WO2010096142A1 - Oxyntomodulin analogs - Google Patents

Oxyntomodulin analogs Download PDF

Info

Publication number
WO2010096142A1
WO2010096142A1 PCT/US2009/068678 US2009068678W WO2010096142A1 WO 2010096142 A1 WO2010096142 A1 WO 2010096142A1 US 2009068678 W US2009068678 W US 2009068678W WO 2010096142 A1 WO2010096142 A1 WO 2010096142A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
peptide
residue
amino
peptide analog
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2009/068678
Other languages
French (fr)
Inventor
Paul E. Carrington
George J. Eiermann
Donald J. Marsh
Joseph. M. Metzger
Alessandro Pocai
Ranabir Sinha Roy
Elisabetta Bianchi
Paolo Ingallinella
Antonello Pessi
Alessia Santoprete
Elena Capito
Richard Dimarchi
Brian Ward
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Organon Pharma UK Ltd
Istituto di Ricerche di Biologia Molecolare P Angeletti SpA
Indiana University Research and Technology Corp
Merck Sharp and Dohme LLC
Original Assignee
Merck Sharp and Dohme Ltd
Istituto di Ricerche di Biologia Molecolare P Angeletti SpA
Indiana University Research and Technology Corp
Merck Sharp and Dohme LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to SG2011060183A priority Critical patent/SG173791A1/en
Priority to BRPI0924307A priority patent/BRPI0924307B8/en
Priority to HRP20141215AT priority patent/HRP20141215T1/en
Priority to CA2754350A priority patent/CA2754350C/en
Priority to JP2011551052A priority patent/JP5756961B2/en
Priority to CN200980158734.XA priority patent/CN102573872B/en
Priority to SI200931091T priority patent/SI2398483T1/en
Priority to AU2009340439A priority patent/AU2009340439B2/en
Priority to PL09840594T priority patent/PL2398483T3/en
Priority to RU2011134596/04A priority patent/RU2542362C2/en
Priority to ES09840594.7T priority patent/ES2524477T3/en
Application filed by Merck Sharp and Dohme Ltd, Istituto di Ricerche di Biologia Molecolare P Angeletti SpA, Indiana University Research and Technology Corp, Merck Sharp and Dohme LLC filed Critical Merck Sharp and Dohme Ltd
Priority to EP09840594.7A priority patent/EP2398483B1/en
Priority to US13/202,524 priority patent/US20120165503A1/en
Priority to DK09840594.7T priority patent/DK2398483T3/en
Priority to HK12106315.1A priority patent/HK1165333B/en
Priority to MX2011008717A priority patent/MX2011008717A/en
Publication of WO2010096142A1 publication Critical patent/WO2010096142A1/en
Priority to ZA2011/06051A priority patent/ZA201106051B/en
Priority to IL214729A priority patent/IL214729A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/605—Glucagons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/04—Anorexiants; Antiobesity agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • the present invention relates to peptide analogs of oxyntomodulin (OXM, glucagon- 37), which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-I /glucagon receptor (GCGR) agonist, and the use of such peptide analogs for treatment of metabolic disorders such as diabetes and obesity.
  • OXM oxyntomodulin
  • DPP-IV dipeptidyl peptidase IV
  • GCGR GLP-I /glucagon receptor
  • the hormone oxyntomodulin (OXM, glucagon-37) is a posttranslational product of preproglucagon processing in the intestine and central nervous system (CNS) and is secreted from L-cells in the gut in response to food intake.
  • OXM has been implicated in the regulation of food intake and energy expenditure (Jarrouse et ah, Endocrinol. 115: 102-105 (1984); Schjoldager et al., Eur. J. Clin. Invest., 18: 499-503 (1988)).
  • Central or peripheral administration of OXM in rats causes a decrease in short term food intake with minimal effects on gastric emptying (Dakin et al.
  • OXM peripheral administration of OXM dose-dependently inhibited both fast-induced and dark phase food intake, but unlike GLP-I , had no effect on gastric emptying, OXM also reduced levels of fasting ghrelin and increased c-fos immunoreactivity, in the arcuate nucleus (ARC). Repeated seven-day IP administration of OXM caused a reduction in the rate of body weight gain and adiposity in rats ⁇ See Dakin et al. Endocrinology, 145: 2687-2695 (2004)).
  • OXM isorectic mediated by the GLP-I receptor.
  • the anorectic actions of OXM require only the GLP-I receptor, as icv OXM inhibits food intake in glucagon receptor knockout mice.
  • the anorectic effects of OXM are completely absent in GLP-I receptor knockout mice.
  • exendin-4 but not OXM, regulates energy expenditure in mice.
  • OXM appears to be a weak agonist at the GLP-I receptor, when used in pharmacological concentrations (See Baggio et a!., Gastroenterol. 127: 546-58 (2004)).
  • OXM was also found to ameliorate glucose intolerance in mice fed a high fat diet (Dakin et al, Am. J. Physiol. Endocrinol, Metab. 294: E142-E147 (2008) and increase the intrinsic heart rate in mice independent of the GLP-I receptor (Sowden et al, Am. J. Physiol. Regul. Integr. Comp. Physiol. 292: R962-R970 (2007). OXM has also been shown to differentially affect GLP-I receptor beta-arrestin recruitment and signaling through Galpha (Jorgensen et al, J. Pharma. Exp. Therapeut.
  • OXM has a very short half-life and is rapidly inactivated by the cell surface dipeptidyl peptidase IV (DPP-IV) (Zhu et al, J. Biol. Chem. 278: 22418-22423 (2002).
  • OXM peptide analogs for inducing weight loss in humans has been the object of Published International Application Nos. WO03/022304, WO2004/062685, and WO2006/134340.
  • OXM therefore shows potential as a treatment for metabolic disorders such as diabetes and obesity.
  • OXM analogs that can be safely and efficaciously administered for the treatment of metabolic diseases, such as diabetes and obesity. It would be further desirable if analogs or derivatives were developed that were modified by conjugation to moieties that would improve stability and pharmacokinetics, more particularly modifications that confer resistance to DPP-IV cleavage. It would further be desirable to provide OXM analogs that are capable of acting as dual GLP-I recept ⁇ r/glucagon receptor agonists.
  • the present invention provides oxyntomodulin (OXM, glucagon-37) peptide analogs, which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-I /glucagon receptor (GCGR) agonist, and the use of such peptide analogs for treatment of metabolic disorders such as diabetes and obesity,
  • the analogs disclosed herein reduce food intake and body weight, increase metabolic rate, mediate glucose- dependent insulin secretion (GDIS) from pancreatic islets and improve glucose tolerance, thereby providing a treatment option for individuals afflicted with a metabolic disorder such as metabolic syndrome, obesity, diabetes, metabolic syndrome X, hyperglycemia, impaired fasting glucose, dyslipidemia, atherosclerosis, and other prediabetic states.
  • a metabolic disorder such as metabolic syndrome, obesity, diabetes, metabolic syndrome X, hyper
  • the present invention provides a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N -terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide is capable of acting as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
  • the amino acid substituted for the second amino acid from the N-terminus is selected from the group consisting of D
  • a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N- terminus is substituted with an amino acid selected from the group consisting of D-serine and ⁇ - aminoisobutyric acid; the C-terminus of the peptide includes a cysteine residue in which the thiol group of the cysteine residue is covalently linked to a cholesterol moiety by a hydrophilic linker; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP- 1 receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
  • OXM human oxyntomodulin
  • a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N- terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 17, 18, and 27; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
  • OXM human oxyntomodulin
  • the one or more amino acid substitutions selected from the group consisting of glutamic acid for the arginine at position 17, alanine for the arginine at position 18, norleucine or O-methyl-L-homoserine for the methionine at position 27.
  • a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N- terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; the peptide lacks the amino acid sequence RNRNNIA (SEQ ID NO: 104); and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof,
  • OXM human oxyntomodulin
  • the amino acid substitution at position 2 is an amino acid selected from the group consisting of D-serine and ⁇ -aminoisobutyric acid and the cholesterol moiety is covalently linked to the thiol group of a cysteine by a hydrophilic linker and the cysteine residue is covalently linked to the C-terminus of the peptide by a peptide bond.
  • the peptide further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 17, 18, and 27.
  • the peptide further includes one or more amino acid substitutions selected from the group consisting of arginine at position 17 to glutamic acid, arginine at position 18 to alanine, methionine at position 27 to norleucine or O-methyl-L-homoserine.
  • the peptide includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue at the C-terminus of the peptide.
  • the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker.
  • the hydrophilic linker can be a peptide or polymer such as an ethoxy polymer that includes one to ten ethoxy units.
  • the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
  • the peptide includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue covalently linked to the C-terminus of the peptide, which in particular embodiments is a palmitoyl.
  • the lysine residue is linked to the C-terminus of the peptide by means of a linker moiety.
  • the linker moiety includes one or more gamma-glutamic acid residues and in other aspects, the linker moiety is l-amino-4,7,10-tioxa-13-tridecanamine succinimic acid.
  • OXM peptide analog selected from the peptide analogs presented in Table 1 and Table 2 and the use of one more of the OXM peptide analogs presented in Table 1 and Table 2 in the manufacture of a medicament for the treatment of a metabolic disorder.
  • Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargyl glycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutyl glycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Ac
  • NIe methionine sulfoxide
  • m methionine sulfoxide
  • o O-methyl-L-homoserine residue
  • Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group
  • Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety
  • Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety
  • P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • L] ⁇ Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
  • Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
  • the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
  • the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
  • Z2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
  • the lipid moiety is a palmitoyl.
  • L] is a linker moiety.
  • the linker moiety is a hydrophilic linker moiety.
  • the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino- 4,7,10-tioxa-13-tridecanamine succinirnic acid.
  • the peptide comprises a structure selected from OXM70 (SEQ ID NO:12);OXM110 (SEQ ID NO: 19); OXMl 15 (SEQ ID NO:21); OXMl 77 (SEQ ID NO:24); OXM212 (SEQ ID NO;27); OXM213 (SEQ ID NO;28); OXM216 (SEQ ID NO:29); OXM290 (SEQ ID NO:4 ⁇ ); OXM301 (SEQ ID N0:51); or OXM325 (SEQ ID NO:65).
  • the peptide comprises a structure selected from OXM237 (SEQ ID NO:31); OXM238 (SEQ ID NO:32); OXM259 (SEQ ID NO:33); OXM260 (SEQ ID NO:34); OXM261 (SEQ ID NO:35); OXM262 (SEQ ID NO:36); OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OXM265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44); and OXM308 (SEQ ID NO:45).
  • OXM237 SEQ ID NO:31
  • OXM238 SEQ ID NO:32
  • OXM259 SEQ ID NO:33
  • OXM260 SEQ ID NO:
  • the peptide comprises a structure selected from OXM291 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO:52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:54); OXM305 (SEQ ID NO:55); 0XM31 1 (SEQ ID NO:56); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO:58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO: ⁇ l); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:
  • the peptide when the peptide lacks RNRNNIA (SEQ ID NO: 104), the peptide comprises the structure selected from OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM
  • Xi is a D ⁇ serine, ⁇ -aminoisobutyric acid (a ⁇ b), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha- aminobutyric acid (D- Abu); Amino valeric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe);
  • NIe methionine sulfoxide
  • m methionine sulfoxide
  • o O-methyl-L-homoserine residue
  • Zi is an optionally present protecting group that, if present, is joined to the N ⁇ terminal amino group, Li is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • L3 is an optionally present protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
  • Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
  • the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
  • the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
  • Z2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
  • the lipid moiety is a palmitoyl
  • Li is a linker moiety.
  • the linker moiety is a hydrophilic linker moiety.
  • the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino- 4,7,10-tioxa-13-tridecanamine succinimic acid.
  • the peptide comprises a structure selected from OXM291 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO.52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:S4); OXM305 (SEQ ID NO:55); OXM311 (SEQ ID NO:5 ⁇ ); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO; 58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO.64); OXM327 (SEQ ID NO:6 ⁇ ); or OXM329 (SEQ ID NO:
  • the peptide comprises the structure selected from OXM345 (SEQ ID NO: ⁇ 9); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO;74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:8 ⁇ ); OXM406 (SEQ ID NO:9
  • Xj is a D-serine, ⁇ -aminoisobutyric acid (aib)., 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D- Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutyl glycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe);
  • Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Lj is optional but when present is a linker moiety;
  • Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and
  • P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
  • Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
  • the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
  • the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
  • Z2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
  • the lipid moiety is a palmitoyl.
  • L] is a linker moiety.
  • the linker moiety is a hydrophilic linker moiety.
  • the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino-
  • the peptide comprises a structure selected from OXM290 (SEQ ID NO:46); OXM301 (SEQ ID NO:51); OXM321 (SEQ ID NO:
  • the peptide comprises a structure selected from OXM70 (SEQ ID NO:12);OXM110 (SEQ ID NO: 19); OXM1 ⁇ 5 (SEQ ID NO: 12);OXM110 (SEQ ID NO: 19); OXM1 ⁇ 5 (SEQ ID NO: 12);OXM110 (SEQ ID NO: 19); OXM1 ⁇ 5 (SEQ ID NO: 12);OXM110 (SEQ ID NO: 19); OXM1 ⁇ 5 (SEQ ID NO:
  • OXM177 SEQ ID NO;24
  • OXM212 SEQ ID NO:27
  • OXM213 SEQ ID NO:28
  • OXM216 SEQ ID NO:29
  • the peptide comprises a structure selected from OXM237 (SEQ ID NO:31); OXM238 (SEQ ID NO:32); OXM259 (SEQ ID NO:31);
  • OXM260 SEQ ID NO:34
  • OXM261 SEQ ID NO;35
  • OXM262 SEQ ID NO:3 ⁇
  • OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OX3VI265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44); and OXM308 (SEQ ID NO:45).
  • peptide analogs that are a dual GLP-I /glucagon receptor (GCGR) agonist and have a pi of less than 6,0.
  • Peptide analogs comprising a cholesterol or fatty acid moiety and have a pi of less than 6 have been found to have a reduced capacity for stimulating mast cell degranulation as determined by a in vitro counterscreening assay using the human mast cell line LAD2, Therefore, further provided is a peptide analog comprising the amino acid sequence HSQGTFTSD YSKYLDSRRAQDFVQWLMNTK (SEQ ID NO: 109) in which the second amino acid from the TV-terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues; the peptide optionally includes one to
  • the amino acid substituted for the second amino acid from the iV-terminus of the peptide analog is selected from the group consisting of D-serine, ⁇ - aminoisobutyric acid, and 1 -amino- 1 -cyclobutane carboxylic acid.
  • the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues
  • the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker, which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
  • the peptide analog includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue: in particular embodiments the lipid moiety is a fatty acid such as a palmitoyl, rnyristoyl, or stearoyl moiety. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
  • the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
  • the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27,
  • the peptide analog includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or ⁇ -aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the argini ⁇ e at position 18, lysine for the glutamine at position 20, and norleucine or O-methyl-L-homoserine for the methionine at position 27.
  • the tyrosine at position 10 in the peptide analog is replaced with a lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues
  • the glutamine at position 20 in the peptide analog is replaced with lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine by one or more gamma-glutamic acid residues.
  • the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus
  • Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl ⁇ propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe) residue,
  • peptide analogs have a pi between 4 and 6, or a pi of about 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, or 5.9, or a pi of about 5.4 to 5.5.
  • M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C- terminus of P.
  • the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units, which in particular aspects can include for example, four ethoxy units.
  • M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P or M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position X2 or
  • the lipid moiety is a palmitoyl, myristoyl, or stearoyl moiety.
  • the peptide analog is OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66); or OXM329 (SEQ ID NO;67).
  • the peptide analog is OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO: 80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO: 83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO: 85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM3
  • a GLP-I agonist is a peptide, small molecule, or chemical compound that binds to the GLP-I receptor and stimulates the same biological activity as does GLP-I .
  • an agonist for the GLP-I receptor binds to the receptor with at least 1% of the affinity as native GLP-I, In another embodiment, an agonist for the GLP-I receptor binds to the receptor with an equal or greater affinity than native GLP-I .
  • a glucagon agonist is a peptide, small molecule, or chemical compound that binds to the glucagon receptor and stimulates the same biological activity as does glucagon.
  • an agonist for the glucagon receptor binds to the receptor with at least 1% of the affinity as native glucagon.
  • an agonist for the glucagon receptor binds to the receptor with an equal or greater affinity than native glucagon.
  • a “dual GLPl /glucagon receptor agonist” is “GLPl receptor/glucagon receptor co-agonist molecule", which exhibit activity at both the glucagon receptor and the GLPl receptor.
  • a dual GLPl receptor agonist and glucagon receptor agonist exhibits activity at the glucagon receptor of at least about 10% relative to native glucagon and also exhibits activity at the GLP-I receptor of at least about 10% relative to native GLP-I .
  • Figure 1 shows the results of an ex vivo assay comparing glycogenolysis of native OXM to OXM(Q3E),
  • the Figure shows that native OXM induces glycogenolysis in a dose dependent fashion and induces full glycogenolysis at 1.5 nM and has an approximate EC50 of 0.5 nM whereas OXM-Q3E induced only about 58% at 300 nM, consistent with its poor GCGR agonist potency.
  • Figure 2 shows the results of an in vivo GCG Receptor occupancy experiment showing that glucagon (GCG) at 1.5 mpk gave 84% GCGR occupancy and 3 mpk OXM gave 31% GCGR occupancy but that OXM-Q3E gave 0% GCGR occupancy.
  • GCG glucagon
  • Figures 3A and 3B show the blood glucose levels and glucose infusion rates, respectively, in response to OXM and OXM-Q3E.
  • Figure 4 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous (s.c.) administration of OXM and OXM-Q3E
  • Figure 5A shows ex vivo measurement of glycogenolysis in perfused liver in the presence of OXM70, OXMl 10, OXM177, OXMl 15, and OXM216.
  • IPGTT intraperitoneal glucose tolerance test
  • Figure 5B shows GGCR occupancy following subcutaneous (s.c.) or intravenous (i.v.) administration of the OXM70, OXMl 10, OXM177, OXMl 15, and OXM2I6 compared to native OXM in a competition assay in wild-type mice.
  • Figure 7 summarizes the acute in vivo efficacy of OXMl 10 and OXM 177 on reducing food intake and body weight in established DIO mice.
  • Food intake was measured about two hours and 18 hours later.
  • Figure 8 summarizes the acute in vivo efficacy of OXM216, OXMl 15, and OXMl 77 on reducing food intake and body weight in established DIO mice.
  • Food intake was measured about two hours and 18 hours later.
  • Figures 9A-D shows the pharmacological end points of a chronic body weight and food intake study in DIO mice for OXM peptide analogs OXMl 10, OXM177, and OXMl 15.
  • Figure 9 A shows the cumulative change in food intake.
  • Figure 9B shows the cumulative change in body weight.
  • Figure 9C shows basal glucose levels over several days of the study.
  • Figure 9D shows IPGTT assay on day 13 of the study.
  • FIG 10 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM70.
  • IPGTT intraperitoneal glucose tolerance test
  • Figure 11 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXMl 10.
  • Figure 12 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM 177.
  • FIG 13 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXMl 15.
  • IPGTT intraperitoneal glucose tolerance test
  • Figure 14A shows the metabolic rate effects of OXMl 15 in DIO Mice over lime.
  • Figure 14B shows the percent change in metabolic rate caused by OXMl 15 in the DIO
  • Figure 15 summarizes the acute in vivo efficacy of several +/+ peptides on reducing food intake and body weight in established DIO mice.
  • Figure 16 shows single dose of several +/+ peptides on food intake on reducing food intake and body weight in established DIO mice.
  • OXM-based therapy has the potential to favorably impact both obesity and, the as yet to be carefully characterized, concomitant effects on improving diabetes.
  • Weight loss efficacy and reduction in food intake upon peripheral administration of OXM has been well validated in humans (Wynne et al., Diabetes 54: 2390-2395 (2005)). More recently, OXM has been shown to increase metabolic rate and specifically activity-related energy expenditure in obese subjects (Wynne et al, Int. J. Obes. 30: 1729-1736 (2006), advance online publication, April 18, 2006; doi: 10.1038/sj.ijo.0803344). OXM has also been shown to reduce body weight in humans ⁇ See,, for example, Published International Application Nos.
  • the OXM peptide analogs disclosed herein are more convenient for therapeutic purposes than native OXM, which requires t.i.d. dosing.
  • the tolerability profile of polypeptides of the current invention is anticipated to be similar to that of native OXM in humans, which may be superior to that of conventional GLP-I minietics like exenatide and liraglutide.
  • the chronic efficacy of the OXM analogs disclosed herein may therefore be better than conventional GLP-I mimetics, such as Byetta® (Amylin
  • OXM analogs disclosed herein which incorporate a balanced GLP-I receptor and GCGR co-agonism, gives enhanced reductions in food intake and body weight with chronic administration and results in improved glucose tolerance.
  • OXM peptide analogs that have dual GLP-I receptor (GLP-IR) and glucagon receptor (GCGR) agonist activity are indicated herein as (+/+).
  • OXM peptide analogs that are GLP-I agonists only are indicated herein as (+/O).
  • OXM analogs disclosed herein can be used for is the treatment of obesity and/or diabetes. Secondary indications are metabolic syndrome, hyperglycemia, impaired fasting glucose, and other prediabetic states. Further indications include all indications for GLP-I such as irritable bowel syndrome and other absorptive diseases of the gut, ischemia, stroke, and neurological disorders including anxiety, impaired cognition, and Alzheimer's disease.
  • OXM analogs disclosed herein are anticipated to exhibit at least comparable if not superior efficacy and a better safety profile than current anti-obesity agents such as orlistat (Xenical® (Roche), a lipase inhibitor) and sibutramine (Meridia® (Abbott Laboratories), a seratonin/norepinephrine re-uptake inhibitor), for which GI intolerance (diarrhea, flatulence) and hypertension are common side effects, respectively,
  • the OXM peptide analogs optionally includes a protecting group covalently joined to the N-terminal amino group.
  • a protecting group covalently joined to the N- terminal amino group of the peptide reduces the reactivity of the amino terminus under in vivo conditions.
  • Amino protecting groups include -Ci_io alkyl, -C ⁇ io substituted alkyl, -C2-10 alkenyl, -C2.10 substituted alkenyl, aryl, -C ⁇ - ⁇ alkyl aryl, -C(O)-(CH2)i-6 ⁇ COOH, -C(O)-Ci .g alkyl, -C(O)-aryI, -C(O)-O-Ci .5 alkyl, or -C(O)-O-aryl.
  • the amino terminus protecting group is selected from the group consisting of acetyl, propyl, succinyl, benzyl, benzyloxycarbonyl, and t-butyloxycarbonyl.
  • Deamination of the N-terminal amino acid is another modification that is contemplated for reducing the reactivity of the amino terminus under in vivo conditions.
  • the OXM peptide analogs may be modified to have a protecting group covalently joined to the C-terminal carboxy group, which reduces the reactivity of the carboxy terminus under in vivo conditions.
  • carboxylic acid groups of the peptide may be provided in the form of a salt of a pharmacologically-acceptable cation or esterified to form a C ⁇ . g ester, or converted to an amide of formula NRR2 wherein R and R2 are each independently H or Ci -6 alkyl, or combined to form a heterocyclic ring, such as a 5 -or 6-membered ring.
  • the carboxy terminus protecting group is preferably attached to the ⁇ - carbonyl group of the last amino acid.
  • Carboxy terminus protecting groups include, but are not limited to, amide, Diethylamide, and ethylamide.
  • Amino groups of the peptide, whether N- terminal or side chain, may be in the form of a pharmacologically-acceptable acid addition salt, such as the HCl, HBr, acetic, benzoic, toluene sulfonic, maleic, tartaric, and other organic salts, or may be modified to Ci -6 alkyl or dialkyl amino or further converted to an amide.
  • the OXM peptide analogs that are capable of acting as dual GLP-I and glucagon agonists comprise the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N-terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; a lipid or cholesterol moiety covalently linked to the OXM peptide analog; optionally one to three amino acid substitutions in addition to the substitution at position 2; and optionally has a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide,
  • the peptide analogs further lack the amino acid sequence RNRNNIA (SEQ ID NO: 104).
