma Gmbh Novel method for synthesizing amanitins
US11702451B2 (en) 2017-08-07 2023-07-18 Heidelberg Pharma Research Gmbh Method for synthesizing amanitins
US10961277B2 (en) 2017-08-07 2021-03-30 Heidelberg Pharma Research Gmbh Method for synthesizing amanitins
WO2019030173A1 (en) 2017-08-07 2019-02-14 Heidelberg Pharma Gmbh Novel method for synthesizing amanitins
US11420971B2 (en) 2017-08-07 2022-08-23 Heidelberg Pharma Research Gmbh Method for synthesizing amanitins
US11926631B2 (en) 2017-08-07 2024-03-12 Heidelberg Pharma Research Gmbh Method of treating cancer using amanitin derivatives
WO2019057964A1 (en) 2017-09-22 2019-03-28 Heidelberg Pharma Research Gmbh Psma-targeting amanitin conjugates
US10882915B2 (en) 2017-10-24 2021-01-05 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD117+ cells
US11958908B2 (en) 2017-10-24 2024-04-16 Crispr Therapeutics Ag Compositions and methods for the depletion of CD117+ cells
US11572411B2 (en) 2017-10-24 2023-02-07 Magenta Therapeutics, Inc. Anti-CD117 antibodies and conjugates
US10899843B2 (en) 2017-10-24 2021-01-26 Magenta Therapeutics, Inc. Compositions and methods for the depletion of CD117+ cells
US11401345B2 (en) 2017-11-27 2022-08-02 Purdue Pharma L.P. Humanized antibodies targeting human tissue factor
WO2019102435A1 (en) 2017-11-27 2019-05-31 Euro-Celtique S.A. Humanized antibodies targeting human tissue factor
US20210369854A1 (en) * 2017-11-29 2021-12-02 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cd5+ cells
RU2826004C2 (en) * 2019-04-24 2024-09-03 Хайдельберг Фарма Ресёрч Гмбх Amatoxin antibody-drug conjugates and use thereof
WO2020216947A1 (en) * 2019-04-24 2020-10-29 Heidelberg Pharma Research Gmbh Amatoxin antibody-drug conjugates and uses thereof
WO2021074261A1 (en) * 2019-10-15 2021-04-22 Heidelberg Pharma Research Gmbh B-lymphocyte specific amatoxin antibody conjugates
WO2022058594A1 (en) 2020-09-18 2022-03-24 Araris Biotech Ag Transglutaminase conjugation method with amino acid-based linkers
US12076412B2 (en) 2020-10-25 2024-09-03 Araris Biotech Ag Antibody-drug conjugates through specific linker oligopeptides
WO2022084560A1 (en) 2020-10-25 2022-04-28 Araris Biotech Ag Means and methods for producing antibody-linker conjugates
WO2022096604A1 (en) 2020-11-04 2022-05-12 Heidelberg Pharma Research Gmbh Composition comprising a combination of immune checkpoint inhibitor and antibody-amatoxin conjugate for use in cancer therapy
WO2022194988A2 (en) 2021-03-19 2022-09-22 Heidelberg Pharma Research Gmbh B-lymphocyte specific amatoxin antibody conjugates
WO2023072934A1 (en) 2021-10-25 2023-05-04 Araris Biotech Ag Methods for producing antibody-linker conjugates
WO2023161291A1 (en) 2022-02-22 2023-08-31 Araris Biotech Ag Peptide linkers comprising two or more payloads

Also Published As

Publication number Publication date
EP2416804B1 (en) 2017-03-01
US10513559B2 (en) 2019-12-24
DK3192529T3 (en) 2020-04-20
CA2758201A1 (en) 2010-10-14
EP3192529A1 (en) 2017-07-19
AU2010234334B2 (en) 2014-10-09
CA3026727A1 (en) 2010-10-14
EP3485912A1 (en) 2019-05-22
CA2758201C (en) 2017-08-01
ES2784829T3 (en) 2020-10-01
SI3192529T1 (en) 2020-07-31
CA3026727C (en) 2022-03-22
EP3192529B1 (en) 2020-03-25
ES2621104T3 (en) 2017-07-03
US20160089450A1 (en) 2016-03-31
HUE050296T2 (en) 2020-11-30
CY1122855T1 (en) 2021-05-05
US20120100161A1 (en) 2012-04-26
AU2010234334A1 (en) 2011-11-10
EP2416804A2 (en) 2012-02-15
US9233173B2 (en) 2016-01-12
HRP20200612T1 (en) 2020-08-07
LT3192529T (en) 2020-06-25
CA2970774A1 (en) 2010-10-14
CA2970774C (en) 2019-01-08
PL3192529T3 (en) 2020-08-24
WO2010115629A3 (en) 2010-12-23
PT3192529T (en) 2020-04-16

Similar Documents

Publication Publication Date Title
US10513559B2 (en) Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
EP2416805B1 (en) Amatoxin antibody conjugates for the treatment of cancer
CA2829421C (en) Amatoxin-conjugates with improved linkages
EP2964264B1 (en) Amatoxin derivatives
US8568727B2 (en) Antibody molecules specific for fibroblast activation protein and immunoconjugates containing them
JP6321687B2 (en) Amatoxin derivatives
CN105377307A (en) Antibody-drug conjugate having improved stability and use thereof
AU2018286601B2 (en) Amatoxin-armed therapeutic cell surface binding components designed for tumour therapy
FAULSTICH et al. Patent 2758201 Summary

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10713429

Country of ref document: EP

Kind code of ref document: A2

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2758201

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 7773/DELNP/2011

Country of ref document: IN

REEP Request for entry into the european phase

Ref document number: 2010713429

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2010713429

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2010234334

Country of ref document: AU

Date of ref document: 20100408

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 13263287

Country of ref document: US