  • OXM peptide analogs having the above structure will act as a dual GLP-I receptor and glucagon receptor agonist and have a serum half-life greater than the serum half-life of native human OXM.
  • the OXM peptide analog can be represented by the structure
  • HX1QGTFTSDYSKYLDSX2X3AQDFVQWLX4NTK (SEQ ID NO: 103) wherein Xi is a D-serine or ⁇ -aminoisobutyric acid (aib) residue; X2 is an arginine (R) or glutamic acid (E) residue; X3 is an arginine (R) or alanine (A) residue; X4 is a methionine (M), norleucine (NIe), or O-methyl-L-homoserine (0) residue;
  • Z ⁇ is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Lj is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety;
  • Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked Io a cholesterol moiety; and
  • P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
  • the OXM peptide analog can be represented by the structure
  • X] is a D-serine or ⁇ -aminoisobutyric acid (aib) residue
  • X2 is an arginine (R) or glutamic acid (E) residue
  • X3 is an arginine (R) or alanine (A) residue
  • X4 is a methionine (M), norleucine (NIe), or O-methyl-L-homoserine (o) residue
  • M methionine
  • NIe norleucine
  • o O-methyl-L-homoserine
  • Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Li is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • L1-Z2 can be linked to the C- terminal amino acid of P or to an internal amino acid of P.
  • the OXM peptide analog can be represented by the structure
  • Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid (Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2 ⁇ cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (
  • Zi is an optionally present protecting group that, if present, is joined to the N-termiiial amino group
  • Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety
  • Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety
  • P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
  • the OXM peptide analog can be represented by the structure Z1-P-L1-Z2 wherein P is a peptide having the amino acid sequence
  • Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 - Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 - Amino- 1 -cyclopentane carboxylic acid (Acpe
  • NIe methionine sulfoxide
  • m methionine sulfoxide
  • o O-methyl-L-homoserine residue
  • Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO; 304) or a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
  • the OXM peptide analog can be represented by the structure
  • Xj is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, I-Amino-1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 - Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1-cyclopentane carboxylic acid (Acpe); X2 is
  • Z] is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L] is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
  • the OXM peptide analog can be represented by the structure Z1-P-L1 -Z2 wherein P is a peptide having the amino acid sequence
  • Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 - Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe);
  • NIe methionine sulfoxide
  • m methionine sulfoxide
  • o O-methyl-L-homoserine residue
  • Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Lj is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or ⁇ 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof, I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
  • the OXM peptide analog can be represented by the structure
  • Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl- alanine (Cpa); propargylglycine (Prg); AlJylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 - Amino- 1 -cyclopentane carboxylic acid (Acpe
  • Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or 2/ ⁇ optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
  • I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
  • the lipid or cholesterol moiety can be directly or indirectly linked to the side chain of an amino acid.
  • the lipid or cholesterol moiety is linked to the amino acid side-chain by means of a linker moiety.
  • the lipid or cholesterol is directly linked to the side chain of an amino acid which is then linked to the OXM peptide analog by a linker moiety (Li).
  • the linker moiety is a hydrophilic linker.
  • the chemical structure of the linker moiety is not critical, however, since it serves primarily as a spacer. However, in certain embodiments, the linker moiety may itself provide improved properties to the OXM peptide analogs.
  • linker moiety is covalently linked to the C-terminal amino acid of the peptide (P) and Z2 is covalently linked to the linker moiety.
  • linker moiety is covalently linked to an internal amino acid of P and Z2 is covalently linked to the linker moiety.
  • L1-Z2 are covalently linked to an internal amino acid of
  • P, X9 can include one or more gamma glutamic acid residues.
  • the OXM peptide analogs include diastereomers as well as their racemic and resolved enantiomerically pure forms.
  • the amino acids are in the L-form with particular amino acids in D-form.
  • individual amino acids can be represented as follows:
  • OXM29, 208, 209 and 229 are peptide analogs precursors (thiolated peptides) that were used for the conjugation reaction with the bromo-cholesterol moieties.
  • Cj Cys(cholest-5-en-3-yl l- ⁇ [(2R)-3-amino-2-(amino)-3-oxo ⁇ ropyl]thio ⁇ -2-oxo-6,9,12,15- tetraoxa-3-azaoctadecan-18-oate) or Cys(Oxa4-cholesterol).
  • OXM peptide analogs OXM36 and OXMl 15 were prepared from OXM229, which includes the native human OXM peptide but with a D-serine at amino acid position 2 and a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated, OXM36 has the structure
  • HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC ⁇ CONHz (SEQ ID N0:8) wherein C4 is a cysteine residue in which choIest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3- oxopropyl]thio ⁇ acetate is covalently linked thereto as shown below.
  • OXMl 15 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC ⁇ - CONH2 (SEQ ID N0:21) wherein the C7 is a cholest-5-en-3-yl l- ⁇ [(2R)-3-amino-2-(amino)-3- oxopropyl]thio ⁇ -2-oxo-6 J 9,12,15-tetraoxa-3-azaoctadecan-18-oate (or Cys(Oxa4-cholesterol)) as shown below.
  • C7 differs from C4 in that it has a hydrophilic spacer formed by four ethylene glycol repeats (ethoxy units) between the cholesterol group and the cysteine moiety.
  • the C7 group increases solubility of the resulting peptide-cholesterol conjugate.
  • the peptide-C ⁇ conjugate shows a less prominent serum shift than peptide-C4 conjugates. This was found to be important for maintaining an optimal balanced activity on the two receptors GLP-IR and Glucagon receptor. The results shown in the Examples illustrate this aspect.
  • OXM peptide analogs OXM70 and OXM216 were prepared from OXM29, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2 and with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
  • OXM70 has the structure HOQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2 (SEQ ID NO: 12) wherein C4 is cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate as shown for OXM36.
  • OXM216 has the structure
  • OXM peptide analog OXM212 was prepared from OXM208, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2, norleucine in place of the methionine residue at position 27, with a cysteine residue in peptide linkage at the C- terminus and in which the C-terminal carboxy group has been amidated.
  • OXM212 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC4-CONH2 (SEQ ID NO:26) wherein C4 is cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate as shown for OXM36.
  • OXM peptide analog OXM213 was prepared from OXM209, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2, O-methyl-L- homoserine in place of the methionine residue at position 27, with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
  • OXM213 has the structure HaQGTFTSDYSKYLDSRRAQDFVQWLYNTKRNRNNIAC 4 -
  • HSQGTFTSDYSICYLDSRRAQDFVQWLmNTKRNRNNIAC 7 -CONH 2 (SEQ ID N0:31). It was designed to contain D-Ser (s) at position 2, Met(O) at position 27, and a Cys(0xa4- cholesterol) (C7) at position site 38.
  • OXM238 was designed to contain D-Ser (s) at position 2, Met(O) at position 27, and a Cys(acetamide) (C5) at position site 38.
  • This peptide has the same peptide sequence of OXM237 and is a control peptide with no cholesterol but with the cysteine thiol blocked with acetamide.
  • OXM259-OXM268 and OXM306-308 (as shown in Table 1) have the amino acid sequence of OXM but wherein the amino acid at position 2 has been substituted with a non- natural amino acid to identify amino acid substitutions that confer resistance to DPP4 catalytic activity.
  • OXM peptide analogs that lack the amino acid sequence RNRNNIA can also display full agonistic activity on the GLP-I and the Glucagon receptors.
  • These OXM peptide analogs along with some additional peptides based upon the full-sized OXM peptide are shown in Table 2.
  • These truncated OXM peptide analogs are variants of the Glucagon K (GcgK) genus of peptides that were disclosed in commonly owned International Published Application No. WO2007100535.
  • the GcgK peptides are peptides where the OXM sequence has been truncated at the C terminus to eliminate the seven amino acid residues at the C-terminus.
  • the resulting peptide is that one of glucagon with an extra lysine residue at the C-terminus,
  • This GcgK peptide is compatible with a +/+ pattern in which the peptides show subnanomolar potency on both the GLP-IR and the GCGR.
  • native OXM shows nanomolar potency on the two receptors.
  • An additional advantage of the GcgK peptide is that the two basic arginine residues at the C-terminus have been eliminated. This was important in the construction of lipidated (acylated or cholesterylated) peptide analogs having dual GLP-I /GCGR agonist activity.
  • the pi for lipidated based peptide analogs should be around 5. Therefore, in particular aspects the lipidated peptide analogs have a pi less than 6.0. In further aspects, the lipidated peptide analogs have a pi between 4.5 and 6.0. In a further aspect, the lipidated peptide analogs have a pi of about 5.4.
  • Reduction of pi was done using one or more of the following three different strategies: 1) substitution of residues in the peptide, 2) introduction of a carboxylate group at the C terminus, and 3) introduction of negative residues such as one or more gamma-carboxy-glutamic acid residues as spacers.
  • the acyl or cholesterol group is covalently linked to the peptide by means of a spacer that comprises two gamma-carboxy-glutamic acid residues.
  • these peptide analogs include those peptide analogs shown in Table 2,
  • peptides with a pi of about 5.4 include but are not limited to OXM345, OXM380, OXM381 , OXM392, OXM395, OXM398, OXM399, OXM400, and OXM401.
  • the acyl or cholesterol group is covalently linked to an internal amino acid in the peptide analogs by means of a spacer that comprises one or two gamma-carboxy-glutamic acid residues and the peptide further includes one or more gamma-carboxy-glutamic acid residue covalently to the lysine residue at the C-terminus.
  • these peptide analogs include but are not limited to OXM407, OXM408, OXM414, and OXM418.
  • the acyl or cholesterol group is covalently linked to the C-terminus of the peptide by means of a spacer that comprises one gamma-carboxy-glutamic acid residue and the peptide further includes one or more amino acid substitutions to reduce the p ⁇ of the peptide.
  • OXM374 is an example of such a peptide analog.
  • a peptide analog comprising the amino acid sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO; 109) in which the second amino acid from the TV- terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-lerminal carboxy group of the peptide; wherein the peptide analog has a pi of less than 6.0 and is a dual GLP-I receptor agonist and glucagon receptor agonist, and pharmaceutically acceptable salts thereof.
  • peptide analogs has a pi of less
  • the amino acid substituted for the second amino acid from the TV-terminus of the peptide analog is selected from the group consisting of D-serine, ⁇ - aminoisobutyric acid, and 1 -amino- 1-cyclobutane carboxylic acid.
  • the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues.
  • the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker, which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
  • a hydrophilic linker which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
  • the peptide analog includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue: in particular embodiments the lipid moiety is a fatty acid such as a palmitoyl, myristoyl, or stearoyl moiety. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
  • the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
  • the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27.
  • the peptide analog includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or a-aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the arginine at position 18, lysine for the glutamine at position 20, and norleucine or Omethyl-L-homoserine for the methionine at position 27.
  • the tyrosine at position 10 in the peptide analog is replaced with a lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues
  • the glutamine at position 20 in the peptide analog is replaced with lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine by one or more gamma-glutamic acid residues.
  • the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus.
  • X ⁇ is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alplia-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alamne (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe
  • M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C- terminus of P.
  • the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units, which in particular aspects can include for example, four ethoxy units.
  • M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P or M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position X2 or
  • the lipid moiety is a palmitoyl, myristoyl, or stearoyl moiety. Examples of these peptide analogs are shown in Table 2.
  • C 7 Cys(cholest-5-en-3-yl 1 - ⁇ [ ⁇ 2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ -2-oxo-6,9, 12,15- tetraoxa-3-azaocladecan ⁇ 18-oate]) or Cys(Oxa4-cholestero ⁇ )
  • C 9 S- ⁇ 1 -[46-(cholest-5-en-3-yloxy)-3 ,43,46-trioxo-7, 10, 13,16,19,22,25,28,31 ,34,37,40- dodecaoxa-4,44-diazahexatetracont-l-yl]-2 ) 5-dioxopy- ⁇ olidin-3-yl ⁇ -L-cysteine or Cys (mal-oxai2- cholesterol)
  • OXM290 is the precursor for OXM301 and OXM291 to 294 are precursors for the remainder of the peptide analogs shown in Table 2.
  • OXM301 is an analogue having D-Ser in amino acid position 2 for DPPIV resistance * substitution of GIu and Ala, respectively, for the Argi ⁇ and Argig residues, and a C(Oxa4-cholesterol) group (C7) for improved pharmacokinetic properties in vivo.
  • the substitutions at Argi ⁇ and Argig were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
  • OXM302 is a peptide analog that lacks the amino acid sequence RNRNMA (SEQ ID NO:96) at the C-terminus (See commonly owned International Published Application No. WO2007/100535, which is incorporated herein in its entirety). Thus, OXM302 is one amino acid longer than the glucagon peptide by one lysine residue at the C-terminus. In OXM302, which has the structure HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:96) at the C-terminus (See commonly owned International Published Application No. WO2007/100535, which is incorporated herein in its entirety). Thus, OXM302 is one amino acid longer than the glucagon peptide by one lysine residue at the C-terminus. In OXM302, which has the structure HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:96) at the
  • OXM303 has the structure HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKC7-
  • OXM304 has the structure HsQGTFTSDYSKYLDSERAQDFVQWLMNTKCv- CONH2 (SEQ ID NO: 54).
  • OXM305 has the structure HSQGTFTSDYSKYLDSERAQDFVQWLMNTKCT-
  • OXM311 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- K(Pa ⁇ mitoyI)-CONH2 (SEQ ID NO:56).
  • the D-Ser in amino acid position 2 provides DPPIV resistance and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo,
  • OXM312 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKK(PaImitoyl)-CONH 2 (SEQ ID NO:57).
  • the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argi ⁇ and Argig residues improves stability and the K( ⁇ almitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
  • OXM314 has the structure HsQGTFTSD YSKYLDSRRAQDFVQWLMNTK-Ttds- K(Palmitoyl)-CONH2 (SEQ ID NO:58).
  • the D-Ser in amino acid position 2 provides DPPIV resistance and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
  • the Ttds (l ⁇ amino-4,7,10-trioxa-13-tridecanamine succinimic acid) is a linker that acts as a flexible and hydrophilic spacer between the peptide sequence and the K( ⁇ almitoyl) group.
  • OXM 313 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-Ttds- K(PalmitoyI)-CONH2 (SEQ ID NO: 59).
  • the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argi ⁇ and Argis residues improves stability and the Ttds-K( ⁇ almitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
  • OXM317 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E-C ⁇ CONH2 (SEQ ID NO:60).
  • the peptide there is a D-Ser in amino acid position 2 for DPPIV resistance, and a gamma glutamic residue linked to cholest-5-en-3-yl ⁇ [(2R)-3 ⁇ amino-2- ⁇ ' amino)- 3 -oxopropyljthio ⁇ acetate (C4) for improves pharmacokinetic properties in vivo.
  • the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the C4 group,
  • OXM318 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK ⁇ E-C ⁇ CONH2 (SEQ ID NO:61).
  • the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argj7 and Arg] g residues improves stability and the ⁇ E -C4 group improves the peptide analog's pharmacokinetic properties in vivo.
  • OXM319 has the structure B ⁇ QGTFTSDYSKYLDSEAAQDFVQWLMNTKC?- CONH2 (SEQ ID NO: ⁇ 2).
  • OXM321 has the structure
  • OXM323 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKR-C-/-
  • C7 provides a peptide with improved pharmacokinetic properties in vivo.
  • OXM325 has the structure
  • HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC7-CO2H (SEQ ID NO:65). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of GIu and Ala, respectively, for the Argi 7 and Argig residues, and a C(Oxa4-cholesterol) group (C7) improves pharmacokinetic properties in vivo.
  • the substitutions at Arg ⁇ an( i Argi g were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
  • OXM327 has the structure HaQGTFTSDYSKYLDSERAQDFVQWLMNTKC 7 - CONH2 (SEQ ID NO:6 ⁇ ).
  • the Aib in position 2 provides DPPIV resistance
  • substitution of GIu for theArg ⁇ residue provides a peptide with improved stability
  • the C(Oxa4-cholesterol) group (C 7 ) provides improved pharmacokinetic properties in vivo
  • OXM329 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E-C4- CO2H (SEQ ID NO:67).
  • the Aib in position 2 provides DPPIV resistance and a C(Oxa4- cholesterol) group (C 7) provides a peptide with improved pharmacokinetic properties in vivo.
  • the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the C4 group.
  • OXM330 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA- ⁇ E-K(Pam)-CONH2 (SEQ ID NO:68). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of GIu and Ala, respectively, for the Arg ⁇ and Argi 8 residues and a -K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
  • the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the K(palmitoyl) group.
  • the substitutions at Arg ⁇ -j and Argig were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
  • OXM345 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- C4-COOH (SEQ ID NO:69). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacers between the peptide sequence, and the cholesterol group, one Cys(cholesterol) at position 33 (C4).
  • OXM355 has the structure HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK- ⁇ E-C4 ⁇ COOH (SEQ ID NO:70), It was designed to contain D-Ser (s) at position 2, a Lys ⁇ Ser substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol one Cys(cholesterol) at position 32 (C4). A serine in position 12 is present in the GLP-I peptide sequence. Therefore, it is expected to have at least compatible potency at the GLP-IR.
  • the substitution Lysi2Ser eliminates a positive charge which results in a pi of about 5.
  • OXM357 has the structure HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK- ⁇ E-C. ⁇ - COOH (SEQ ID NO:71 ). It was designed to contain D-Ser (s) at position 2, one gamma- glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol one Cys(cholesterol) (C4) at position 32. OXM357 differs from OXM345 in having only one ⁇ Glu while OXM345 has two ⁇ -Glu.
  • OXM359 has the structure HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK- ⁇ E-C ⁇ - COOH (SEQ ID NO:72). It was designed to contain D-Ser (s) at position 2, a Lysi 2Ser substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) at position 32 (C7). Thus, OXM359 differs from OXM355 in having C7 (cholesterol group with the tetraethylene glycol spacer) instead of C4
  • OXM361 (cholesterol without an ethylene glycol spacer).
  • OXM361 has the structure HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK- ⁇ E-Cv-
  • COOH (SEQ ID NO:73). It was designed to contain D-Ser (s) at position 2, an ArgjgAla substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) at position 32 (C 7 in the table).
  • the ArgisAla substitution eliminates a positive charge which is important for the tuning of the optimal pi value to 5.
  • OXM373 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E-C 4 - COOH (SEQ ID NO:74). It was designed to contain D-Ser (s) at position 2, a SerieGlu substitution, one gamma-glutamic acid at position 31 as spacers between the peptide sequence, and the cholesterol, one Cys(cholesterol) at position 32 (C4). The GIu at position 16 is present in the e ⁇ endin-4 peptide so this substitution is expected to be at least compatible with GLP-IR activation.
  • OXM374 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E-C ⁇ - COOH (SEQ ID NO:75), It was designed to contain D-Ser (s) at position 2, a SerisGlu substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4 ⁇ cholesterol) at position 32 (C7).
  • the difference between OXM373 and 374 is due to the presence of the tetraethylene glycol spacer attached to the cholesterol group in OXM374.
  • OXM380 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- C7-COOH (SEQ ID NO;76). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (C ⁇ )at position 33.
  • OXM380 has the same peptide sequence of OXM345 but differs in the Oxa4 spacer linked to the cholesterol group.
  • OXM381 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- C9--COOH (SEQ ID NO:77). ⁇ t was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(maleimide ⁇ Oxai2-cholesterol) (C9) at position 33.
  • OXM381 has the same peptide sequence of OXM345 and OXM380 differing in the maleimide ⁇ 0xai2 spacer linked to the cholesterol. The structure of C9 is shown below.
  • OXM383 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK ⁇ E- ⁇ E- C7-COOH (SEQ ID NO:78). It was designed to contain Aib ( ⁇ ) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (C7) at position 33. OXM383 differs from OXM380 only with respect to the amino acid at position 2.
  • OXM388 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C7-COOH (SEQ ⁇ D NO:79). It was designed to contain Acb at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (C7) at position 33. OXM388 differs from OXM380 and 383 only with respect to the amino acid at position 2.
  • OXM392 has the structure HsQGTFTSDYSKYLDERRAKDFVQWLMNTK- ⁇ E- ⁇ E- C10-COOH (lactam bridge between E and K) (SEQ ID NO:80). It was designed to contain Ser (s) at position 2, SerigGlu and Gln2 ⁇ Lys substitutions wherein the Gluig and Lys20 are linked with a lactam bridge on the side chains, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (Ci 0) at position 33.
  • the lactam bridge is between position i (16) and i+4 (20) and is meant to stabilize the alpha-helical conformation of the peptide and to stabilize the peptide against proteolytic degradation.
  • the Cio group differs from the C9 group for the thioether bond connecting the cysteine thiol group to the Oxai2-cholesterol.
  • C9 there is a maleimide thioether bond while in Cio there is an acetamide thioether.
  • the structure of C ⁇ Q is shown below.
  • OXM395 has the structure H ⁇ QGTFTSDYSKYLDERRAKDFVQWLMNTK- ⁇ E-yE- C10-COOH (lactam bridge between E and K) (SEQ ID NO:81). It was designed to contain Aib ( ⁇ ) at position 2, SeqgGru and a Gln2 ⁇ Lys substitutions wherein the Gluig and Lys20 are linked with a lactam bridge between the side chains, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2 ⁇ cholesterol) (C 10) at position 33.
  • the lactam bridge is between position 16( i ) and 20 (i+4) and is meant to stabilize the peptide's alpha-helical conformation and to stabilize the peptide against proteolytic degradation.
  • OXM398 has the structure H-Acb-QGTFTSDYSKYLDERRAKDFVQWLMNTK- ⁇ E- ⁇ E-Cio-COOH (lactam bridge between E and K) (SEQ ID NO: 82).
  • OXM392, 395 and 398 differ only in the amino acid that is at position 2.
  • OXM399 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- Ci ⁇ -COOH (SEQ ID NO: 83). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33. OXM399 differs from OXM392 only in that it lacks the lactam bridge present in OXM392.
  • OXM400 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- Cio-COOH (SEQ ID NO;84). It was designed to contain Aib ( ⁇ ) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33. OXM400 differs from OXM395 only in that it lacks the lactam bridge present in OXM395.
  • OXM40I has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-Cio-COOH (SEQ ID NO:85). It was designed to contain Acb at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33.
  • OXM401 differs from OXM398 only in that it lacks the lactam bridge present in OXM398.
  • OXM399, OXM40, and 401 differ from each other in the amino acid at position 2.
  • OXM404 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-
  • K( ⁇ E- ⁇ almitoyl)-CONH2 (SEQ ID NO:8 ⁇ ). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
  • the peptide in this embodiment is amidated at the C-terminus.
  • OXM406 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E- ⁇ E-
  • C10-CONH2 (SEQ ID NO:87). It was designed to contain D-Ser (s) at position 2, a SerieGlu substitution, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2- c holesterol) (C 10 ) at position 33.
  • the peptide in this embodiment is amidated at the C-terminus.
  • OXM407 has the structure HsQGTFTSDYSKYLDSRRAK( ⁇ E- palmitoyl)DFVQWLMNTK- ⁇ E ⁇ E-CONH2 (SEQ ID NO:88). It was designed to contain D-Ser
  • OXM408 has the structure HsQGTFTSDYSKYLDSRRAK( ⁇ E- ⁇ E- pa!mitoy ⁇ )DFVQWLMNTK- ⁇ E-C ⁇ NH2 (SEQ ID NO:89).
  • OXM409 has the structure HsQGTFTSDK( ⁇ E- ⁇ E- palmitoyl)SKYLDSRRADFVQWLMNTK-CONH 2 (SEQ ID NO;89). It was designed to contain D-Ser (s) at position 2 and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ B-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
  • OXM410 has the structure HsQGTFTSDYSKYLDERRAK( ⁇ E- ⁇ E- palmitoyl)DFVQWLMNTK-CONH2 (SEQ ID NO;91). It was designed to contain D-Ser (s) at position 2, a Sei"i6Glu substitution, and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 20.
  • the peptide in this embodiment is amidated at the C-terminus,
  • OXM411 has the structure HsQGTFTSDK( ⁇ E- ⁇ E- palraitoyl)SKYLDERRAQDFVQWLMNTK:-CONH2 (SEQ ID NO:92). It was designed to contain D-Ser (s) at position 2, a Ser 16GIu substitution and a palmitoyl group linked to two ⁇ - glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-pa ⁇ mitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
  • OXM412 has the structure HsQGTFTSD YSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- CJ I-COOH (SEQ ID NO:93). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa24-cholesterol) (Ci i)at position 33. OXM412 differs from OXM399 for the length of the Oxa spacer linked to the cholesterol group. The structure of C ⁇ ⁇ is shown below.
  • OXM413 has the structure HaDGTFTSDYSKYLDSRRAQDFVK(DOTA)WLmNTK- ⁇ E- ⁇ E-Ci ⁇ -CONH2 (SEQ ID NO:94). It was designed as a peptide for imaging to target GLP-
  • the sequence contains Aib at position 2, an Asp at position 3 to give selectivity on the GLP- 1 R 1 a Lys(DOTA) at position 24, a Met(O) at position 27, two garama-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2 ⁇ cholesterol) (Ci o) at position 33.
  • the peptide in this embodiment is amidated at the
  • OXM414 has the structure HsQGTFTSDK( ⁇ E- paIraitoyl)SKYLDERRAQDFVQWLMNTK- ⁇ E-CONH2 (SEQ ID NO:95). It was designed to contain D-Ser (s) at position 2, two ⁇ -glutamic acids at positions 31, a Ser]6Glu substitution and a palmitoyl group linked to the side chain amino group of a lysine [Lys(palmitoyl)j at position 10. The peptide in this embodiment is amidated at the C-terminus.
  • OXM415 has the structure
  • HsQGTFTSDK(palmitoy ⁇ )SKYLDERRAQDFVQWLMNTK- ⁇ E- ⁇ E-CONH2 (SEQ ID NO;96). It was designed to contain D-Ser (s) at position 2, one ⁇ -glutamic acid at positions 31, a SerjeGIu substitution and a palmitoyl group linked to one ⁇ -glutamic acid residue and to the side chain amino group of a lysine [Lys( ⁇ E-palmitoyl)] at position 10, The peptide in this embodiment is amidated at the C-terminus.
  • OXM416 has the structure H ⁇ QGTFTSDK( ⁇ E- ⁇ E- palmitoyI)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:97). It was designed to contain Aib ( ⁇ ) at position 2, a SerigGlu substitution and a palmitoyl group linked to two ⁇ - glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-paimitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
  • OXM417 has the structure H-Acb ⁇ QGTFTSDK( ⁇ E- ⁇ E- palmitoyl)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:98). It was designed to contain Acb at position 2, a SerigGlu substitution and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
  • OXM418 has the structure HsQGTFTSDK( ⁇ E- ⁇ E- palmitoyl)SKYLD ⁇ RRAQDFVQWLMNTK- ⁇ E-CONH2 (SEQ ID NO:99). It was designed to contain D-Ser (s) at position 2, one gamma- glutamic acid at positions 31, a Ser ⁇ Aib ( ⁇ ) substitution and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10.
  • the peptide in this embodiment is amidated at the C-terminus.
  • OXM419 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- K( ⁇ E-pa ⁇ mitoyl)-CONH2 (SEQ ID NO: 100). It was designed to contain Aib ( ⁇ ) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
  • the peptide in this embodiment is amidated at the C-terminus
  • OXM420 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-K( ⁇ E-pa!mitoyl)-CONH2 (SEQ ID NO: 101). It was designed to contain Acb at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
  • the peptide in this embodiment is amidated at the C-terminus
  • OXM421 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- C12-COOH (SEQ ID NO: 102). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-O-cholesterol) (Ci 2) at position 33.
  • the Cys(Oxai2 ⁇ 0-cholesterol) differs from Cys(Oxai2-cholesterol) in having the cholesterol linked through an ether bond to the Oxai2 spacer.
  • the ether bond can confer more stability towards the ester bond present in the Cys(Oxa 12- cholesterol) or Ci 1 group.
  • the structure of Cys(oxai2-O-cholesterol) is shown below.
  • compositions comprising a therapeutically effective amount of one or more of the OXM analogs disclosed herein for the treatment of a metabolic disorder in an individual.
  • Such disorders include, but are not limited to, obesity, metabolic syndrome or syndrome X, type II diabetes, complications of diabetes such as retinopathy, hypertension, dyslipidemias, cardiovascular disease, gallstones, osteoarthritis, and certain forms of cancers.
  • the obesity-related disorders herein are associated with, caused by, or result from obesity.
  • “Obesity” is a condition in which there is an excess of body fat.
  • the operational definition of obesity is based on the Body Mass Index (BMI), calculated as body weight per height in meters squared (kg/m2).
  • BMI Body Mass Index
  • “Obesity” refers to a condition whereby an otherwise healthy subject has a Body Mass Index (BMI) greater than or equal to 30 kg/m2, or a condition whereby a subject with at least one co-morbidity has a BMI greater than or equal to 27 kg/m2.
  • An “obese subject” is an otherwise healthy subject with a Body Mass Index (BMl) greater than or equal to 30 kg/m2 or a subject with at least one co-morbidity with a BMI greater than or equal to 27 kg/m2.
  • a "subject at risk for obesity” is an otherwise healthy subject with a BMI of 25 kg/m2 to less than 30 kg/m2 or a subject with at least one co-morbidity with a BMI of 25 kg/m2 to less than 27 kg/m2.
  • BMI Body Mass Index
  • “obesity” refers to a condition whereby a subject with at least one obesity-induced or obesity-related co-morbidity that requires weight reduction or that would be improved by weight reduction, has a BMI greater than or equal to 25 kg/m2
  • an “obese subject” refers to a subject with at least one obesity- induced or obesity-related co-morbidity that requires weight reduction or that would be improved by weight reduction, with a BMI greater than or equal to 25 kg/m2.
  • a "subject at risk of obesity” is a subject with a BMI of greater than 23 kg/m2 to less than 25 kg/m2.
  • Obesity-induced or obesity-related co-morbidities include, but are not limited to, diabetes, non-insulin dependent diabetes mellitus - type 2, impaired glucose tolerance, impaired fasting glucose, insulin resistance syndrome, dyslipidemia, hypertension, hyperuricacidemia, gout, coronary artery disease, myocardial infarction, angina pectoris, sleep apnea syndrome, Pickwickian syndrome, fatty liver; cerebral infarction, cerebral thrombosis, transient ischemic attack, orthopedic disorders, arthritis deformans, lumbodynia, emmeniopathy, and infertility.
  • co -morbidities include: hypertension, hyperlipidemia, dyslipidemia, glucose intolerance, cardiovascular disease, sleep apnea, diabetes mellitus, and other obesity-related conditions.
  • Treatment refers to the administration of the compounds of the present invention to reduce or maintain the body weight of an obese subject.
  • One outcome of treatment may be reducing the body weight of an obese subject relative to that subject's body weight immediately before the administration of the compounds of the present invention.
  • Another outcome of treatment may be preventing body weight regain of body weight previously lost as a result of diet, exercise, or pharmacotherapy.
  • Another outcome of treatment may be decreasing the occurrence of and/or the severity of obesity-related diseases.
  • the treatment may suitably result in a reduction in food or calorie intake by the subject, including a reduction in total food intake, or a reduction of intake of specific components of the diet such as carbohydrates or fats; and/or the inhibition of nutrient absorption; and/or the inhibition of the reduction of metabolic rate; and in weight reduction in patients in need thereof.
  • the treatment may also result in an alteration of metabolic rate, such as an increase in metabolic rate, rather than or in addition to an inhibition of the reduction of metabolic rate; and/or in minimization of the metabolic resistance that normally results from weight loss.
  • Prevention refers to the administration of the compounds of the present invention to reduce or maintain the body weight of a subject at risk of obesity.
  • One outcome of prevention may be reducing the body weight of a subj ect at risk of obesity relative to that subject's body weight immediately before the administration of the compounds of the present invention.
  • Another outcome of prevention may be preventing body weight regain of body weight previously lost as a result of diet, exercise, or pharmacotherapy.
  • Another outcome of prevention may be preventing obesity from occurring if the treatment is administered prior to the onset of obesity in a subject at risk of obesity.
  • Another outcome of prevention may be decreasing the occurrence and/or severity of obesity-related disorders if the treatment is administered prior to the onset of obesity in a subject at risk of obesity.
  • Such treatment may prevent the occurrence, progression or severity of obesity-related disorders, such as, but not limited to, arteriosclerosis, Type II diabetes, polycystic ovarian disease, cardiovascular diseases, osteoarthritis, dermatological disorders, hypertension, insulin resistance, hypercholesterolemia, hypertriglyceridemia, and cholelithiasis.
  • the obesity-related disorders herein are associated with, caused by, or result from obesity.
  • obesity-related disorders include overeating and bulimia, hypertension, diabetes, elevated plasma insulin concentrations and insulin resistance, dyslipidemias, hyperlipidemia, endometrial, breast, prostate and colon cancer, osteoarthritis, obstructive sleep apnea, cholelithiasis, gallstones, heart disease, abnormal heart rhythms and arrythmias, myocardial infarction, congestive heart failure, coronary heart disease, sudden death, stroke, polycystic ovarian disease, craniopharyngioma, the Prader-Willi Syndrome, Frohlich's syndrome, GH-deficient subjects, normal variant short stature, Turner's syndrome, and other pathological conditions showing reduced metabolic activity or a decrease in resting energy expenditure as a percentage of total fat-free mass, e.g, children with acute lymphoblastic leukemia.
  • obesity-related disorders are metabolic syndrome, also known as syndrome X, insulin resistance syndrome, sexual and reproductive dysfunction, such as infertility, hypogonadism in males and hirsutism in females, gastrointestinal motility disorders, such as obesity-related gastro-esophageal reflux, respiratory disorders, such as obesity-hypoventilation syndrome (Pickwickian syndrome), cardiovascular disorders, inflammation, such as systemic inflammation of the vasculature, arteriosclerosis, hypercholesterolemia, hyperuricaemia, lower back pain, gallbladder disease, gout, and kidney cancer.
  • the compounds of the present invention are also useful for reducing the risk of secondary outcomes of obesity, such as reducing the risk of left ventricular hypertrophy.
  • diabetes includes both insulin-dependent diabetes mellitus
  • Type I diabetes also known as type I diabetes
  • NIDDM non-insulin-dependent diabetes mellitus
  • Type I diabetes or insulin-dependent diabetes
  • Type II diabetes is the result of an absolute deficiency of insulin, the hormone which regulates glucose utilization.
  • Type II diabetes, or insulin-independent diabetes i.e., non-insulin-dependent diabetes mellilus
  • the compounds of the present invention are useful for treating both Type I and Type 0 diabetes.
  • the compounds are especially effective for treating Type II diabetes.
  • the compounds of the present invention are also useful for treating and/or preventing gestational diabetes mellitus.
  • U.S. Patent No. 6,852,690 which is incorporated herein in its entirety, discloses methods for enhancing metabolism of nutrients comprising administering to a non-diabetic patient a formulation comprising a nutritively effective amount of one or more nutrients or any combination thereof and one or more insuHnotropic peptides.
  • the OXM peptide anlogs disclosed herein are insuHnotropic and can be administered to patients with a disturbed glucose metabolism such as insulin resistance but no overt diabetes, as well as patients who for any reason cannot receive nutrition through the alimentary canal.
  • Such patients include surgery patients, comatose patients, patients in shock, patients with gastrointestinal disease, patients with digestive hormone disease, and the like.
  • obese patients atherosclerotic patients, vascular disease patients, patients with gestational diabetes, patients with liver disease such as liver cirrhosis, patients with acromegaly, patients with glucorticoid excess such as Cortisol treatment or Cushings disease, patients with activated counterregulatory hormones such as would occur after trauma, accidents and surgery and the like
  • patients with hypertriglyceridemia and patients with chronic pancreatitis can be readily and suitably nourished according to the invention without subjecting the patient to hypo- or hyperglycemia.
  • the administration to such a patient aims to provide a therapy to as rapidly as possible deliver the nutritional and caloric requirements to the patient while maintaining his plasma glucose below the so-called renal threshold of about 160 to 180 milligrams per deciliter of glucose in the blood.
  • renal threshold of about 160 to 180 milligrams per deciliter of glucose in the blood.
  • normal patients not having glucose levels just below the renal threshold can also be treated according to the invention as described above, patients with disturbed glucose metabolism such as hyperglycemic patients whose plasma glucose level is just above the renal threshold also find the therapy suitable for their condition,
  • such patients who have a degree of hyperglycemia below the renal threshold at intermittent intervals can receive a combination treatment of nutrients plus insuHnotropic peptides according to any of the following regimens.
  • compositions comprising the OXM analogs disclosed herein can be administered, if desired, in the form of salts provided the salts are pharmaceutically acceptable. Salts may be prepared using standard procedures known to those skilled in the art of synthetic organic chemistry.
  • compositions comprising formula I are also useful for treating or preventing obesity and obesity-related disorders in cats and dogs.
  • mamal includes companion animals such as cats and dogs.
  • pharmaceutically acceptable salts refers to salts prepared from pharmaceutically acceptable non-toxic bases or acids including inorganic or organic bases and inorganic or organic acids. Salts derived from inorganic bases include aluminum, ammonium, calcium, copper, ferric, ferrous, lithium, magnesium, manganic salts, manganous, potassium, sodium, zinc, and the like. Particularly preferred are the ammonium, calcium, magnesium, potassium, and sodium salts.
  • Salts derived from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, and basic ion exchange resins, such as arginine, betaine, caffeine, choline, N,N'-dibenzylethylenediamine, diethyl amine, 2- diethylaminoethanol, 2-dimethylaminoethanol, ethanolamine, ethylenediamine, N-ethyl- morpholine, N-ethylpiperidine, glucamine, glucosamine, histidine, hydrabamine, isopropylamine, lysine, methylglucamine, morphoHne, piperazine, piperidine, polyamine resins, procaine, purines, theobromine, tri ethyl amine, trimethylamine, tripropylamine, tromethamine, and the like.
  • pharmaceutically acceptable salt further includes all acceptable salts such as acetate, lactobionate, benzenesulfonate, laurate, benzoate, malate, bicarbonate, maleate, bisulfate, mandelate, bitartrate, mesylate, borate, methylbromide, bromide, methylnitrate, calcium edetate, methylsulfate, camsylate, mucate, carbonate, napsylate, chloride, nitrate, clavulanate, N- methylglucamine, citrate, ammonium salt, dihydrochloride, oleate, edetate, oxalate, edisylate, pamoate (embonate), estolate, palmitate, esylate, pantothenate, fumarate, phosphate/diphosphate, gluceptate, polygalacturonate, gluconate, salicylate, glutamate, stearate, glycolly
  • the term "pharmaceutically acceptable” means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredient(s), approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopoeia or other generally recognized pharmacopoeia for use in animals and, more particularly, in humans.
  • carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered and includes, but is not limited to such sterile liquids as water and oils. The characteristics of the carrier will depend on the route of administration.
  • compositions of the invention may comprise one ore more OXM analogs disclosed herein in such multimeric or complexed form.
  • therapeutically effective amount means the total amount of each active component of the pharmaceutical composition or method that is sufficient to show a meaningful patient benefit, i.e., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions.
  • a meaningful patient benefit i.e., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions.
  • the term refers to that ingredient alone.
  • the term refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially, or simultaneously.
  • the pharmacological composition can comprise one or more OXM analogs disclosed herein; one or more OXM analogs disclosed herein and one or more other agents for treating a metabolic disorder; or the pharmacological composition comprising the one or more OXM analogs disclosed herein can be used concurrently with a pharmacological composition comprising an agent for treating a metabolic disorder.
  • Such disorders include, but are not limited to, obesity, metabolic syndrome or syndrome X, type II diabetes, complications of diabetes, hypertension, dyslipidemias, cardiovascular disease, gallstones, osteoarthritis, and certain forms of cancers.
  • the pharmacological composition comprises another agent for treating a metabolic disorder or the treatment includes a second pharmacological composition comprising an agent for treating a metabolic disorder
  • the agent includes, but are not limited to, cannabinoid (CBl) receptor antagonists, glucagon like peptide 1 (GLP-I) receptor agonists, lipase inhibitors, leptin, tetrahydrolipstatin, 2-4-dinitrophenol ?
  • Suitable agents of use in combination with a compound of the present invention include, but are not limited to:
  • anti-diabetic agents such as (1) PPAR ⁇ agonists such as glitazones (e.g. ciglitazone; darglitazone; englitazone; isaglitazone (MCC-555); pioglitazone (ACTOS); rosiglitazone (AVANDIA); troglitazone; rivoglitazone, BRL49653; CLX-0921 ; 5-BTZD, GW- 0207, LG-100641 , R483, and LY-300512, and the like and compounds disclosed in WO97/10813, 97/27857, 97/28115, 97/28137, 97/27847, 03/000685, and 03/0271 12 and SPPARMS (selective PPAR gamma modulators) such as Tl 31 (Amgen), FK614 (Fujisawa), netoglitazone, and metaglidasen; (2) biguanides such as buformin;
  • ATP consumption promotors such as those disclosed in WO 03/007990; (21) fixed combinations of PPAR ⁇ agonists and metformin such as AVANDAMET; (22) PPAR pan agonists such as GSK 677954; (23) GPR40 (G-protein coupled receptor 40) also called SNORF 55 such as BG 700, and those disclosed in WO 04/041266, 04/022551, 03/099793; (24) GPRl 19 (also called RUP3; SNORF 25) such as RUP3, HGPRBMY26, PFI 007, SNORF 25; (25) adenosine receptor 2B antagonists such as ATL-618, ATl-802, E3O8O, and the like; (26) carnitine palmitoyl transferase inhibitors such as ST 13
  • NS-220/R1593 Nippon Shinyaku/Roche, STl 929 (Sigma Tau) MC3001/MC3004 (MaxoCore Pharmaceuticals, gemcabene calcium, other fibric acid derivatives, such as Atromid®, Lopid®, and Tricor®, and those disclosed in US 6,548,538, and the like;
  • FXR receptor modulators such as GW 4064 (GlaxoSmithkline), SR 103912, QRX401, LN-6691 (Lion Bioscience), and those disclosed in WO 02/064125, WO 04/045511, and the like;
  • LXR receptor modulators such as GW 3965 (GlaxoSmithkline), T9013137, and XTCO179628 (X-Ceptor Therapeutics/Sanyo), and those disclosed in WO 03/031408, WO 03/063796, WO 04/072041 , and the like;
  • lipoprotein synthesis inhibitors such as niacin;
  • anti-obesity agents such as (1) 5HT (serotonin) transporter inhibitors, such as paroxetine, fluoxetine, fenfluramine, fluvoxamine, sertraline, and imipramine, and those disclosed in WO 03/00663, as well as serotonin/noradrenaline re uptake inhibitors such as sibutramine (MERIDI A/REDU CTIL) and dopamine uptake inhibitor/Norepenephrine uptake inhibitors such as radafaxine hydrochloride, 353162 (GlaxoSmithkline), and the like; (2) NE (norepinephrine) transporter inhibitors, such as GW 320659, despiramine, talsupram, and nomifensine; (3) CBl (cannabinoid-1 receptor) antagonist/inverse agonists, such as rimonabant (ACCOMPLIA Sanofi Synthelabo), SR- 147778 (Sanofi Synthelabo),
  • MCHlR melanin-concentrating hormone 1 receptor
  • T-226296 Takeda
  • T71 Takeda/Amgen
  • AMGN- 608450 AMGN-503796
  • Amgen 856464
  • A798 Abbott
  • ATCOl 75/AR224349 Arena Pharmaceuticals
  • GW803430 GaxoSmithkine
  • NBI- IA Neurorocrine Biosciences
  • NGX-I Neurogen
  • SNP-7941 Synaptic
  • SNAP9847 Synaptic
  • T-226293 Schering Plough
  • TP ⁇ - 1361-17 Saitama Medical School/University of California Irvine
  • NPY5 neuropeptide Y Y5-5 antagonists, such as 152,804, S2367 (Shionogi), E-6999 (Esteve), GW- 56918OA, GW-594884A (GlaxoSmithkline), GW-587081X, GW-548118X; FR 235,208; FR226928, FR 240662, FR252384; 1229U91, GI-264879A, CGP71683A, C-75 (Fasgen) LY- 377897, LY366377, PD-160170, SR-120562A, SR-1208I9A,S2367 (Shionogi), JCF-104, and H409/22; and
  • WO 97/19682 WO 97/2082O 5 WO 97/20821 , WO 97/20822, WO 97/20823, WO 98/27063, WO 00/107409, WO 00/185714, WO 00/185730, WO 00/64880, WO 00/68197, WO 00/69849, WO 01/09120, WO 01/14376, WO 01/85714, WO 01/85730, WO 01/07409, WO 01/02379, WO 01/02379, WO 01/23388, WO 01/23389, WO 01/44201, WO 01/62737, WO 01/62738, WO 01/09120, WO 02/20488, WO 02/22592, WO 02/48152, WO 02/49648, WO 02/051806, WO 02/094789, WO 03/009845, WO 03/014083, WO 03/02
  • leptin such as recombinant human leptin (PEG-OB, Hoffman La Roche) and recombinant methionyl human leptin (Amgen);
  • leptin derivatives such as those disclosed in Patent Nos.
  • opioid antagonists such as nalmefene (Revex ®), 3-methoxynaItrexone, naloxone, and naltrexone; and those disclosed in WO 00/21509; (13) orexin antagonists, such as SB-334867-A (GlaxoSmithkline); and those disclosed in WO 01/96302, 01/68609, 02/44172, 02/51232, 02/51838, 02/089800, 02/090355, 03/023561, 03/032991, 03/037847, 04/004733, 04/026866, 04/041791, 04/08540
  • Patent No. 6358951 U.S. Patent Application Nos. 2002/049196 and 2002/022637; and WO 01/56592, and WO 02/32888; (19) 5HT2c (serotonin receptor 2c) agonists, such as APD3546/AR10A (Arena Pharmaceuticals), ATH88651 (Athersys), ATH88740 (Athersys), BVT933 (Biovitrum/GSK), DPCA37215 (BMS), IK264; LY448100 (Lilly), PNU 22394; WAY 470 (Wyeth), WAY629 (Wyeth), WAYl 61503 (Biovitrum), R- 1065, VRl 065 (Vernalis/Roche) YM 348; and those disclosed in U.S. Patent No. 3,914,250; and PCT Publications 01/66548, 02/36596, 02/48124, 02/10169, 02/44152;
  • Mc3r melanocortin 3 receptor
  • Mc4r Mcanocortin 4 receptor
  • CHIR86036 Choiron
  • CHIR915 Chiron
  • ME-10142 Melacure
  • MB-10145 Melacure
  • HS-131 Melacure
  • NBI72432 Neuronal Biosciences
  • NNC 70-619 Novo Nordisk
  • TTP2435 Transtech
  • PCT Publications WO 99/64002 00/74679, 01/991752, 01/0125192, 01/52880, 01/74844, 01/70708, 01/70337, 01/91752, 01/010842, 02/059095, 02/059107, 02/059108, 02/0591 17, 02/062766, 02/069095, 02/12166, 02/11715
  • GLP-I glucagon- like peptide 1 agonists
  • Topiramate Topimax®
  • phytopharm compound 57 CP 644,673
  • ACC2 acetyl-CoA carboxylase-2
  • ⁇ 3 beta adrenergic receptor 3) agonists, such as rafebergron/AD9677/TAK677 (Dainippon/ Takeda), CL-316,243, SB 418790, BRL- 37344, L-796568, BMS-196085, BRL-35135A, CGP12177A, BTA-243, GRC1087 (Glenmark Pharmaceuticals)
  • GW 427353 solabegron hydrochloride
  • Trecadrine Zeneca D7114, N-5984 (Nisshln Kyorin)
  • LY-377604 Livothyln hydrochloride
  • WO98/04526 WO98/32753, WO 01/74782, WO 02/32897, WO 03/014113, WO 03/016276, WO 03/016307, WO 03/024948, WO 03/024953, WO 03/037881, WO 04/108674, and the like;
  • DGATl diacylglycerol acyltransferase 1 inhibitors
  • DGAT2 diacylglycerol acyltransferase 2inhibitors
  • PDE phosphodiesterase
  • inhibitors such as theophylline, pentoxifylline, zaprinast, sildenafil, amrinone, milrinone, cilostamide, rolipram, and cilomilast, as well as those described in WO 03/037432, WO 03/0378
  • UCP-I uncoupling protein 1
  • 2, or 3 activators such as phytanic acid, 4-[(E)- 2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-napthalenyl)-l-propenyl]benzoic acid (TTNPB), and retinoic acid; and those disclosed in WO 99/00123; (35) acyl-estrogens, such as oleoyl-estrorte, disclosed in del Mar-Grasa, M.
  • glucocorticoid receptor antagonists such as CP472555 (Pfizer), KB 3305, and those disclosed in WO 04/000869, WO 04/075864, and the like; (37) 1 l ⁇ HSD-I (1 1-beta hydroxy steroid dehydrogenase type 1 ) inhibitors, such as BVT 3498 (AMG 331 ), BVT 2733, 3-( 1 -adamantyl)-4 ⁇ ethyl-5-(ethylthio)-4H-l,2,4-triazole, 3 ⁇ (l-adamantyl)-5-(3,4,5-trimethoxyphenyl)-4-methyI-4H- 1,2,4-triazole, 3 ⁇ adamantanyl-4,5,6,7,8,9,lO,l 1 ,12,3a-decahydro-l,2,4-triazolo[4,3- a]
  • lipase inhibitors such as tetrahydrolipstatin (orhstat/XENICAL), ATL962 (AHzyme/Takeda), GT389255 (Genzyme/Peptimmune)Triton WR1339, RHC80267, lipstatin, teasaponin, and diethy ⁇ umbelliferyl phosphate, FL-386, WAY-121898, Bay-N-3176, valilactone, esteracin, ebelactone A, ebelactone B, and RHC 80267, and those disclosed in WO 01/77094, WO 04/111004, and U.S.
  • lipase inhibitors such as tetrahydrolipstatin (orhstat/XENICAL), ATL962 (AHzyme/Takeda), GT389255 (Genzyme/Peptimmune)Triton WR1339, RHC80267, lipstatin, teasaponin, and diethy ⁇ umbelliferyl phosphate, FL
  • BVT74713 and other gut lipid appetite suppressants (61) dopamine agonists such as bupropion (WELLBUTRIN/GlaxoSmithkline); (62) zonisamide (ZONEGRAN/Dainippon/Elan), and the like.
  • Specific compounds that can be used in combination with the OXM analogs disclosed herein include specific CBl antagonists/inverse agonists include those described in
  • WO03/077847 including: N-[3-(4-chlorophenyl)-2(5)-phenyl- 1 (5)-methylpropyl]-2-(4- trifluoromethyl-2-pyrimidyloxy)-2-methylpropanamide > /V-[3-(4-chlorophenyl)-2-(3- cyanophenyl)- 1 -methylpropyl]-2-(5-trifluoromethyl-2-pyridyloxy)-2-methylpropanamide, JV-[3- (4-chlorophenyl)-2-(5-chloro-3-pyridyl)-l-methyl ⁇ ropyl]-2-(5-trifl ⁇ ioromethyl-2-pyridyloxy)-2- methylpropanamide, and pharmaceutically acceptable salts thereof; as well as those in
  • WO05/000809 which includes the following: 3- ⁇ 1 -[bis(4-chlorophenyl)methyl]azetidin-3- ylidene ⁇ -3-(3,5-difluorophenyl)-2,2-dimethylpropanenitrile, 1 - ⁇ 1 -[ 1 -(4- chlorophenyl)pentyl] azetidin ⁇ 3 -yl ⁇ - 1 -(3 , 5-difluorophenyI)-2-methylpropan-2-ol.
  • NPY5 antagonists that can be used in combination with the OXM analogs disclosed herein include: 3-oxo-N-(5-phenyl-2- ⁇ yrazinyl)-s ⁇ iro[isobenzofl ⁇ ran-l(3H),4'- pi ⁇ eridme]-r-carboxamide, 3-oxo-N-(7-trifluoromethyl ⁇ yrido[3,2-b]pyridin-2-y!)spiro- [isobenzofuran-1 (3H),4'-piperidine]-l '-carboxamide, N-[5-(3-fluorophenyl)-2-pyrimidinyl]-3- oxospiro-[isobenz;ofuran-l(3H),4'-piperidine]-r-carboxamide, trans-3'-oxo-N-(5-phenyl-2- pyrimidinyl)spiro[cyclohexane- 1 , 1 '(3 ⁇ )-is
  • ACC- 1/2 inhibitors that can be used in combination with the OXM analogs disclosed herein include: r-[(4,8-dimethoxyquinolin-2-yl)carbonyl]-6-(lH-tetrazol-5- yl)spiro[chroman-2 ,4'-piperidin] ⁇ 4-one; (5- ⁇ 1 '-[(4,8-dimethoxyquinolin-2-yl)carbonyl]-4- oxospiro[chroman-2,4'-piperidin]-6-yl ⁇ -2//-tetrazol-2-yl)methyl pivalate; 5- ⁇ l'-[(8-cyclopropyl- 4-methoxyquinolJn-2-yl)carbonyl]-4-oxospiro[chroman-2,4'-piperidin]-6-yl ⁇ nicotinic acid; 1 '-(
  • MCHlR antagonist compounds that can be used in combination with the OXM analogs disclosed herein include: 1 - ⁇ 4-[( 1 -ethylazetidin-3 -yl)oxy]phenyl ⁇ -4- [(4-f ⁇ uorobenzyl)oxy]pyridin-2( 1 H)- one, 4- [ (4-fluorobenzyl)oxy] - 1 - ⁇ 4-[ ( 1 -i sopropylazetidin- 3 -yl)oxy]phenyl ⁇ pyridin-2( ⁇ H)-one, 1 - [4-(azetidin-3-yloxy)phenyl]-4-[(5-chloropyridin-2-yl)methoxy]pyridin-2(lH)-one, 4-[(5- chloro ⁇ yridin-2-yl)methoxy]-l - ⁇ 4-[(l -ethylazetidin-3-yl)oxy]phenyl
  • a specific DPP- ⁇ V inhibitor that can be used in combination with the OXM analogs disclosed herein is 7-[(3R)-3-amino-4-(2 5 4 J 5-trifluoro ⁇ henyl)butanoyl]-3-(trifluoromethyl)- 5, ⁇ ,7,8-tetrahydro-l,2j44riazolo[4,3-a]pyrazine, or a pharmaceutically acceptable salt thereof.
  • H3 (histamine H3) antagonists/inverse agonists that can be used in combination with the OXM analogs disclosed herein include: those described in WO05/077905, including:3- ⁇ 4-[(l -cyclobutyl-4-piperidinyl)oxy] ⁇ henyl ⁇ -2-ethyl ⁇ yrido[2,3-d]-pyrimidin-4(3H)-one, 3- ⁇ 4- [(l-cyclobutyl-4-piperidinyl)oxy]phenyl ⁇ -2-methylpyrido[4,3-d]pyrimidin-4(3H)-one, 2-ethyI-3- (4- ⁇ 3-[(3S)-3-methylpiperidin-l-y ⁇ ]propoxy ⁇ phenyl)pyrido[2,3-d3pyrimidin-4(3H)-one 2- methyl-3-(4» ⁇ 3-[(3S)-3-methylpiperidin-l-yl]propoxy ⁇ phenyl)pyrido[
  • CCKlR agonists of use in combination with the OXM analogs disclosed herein include: 3 -(4- ⁇ [ 1 -(3 -ethoxyphenyl)-2-(4-methylphenyl)- IH -imidazol-4-yl]carbonyl ⁇ - 1 - piperazinyl)- 1 -naphthoic acid; 3-(4- ⁇ [1 -(3-ethoxyphenyl)-2-(2-fluoro-4"methylphenyl)-lH - imidazol-4-yl]carbonyl ⁇ -l -piperazinyl)- 1 -naphthoic acid; 3 -(4- ⁇ [1 -(3-ethoxyphenyl)-2-(4- fluoropheny I)-IH -imidazol-4-yl]carbonyl ⁇ -l -piperazinyl)- 1 -naphthoic acid; 3-(4- ⁇
  • MC4R agonists of use in combination with the OXM analogs disclosed herein include: 1) (S ⁇ -r-ltCS ⁇ -l-tert-butyl-S ⁇ -trifluorophenyOpiperidin ⁇ -ylJcarbonylJ-S- chloro-2-methyl-5-[l-methyl-l-(l-methyI-lH-l 5 2,4-triazol-5-yl)ethyI]-5/7-s ⁇ iro[furo[3 !
  • peptide analogs and mimetics of the incretin hormone glucagon-like peptide 1 may also be of use in combination with the OXM analogs disclosed herein.
  • Methods of administrating the pharmacological compositions comprising the one or more OXM analogs disclosed herein to an individual include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
  • compositions can be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (for example, oral mucosa, rectal and intestinal mucosa, and the like), ocular, and the like and can be administered together with other biologically-active agents. Administration can be systemic or local, In addition, it may be advantageous to administer the composition into the central nervous system by any suitable route, including intraventricular and intrathecal injection. Intraventricular injection may be facilitated by an intraventricular catheter attached to a reservoir (for example, an Ommaya reservoir). Pulmonary administration may also be employed by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
  • OXM analogs disclosed herein may also be desirable to administer the one or more OXM analogs disclosed herein locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, by injection, by means of a catheter, by means of a suppository, or by means of an implant.
  • the OXM analogs disclosed herein may be delivered in a vesicle, in particular a liposome.
  • a liposome the OXM analogs disclosed herein are combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids which exist in aggregated form as micelles, insoluble monolayers, liquid crystals, or lamellar layers in aqueous solution.
  • Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like. Preparation of such liposomal formulations is within the level of skill in the art, as disclosed, for example, in U.S. Patent No. 4,837,028 and U.S. Patent No. 4,737,323.
  • the OXM analogs disclosed herein can be delivered in a controlled release system including, but not limited to: a delivery pump (See, for example, Saudek, et a!., New Engl. J. Med.
  • compositions comprising one or more of the OXM analogs disclosed herein which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and may be determined by standard clinical techniques by those of average skill within the art.
  • in vitro assays may optionally be employed to help identify optimal dosage ranges.
  • the precise dose to be employed in the formulation will also depend on the route of administration, and the overall seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances, Ultimately, the attending physician will decide the amount of the composition with which to treat each individual patient. Initially, the attending physician will administer low doses of the composition and observe the patient's response. Larger doses of the composition may be administered until the optimal therapeutic effect is obtained for the patient, and at that point the dosage is not increased further.
  • the daily dose range lie within the range of from about 0.001 mg to about 100 mg per kg body weight of a mammal, preferably 0.01 mg to about 50 mg per kg, and most preferably 0.1 to 10 mg per kg, in single or divided doses. On the other hand, it may be necessary to use dosages outside these limits in some cases.
  • suitable dosage ranges for intravenous administration of the compositions comprising the one or more OXM analogs disclosed herein are generally about 5-500 micrograms ( ⁇ g) of active compound per kilogram (Kg) body weight.
  • Suitable dosage ranges for intranasal administration are generally about 0.01 pg/kg body weight to 1 mg/kg body weight.
  • Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems, Suppositories generally contain active ingredient in the range of 0.5% to 10% by weight; oral formulations preferably contain 10% to 95% active ingredient. Ultimately the attending physician will decide on the appropriate duration of therapy using compositions comprising the one or more OXM analogs disclosed herein of the present invention. Dosage will also vary according to the age, weight and response of the individual patient.
  • a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions and OXM analogs disclosed herein.
  • Optionally associated with such container(s) may be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
  • OXM Oxyntomodulin
  • peptide amides 0.1 g of an aminomethylated polystirene LL (100-200 mesh, 0.41 mmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S)- ⁇ -[9H-Fluoren-9-yl-methoxyforraamido]-2 J 4- dimethoxybenzylj-phenoxyacetic acid (Rink, H., 1987, Tetrahedron Lett. 28:3787-3789; Bernatowicz, M. S. et al, 1989, Tetrahedron Lett. 30:4645-4667) was used.
  • All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5M HOBt (Hydroxybenzotriazole) in DMF.
  • the acylation reactions were performed for 45 minutes with six-fold excess of activated amino acid over the resin free amino groups.
  • the amino acids were activated with equimolar amounts of HBTU (2-(lH ⁇ benzotriazole-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate) and a two-fold molar excess of DIEA (N,N-diisopropylethylamine).
  • the peptides were synthesized by solid phase using Fmoc/t-Bu chemistry on a Pioneer Peptide Synthesizer (Applied Biosystems).
  • the side chain protecting groups were: OMpe (0-3 -Methyl -pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, GIn, and His; and, tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg.
  • Lysine-Palmitoyl was manually acylated by reaction with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l,l,3,3 ⁇ tetramethyluronium hexafluorophosphate) and a 2-fold molar excess of DIEA (N,N-diiso ⁇ ropylethylamine).
  • HBTU 2-(lH-benzotriazole-l-yl)-l,l,3,3 ⁇ tetramethyluronium hexafluorophosphate
  • DIEA N,N-diiso ⁇ ropylethylamine
  • the dry peptide-resins were individually treated with 20 mL of the cleavage mixture, 88% trifluoroacetic acid (TFA), 5% phenol, 2% triisopropylsilane and 5% water (Sole, N. A. and G. Barany, 1992, J Org, Chem. 57:5399-5403) for 1.5 hours at room temperature. Each resin was filtered and the solution was added to cold methyl -t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice.
  • the following gradient of eluent B was used: 20%-20% over five minutes and 20%-35% over 20 minutes for the OXM229 (the peptide thiolated precursor of OXM36 and OXMI l 5), OXM29 (the thiolated precursor of OXM70 and OXM216), OXM208 (the peptide thiolated precursor of OXM212), and OXM209 (the peptide thiolated precursor of 0XM213).
  • Oxyntomodulin OXM cholesterylated analogs OXM36, OXM70, OXMl 15, OXM212, OXM213, and OXM216 was as follows.
  • the reactions were run under conditions that permit the formation of a thioether bond.
  • the cholesterylaled OXM peptides were then isolated using reverse-phase HPLC and characterized on a Micromass LCZ platform.
  • the analogs OXM36, 70, 212, and 213 were synthesized from the thiol containing OXM peptide precursor OXM229, OXM208, and 209, respectively, by reaction with the bromo derivative, cho ⁇ est-5-en-3-yl bromoacetate having the structure
  • cholest- ⁇ -en-3-yl bromoacetate to produce conjugates attached via a thioether bond.
  • 30 mg of peptide precursor were dissolved in one mL of DMSO (cone. 30 mg/mL) and a one molar excess of cholest-5 ⁇ en-3-yl bromoacetate dissolved in THF (cone. 20 mg/mL) was added.
  • 1% by volume of DIPEA N,N-diiso ⁇ ropyl-ethylamine
  • the peptide solution was purified by RP-HPLC and characterized on a Micromass LCZ platform.
  • the peptides OXMl 15 and 216 were synthesized from the thiol containing OXM peptide precursor OXM229 and OXM29 to produce analogs by reaction with the bromo derivative, cholest-5-en-3-yl l-bromo-2-oxo- ⁇ ,9,l 2,15-tetraoxa-3-azaoctadecan-l 8-oate
  • peptide precursor were dissolved in J mL of DMSO (cone. 30 mg/mL) and a one molar excess of cholest-5-en-3-yl 1- bromo-2-oxo-6,9,l 2, 15-tetraoxa-3 ⁇ azaoctadecan-l 8-oate dissolved in THF (cone. 20 mg/mL) was added.
  • PEGylation reactions were run under conditions permitting thioester bond formation.
  • the PEGylated OXM peptide was then isolated using reverse-phase HPLC or ion exchange chromatography and size exclusion chromatography (SEC).
  • SEC size exclusion chromatography
  • PEGylated OXM analogs were characterized using RP-HPLC, HPLC-SEC and MALDI-Tof Mass Spectrometry.
  • OXM33, 34, 35, 36 and 54 peptides were synthesized from the thiol-containing OXM peptide precursor OXM229 to produce analogs with PEG covalently attached via a thioether bond.
  • the PEGylated peptide solution was acidified to 1% acetic acid and purified by cation exchange chromatography (IXC) on TSK CM-650S with a linear gradient of NaCl in sodium acetate 50 mM pH 4.8.
  • IXC purified PEGylated-peptide was further purified by SEC and characterized by MALDI-TOF.
  • OXM peptide analogs that that display full agonistic activity on the GLP- 1 and the Glucagon receptors and shown in Table 2 were synthesized as follows.
  • the peptides OXM290, 291, 292, 293 and 294 that are precursors of OXM301, OXM302, OXM303, OXM304 and OXM305 were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer Simphony Protein Technologies Inc.
  • peptide amides For peptide amides, 0.5 g of a resin Aminomethylated polystirene LL (100-200 mesh, 0.41 rnmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S) ⁇ -[9H-Fluoren- 9-yl-methoxyfo ⁇ namido] ⁇ 2,4-dimethoxybenzyI]-phenoxyacetic acid (Rink, Tetrahedron Lett. 28:3787-3789 (1987); Bernatowicz et at., Tetrahedron Lett. 30:4645-4667 (1989)) was used.
  • All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5 M HOBt (Hydroxybenzotriazole) in DMF.
  • the acylation reactions were performed for 60 minutes with 8- fold excess of activated amino acid over the resin free amino groups.
  • the amino acids were activated with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l, 1 ,3,3- tetramethyluronium hexafluorophosphate), solution 0.5 M in DMF, and a 2-fold molar excess of DIEA (N ,N-diisopropylethyl amine), solution 2 M in NMP.
  • the side chain protecting groups were: OMpe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, GIn and His; tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-su ⁇ fonyj for Arg; Boc-His(Trt)-OH was used in the synthesis.
  • the dry peptide-resins were individually treated with 25 mL of the cleavage mixture, 82.5% trifluoroacetic acid (TFA), 5% phenol, 5% thioanisole, 2.5% Ethandithiole, and 5% water for 1.5 hours at room temperature. Each resin was filtered and the volume of the solution was reduced then added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H2O, 20% acetonitrile, and lyophilized.
  • TFA trifluoroacetic acid
  • the crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM C4 cartridges (40 x 200 mm, 15 ⁇ m) and using as eluents (A) 0.1 % TFA in water and (B) 0.1 % TFA in acetonitrile.
  • the following gradient of eluent B was used: 22%-22% over 5min and 22%-32% over 20 min for OXM301 precursor, 22%-22% over 5min and 22%-35% over 20 min for OXM302 precursor, 25%-25% over 5min and 25%-40% over 20 min for OXM303 precursor, 25%-25% over 5min and 25%-35% over 20 min for OXM304 precursor and OXM305 precursor, flow rate 80 mL/min, wavelength 214 nm.
  • Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4,6 mm, (CPS analitica p/n ACE-213-1546), at 45 0 C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents and the following linear gradient: 25%-25% B (in 5 min) - 40%B (in 20 min) - 80% B (in 2 minutes), flow 1 mL/min.
  • the purified peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
  • OXM304, and OXM305 were synthesized from the thiol containing OXM peptide precursor OXM290-294 respectively to produce derivatives with the C7 group covalently attached via the thioether group of the cysteine residue at the C-terminus.
  • derivatization of the precursor 40 mg of peptide precursor were dissolved in 1.33 mL of DMSO (cone. 30 mg/mL) and a 2.1 molar excess of eholest-5-en-3-yl l-bromo-2 ⁇ oxo-6,9,12,15-tetraoxa-3-azaoctadecan- 18-oate dissolved in THF (cone. 30 mg/mL) was added.
  • DIPEA N,N- diisopropyl-ethylamine
  • OXM237-OXM308 and OXM345-OXM414 were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer Simphony Protein Technologies Inc.
  • the amino acids were activated with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate), solution 0,5 M in DMF, and a 2-fold molar excess of DIEA (N,N- diisopropylethylamine), solution 2M in NMP.
  • HBTU 2-(lH-benzotriazole-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate
  • DIEA N,N- diisopropylethylamine
  • the side chain protecting groups were: Ompe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys ⁇ GIn and His; tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg; Boc-His(Trt)-OH was used in the synthesis.
  • Glul6 and Lys20 were incorporated as GIu(OaIl) and Lys(AlIoc).
  • the resins were dried, the protecting groups of GIu(OaIl) and Lys(Alloc) were removed and the lactam bridge was formed by incubating the resin with 5 molar excess of HBTU and 10 molar excess of DIPEA.
  • lipidated peptides such as OXM404, 407, 408, 410, 411, 414, 415, 416, 417, 418, 419, 420 the lysine to be derivatized on the side chain was incorporated as Lys(AIloc).
  • Alloc protecting group was removed and the synthesis was completed by condensation of the ⁇ -carboxyglutamic acid residues and the palmitic acid using HBTU and DIPEA as activators.
  • the dry peptide-resins were individually treated with 25 mL of the cleavage mixture, 82,5% trifluoro acetic acid (TFA), 5% phenol, 5% thioanisole, 2.5% ethandithiole and 5% water for 1.5 hours at room temperature. Each resin was filtered and the volume of the solution was reduced then added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H 2 O, 20% acetonitrile, and lyophilized.
  • TFA trifluoro acetic acid
  • the crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM C 4 cartridges (40 x 200 mm, 15 ⁇ m) and using as eluents (A) 0.1% TFA in water and (B) 0.1% TFA in acetonitrile.
  • Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 x 4.6 mm, (CPS analitica p/n ACE- 213-1546), at 45 0 C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
  • the purified peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
  • C5 conjugates were a follows.
  • the peptide OXM238 was synthesized from a thiol containing OXM peptide precursor to produce derivatives with the acetamide covalently attached via the thioethers group of the cysteine residue at the C-terminus,
  • derivatization of the precursor 50 mg of peptide precursor were dissolved in Tris HCl buffer 0.25 M, EDTA 2mM, Urea 6M pH 8.3 (cone. 30 mg/raL) and a 10 molar excess of iodoacetamide dissolved in DMSO (cone. 30 mg/mL) was added. After 30 minutes the reaction is complete. The solution is acidified with acetic acid and purified on preparative HPLC.
  • Synthesis of C4 conjugates was as follows. The peptides OXM345, OXM355,
  • OXM357, OXM373 were synthesized from the thiol containing OXM peptide precursors respectively to produce derivatives with the cholesterol group covalently attached via the thioethers group of the cysteine at the C ⁇ terminus.
  • derivatization of the precursor 40 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 2.1 molar excess of choIest-5-en-3-yl l ⁇ bromo-2-oxo- ⁇ ,9,12,15-tetraoxa-3 ⁇ azaoctadecan-18-oate dissolved in THF (cone. 30 mg/mL) was added.
  • DIPEA N ,N- d ⁇ sopropy ⁇ -ethylamine
  • the final peptides were characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45°C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
  • the peptides were characterized by electrospray mass spectrometry on a Micromass. Synthesis of C7 conjugates was as follows.
  • OXM374, OXM380, OXM383 and OXM388 were synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxa4-cholesterol covalently attached via a tbioether bond to the cysteine residue at the C-terminus.
  • derivatization of the precursor 25 mg of peptide precursor were dissolved in 1.33 mL of DMSO (cone. 30 mg/mL) and a 1.1 molar excess of cholest-5-en-3 ⁇ yl 1 -bromo-2-oxo-6,9, 12, 15-tetraoxa-3-azaoctadecan- 18-oate dissolved in THF (cone.
  • ACE C-4 300 A
  • 3 um column 150 x 4.6 mm
  • (CPS analitica p/n ACE-213-1546) at 45 0 C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
  • the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
  • Synthesis of C9 conjugates was as follows.
  • the peptide OXM381 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxal 2-cholesterol covalently attached via the maleimide thioether bond to the cysteine residue at the C-terminus.
  • 25 mg of peptide precursor were dissolved in DMSO (cone.
  • the final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45°C, using H 2 O, 0.1% TFA (A) and CH3CN, 0,1% TFA (B) as solvents.
  • the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
  • Synthesis of C 12 conjugates was as follows.
  • the peptides OXM421 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxal 2-0- cholesterol covalently attached via a thioether bond to the cysteine residue at the C-terminus.
  • derivatization of the precursor 25 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 1.5 molar excess of cholest-5-en-3-yl 1 -bromo-2-oxo- 6 ; 9 ?
  • the final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 m ⁇ column, 150 x 4.6 mm, (CPS analitica ⁇ /n ACE-213-1546), at 45°C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
  • the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
  • C 3 Cys(mPEG) 2 40kDa, each corresponding to a cysteine residue PEGylated via the side- chain thiol with linear methoxyPEG (mPEG) or branched mPEG [XmPEG) 2 ] of the indicated MW;
  • C 4 Cys(cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate);
  • Cs CyS(CH 2 CONH 2 ), corresponding to a cysteine residue in which the side-chain thiol was reacted with iodoacetamide;
  • C 7 Cys(cholest-5-en-3-yl l- ⁇ [(2R)-3-amino-2»(amino)-3-oxopropyl]thio ⁇ -2-oxo-6,9,l2,15- tetraoxa-3-azaoctadecan-18-oate]) or Cys(Oxa4-cholesterol));
  • C 8 Cys(N-ethylmaleimidyl).
  • CHO cells stably expressing mouse or human GLP-IR or GCGR were grown in Iscove's Modified Dulbecco's Medium (IMDM), 10% FBS, ImM L-glutamine, penicillin- streptomycin (100 ⁇ /mL) and 750 ⁇ g G418/mL for three-four days before harvesting using Enzymefree Dissociation Media (EFDM, Specialty Media).
  • IMDM Iscove's Modified Dulbecco's Medium
  • FBS Iscove's Modified Dulbecco's Medium
  • ImM L-glutamine penicillin- streptomycin
  • EFDM Enzymefree Dissociation Media
  • OXM and OXM-Q3E were diluted in assay buffer and were incubated with cells in the absence or presence of 10% mouse plasma, respectively, for 30 min at room temperature. The assay was terminated with the addition of the LANCE kit Detection buffer as per the manufacturer's instructions.
  • GLP-IR selective agonist was as follows. First, in order to evaluate the therapeutic utility of a dual GLP-1R/GCGR agonist (OXM mimetic), a matched peptide that was selective for only the GLP-I receptor (GLP-I mimetic), yet differs from native OXM by only one amino acid was identified. This peptide differed from native OXM by having a Glutamic acid (E) residue at position 3 instead of Glutamine (Q). A second GLP-I mimetic was identified that had an aspartic acid residue (D) in place of the Q. The efficacy of the GLP-I mimetic and the OXM mimetic in improving metabolic control in rodents were compared. These peptides and human OXM were synthesized and purified by GL Biochem (Shanghai) Ltd.
  • Percent inhibition values for each treatment were generated from the AUC data normalized to the saline-challenged controls. Areas under the curve (AUC) for glucose (AUC glucose) was calculated using the trapezoidal method. Statistics. Statistical analysis was done using unpaired 2-tailed Student's t test. P values ⁇ 0.05 were reported as significant.
  • 31p NMR spectroscopy was performed initially to examine the ATP and inorganic phosphate (Pi) levels to assess hepatic viability.
  • a 13c NMR- visible pool of glycogen was then created by the addition of the gluconeogenic substrate [2-13C] Pyruvate and ammonium chloride ( ⁇ 7 mM and 1 raM, respectively) to the perfusate, and the amount of 13c glycogen contained in the liver was monitored in real time via the Cl resonance of the glucosyl units in glycogen.
  • GDIS Glucose dependent insulin secretion
  • Insulin was measured in aliquots of the incubation buffer by enzymelinked immunosorbent assay with a commercial kit (ALPCO diagnostics, Windham, NH). Animal study protocols were reviewed and approved by the Merck Research Laboratories Institutional Animal Care and Use Committee in Rahway, NJ.
  • 13C-NMR spectroscopy was used to non-invasively monitor glycogen and glucose levels in response to acute treatment with novel oxyntomodulin analogs in real time.
  • Mice expressing human GCGR were anesthetized (Nembutal IP, 50 mg/kg) at approximately the middle of the dark cycle.
  • the portal vein was then cannulated and tied off and the liver was excised.
  • the liver was then placed into a 20 mm NMR tube and the initial Krebs solution was exchanged for a Kxebs-BSA perfusate, which was recirculated.
  • 31p NMR spectroscopy was performed initially to examine the ATP and inorganic phosphate (Pi) levels in the liver which can be used to assess hepatic viability.
  • glucagon at 1.5 mpk gave 84% GCGR occupancy
  • 3 mpk OXM gave 31% GCGR occupancy
  • OXM-Q3E gave 0% GCGR occupancy.
  • OXM, 0XM-Q3E Using the matched peptides, OXM, 0XM-Q3E, we investigated both acute and chronic pharmacological effects of co-agonism of both receptors in a chronic hyperglycemic clamp and a chronic food intake (FI) and body weight (BW) study (Table 5) and in an acute intraperitoneal glucose tolerance test (IPGTT, Figure 3). While both peptides effectively improved glucose tolerance, OXM-Q3E out-performed native OXM in reducing glucose excursion in both lean and diet induced obesity (DIO) mouse models.
  • DIO diet induced obesity
  • the native peptide proved superior at reducing food intake and body weight ( ⁇ BW: -6% for OXM vs -2.4% for 0XM-Q3E at 5 mg/kg) in DIO mice, an effect attributed to co-agonism of the GCGR, In both acute and chronic paradigms, native OXM did not cause increased glucose excursion.
  • DIO mice (16 wk on high fat diet) were anesthetized with xylazine and ketamine and catheterized through the right internal jugular vein 3 days before the in vivo studies. 25% glucose was infused and adjusted for the duration of the experiment to maintain hyperglycemia. Due to the short half-life of the peptides (both are rapidly inactivated by dipeptidyl peptidase IV and renally cleared (Zhu et ah, J. Biol. Chera. 278: 22418-23, (2003))), vehicle, OXM (-16 ⁇ g/kg/min) and OXM-Q3E (-16 ⁇ g/kg/min) were infused intravenously during the last 60 minutes of the study.
  • the venous catheter was used for infusion, and blood samples were collected from the tail vein. Each animal was monitored for food intake and weight gain after surgery to ensure complete recovery.
  • Hyperglycemic clamps were performed in conscious, unrestrained, catheterized mice as previously described (Pocai et al., Nature. 43: 1026-31 , (2005)). Briefly, plasma glucose was measured by OneTouch giucometer every 10 minutes during the 2 hour period. Twenty-five percent glucose (D-glucose, Sigma) was infused i.v. and the rate was adjusted periodically to clamp the plasma glucose levels (-20 mM).
  • OXM 16 ⁇ g/kg/min
  • OXM-Q3E 16 ⁇ g/kg/min
  • vehicle sterile saline
  • EXAMPLE 8 Native OXM has an in vivo half-life (ty 2 ) of about 8 to 12 minutes in humans, unsuitable for sustained pharmacological therapy. Therefore, we investigated the addition of bulky substituents to the peptide to reduce renal clearance. Various molecular weight PEG moieties or N-ethyl maleimide were conjugated to the
  • OXM peptide at various locations throughout the molecule, by conjugation to the side chain of an introduced cysteine residue. Positions that were investigated for conjugation with either Cys- N -ethyl malemide or a Cys-PEG moiety are underlined in the following amino acid sequence for OXM (SEQ ID NO: 1 ) or placed at the C-terminus of the OXM,
  • Figure 5 A shows ex vivo measurement of glycogenosis in perfused liver in the presence of OXM70, OXMl 10, OXM177, OXMl 15, and OXM216.
  • Figure 5B shows GGCR occupancy following subcutaneous (s.c.) or intravenous (i.v.) administration of the OXM70, OXMl 10, OXM177, OXMl 15, and OXM216 compared to native OXM in a competition assay in wild-type mice, EXAMPLE 10
  • Figure 7 summarizes the acute in vivo efficacy of OXMl 10 and OXMl 77 on reducing food intake and body weight in established DIO mice.
  • Figure 8 summarizes the acute in vivo efficacy of OXM216, OXMl 15, and OXM177 on reducing food intake and body weight in established DIO mice.
  • OXMl 15 analog confers a metabolic rate
  • a chronic study was performed, with a single injection of OXMl 15.
  • Male B6 DIO mice (average starting body weight 55 g) were acclimated to metabolic rate chambers without food at thermoneutrality (T 29°C). A three hour period from 6:00 to 9:00 am was used to calculate resting metabolic rate. Three hours into the light phase (9:00 am), vehicle (dH ⁇ O), OXMl 15 at 3 or 10 mg/kg was administered subcutaneously.
  • the total cycle time was set for 20 minutes, consisting of a reference reading with a 70 second settling time and a 10 second measure period as well as 60 second settle time and 10 second measure time for each of the 16 cages.
  • FIG. 14A and B show that administration of OXMl 15 dose dependently increased the acute metabolic rate in DIO mice.
  • Figure 15 summarizes the acute in vivo efficacy of OXM303, OXM304, and OXM305 on reducing food intake and body weight in established DIO mice and shows OXM305 as being particularly efficacious at reducing food intake and reducing body weight.
  • Ad libitum fed, DIO male C57BL/6 mice (about 50 g each) were weighed and dosed s.c. with either vehicle (water) or
  • OXM401 on reducing food intake and body weight in established DIO mice.
  • OXM401 is a 0/+ control peptide having the sequence HAibEGTFTSDYSKYLDSRRAQDFVQWLmNTK- ⁇ E ⁇ E-
  • Established DIO mice ( ⁇ 52g each) were dosed sc with vehicle (30%HBC) or peptide 1 mg/kg about 30 minutes prior to the onset of the dark phase. Food intake and body weight changes were measured over a four day time period (* P ⁇ 0.05 vs. vehicle, n - 5 per group).
  • LAD2 cells 50,000 cells/well, 96-well plate
  • the degranulation of LAD2 cells was determined by quantification of the ⁇ -hexosaminidase released into the supernatants and in cell lysates after hydrolysis of 4-methylumbeIlifeiyl-N-acetyl- ⁇ -D- glucosaminide. Results are expressed as percentage of ⁇ -hexosaminidase release, calculated as percent of total content.
  • Table 1 summarizes the degranulation potency (EC 50 ) of OXM analogues in LAD2 cells. The results suggest that to reduce the likelihood of stimulating degranulation of mast cells, the pi for Hpidated based analogues should be around 5.
  • This example presents tables showing the in vitro potencies of various peptide analogs at the human GLP-I receptor (hGLP-lR) and the human glucagon receptor (hGCGR).
  • the in vitro potencies shown in Tabie 10 or Table 11 were determined from the results of assays that were similar to either the cell-based cAMP assays described herein above (Table 10) or the cell-based cAMP assays described in International Published Application No. WO2008101017, which is incorporated herein in its entirety, in particular the cell-based cAMP assays described therein (Table 11).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Diabetes (AREA)
  • Endocrinology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Hematology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Obesity (AREA)
  • Child & Adolescent Psychology (AREA)
  • Emergency Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Physical Water Treatments (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

Peptide analogs of oxyntomodulin (OXM, glucagon-37), which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-1/glucagon receptor (GCGR) agonist, are described. The peptide analogs are useful for treatment of metabolic disorders such as diabetes and obesity.

Description

TITLE OF THE INVENTION OXYNTOMODULIN ANALOGS
CROSS-REFERENCE TO RELATED APPLICATIONS This application is a continuation-in-part of International Patent Application No.
PCT/US2009/034448 filed 19 February 2009, the content of which is incorporated herein in its entirety,
BACKGROUND OF THE INVENTION ( 1 ) Field of the Invention
The present invention relates to peptide analogs of oxyntomodulin (OXM, glucagon- 37), which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-I /glucagon receptor (GCGR) agonist, and the use of such peptide analogs for treatment of metabolic disorders such as diabetes and obesity.
(2) Description of Related Art
The hormone oxyntomodulin (OXM, glucagon-37) is a posttranslational product of preproglucagon processing in the intestine and central nervous system (CNS) and is secreted from L-cells in the gut in response to food intake. Discovered in 1983, OXM has been implicated in the regulation of food intake and energy expenditure (Jarrouse et ah, Endocrinol. 115: 102-105 (1984); Schjoldager et al., Eur. J. Clin. Invest., 18: 499-503 (1988)). Central or peripheral administration of OXM in rats causes a decrease in short term food intake with minimal effects on gastric emptying (Dakin et al. Endocrinology, 142; 4244-4250 (2001), Dakin et al. Endocrinology, 145: 2687-2695 (2004)). Repeated intracerebroventricular administration of OXM in rats results in elevated core temperatures and reduced weight gain compared to pair- fed animals, suggesting effects on both caloric intake and energy expenditure (Dakin et al. Am. J.Physiol. Endocrinol. Metab., 283: E1173-E1177 (2002)).
In related studies, peripheral administration of OXM dose-dependently inhibited both fast-induced and dark phase food intake, but unlike GLP-I , had no effect on gastric emptying, OXM also reduced levels of fasting ghrelin and increased c-fos immunoreactivity, in the arcuate nucleus (ARC). Repeated seven-day IP administration of OXM caused a reduction in the rate of body weight gain and adiposity in rats {See Dakin et al. Endocrinology, 145: 2687-2695 (2004)). Studies of OXM action in mice have demonstrated that although OXM can activate both the glucagon and GLP-I receptors, the anorectic actions of OXM require only the GLP-I receptor, as icv OXM inhibits food intake in glucagon receptor knockout mice. However, the anorectic effects of OXM are completely absent in GLP-I receptor knockout mice. Furthermore, exendin-4, but not OXM, regulates energy expenditure in mice. Hence, OXM appears to be a weak agonist at the GLP-I receptor, when used in pharmacological concentrations (See Baggio et a!., Gastroenterol. 127: 546-58 (2004)). OXM was also found to ameliorate glucose intolerance in mice fed a high fat diet (Dakin et al, Am. J. Physiol. Endocrinol, Metab. 294: E142-E147 (2008) and increase the intrinsic heart rate in mice independent of the GLP-I receptor (Sowden et al, Am. J. Physiol. Regul. Integr. Comp. Physiol. 292: R962-R970 (2007). OXM has also been shown to differentially affect GLP-I receptor beta-arrestin recruitment and signaling through Galpha (Jorgensen et al, J. Pharma. Exp. Therapeut. 322: 148-154 (2007)) and to differentially affect hypothalamic neuronal activation following peripheral injection of OXM (Choudhri et al, Biochem. Biophys. Res. Commun. 350: 298-306 (2006)).
In humans, a single 90 minute intravenous infusion of OXM in normal weight healthy subjects reduced hunger scores and food intake at a buffet meal by about 19%. Cumulative twelve-hour caloric intake was reduced by about 1 1% with no reports of nausea or changes in food payability (Cohen et al., J. CHn. Endocrinol. Metab., 88: 4696-4701 (2003); Lykkegaard et al., ADA Scientific Sessions, Abstract #1506-P (2003)). More recently, pre-prandial injections of OXM over a four-week period in obese healthy volunteers (BMI about 33) led to a significant reduction of caloric intake on the first day of treatment (about 25%) that was maintained over the course of the study (35% reduction after four weeks) (Wynne et al, Diabetes 54: 2390-2395 (2005)). Robust weight loss was observed at the end of the study in treated subjects (1.9%, placebo-corrected). Plasma levels of OXM were similar to that observed in the infusion study (peak concentration about 950 pM). The absence of any tachyphylaxis and a low incidence of mild and transient nausea (about 3%) despite the relatively high doses necessitated by the poor in vivo stability of OXM (plasma tjβ < 12 minutes) renders this hormone one of the few obesity targets with both human validation and an attractive tolerability profile. OXM has a very short half-life and is rapidly inactivated by the cell surface dipeptidyl peptidase IV (DPP-IV) (Zhu et al, J. Biol. Chem. 278: 22418-22423 (2002). However, DPP-IV inhibitors are weight-neutral in the clinic, suggesting that supraphysiological levels of OXM (900-1000 pM) may be required to achieve weight loss in humans. OXM peptide analogs for inducing weight loss in humans has been the object of Published International Application Nos. WO03/022304, WO2004/062685, and WO2006/134340.
OXM therefore shows potential as a treatment for metabolic disorders such as diabetes and obesity. However, because of the poor in vivo stability of OXM, there exists a need to develop OXM analogs that can be safely and efficaciously administered for the treatment of metabolic diseases, such as diabetes and obesity. It would be further desirable if analogs or derivatives were developed that were modified by conjugation to moieties that would improve stability and pharmacokinetics, more particularly modifications that confer resistance to DPP-IV cleavage. It would further be desirable to provide OXM analogs that are capable of acting as dual GLP-I receptør/glucagon receptor agonists.
BRIEF SUMMARY OF THE INVENTION The present invention provides oxyntomodulin (OXM, glucagon-37) peptide analogs, which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-I /glucagon receptor (GCGR) agonist, and the use of such peptide analogs for treatment of metabolic disorders such as diabetes and obesity, In particular, the analogs disclosed herein reduce food intake and body weight, increase metabolic rate, mediate glucose- dependent insulin secretion (GDIS) from pancreatic islets and improve glucose tolerance, thereby providing a treatment option for individuals afflicted with a metabolic disorder such as metabolic syndrome, obesity, diabetes, metabolic syndrome X, hyperglycemia, impaired fasting glucose, dyslipidemia, atherosclerosis, and other prediabetic states. Therefore, the present invention provides a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N -terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide is capable of acting as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof. In further aspects, the amino acid substituted for the second amino acid from the N-terminus is selected from the group consisting of D-serine and α- aminoisobutyric acid.
Further provided is a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N- terminus is substituted with an amino acid selected from the group consisting of D-serine and α- aminoisobutyric acid; the C-terminus of the peptide includes a cysteine residue in which the thiol group of the cysteine residue is covalently linked to a cholesterol moiety by a hydrophilic linker; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP- 1 receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof. Further provided is a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N- terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 17, 18, and 27; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof. In further aspects, the one or more amino acid substitutions selected from the group consisting of glutamic acid for the arginine at position 17, alanine for the arginine at position 18, norleucine or O-methyl-L-homoserine for the methionine at position 27.
Further provided is a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N- terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; the peptide lacks the amino acid sequence RNRNNIA (SEQ ID NO: 104); and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof,
In further aspects, the amino acid substitution at position 2 is an amino acid selected from the group consisting of D-serine and α-aminoisobutyric acid and the cholesterol moiety is covalently linked to the thiol group of a cysteine by a hydrophilic linker and the cysteine residue is covalently linked to the C-terminus of the peptide by a peptide bond. In further aspects, the peptide further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 17, 18, and 27. In further aspects, the peptide further includes one or more amino acid substitutions selected from the group consisting of arginine at position 17 to glutamic acid, arginine at position 18 to alanine, methionine at position 27 to norleucine or O-methyl-L-homoserine.
In further aspects of any one of the above peptides, the peptide includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue at the C-terminus of the peptide. In particular aspects, the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker. The hydrophilic linker can be a peptide or polymer such as an ethoxy polymer that includes one to ten ethoxy units. In further aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units. In other aspects of the peptide, the peptide includes a lipid moiety covalently linked to the ε-amino group of a lysine residue covalently linked to the C-terminus of the peptide, which in particular embodiments is a palmitoyl. In further embodiments, the lysine residue is linked to the C-terminus of the peptide by means of a linker moiety. In particular aspects, the linker moiety includes one or more gamma-glutamic acid residues and in other aspects, the linker moiety is l-amino-4,7,10-tioxa-13-tridecanamine succinimic acid.
Further provided is an OXM peptide analog selected from the peptide analogs presented in Table 1 and Table 2 and the use of one more of the OXM peptide analogs presented in Table 1 and Table 2 in the manufacture of a medicament for the treatment of a metabolic disorder.
Further provided is a peptide analog comprising the structure
Zi-P-Li-Z2 wherein P is a peptide having the amino acid sequence
HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTK (SEQ ID NO; 106)
wherein Xi is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargyl glycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutyl glycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe); X2 is Ser (S) or Lys (K); X3 is Ser (S) or GIu (E); X4 is an arginine (R) or glutamic acid (E) residue; X5 is an arginine (R) or alanine (A) residue; XO is GIn (Q) or Lys (K); X7 is a methionine (M), norleucine
(NIe), methionine sulfoxide (m), or O-methyl-L-homoserine (o) residue;
Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. L] ~Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
In further aspects of the above peptides, Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety. In other embodiments, the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker. In particular aspects, the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units. In further aspects of the above peptides, Z2 is a lysine residue, which in particular embodiments, the ε-amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker. In particular embodiments, the lipid moiety is a palmitoyl.
In further aspects of the above peptides, L] is a linker moiety. In particular aspects, the linker moiety is a hydrophilic linker moiety. In further still aspects, the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino- 4,7,10-tioxa-13-tridecanamine succinirnic acid.
In particular embodiments of the above peptide, the peptide comprises a structure selected from OXM70 (SEQ ID NO:12);OXM110 (SEQ ID NO: 19); OXMl 15 (SEQ ID NO:21); OXMl 77 (SEQ ID NO:24); OXM212 (SEQ ID NO;27); OXM213 (SEQ ID NO;28); OXM216 (SEQ ID NO:29); OXM290 (SEQ ID NO:4ό); OXM301 (SEQ ID N0:51); or OXM325 (SEQ ID NO:65). In further particular embodiments of the above peptide, the peptide comprises a structure selected from OXM237 (SEQ ID NO:31); OXM238 (SEQ ID NO:32); OXM259 (SEQ ID NO:33); OXM260 (SEQ ID NO:34); OXM261 (SEQ ID NO:35); OXM262 (SEQ ID NO:36); OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OXM265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44); and OXM308 (SEQ ID NO:45).
In particular embodiments of the above peptide when the peptide lacks RNRNNIA (SEQ ID NO: 104), the peptide comprises a structure selected from OXM291 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO:52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:54); OXM305 (SEQ ID NO:55); 0XM31 1 (SEQ ID NO:56); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO:58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:όl); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66); or OXM329 (SEQ ID NO:67).
In further particular embodiments when the peptide lacks RNRNNIA (SEQ ID NO: 104), the peptide comprises the structure selected from OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM407 (SEQ ID NO:88); OXM408 (SEQ ID NO: 89); OXM410 (SEQ ID NO:91); OXM411 (SEQ ID NO:92); OXM412 (SEQ ID NO:93); OXM414 (SEQ ID NO:95); OXM415 (SEQ ID NO:96); OXM416 (SEQ ID NO:97; OXM417 (SEQ ID NO:98); OXM418 (SEQ ID NO:99; OXM419 (SEQ ID NO: 100; OXM420 (SEQ ID NO:101); or OXM421 (SEQ ID NO: 102).
Further provided is a peptide analog comprising the structure
Z1-P-L1-Z2 wherein P is a peptide having the amino acid sequence
HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTK (SEQ ID NO: 106)
wherein Xi is a D~serine, α-aminoisobutyric acid (aϊb), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha- aminobutyric acid (D- Abu); Amino valeric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe); X2 is Ser (S) or Lys (K); X3 is Ser (S) or GIu (E); X4 is an arginine (R) or glutamic acid (E) residue; X5 is an arginine (R) or alanine (A) residue; Xg is GIn (Q) or Lys (K); X7 is a methionine (M), norleucine
(NIe), methionine sulfoxide (m), or O-methyl-L-homoserine (o) residue;
Zi is an optionally present protecting group that, if present, is joined to the N~terminal amino group, Li is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. L3.-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P. In further aspects of the above peptides, Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety. In other embodiments, the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker. In particular aspects, the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
In further aspects of the above peptides, Z2 is a lysine residue, which in particular embodiments, the ε-amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker. In particular embodiments, the lipid moiety is a palmitoyl,
In further aspects of the above peptides, Li is a linker moiety. In particular aspects, the linker moiety is a hydrophilic linker moiety. In further still aspects, the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino- 4,7,10-tioxa-13-tridecanamine succinimic acid.
In particular embodiments of the above peptide, the peptide comprises a structure selected from OXM291 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO.52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:S4); OXM305 (SEQ ID NO:55); OXM311 (SEQ ID NO:5ό); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO; 58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO.64); OXM327 (SEQ ID NO:6ό); or OXM329 (SEQ ID NO:67).
In further particular embodiments, the peptide comprises the structure selected from OXM345 (SEQ ID NO:ό9); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO;74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:8ό); OXM406 (SEQ ID NO:87); OXM407 (SEQ ID NO:88); OXM408 (SEQ ID NO:89); OXM410 (SEQ ID NO:91); 0XM411 (SEQ ID NO:92); OXM412 (SEQ ID NO:93); OXM414 (SEQ ID NO:95); OXM415 (SEQ ID NO:96); OXM416 (SEQ ID NO:97; OXM417 (SEQ ID NO:98); OXM418 (SEQ ID NO:99; OXM419 (SEQ ID NO:100; OXM420 (SEQ ID NO: 101); or OXM421 (SEQ ID NO: 102). Further provided is a peptide analog comprising the structure
Zi-P-Li-Z2 wherein P is a peptide having the amino acid sequence
HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTKRNRNNIA (SEQ ID
NO: 107)
wherein Xj is a D-serine, α-aminoisobutyric acid (aib)., 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D- Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutyl glycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe); X2 is Ser (S) or Lys (K); X3 is Ser (S) or GIu (E); X4 is an arginine (R) or glutamic acid (E) residue; X5 is an arginine (R) or alanine (A) residue; Xg is GIn (Q) or Lys (K); X7 is a methionine (M), norleucine
(NIe), methionine sulfoxide (m), or O-methyl-L-homoserine (o) residue; Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Lj is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P. ϊn further aspects of the above peptides, Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety. In other embodiments, the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker. In particular aspects, the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
In further aspects of the above peptides, Z2 is a lysine residue, which in particular embodiments, the ε-amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker. In particular embodiments, the lipid moiety is a palmitoyl.
In further aspects of the above peptides, L] is a linker moiety. In particular aspects, the linker moiety is a hydrophilic linker moiety. In further still aspects, the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino-
4,7,10-tioxa-13-tridecanamine succinimic acid.
In particular embodiments of the above peptide, the peptide comprises a structure selected from OXM290 (SEQ ID NO:46); OXM301 (SEQ ID NO:51); OXM321 (SEQ ID
NO:ό3); OXM325 (SEQ ID NO:65); or OXM330 (SEQ ID NO:68), In further particular embodiments of the above peptide, the peptide comprises a structure selected from OXM70 (SEQ ID NO:12);OXM110 (SEQ ID NO: 19); OXM1 Ϊ5 (SEQ
ID NO:21); OXM177 (SEQ ID NO;24); OXM212 (SEQ ID NO:27); OXM213 (SEQ ID NO:28); or OXM216 (SEQ ID NO:29)..
In further particular embodiments of the above peptide, the peptide comprises a structure selected from OXM237 (SEQ ID NO:31); OXM238 (SEQ ID NO:32); OXM259 (SEQ
ID NO.-33); OXM260 (SEQ ID NO:34); OXM261 (SEQ ID NO;35); OXM262 (SEQ ID NO:3ό);
OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OX3VI265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44); and OXM308 (SEQ ID NO:45).
Further provided are peptide analogs that are a dual GLP-I /glucagon receptor (GCGR) agonist and have a pi of less than 6,0. Peptide analogs comprising a cholesterol or fatty acid moiety and have a pi of less than 6 have been found to have a reduced capacity for stimulating mast cell degranulation as determined by a in vitro counterscreening assay using the human mast cell line LAD2, Therefore, further provided is a peptide analog comprising the amino acid sequence HSQGTFTSD YSKYLDSRRAQDFVQWLMNTK (SEQ ID NO: 109) in which the second amino acid from the TV-terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide analog has a pi of less than 6,0 and is a dual GLP-I receptor agonist and glucagon receptor agonist, and pharmaceutically acceptable salts thereof. In particular aspects, peptide analogs have a pi between 4 and 6, or a pi of about 5.0, for example, a pi of about 5.4,
In further aspects, the amino acid substituted for the second amino acid from the iV-terminus of the peptide analog is selected from the group consisting of D-serine, α- aminoisobutyric acid, and 1 -amino- 1 -cyclobutane carboxylic acid.
In particular aspects, the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalently linked to the ε-amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues, In a further embodiment, the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker, which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
In particular aspects, the peptide analog includes a lipid moiety covalently linked to the ε-amino group of a lysine residue: in particular embodiments the lipid moiety is a fatty acid such as a palmitoyl, rnyristoyl, or stearoyl moiety. In a further embodiment, the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ε-amino group of the lysine residue at the C-terminus by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma-glutamic acid residues. In further aspects,the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27, In particular embodiments, the peptide analog includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or α-aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the arginiπe at position 18, lysine for the glutamine at position 20, and norleucine or O-methyl-L-homoserine for the methionine at position 27.
In a further embodiment, the tyrosine at position 10 in the peptide analog is replaced with a lysine and the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues, hi another embodiment, the glutamine at position 20 in the peptide analog is replaced with lysine and the lipid moiety is covalently linked to the ε-amino group of the lysine by one or more gamma-glutamic acid residues. In either embodiment, the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus,
Further provided is a peptide analog comprising the structure
Z]-P-M-Z2 wherein P is a peptide having the amino acid sequence
HXiQGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTKX9X10 (SEQ ID
NO: 1 10)
wherein Xi is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl~ propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe) residue; X2 is a tyrosine (Y) or lysine (K) residue; X3 is serine (S) or lysine (K) residue; X4 is serine (S), α- aminoisobutyric acid (aib), or glutamic acid (E) residue; X5 is an arginine (R) or glutamic acid (E) residue; Xg is an arginirie (R) or alanine (A) residue; X7 is a glutamine (Q) or lysine (K) residue; Xg is a methionine (M), norleucine (NIe), methionine sulfoxide (m), or O-methyl-L- homoserine (o) residue; X9 is a gamma glutamic acid (γGlu) residue; Xio is a gamma glutamic acid (γGlu) residue or absent; Z\ is an optionally present protecting group that, if present, is joined to the /V-terminal amino group, M is (i) a cysteine residue covalently linked to a cholesterol moiety by a hydrophilic linker, (ii) a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues, or (iii) a lipid moiety, wherein M is covalently linked to C-terminal or internal amino acid of P by a spacer comprising one or more gamma-glutamic acid residues; and Z2 is an optionally present protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof, wherein the peptide analog or salt thereof has a pi of less than 6,0 and is a dual GLP-I receptor agonist and glucagon receptor agonist. In particular aspects, peptide analogs have a pi between 4 and 6, or a pi of about 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, or 5.9, or a pi of about 5.4 to 5.5.
In further aspects of the peptide analog, M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C- terminus of P. In further embodiments, the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units, which in particular aspects can include for example, four ethoxy units.
In further aspects, M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P or M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position X2 or
X7 of P. In particular aspects, the lipid moiety is a palmitoyl, myristoyl, or stearoyl moiety.
In particular aspects, the peptide analog is OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66); or OXM329 (SEQ ID NO;67). In further aspects, the peptide analog is OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO: 80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO: 83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO: 85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM407 (SEQ ID NO:88); OXM408 (SEQ ID NO:89); OXM410 (SEQ ID NO:91); 0XM411 (SEQ ID NO:92); OXM412 (SEQ ID NO:93); OXM414 (SEQ ID NO:95); OXM415 (SEQ ID NO:96); OXM416 (SEQ ID NO;97; OXM417 (SEQ ID NO:98); OXM418 (SEQ ID NO:99; OXM419 (SEQ ID NO: 100; OXM420 (SEQ ID NO:101); or OXM421 (SEQ ID NO: 102).
Further provided is the use of any one of the aforementioned peptides and pharmaceutically acceptable salts thereof, in the manufacture of a medicament for the treatment of a metabolic disorder.
Definitions A GLP-I agonist is a peptide, small molecule, or chemical compound that binds to the GLP-I receptor and stimulates the same biological activity as does GLP-I . In one embodiment, an agonist for the GLP-I receptor binds to the receptor with at least 1% of the affinity as native GLP-I, In another embodiment, an agonist for the GLP-I receptor binds to the receptor with an equal or greater affinity than native GLP-I .
A glucagon agonist is a peptide, small molecule, or chemical compound that binds to the glucagon receptor and stimulates the same biological activity as does glucagon. In one embodiment, an agonist for the glucagon receptor binds to the receptor with at least 1% of the affinity as native glucagon. In another embodiment, an agonist for the glucagon receptor binds to the receptor with an equal or greater affinity than native glucagon.
As used herein a "dual GLPl /glucagon receptor agonist" is "GLPl receptor/glucagon receptor co-agonist molecule", which exhibit activity at both the glucagon receptor and the GLPl receptor. In general, a dual GLPl receptor agonist and glucagon receptor agonist exhibits activity at the glucagon receptor of at least about 10% relative to native glucagon and also exhibits activity at the GLP-I receptor of at least about 10% relative to native GLP-I .
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 shows the results of an ex vivo assay comparing glycogenolysis of native OXM to OXM(Q3E), The Figure shows that native OXM induces glycogenolysis in a dose dependent fashion and induces full glycogenolysis at 1.5 nM and has an approximate EC50 of 0.5 nM whereas OXM-Q3E induced only about 58% at 300 nM, consistent with its poor GCGR agonist potency.
Figure 2 shows the results of an in vivo GCG Receptor occupancy experiment showing that glucagon (GCG) at 1.5 mpk gave 84% GCGR occupancy and 3 mpk OXM gave 31% GCGR occupancy but that OXM-Q3E gave 0% GCGR occupancy.
Figures 3A and 3B show the blood glucose levels and glucose infusion rates, respectively, in response to OXM and OXM-Q3E.
Figure 4 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous (s.c.) administration of OXM and OXM-Q3E, Figure 5A shows ex vivo measurement of glycogenolysis in perfused liver in the presence of OXM70, OXMl 10, OXM177, OXMl 15, and OXM216.
Figure 5B shows GGCR occupancy following subcutaneous (s.c.) or intravenous (i.v.) administration of the OXM70, OXMl 10, OXM177, OXMl 15, and OXM2I6 compared to native OXM in a competition assay in wild-type mice. Figure 6 summarizes the acute in vivo efficacy of OXM70 on reducing food intake and body weight in established DIO mice. Food intake was measured about two hours and 18 hours later. Body weight changes at 18 hours (overnight) were also measured *P < 0.05 vs. vehicle, n = 5-6 per group).
Figure 7 summarizes the acute in vivo efficacy of OXMl 10 and OXM 177 on reducing food intake and body weight in established DIO mice. Food intake was measured about two hours and 18 hours later. Body weight changes at 18 hours (overnight) were also measured *P < 0.05 vs. vehicle, n = 5-6 per group).
Figure 8 summarizes the acute in vivo efficacy of OXM216, OXMl 15, and OXMl 77 on reducing food intake and body weight in established DIO mice. Food intake was measured about two hours and 18 hours later. Body weight changes at 18 hours (overnight) were also measured *P < 0.05 vs. vehicle, n = 5-6 per group).
Figures 9A-D shows the pharmacological end points of a chronic body weight and food intake study in DIO mice for OXM peptide analogs OXMl 10, OXM177, and OXMl 15. Figure 9 A shows the cumulative change in food intake. Figure 9B shows the cumulative change in body weight. Figure 9C shows basal glucose levels over several days of the study. Figure 9D shows IPGTT assay on day 13 of the study.
Figure 10 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM70.
Figure 11 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXMl 10. Figure 12 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM 177.
Figure 13 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXMl 15.
Figure 14A shows the metabolic rate effects of OXMl 15 in DIO Mice over lime. Figure 14B shows the percent change in metabolic rate caused by OXMl 15 in the DIO
Mice.
Figure 15 summarizes the acute in vivo efficacy of several +/+ peptides on reducing food intake and body weight in established DIO mice.
Figure 16 shows single dose of several +/+ peptides on food intake on reducing food intake and body weight in established DIO mice.
DETAILED DESCRIPTION OF THE INVENTION
OXM-based therapy has the potential to favorably impact both obesity and, the as yet to be carefully characterized, concomitant effects on improving diabetes. Weight loss efficacy and reduction in food intake upon peripheral administration of OXM has been well validated in humans (Wynne et al., Diabetes 54: 2390-2395 (2005)). More recently, OXM has been shown to increase metabolic rate and specifically activity-related energy expenditure in obese subjects (Wynne et al, Int. J. Obes. 30: 1729-1736 (2006), advance online publication, April 18, 2006; doi: 10.1038/sj.ijo.0803344). OXM has also been shown to reduce body weight in humans {See,, for example, Published International Application Nos. WO03/022304, WO2004/062685, and WO2006/134340); however, the effects of the OXM peptide and similar dual GLP-I receptor/glucagon receptor (GLP-I R/GCGR) agonists on the glycemic control independent of weight loss have not been systematically studied. The ability of OXM to have agonist activity at both the glucagon receptor and the GLP-I receptor makes it an attractive candidate for treating metabolic diseases where it is desirable that the treatment positively interact with the glucagon and GLP-I receptors. OXM (and GLP- 1 ) has a very short half-life and is rapidly inactivated by the cell surface dipeptidyl peptidase IV (DPP-IV). Mutations can be incorporated into the OXM peptide to render the peptide resistant to DPP-IV cleavage; however, many of these mutations have also been found to inactivate the native peptide or adversely affect the ability of the peptide to interact with the glucagon receptor (GCGR) or GLP-I receptor (GLP-IR) {See Published International Application No. WO2007/100535, which is incorporated herein in its entirety). OXM (and GLP- 1) is also rapidly cleared by the kidneys. Conjugation of peptides with bulky substituents such as polyethylene glycol can reduce renal clearance of the peptide; however, when these bulky substituents have been incorporated into the OXM peptide, many of resulting OXM peptide analogs have been found to have a reduced ability or no ability to effectively interact with the glucagon receptor. Before effective therapies for metabolic diseases based on administering OXM peptides can be advanced, the problems associated with stability and pharmacokinetics need to be solved.
The OXM peptide analogs disclosed herein solve these problems.
First, the limited in vivo stability of native OXM and GLP-I due to cleavage by DPP-IV and rapid renal clearance, which necessitates frequent dosing (t.i.d. s.c. injections for OXM, continuous infusion for GLP-I) at high doses in humans has been solved by mutating the site of DPP-IV cleavage (the penultimate residue at the N-terminus) and lipidating the OXM peptide to increase in vivo half-life (t]V2). It is anticipated that the tj/2 of the lipidated (such as acylated or conjugated with a cholesterol moiety) OXM peptide analogs in humans will be suitable for at least once daily administration. The OXM peptide analogs disclosed herein are more convenient for therapeutic purposes than native OXM, which requires t.i.d. dosing. Second, the tolerability profile of polypeptides of the current invention is anticipated to be similar to that of native OXM in humans, which may be superior to that of conventional GLP-I minietics like exenatide and liraglutide. The chronic efficacy of the OXM analogs disclosed herein may therefore be better than conventional GLP-I mimetics, such as Byetta® (Amylin
Pharmaceuticals), due to minimal nausea and vomiting, which have typically been dose limiting for the GLP-I mimetics. Unlike the latter, no dose-titrations to mitigate nausea may be required for polypeptides of this invention.
Third, no systematic studies have been performed to evaluate the potential for improving glucose control. Since OXM is potent agonist of the glucagon receptor, the expectation would be that chronic administration would lead to impaired glucose control
(hyperglycemia). However, unexpectedly, the OXM analogs disclosed herein, which incorporate a balanced GLP-I receptor and GCGR co-agonism, gives enhanced reductions in food intake and body weight with chronic administration and results in improved glucose tolerance. OXM peptide analogs that have dual GLP-I receptor (GLP-IR) and glucagon receptor (GCGR) agonist activity are indicated herein as (+/+). OXM peptide analogs that are GLP-I agonists only are indicated herein as (+/O).
To produce a long acting OXM peptide analogs has not been straight forward. Our initial studies focused on site-specific conjugation of a bulky poly-ethyl ene glycol (PEG) substituenl at promising locations throughout the peptide. Surprisingly, addition of PEG at all positions tested resulted in a significant reduction in GCGR and/or GLP-IR potency. We therefore investigated other methods to improve pharmaco kinetic properties, whilst maintaining GCGR activity. Addition of a cholesterol conjugate to various positions in the peptide indicated C-terminal conjugation as the most favorable method. In vitro and in vivo studies, however, indicated that the cholesteroylation resulted in a significant serum shift of potency and decreased in vivo efficacy. Therefore, further investigation resulted in the non-trivial inclusion of a hydrophilic linker between the peptide and cholesterol group, or direct addition of an acyl-chain to a C-terminal residue.
Primary indications in which the OXM analogs disclosed herein can be used for is the treatment of obesity and/or diabetes. Secondary indications are metabolic syndrome, hyperglycemia, impaired fasting glucose, and other prediabetic states. Further indications include all indications for GLP-I such as irritable bowel syndrome and other absorptive diseases of the gut, ischemia, stroke, and neurological disorders including anxiety, impaired cognition, and Alzheimer's disease.
Based on published human studies with OXM, the OXM analogs disclosed herein are anticipated to exhibit at least comparable if not superior efficacy and a better safety profile than current anti-obesity agents such as orlistat (Xenical® (Roche), a lipase inhibitor) and sibutramine (Meridia® (Abbott Laboratories), a seratonin/norepinephrine re-uptake inhibitor), for which GI intolerance (diarrhea, flatulence) and hypertension are common side effects, respectively,
In particular aspects, the OXM peptide analogs optionally includes a protecting group covalently joined to the N-terminal amino group. A protecting group covalently joined to the N- terminal amino group of the peptide reduces the reactivity of the amino terminus under in vivo conditions. Amino protecting groups include -Ci_io alkyl, -Cμio substituted alkyl, -C2-10 alkenyl, -C2.10 substituted alkenyl, aryl, -C\-β alkyl aryl, -C(O)-(CH2)i-6~COOH, -C(O)-Ci .g alkyl, -C(O)-aryI, -C(O)-O-Ci .5 alkyl, or -C(O)-O-aryl. In particular embodiments, the amino terminus protecting group is selected from the group consisting of acetyl, propyl, succinyl, benzyl, benzyloxycarbonyl, and t-butyloxycarbonyl. Deamination of the N-terminal amino acid is another modification that is contemplated for reducing the reactivity of the amino terminus under in vivo conditions.
The OXM peptide analogs may be modified to have a protecting group covalently joined to the C-terminal carboxy group, which reduces the reactivity of the carboxy terminus under in vivo conditions. For example, carboxylic acid groups of the peptide, whether carboxyl- terminal or side chain, may be provided in the form of a salt of a pharmacologically-acceptable cation or esterified to form a C\. g ester, or converted to an amide of formula NRR2 wherein R and R2 are each independently H or Ci -6 alkyl, or combined to form a heterocyclic ring, such as a 5 -or 6-membered ring. The carboxy terminus protecting group is preferably attached to the α- carbonyl group of the last amino acid. Carboxy terminus protecting groups include, but are not limited to, amide, Diethylamide, and ethylamide. Amino groups of the peptide, whether N- terminal or side chain, may be in the form of a pharmacologically-acceptable acid addition salt, such as the HCl, HBr, acetic, benzoic, toluene sulfonic, maleic, tartaric, and other organic salts, or may be modified to Ci -6 alkyl or dialkyl amino or further converted to an amide.
The OXM peptide analogs that are capable of acting as dual GLP-I and glucagon agonists comprise the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N-terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; a lipid or cholesterol moiety covalently linked to the OXM peptide analog; optionally one to three amino acid substitutions in addition to the substitution at position 2; and optionally has a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide, In further embodiments, the peptide analogs further lack the amino acid sequence RNRNNIA (SEQ ID NO: 104). In general, OXM peptide analogs having the above structure will act as a dual GLP-I receptor and glucagon receptor agonist and have a serum half-life greater than the serum half-life of native human OXM. In more specific embodiments, the OXM peptide analog can be represented by the structure
Zi-P-Li-Z2 wherein P is a peptide having the amino acid sequence
HX1QGTFTSDYSKYLDSX2X3AQDFVQWLX4NTK (SEQ ID NO: 103) wherein Xi is a D-serine or α-aminoisobutyric acid (aib) residue; X2 is an arginine (R) or glutamic acid (E) residue; X3 is an arginine (R) or alanine (A) residue; X4 is a methionine (M), norleucine (NIe), or O-methyl-L-homoserine (0) residue;
Z\ is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Lj is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked Io a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
In a further embodiment, the OXM peptide analog can be represented by the structure
Zi -P-Li -Z2 wherein P is a peptide having the amino acid sequence
HX1QGTFTSDYSKYLDSX2X3AQDFVQWLX4NTK (SEQ ID NO: 103)
wherein X] is a D-serine or α-aminoisobutyric acid (aib) residue; X2 is an arginine (R) or glutamic acid (E) residue; X3 is an arginine (R) or alanine (A) residue; X4 is a methionine (M), norleucine (NIe), or O-methyl-L-homoserine (o) residue;
Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Li is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. L1-Z2 can be linked to the C- terminal amino acid of P or to an internal amino acid of P.
In a further embodiment, the OXM peptide analog can be represented by the structure
Zi-P-Li-Z2 wherein P is a peptide having the amino acid sequence
HX 1 QGTFTSDYSKYLDSX2X3AQDFVQ WLX4NTKRNRNNIA (SEQ ID
NO: 105) wherein Xi is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid (Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2~cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe); X2 is an arginine (R) or glutamic acid (E) residue; X3 is an arginine (R) or alanine (A) residue; X4 is a methionine
(M), norleucine (NIe), or O-methyl-L-homoserine (o) residue;
Zi is an optionally present protecting group that, if present, is joined to the N-termiiial amino group, Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
In further specific embodiments, the OXM peptide analog can be represented by the structure Z1-P-L1-Z2 wherein P is a peptide having the amino acid sequence
HXi QGTFTSDYSX2 YLDX3X4X5 AX^DFVQWLXyNTK (SEQ ID NO: 106)
wherein Xi is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 - Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 - Amino- 1 -cyclopentane carboxylic acid (Acpe); X2 is Ser (S) or Lys (K); X3 is Ser (S) or GIu (E); X4 is an arginine (R) or glutamic acid (E) residue; X5 is an arginine (R) or alanine (A) residue; Xg is GIn (Q) or Lys (K); X7 is a methionine (M), norleucine
(NIe), methionine sulfoxide (m), or O-methyl-L-homoserine (o) residue;
Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO; 304) or a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
In a further embodiment, the OXM peptide analog can be represented by the structure
Z1-P-Li-Z2 wherein P is a peptide having the amino acid sequence
HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTK (SEQ ID NO: 106)
wherein Xj is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, I-Amino-1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 - Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1-cyclopentane carboxylic acid (Acpe); X2 is Ser (S) or Lys (K); X3 is Ser (S) or GIu (E); X4 is an arginine (R) or glutamic acid (E) residue; X5 is an arginine (R) or alanine (A) residue; Xg is GIn (Q) or Lys (K); X7 is a methionine (M), norleucine (NIe), methionine sulfoxide (m), or O-methyl-L-homoserine (o) residue;
Z] is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L] is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
In a further embodiment, the OXM peptide analog can be represented by the structure Z1-P-L1 -Z2 wherein P is a peptide having the amino acid sequence
HX1QGTFTSDYSX2YLDX3X4X5AX6DFVQWLX7NTKRNRNNIA (SEQ ID NO: 107)
wherein Xi is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 - Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe); X2 is Ser (S) or Lys (K); X3 is Ser (S) or GIu (E); X4 is an arginine (R) or glutamic acid (E) residue; X5 is an arginine (R) or alanine (A) residue; Xe is GIn (Q) or Lys (K); X7 is a methionine (M), norleucine
(NIe), methionine sulfoxide (m), or O-methyl-L-homoserine (o) residue;
Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Lj is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or ∑2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof, I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
In further specific embodiments, the OXM peptide analog can be represented by the structure
Z1-P-L1-Z2 wherein P is a peptide having the amino acid sequence
HXIQGTFTSDX2SXsYLDX4X5XeAX7DFVQWLXgNTKXg (SEQ ID
NO: 108)
wherein Xi is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl- alanine (Cpa); propargylglycine (Prg); AlJylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 - Amino- 1 -cyclopentane carboxylic acid (Acpe); X2 is Tyr or Lys; X3 is Ser (S) or Lys (K); X4 is Ser (S) or GIu (E); X5 is an arginine (R) or glutamic acid (E) residue; Xg is an arginine (R) or alanine (A) residue; X7 is Gin (Q) or Lys (K); Xg is a methionine (M), norleucine (NIe), methionine sulfoxide (m), or O-methyl-L-homoserine (o) residue; X9 is optional but when present is one or more gamma glutamic acid residues.
Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or 2/∑ optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof. I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
In each of the above embodiments, the lipid or cholesterol moiety can be directly or indirectly linked to the side chain of an amino acid. When the lipid or cholesterol moiety is indirectly linked to the amino acid side-chain, the lipid or cholesterol moiety is linked to the amino acid side-chain by means of a linker moiety. In particular aspects, the lipid or cholesterol is directly linked to the side chain of an amino acid which is then linked to the OXM peptide analog by a linker moiety (Li).
In particular embodiments of the OXM analogs disclosed herein, when residues 16 and 20 are GIu and Lys, respectively, the side chains of said residues can participate in a lactam bridge between said GIu and Lys residues. In many embodiments, the linker moiety is a hydrophilic linker. The chemical structure of the linker moiety is not critical, however, since it serves primarily as a spacer. However, in certain embodiments, the linker moiety may itself provide improved properties to the OXM peptide analogs. Examples of linker moieties, include but are not limited to, amino acids and peptides; alkyl linkers such as-NH-(CH2)s-C(O)-, wherein s = 2-20, these alkyl linkers may further be substituted by any non-sterically hindering group such as lower alkyl (for example, C 1-6) lower acyl, halogen (for example, Cl, Br), CN, NH2, phenyl, and the like; an ethoxy polymer that includes one to twelve ethoxy units; Ttds (l-ammo-4,7,10~trioxa~13-tridecanarnine- succinamic acid); and one, two, three, or more gamma glutamic acid residues.
In general, the linker moiety is covalently linked to the C-terminal amino acid of the peptide (P) and Z2 is covalently linked to the linker moiety. In particular aspects, the linker moiety is covalently linked to an internal amino acid of P and Z2 is covalently linked to the linker moiety. In further aspects, when L1-Z2 are covalently linked to an internal amino acid of
P, X9 can include one or more gamma glutamic acid residues.
The OXM peptide analogs include diastereomers as well as their racemic and resolved enantiomerically pure forms. In general, the amino acids are in the L-form with particular amino acids in D-form. As is known in the art, individual amino acids can be represented as follows:
A=Ala=Alanine;
Figure imgf000023_0001
Acid;
F=Phe=PhenylaIanine; G=Gly^Glycine; H=His=Histidine; I=Ile=Isoleucine; K-Lys^Lysine;
Figure imgf000023_0002
R=Arg=Arginine; S=Ser=Serine; T=Thr=Threonine; V=VaI=V aline; W==Trp=Tryptophan; and
Y=Tyr=Tyrosine. Table 1 shows the structures for a representative number of OXM peptide analogs based on the full-length OXM molecule that have activity at both the glucagon receptor and the GLP-I receptor (+/+)• OXM peptide analogs OXM29, 208, 209 and 229 are peptide analogs precursors (thiolated peptides) that were used for the conjugation reaction with the bromo-cholesterol moieties.
Figure imgf000024_0001
Figure imgf000025_0001
Cj = Cys(cholest-5-en-3-yl l-{[(2R)-3-amino-2-(amino)-3-oxoρropyl]thio}-2-oxo-6,9,12,15- tetraoxa-3-azaoctadecan-18-oate) or Cys(Oxa4-cholesterol).
OXM peptide analogs OXM36 and OXMl 15 were prepared from OXM229, which includes the native human OXM peptide but with a D-serine at amino acid position 2 and a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated, OXM36 has the structure
HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC^CONHz (SEQ ID N0:8) wherein C4 is a cysteine residue in which choIest-5-en-3-yl{[(2R)-3-amino-2-(amino)-3- oxopropyl]thio} acetate is covalently linked thereto as shown below.
Figure imgf000026_0001
OXMl 15 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIACγ- CONH2 (SEQ ID N0:21) wherein the C7 is a cholest-5-en-3-yl l-{[(2R)-3-amino-2-(amino)-3- oxopropyl]thio}-2-oxo-6J9,12,15-tetraoxa-3-azaoctadecan-18-oate (or Cys(Oxa4-cholesterol)) as shown below.
Figure imgf000026_0002
C7 differs from C4 in that it has a hydrophilic spacer formed by four ethylene glycol repeats (ethoxy units) between the cholesterol group and the cysteine moiety. The C7 group increases solubility of the resulting peptide-cholesterol conjugate. Moreover, in the presence of serum plasma, the peptide-Cγ conjugate shows a less prominent serum shift than peptide-C4 conjugates. This was found to be important for maintaining an optimal balanced activity on the two receptors GLP-IR and Glucagon receptor. The results shown in the Examples illustrate this aspect.
OXM peptide analogs OXM70 and OXM216 were prepared from OXM29, which includes the native human OXM peptide but with α-aminoisobutyric acid at amino acid position 2 and with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated. OXM70 has the structure HOQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2 (SEQ ID NO: 12) wherein C4 is cholest-5-en-3-yl{[(2R)-3-amino-2-(amino)-3-oxopropyl]thio} acetate as shown for OXM36. OXM216 has the structure
HaQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC7-CONH2 (SEQ ID NO:29) wherein the C7 is a cholest-5-en-3~yl l-{[(2R)-3-amino-2-(amino)-3-oxopropyl]thio}-2-oxo- 6,9,12,15-tetraoxa-3-azaoctadecan-18~oate (or Cys(Oxa4-cholesterol)) as for OXMl 15.
OXM peptide analog OXM212 was prepared from OXM208, which includes the native human OXM peptide but with α-aminoisobutyric acid at amino acid position 2, norleucine in place of the methionine residue at position 27, with a cysteine residue in peptide linkage at the C- terminus and in which the C-terminal carboxy group has been amidated. OXM212 has the structure HαQGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC4-CONH2 (SEQ ID NO:26) wherein C4 is cholest-5-en-3-yl{[(2R)-3-amino-2-(amino)-3-oxopropyl]thio}acetate as shown for OXM36.
OXM peptide analog OXM213 was prepared from OXM209, which includes the native human OXM peptide but with α-aminoisobutyric acid at amino acid position 2, O-methyl-L- homoserine in place of the methionine residue at position 27, with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
OXM213 has the structure HaQGTFTSDYSKYLDSRRAQDFVQWLYNTKRNRNNIAC4-
CONH2 (SEQ ID NO:28) wherein C4 is cholest-5-en-3-yl{[(2R)-3-amino-2-(amino)-3- oxopropyl]thio} acetate as shown for OXM36. OXM237 has the structure
HSQGTFTSDYSICYLDSRRAQDFVQWLmNTKRNRNNIAC7-CONH2 (SEQ ID N0:31). It was designed to contain D-Ser (s) at position 2, Met(O) at position 27, and a Cys(0xa4- cholesterol) (C7) at position site 38.
OXM238 was designed to contain D-Ser (s) at position 2, Met(O) at position 27, and a Cys(acetamide) (C5) at position site 38. This peptide has the same peptide sequence of OXM237 and is a control peptide with no cholesterol but with the cysteine thiol blocked with acetamide. OXM259-OXM268 and OXM306-308 (as shown in Table 1) have the amino acid sequence of OXM but wherein the amino acid at position 2 has been substituted with a non- natural amino acid to identify amino acid substitutions that confer resistance to DPP4 catalytic activity. OXM peptide analogs that lack the amino acid sequence RNRNNIA (SEQ ID NO: 55) can also display full agonistic activity on the GLP-I and the Glucagon receptors. These OXM peptide analogs along with some additional peptides based upon the full-sized OXM peptide are shown in Table 2. These truncated OXM peptide analogs are variants of the Glucagon K (GcgK) genus of peptides that were disclosed in commonly owned International Published Application No. WO2007100535. The GcgK peptides are peptides where the OXM sequence has been truncated at the C terminus to eliminate the seven amino acid residues at the C-terminus. The resulting peptide is that one of glucagon with an extra lysine residue at the C-terminus, This GcgK peptide is compatible with a +/+ pattern in which the peptides show subnanomolar potency on both the GLP-IR and the GCGR. In contrast, native OXM shows nanomolar potency on the two receptors. An additional advantage of the GcgK peptide is that the two basic arginine residues at the C-terminus have been eliminated. This was important in the construction of lipidated (acylated or cholesterylated) peptide analogs having dual GLP-I /GCGR agonist activity. Our data has shown that lipidated peptide analogs with a pi above 7 based on the OXM sequence stimulate mast cell degranulation while lipidated peptide analogs with a pi of about 5 appear not to stimulate mast degranulation (See Example 1 1). Thus based on our results, to reduce the risk of the peptide stimulating mast cell degranualtion, the pi for lipidated based peptide analogs should be around 5. Therefore, in particular aspects the lipidated peptide analogs have a pi less than 6.0. In further aspects, the lipidated peptide analogs have a pi between 4.5 and 6.0. In a further aspect, the lipidated peptide analogs have a pi of about 5.4. Reduction of pi was done using one or more of the following three different strategies: 1) substitution of residues in the peptide, 2) introduction of a carboxylate group at the C terminus, and 3) introduction of negative residues such as one or more gamma-carboxy-glutamic acid residues as spacers.
Therefore, in one aspect of OXM peptide analogs with a pi of less than 6.0, the acyl or cholesterol group is covalently linked to the peptide by means of a spacer that comprises two gamma-carboxy-glutamic acid residues. Examples of these peptide analogs include those peptide analogs shown in Table 2, For example, peptides with a pi of about 5.4 include but are not limited to OXM345, OXM380, OXM381 , OXM392, OXM395, OXM398, OXM399, OXM400, and OXM401. In another aspect of peptide analogs with a pi of less than 6,0, the acyl or cholesterol group is covalently linked to an internal amino acid in the peptide analogs by means of a spacer that comprises one or two gamma-carboxy-glutamic acid residues and the peptide further includes one or more gamma-carboxy-glutamic acid residue covalently to the lysine residue at the C-terminus. Examples of these peptide analogs include but are not limited to OXM407, OXM408, OXM414, and OXM418. In another aspect of peptide analogs with a pi of less than 6.0, the acyl or cholesterol group is covalently linked to the C-terminus of the peptide by means of a spacer that comprises one gamma-carboxy-glutamic acid residue and the peptide further includes one or more amino acid substitutions to reduce the pϊ of the peptide. OXM374 is an example of such a peptide analog.
Therefore, further provided is a peptide analog comprising the amino acid sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO; 109) in which the second amino acid from the TV- terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-lerminal carboxy group of the peptide; wherein the peptide analog has a pi of less than 6.0 and is a dual GLP-I receptor agonist and glucagon receptor agonist, and pharmaceutically acceptable salts thereof. In particular aspects, peptide analogs have a pi between 4 and 6, or a pi of about 5.0, for example, a pi of about 5.4.
In further aspects, the amino acid substituted for the second amino acid from the TV-terminus of the peptide analog is selected from the group consisting of D-serine, α- aminoisobutyric acid, and 1 -amino- 1-cyclobutane carboxylic acid. In particular aspects, the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalently linked to the ε-amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues. In a further embodiment, the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker, which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
In particular aspects, the peptide analog includes a lipid moiety covalently linked to the ε-amino group of a lysine residue: in particular embodiments the lipid moiety is a fatty acid such as a palmitoyl, myristoyl, or stearoyl moiety. In a further embodiment, the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ε-amino group of the lysine residue at the C-terminus by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
In further asρects,the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27. In particular embodiments, the peptide analog includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or a-aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the arginine at position 18, lysine for the glutamine at position 20, and norleucine or Omethyl-L-homoserine for the methionine at position 27.
In a further embodiment, the tyrosine at position 10 in the peptide analog is replaced with a lysine and the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues, In another embodiment, the glutamine at position 20 in the peptide analog is replaced with lysine and the lipid moiety is covalently linked to the ε-amino group of the lysine by one or more gamma-glutamic acid residues. In either embodiment, the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus.
Further provided is a peptide analog comprising the structure
Z1-P-M-Z2 wherein P is a peptide having the amino acid sequence
HXi QGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTK-X9X1o (SEQ ID NO: 110)
wherein X\ is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alplia-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alamne (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe) residue; X2 is a tyrosine (Y) or lysine (K) residue; X3 is serine (S) or lysine (K) residue; X4 is serine (S), α- aminoisobutyric acid (aib), or glutamic acid (E) residue; X5 is an arginine (R) or glutamic acid (E) residue; XO is an arginine (R) or alanine (A) residue; X7 is a glutamine (Q) or lysine (K) residue; X8 is a methionine (M), norleucine (NIe), methionine sulfoxide (m), or O-methyl-L- homoserine (o) residue; X9 is a gamma glutamic acid (γGlu) residue; X] 0 is a gamma glutamic acid (γGlu) residue or absent; Z\ is an optionally present protecting group that, if present, is joined to the JV-terminal amino group, M is (i) a cysteine residue covalently linked to a cholesterol moiety by a hydrophilic linker, (ii) a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues, or (iii) a lipid moiety, wherein M is covalently linked to C-terminal or internal amino acid of P by a spacer comprising one or more gamma-glutamic acid residues; and Z2 is an optionally present protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof, wherein the peptide analog or salt thereof has a pi of less than 6.0 and is a dual GLP-I receptor agonist and glucagon receptor agonist, In particular aspects, peptide analogs have a pi between 4 and 6, or a pi of about 5.0, 5,1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, or 5.9, or a pi of about 5.4 to 5.5.
In further aspects of the peptide analog, M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C- terminus of P. In further embodiments, the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units, which in particular aspects can include for example, four ethoxy units.
In further aspects, M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P or M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position X2 or
X7 of P. In particular aspects, the lipid moiety is a palmitoyl, myristoyl, or stearoyl moiety. Examples of these peptide analogs are shown in Table 2.
Figure imgf000031_0001
Figure imgf000032_0001
Figure imgf000033_0001
thiol with linear methoxyPEG (mPEG) or branched mPEG2mPEG [OnPEG)2] of the indicated
MW;
C7= Cys(cholest-5-en-3-yl 1 - {[{2R)-3-amino-2-(amino)-3-oxopropyl]thio} -2-oxo-6,9, 12,15- tetraoxa-3-azaocladecan~18-oate]) or Cys(Oxa4-cholesteroϊ)
Q- Cys(N-ethylmaleimidyl).
C9 = S- { 1 -[46-(cholest-5-en-3-yloxy)-3 ,43,46-trioxo-7, 10, 13,16,19,22,25,28,31 ,34,37,40- dodecaoxa-4,44-diazahexatetracont-l-yl]-2)5-dioxopy-τolidin-3-yl}-L-cysteine or Cys (mal-oxai2- cholesterol)
Cio - 5-[42-(cholest-5-en-3-yloxy)-2142-dioxo-6,9,12,15,18,21,24,27,30,33,36,39~dodecaoxa-3- azadotetracont-l-yl]-L-cysteine or Cys (oxai2-cholesterol)
Cu = 5-[78-(cholest-5-en-3-yloxy)-2,78-dioxo-
6,9,12,l S,18,21 ,24,27,30,33,36,39,42,45,48>51,54,57,60,63)66,69,72,75-tetraoosaoxa-3- azaoctaheρtacont-l-yl]-L-cysteine or Cys (oxa24-cholesterol)
Cl 2 - 5-[38-(cholest-5-en-3-yloxy)-2-oxo-6,9,12,l 5,18,21, 24,27,30>33,36-undecaoxa-3- azaoctatriacont-l-yl]-L-cysteine or Cys {oxai2-0-cholesterol)
Ttds^ l~amino-4,7,10-trioxa-13~tridecanamine succinimic acid γE= gamma glutamic acid
Peptide OXM290 is the precursor for OXM301 and OXM291 to 294 are precursors for the remainder of the peptide analogs shown in Table 2. OXM301 is an analogue having D-Ser in amino acid position 2 for DPPIV resistance* substitution of GIu and Ala, respectively, for the Argiγ and Argig residues, and a C(Oxa4-cholesterol) group (C7) for improved pharmacokinetic properties in vivo. The substitutions at Argiγ and Argig were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
OXM302 is a peptide analog that lacks the amino acid sequence RNRNMA (SEQ ID NO:96) at the C-terminus (See commonly owned International Published Application No. WO2007/100535, which is incorporated herein in its entirety). Thus, OXM302 is one amino acid longer than the glucagon peptide by one lysine residue at the C-terminus. In OXM302, which has the structure HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKC7-CONH2 (SEQ ID
NO:52) there is a D-Ser in amino acid position 2 for DPPIV resistance and a C(Oxa4-cholesterol) group (C7) for improved pharmacokinetic properties in vivo. OXM303 has the structure HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKC7-
CONH2 (SEQ ID NO: 53). The D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argπ and Argjg residues improves stability and a C(Oxa4-cholesterol) group (C7) improves the peptide analog's pharmacokinetic properties in vivo. OXM304 has the structure HsQGTFTSDYSKYLDSERAQDFVQWLMNTKCv- CONH2 (SEQ ID NO: 54). The D-Ser in position 2 provides DPPIV resistance, substitution of GIu for the Argiγ residue improves stability and a C(Oxa4-choIesterol) group (C7) improves the peptide analog's pharmacokinetic properties in vivo. . OXM305 has the structure HSQGTFTSDYSKYLDSERAQDFVQWLMNTKCT-
CONH2 (SEQ ID NO:55). The D-Ser in position 2 provides DPPIV resistance, substitution of Ala for the Argi 8 residue improves stability and a C(Oxa4-cholesterol) group (C7) improves the peptide analog's pharmacokinetic properties in vivo.
OXM311 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- K(PaϊmitoyI)-CONH2 (SEQ ID NO:56). The D-Ser in amino acid position 2 provides DPPIV resistance and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo,
OXM312 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKK(PaImitoyl)-CONH2 (SEQ ID NO:57). The D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argiγ and Argig residues improves stability and the K(ρalmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
OXM314 has the structure HsQGTFTSD YSKYLDSRRAQDFVQWLMNTK-Ttds- K(Palmitoyl)-CONH2 (SEQ ID NO:58). The D-Ser in amino acid position 2 provides DPPIV resistance and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo. The Ttds (l~amino-4,7,10-trioxa-13-tridecanamine succinimic acid) is a linker that acts as a flexible and hydrophilic spacer between the peptide sequence and the K(ρalmitoyl) group. OXM 313 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-Ttds- K(PalmitoyI)-CONH2 (SEQ ID NO: 59). The D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argiγ and Argis residues improves stability and the Ttds-K(ρalmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
OXM317 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-C^ CONH2 (SEQ ID NO:60). In the peptide, there is a D-Ser in amino acid position 2 for DPPIV resistance, and a gamma glutamic residue linked to cholest-5-en-3-yl{[(2R)-3~amino-2-{'amino)- 3 -oxopropyljthio} acetate (C4) for improves pharmacokinetic properties in vivo. The gamma glutamic residue (γE) is a linker that acts as a flexible spacer between the peptide sequence and the C4 group,
OXM318 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK~γE-Cφ CONH2 (SEQ ID NO:61). The D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argj7 and Arg] g residues improves stability and the γE -C4 group improves the peptide analog's pharmacokinetic properties in vivo. OXM319 has the structure BαQGTFTSDYSKYLDSEAAQDFVQWLMNTKC?- CONH2 (SEQ ID NO:ό2). In the peptide, there is a Aib in amino acid position 2 for DPPIV resistance, and the C(Oxa4-cholesterol) group {C7) improves the peptide analog's pharmacokinetic properties in vivo. OXM321 has the structure
HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA-γE- C4-CONH2 (SEQ ID
NO:63). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of GIu and Ala, respectively, for the Argi 7 and Argi 8 residues and a C(-cholesterol) group (C4) improves pharmacokinetic properties in vivo. The substitutions at Argπ and Argi 8 were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites. The gamma glutamic residue (γE) is a linker that acts as a flexible spacer between the peptide sequence and the C4 group.
OXM323 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKR-C-/-
CONH2 (SEQ ID NO:64). The D-Ser in position 2 provides DPPIV resistance, substitution of GIu and Ala for Argi 7 and Argi 8 residue provides a peptide with improved stability and the
C(Oxa4-cholesterol) group (C7) provides a peptide with improved pharmacokinetic properties in vivo.
OXM325 has the structure
HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC7-CO2H (SEQ ID NO:65). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of GIu and Ala, respectively, for the Argi 7 and Argig residues, and a C(Oxa4-cholesterol) group (C7) improves pharmacokinetic properties in vivo. The substitutions at Argπ an(i Argi g were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
OXM327 has the structure HaQGTFTSDYSKYLDSERAQDFVQWLMNTKC7- CONH2 (SEQ ID NO:6ό). The Aib in position 2 provides DPPIV resistance, substitution of GIu for theArgπ residue provides a peptide with improved stability and the C(Oxa4-cholesterol) group (C7) provides improved pharmacokinetic properties in vivo,
OXM329 has the structure HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-C4- CO2H (SEQ ID NO:67). The Aib in position 2 provides DPPIV resistance and a C(Oxa4- cholesterol) group (C 7) provides a peptide with improved pharmacokinetic properties in vivo.
The gamma glutamic residue (γE) is a linker that acts as a flexible spacer between the peptide sequence and the C4 group.
OXM330 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA-γE-K(Pam)-CONH2 (SEQ ID NO:68). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of GIu and Ala, respectively, for the Argπ and Argi 8 residues and a -K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo. The gamma glutamic residue (γE) is a linker that acts as a flexible spacer between the peptide sequence and the K(palmitoyl) group. The substitutions at Arg\-j and Argig were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
OXM345 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE- C4-COOH (SEQ ID NO:69). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacers between the peptide sequence, and the cholesterol group, one Cys(cholesterol) at position 33 (C4).
OXM355 has the structure HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK-γE-C4~ COOH (SEQ ID NO:70), It was designed to contain D-Ser (s) at position 2, a Lys^Ser substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol one Cys(cholesterol) at position 32 (C4). A serine in position 12 is present in the GLP-I peptide sequence. Therefore, it is expected to have at least compatible potency at the GLP-IR. The substitution Lysi2Ser eliminates a positive charge which results in a pi of about 5.
OXM357 has the structure HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK-γE-C.}- COOH (SEQ ID NO:71 ). It was designed to contain D-Ser (s) at position 2, one gamma- glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol one Cys(cholesterol) (C4) at position 32. OXM357 differs from OXM345 in having only one γ~Glu while OXM345 has two γ-Glu.
OXM359 has the structure HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK-γE-Cγ- COOH (SEQ ID NO:72). It was designed to contain D-Ser (s) at position 2, a Lysi 2Ser substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) at position 32 (C7). Thus, OXM359 differs from OXM355 in having C7 (cholesterol group with the tetraethylene glycol spacer) instead of C4
(cholesterol without an ethylene glycol spacer). OXM361 has the structure HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK-γE-Cv-
COOH (SEQ ID NO:73). It was designed to contain D-Ser (s) at position 2, an ArgjgAla substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) at position 32 (C7 in the table). The ArgisAla substitution eliminates a positive charge which is important for the tuning of the optimal pi value to 5.
OXM373 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-C4- COOH (SEQ ID NO:74). It was designed to contain D-Ser (s) at position 2, a SerieGlu substitution, one gamma-glutamic acid at position 31 as spacers between the peptide sequence, and the cholesterol, one Cys(cholesterol) at position 32 (C4). The GIu at position 16 is present in the eχendin-4 peptide so this substitution is expected to be at least compatible with GLP-IR activation. OXM374 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-Cγ- COOH (SEQ ID NO:75), It was designed to contain D-Ser (s) at position 2, a SerisGlu substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4~cholesterol) at position 32 (C7). Thus, the difference between OXM373 and 374 is due to the presence of the tetraethylene glycol spacer attached to the cholesterol group in OXM374.
OXM380 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE- C7-COOH (SEQ ID NO;76). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (Cγ)at position 33. OXM380 has the same peptide sequence of OXM345 but differs in the Oxa4 spacer linked to the cholesterol group.
OXM381 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE- C9--COOH (SEQ ID NO:77). ϊt was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(maleimide~Oxai2-cholesterol) (C9) at position 33. OXM381 has the same peptide sequence of OXM345 and OXM380 differing in the maleimide~0xai2 spacer linked to the cholesterol. The structure of C9 is shown below.
Figure imgf000038_0001
OXM383 has the structure HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK~γE-γE- C7-COOH (SEQ ID NO:78). It was designed to contain Aib (α) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (C7) at position 33. OXM383 differs from OXM380 only with respect to the amino acid at position 2.
OXM388 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE- γE-C7-COOH (SEQ ΪD NO:79). It was designed to contain Acb at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (C7) at position 33. OXM388 differs from OXM380 and 383 only with respect to the amino acid at position 2.
OXM392 has the structure HsQGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-γE- C10-COOH (lactam bridge between E and K) (SEQ ID NO:80). It was designed to contain Ser (s) at position 2, SerigGlu and Gln2θLys substitutions wherein the Gluig and Lys20 are linked with a lactam bridge on the side chains, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (Ci 0) at position 33. The lactam bridge is between position i (16) and i+4 (20) and is meant to stabilize the alpha-helical conformation of the peptide and to stabilize the peptide against proteolytic degradation.
The Cio group differs from the C9 group for the thioether bond connecting the cysteine thiol group to the Oxai2-cholesterol. In C9 there is a maleimide thioether bond while in Cio there is an acetamide thioether. The structure of C\Q is shown below.
Figure imgf000039_0001
OXM395 has the structure HαQGTFTSDYSKYLDERRAKDFVQWLMNTK-γE-yE- C10-COOH (lactam bridge between E and K) (SEQ ID NO:81). It was designed to contain Aib (α) at position 2, SeqgGru and a Gln2θLys substitutions wherein the Gluig and Lys20 are linked with a lactam bridge between the side chains, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2~ cholesterol) (C 10) at position 33. The lactam bridge is between position 16( i ) and 20 (i+4) and is meant to stabilize the peptide's alpha-helical conformation and to stabilize the peptide against proteolytic degradation. OXM398 has the structure H-Acb-QGTFTSDYSKYLDERRAKDFVQWLMNTK-γE- γE-Cio-COOH (lactam bridge between E and K) (SEQ ID NO: 82). It was designed to contain Acb at position 2, SerigGϊu and a Gln2θLys substitutions wherein the Glui6 and Lys20 are linked with a lactam bridge between the side chains, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2- cholesterol) (C 10) at position 33. The lactam bridge is between position 16 (i) and 20 (i+4) and is meant to stabilize the alpha-helical conformation of the peptide and to stabilize the peptide against proteolytic degradation.
OXM392, 395 and 398 differ only in the amino acid that is at position 2.
OXM399 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE- Ciø-COOH (SEQ ID NO: 83). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33. OXM399 differs from OXM392 only in that it lacks the lactam bridge present in OXM392.
OXM400 has the structure HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE- Cio-COOH (SEQ ID NO;84). It was designed to contain Aib (α) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33. OXM400 differs from OXM395 only in that it lacks the lactam bridge present in OXM395.
OXM40I has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE- γE-Cio-COOH (SEQ ID NO:85). It was designed to contain Acb at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33. OXM401 differs from OXM398 only in that it lacks the lactam bridge present in OXM398. OXM399, OXM40, and 401 differ from each other in the amino acid at position 2. OXM404 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE-
K(γE-ρalmitoyl)-CONH2 (SEQ ID NO:8ό). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys(γE-palmitoyl) at position 33. The peptide in this embodiment is amidated at the C-terminus. OXM406 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK-γE-γE-
C10-CONH2 (SEQ ID NO:87). It was designed to contain D-Ser (s) at position 2, a SerieGlu substitution, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C10) at position 33. The peptide in this embodiment is amidated at the C-terminus. OXM407 has the structure HsQGTFTSDYSKYLDSRRAK(γE- palmitoyl)DFVQWLMNTK-γEγE-CONH2 (SEQ ID NO:88). It was designed to contain D-Ser
(s) at position 2, two gamma-glutamic acid residuesat positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys(γE-palmitoyl) at position 33. The peptide in this embodiment is amidated at the C-terminus. OXM408 has the structure HsQGTFTSDYSKYLDSRRAK(γE-γE- pa!mitoyϊ)DFVQWLMNTK-γE-CθNH2 (SEQ ID NO:89). It was designed to contain D-Ser (s) at position 2, one gamma-glutamic acid at positions 31 , and a palmitoyl group linked to two y- glutamic acid residues and to the side chain amino group of a lysine [Lys(γE- γE-palmitoyl)] at position 20. The peptide in this embodiment is amidated at the C-terminus.
OXM409 has the structure HsQGTFTSDK(γE-γE- palmitoyl)SKYLDSRRADFVQWLMNTK-CONH2 (SEQ ID NO;89). It was designed to contain D-Ser (s) at position 2 and a palmitoyl group linked to two γ-glutamic acid residues and to the side chain amino group of a lysine [Lys(γE- γB-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
OXM410 has the structure HsQGTFTSDYSKYLDERRAK(γE-γE- palmitoyl)DFVQWLMNTK-CONH2 (SEQ ID NO;91). It was designed to contain D-Ser (s) at position 2, a Sei"i6Glu substitution, and a palmitoyl group linked to two γ-glutamic acid residues and to the side chain amino group of a lysine [Lys(γE- γE-palmitoyl)] at position 20. The peptide in this embodiment is amidated at the C-terminus,
OXM411 has the structure HsQGTFTSDK(γE-γE- palraitoyl)SKYLDERRAQDFVQWLMNTK:-CONH2 (SEQ ID NO:92). It was designed to contain D-Ser (s) at position 2, a Ser 16GIu substitution and a palmitoyl group linked to two γ- glutamic acid residues and to the side chain amino group of a lysine [Lys(γE- γE-paϊmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
OXM412 has the structure HsQGTFTSD YSKYLDSRRAQDFVQWLMNTK-γE-γE- CJ I-COOH (SEQ ID NO:93). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa24-cholesterol) (Ci i)at position 33. OXM412 differs from OXM399 for the length of the Oxa spacer linked to the cholesterol group. The structure of C\ \ is shown below.
Figure imgf000041_0001
OXM413 has the structure HaDGTFTSDYSKYLDSRRAQDFVK(DOTA)WLmNTK- γE-γE-Ciø-CONH2 (SEQ ID NO:94). It was designed as a peptide for imaging to target GLP-
IR in vivo. The sequence contains Aib at position 2, an Asp at position 3 to give selectivity on the GLP- 1 R1 a Lys(DOTA) at position 24, a Met(O) at position 27, two garama-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2~cholesterol) (Ci o) at position 33. The peptide in this embodiment is amidated at the
C~terminus. The structure of Fmoc-Lys(DOT A)-OH is shown below.
Figure imgf000042_0001
OXM414 has the structure HsQGTFTSDK(γE- paIraitoyl)SKYLDERRAQDFVQWLMNTK-γE-CONH2 (SEQ ID NO:95). It was designed to contain D-Ser (s) at position 2, two γ-glutamic acids at positions 31, a Ser]6Glu substitution and a palmitoyl group linked to the side chain amino group of a lysine [Lys(palmitoyl)j at position 10. The peptide in this embodiment is amidated at the C-terminus.
OXM415 has the structure
HsQGTFTSDK(palmitoyϊ)SKYLDERRAQDFVQWLMNTK-γE-γE-CONH2 (SEQ ID NO;96). It was designed to contain D-Ser (s) at position 2, one γ-glutamic acid at positions 31, a SerjeGIu substitution and a palmitoyl group linked to one γ-glutamic acid residue and to the side chain amino group of a lysine [Lys(γE-palmitoyl)] at position 10, The peptide in this embodiment is amidated at the C-terminus.
OXM416 has the structure HαQGTFTSDK(γE-γE- palmitoyI)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:97). It was designed to contain Aib (α) at position 2, a SerigGlu substitution and a palmitoyl group linked to two γ- glutamic acid residues and to the side chain amino group of a lysine [Lys(γE- γE-paimitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus. OXM417 has the structure H-Acb~QGTFTSDK(γE-γE- palmitoyl)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:98). It was designed to contain Acb at position 2, a SerigGlu substitution and a palmitoyl group linked to two γ-glutamic acid residues and to the side chain amino group of a lysine [Lys(γE- γE-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
OXM418 has the structure HsQGTFTSDK(γE-γE- palmitoyl)SKYLDαRRAQDFVQWLMNTK-γE-CONH2 (SEQ ID NO:99). It was designed to contain D-Ser (s) at position 2, one gamma- glutamic acid at positions 31, a Ser^Aib (α) substitution and a palmitoyl group linked to two γ-glutamic acid residues and to the side chain amino group of a lysine [Lys(γE- γE-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
OXM419 has the structure HαQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE- K(γE-paϊmitoyl)-CONH2 (SEQ ID NO: 100). It was designed to contain Aib (α) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys(γE-palmitoyl) at position 33. The peptide in this embodiment is amidated at the C-terminus,
OXM420 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE- γE-K(γE-pa!mitoyl)-CONH2 (SEQ ID NO: 101). It was designed to contain Acb at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys(γE-palmitoyl) at position 33. The peptide in this embodiment is amidated at the C-terminus,
OXM421 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK-γE-γE- C12-COOH (SEQ ID NO: 102). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-O-cholesterol) (Ci 2) at position 33. The Cys(Oxai2~0-cholesterol) differs from Cys(Oxai2-cholesterol) in having the cholesterol linked through an ether bond to the Oxai2 spacer. The ether bond can confer more stability towards the ester bond present in the Cys(Oxa 12- cholesterol) or Ci 1 group. The structure of Cys(oxai2-O-cholesterol) is shown below.
Figure imgf000044_0001
Pharmaceutical Compositions
Further provided are pharmaceutical compositions comprising a therapeutically effective amount of one or more of the OXM analogs disclosed herein for the treatment of a metabolic disorder in an individual. Such disorders include, but are not limited to, obesity, metabolic syndrome or syndrome X, type II diabetes, complications of diabetes such as retinopathy, hypertension, dyslipidemias, cardiovascular disease, gallstones, osteoarthritis, and certain forms of cancers. The obesity-related disorders herein are associated with, caused by, or result from obesity.
"Obesity" is a condition in which there is an excess of body fat. The operational definition of obesity is based on the Body Mass Index (BMI), calculated as body weight per height in meters squared (kg/m2). "Obesity" refers to a condition whereby an otherwise healthy subject has a Body Mass Index (BMI) greater than or equal to 30 kg/m2, or a condition whereby a subject with at least one co-morbidity has a BMI greater than or equal to 27 kg/m2. An "obese subject" is an otherwise healthy subject with a Body Mass Index (BMl) greater than or equal to 30 kg/m2 or a subject with at least one co-morbidity with a BMI greater than or equal to 27 kg/m2. A "subject at risk for obesity" is an otherwise healthy subject with a BMI of 25 kg/m2 to less than 30 kg/m2 or a subject with at least one co-morbidity with a BMI of 25 kg/m2 to less than 27 kg/m2.
The increased risks associated with obesity occur at a lower Body Mass Index (BMI) in Asians. In Asian countries, including Japan, "obesity" refers to a condition whereby a subject with at least one obesity-induced or obesity-related co-morbidity that requires weight reduction or that would be improved by weight reduction, has a BMI greater than or equal to 25 kg/m2, In Asian countries, including Japan, an "obese subject" refers to a subject with at least one obesity- induced or obesity-related co-morbidity that requires weight reduction or that would be improved by weight reduction, with a BMI greater than or equal to 25 kg/m2. In Asian countries, a "subject at risk of obesity" is a subject with a BMI of greater than 23 kg/m2 to less than 25 kg/m2.
As used herein, the term "obesity" is meant to encompass all of the above definitions of obesity. Obesity-induced or obesity-related co-morbidities include, but are not limited to, diabetes, non-insulin dependent diabetes mellitus - type 2, impaired glucose tolerance, impaired fasting glucose, insulin resistance syndrome, dyslipidemia, hypertension, hyperuricacidemia, gout, coronary artery disease, myocardial infarction, angina pectoris, sleep apnea syndrome, Pickwickian syndrome, fatty liver; cerebral infarction, cerebral thrombosis, transient ischemic attack, orthopedic disorders, arthritis deformans, lumbodynia, emmeniopathy, and infertility. In particular, co -morbidities include: hypertension, hyperlipidemia, dyslipidemia, glucose intolerance, cardiovascular disease, sleep apnea, diabetes mellitus, and other obesity-related conditions.
"Treatment" (of obesity and obesity-related disorders) refers to the administration of the compounds of the present invention to reduce or maintain the body weight of an obese subject. One outcome of treatment may be reducing the body weight of an obese subject relative to that subject's body weight immediately before the administration of the compounds of the present invention. Another outcome of treatment may be preventing body weight regain of body weight previously lost as a result of diet, exercise, or pharmacotherapy. Another outcome of treatment may be decreasing the occurrence of and/or the severity of obesity-related diseases. The treatment may suitably result in a reduction in food or calorie intake by the subject, including a reduction in total food intake, or a reduction of intake of specific components of the diet such as carbohydrates or fats; and/or the inhibition of nutrient absorption; and/or the inhibition of the reduction of metabolic rate; and in weight reduction in patients in need thereof. The treatment may also result in an alteration of metabolic rate, such as an increase in metabolic rate, rather than or in addition to an inhibition of the reduction of metabolic rate; and/or in minimization of the metabolic resistance that normally results from weight loss.
"Prevention" (of obesity and obesity-related disorders) refers to the administration of the compounds of the present invention to reduce or maintain the body weight of a subject at risk of obesity. One outcome of prevention may be reducing the body weight of a subj ect at risk of obesity relative to that subject's body weight immediately before the administration of the compounds of the present invention. Another outcome of prevention may be preventing body weight regain of body weight previously lost as a result of diet, exercise, or pharmacotherapy. Another outcome of prevention may be preventing obesity from occurring if the treatment is administered prior to the onset of obesity in a subject at risk of obesity. Another outcome of prevention may be decreasing the occurrence and/or severity of obesity-related disorders if the treatment is administered prior to the onset of obesity in a subject at risk of obesity. Moreover, if treatment is commenced in already obese subjects, such treatment may prevent the occurrence, progression or severity of obesity-related disorders, such as, but not limited to, arteriosclerosis, Type II diabetes, polycystic ovarian disease, cardiovascular diseases, osteoarthritis, dermatological disorders, hypertension, insulin resistance, hypercholesterolemia, hypertriglyceridemia, and cholelithiasis.
The obesity-related disorders herein are associated with, caused by, or result from obesity. Examples of obesity-related disorders include overeating and bulimia, hypertension, diabetes, elevated plasma insulin concentrations and insulin resistance, dyslipidemias, hyperlipidemia, endometrial, breast, prostate and colon cancer, osteoarthritis, obstructive sleep apnea, cholelithiasis, gallstones, heart disease, abnormal heart rhythms and arrythmias, myocardial infarction, congestive heart failure, coronary heart disease, sudden death, stroke, polycystic ovarian disease, craniopharyngioma, the Prader-Willi Syndrome, Frohlich's syndrome, GH-deficient subjects, normal variant short stature, Turner's syndrome, and other pathological conditions showing reduced metabolic activity or a decrease in resting energy expenditure as a percentage of total fat-free mass, e.g, children with acute lymphoblastic leukemia. Further examples of obesity-related disorders are metabolic syndrome, also known as syndrome X, insulin resistance syndrome, sexual and reproductive dysfunction, such as infertility, hypogonadism in males and hirsutism in females, gastrointestinal motility disorders, such as obesity-related gastro-esophageal reflux, respiratory disorders, such as obesity-hypoventilation syndrome (Pickwickian syndrome), cardiovascular disorders, inflammation, such as systemic inflammation of the vasculature, arteriosclerosis, hypercholesterolemia, hyperuricaemia, lower back pain, gallbladder disease, gout, and kidney cancer. The compounds of the present invention are also useful for reducing the risk of secondary outcomes of obesity, such as reducing the risk of left ventricular hypertrophy. The term "diabetes," as used herein, includes both insulin-dependent diabetes mellitus
(IDDM, also known as type I diabetes) and non-insulin-dependent diabetes mellitus (NIDDM, also known as Type II diabetes). Type I diabetes, or insulin-dependent diabetes, is the result of an absolute deficiency of insulin, the hormone which regulates glucose utilization. Type II diabetes, or insulin-independent diabetes (i.e., non-insulin-dependent diabetes mellilus), often occurs in the face of normal, or even elevated levels of insulin and appears to be the result of the inability of tissues to respond appropriately to insulin. Most of the Type II diabetics are also obese. The compounds of the present invention are useful for treating both Type I and Type 0 diabetes. The compounds are especially effective for treating Type II diabetes. The compounds of the present invention are also useful for treating and/or preventing gestational diabetes mellitus.
U.S. Patent No. 6,852,690, which is incorporated herein in its entirety, discloses methods for enhancing metabolism of nutrients comprising administering to a non-diabetic patient a formulation comprising a nutritively effective amount of one or more nutrients or any combination thereof and one or more insuHnotropic peptides. The OXM peptide anlogs disclosed herein are insuHnotropic and can be administered to patients with a disturbed glucose metabolism such as insulin resistance but no overt diabetes, as well as patients who for any reason cannot receive nutrition through the alimentary canal. Such patients include surgery patients, comatose patients, patients in shock, patients with gastrointestinal disease, patients with digestive hormone disease, and the like. In particular, obese patients, atherosclerotic patients, vascular disease patients, patients with gestational diabetes, patients with liver disease such as liver cirrhosis, patients with acromegaly, patients with glucorticoid excess such as Cortisol treatment or Cushings disease, patients with activated counterregulatory hormones such as would occur after trauma, accidents and surgery and the like, patients with hypertriglyceridemia and patients with chronic pancreatitis can be readily and suitably nourished according to the invention without subjecting the patient to hypo- or hyperglycemia. In particular, the administration to such a patient aims to provide a therapy to as rapidly as possible deliver the nutritional and caloric requirements to the patient while maintaining his plasma glucose below the so-called renal threshold of about 160 to 180 milligrams per deciliter of glucose in the blood. Although normal patients not having glucose levels just below the renal threshold can also be treated according to the invention as described above, patients with disturbed glucose metabolism such as hyperglycemic patients whose plasma glucose level is just above the renal threshold also find the therapy suitable for their condition, In particular, such patients who have a degree of hyperglycemia below the renal threshold at intermittent intervals can receive a combination treatment of nutrients plus insuHnotropic peptides according to any of the following regimens. Normal patients not suffering from such hyperglycemia can also be treated using the peptide analogs disclosed herein. The OXM analogs disclosed herein may be used in a pharmaceutical composition when combined with a pharmaceutically acceptable carrier. Such compositions comprise a therapeuticalϊy-effective amount of one or more of the OXM analogs disclosed herein and a pharmaceutically acceptable carrier. Such a composition may also be comprised of (in addition to the OXM analog disclosed herein and a carrier) diluents, fillers, salts, buffers, stabilizers, solubilizers, and other materials well known in the art. Compositions comprising the OXM analogs disclosed herein can be administered, if desired, in the form of salts provided the salts are pharmaceutically acceptable. Salts may be prepared using standard procedures known to those skilled in the art of synthetic organic chemistry.
The term "individual" is meant to include humans and companion or domesticated animals such as dogs, cats, horses, and the like. Therefore, the compositions comprising formula I are also useful for treating or preventing obesity and obesity-related disorders in cats and dogs. As such, the term "mammal" includes companion animals such as cats and dogs. The term "pharmaceutically acceptable salts" refers to salts prepared from pharmaceutically acceptable non-toxic bases or acids including inorganic or organic bases and inorganic or organic acids. Salts derived from inorganic bases include aluminum, ammonium, calcium, copper, ferric, ferrous, lithium, magnesium, manganic salts, manganous, potassium, sodium, zinc, and the like. Particularly preferred are the ammonium, calcium, magnesium, potassium, and sodium salts. Salts derived from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, and basic ion exchange resins, such as arginine, betaine, caffeine, choline, N,N'-dibenzylethylenediamine, diethyl amine, 2- diethylaminoethanol, 2-dimethylaminoethanol, ethanolamine, ethylenediamine, N-ethyl- morpholine, N-ethylpiperidine, glucamine, glucosamine, histidine, hydrabamine, isopropylamine, lysine, methylglucamine, morphoHne, piperazine, piperidine, polyamine resins, procaine, purines, theobromine, tri ethyl amine, trimethylamine, tripropylamine, tromethamine, and the like. The term "pharmaceutically acceptable salt" further includes all acceptable salts such as acetate, lactobionate, benzenesulfonate, laurate, benzoate, malate, bicarbonate, maleate, bisulfate, mandelate, bitartrate, mesylate, borate, methylbromide, bromide, methylnitrate, calcium edetate, methylsulfate, camsylate, mucate, carbonate, napsylate, chloride, nitrate, clavulanate, N- methylglucamine, citrate, ammonium salt, dihydrochloride, oleate, edetate, oxalate, edisylate, pamoate (embonate), estolate, palmitate, esylate, pantothenate, fumarate, phosphate/diphosphate, gluceptate, polygalacturonate, gluconate, salicylate, glutamate, stearate, glycollylarsanilate, sulfate, hexylresorcinate, subacetate, hydrabamine, succinate, hydrobromide, tannate, hydrochloride, tartrate, hydroxynaphthoate, teoclate, iodide, tosylate, isothionate, triethiodide, lactate, panoate, valerate, and the like which can be used as a dosage form for modifying the solubility or hydrolysis characteristics or can be used in sustained release or pro-drug formulations. It will be understood that, as used herein, references to the OXM analogs disclosed herein are meant to also include the pharmaceutically acceptable salts.
As utilized herein, the term "pharmaceutically acceptable" means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredient(s), approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopoeia or other generally recognized pharmacopoeia for use in animals and, more particularly, in humans. The term "carrier" refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered and includes, but is not limited to such sterile liquids as water and oils. The characteristics of the carrier will depend on the route of administration. The OXM analogs disclosed herein may be in muϊtimers (for example, heterodimers or homodimers) or complexes with itself or other peptides, As a result, pharmaceutical compositions of the invention may comprise one ore more OXM analogs disclosed herein in such multimeric or complexed form. As used herein, the term "therapeutically effective amount" means the total amount of each active component of the pharmaceutical composition or method that is sufficient to show a meaningful patient benefit, i.e., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions. When applied to an individual active ingredient, administered alone, the term refers to that ingredient alone. When applied to a combination, the term refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially, or simultaneously.
The pharmacological composition can comprise one or more OXM analogs disclosed herein; one or more OXM analogs disclosed herein and one or more other agents for treating a metabolic disorder; or the pharmacological composition comprising the one or more OXM analogs disclosed herein can be used concurrently with a pharmacological composition comprising an agent for treating a metabolic disorder. Such disorders include, but are not limited to, obesity, metabolic syndrome or syndrome X, type II diabetes, complications of diabetes, hypertension, dyslipidemias, cardiovascular disease, gallstones, osteoarthritis, and certain forms of cancers.
When the pharmacological composition comprises another agent for treating a metabolic disorder or the treatment includes a second pharmacological composition comprising an agent for treating a metabolic disorder, the agent includes, but are not limited to, cannabinoid (CBl) receptor antagonists, glucagon like peptide 1 (GLP-I) receptor agonists, lipase inhibitors, leptin, tetrahydrolipstatin, 2-4-dinitrophenol? acarbose, sibutramine, phentamine, fat absorption blockers, simvastatin, mevastatin, ezetimibe, atorvastatin, sitagliptin, metformin, orlistat, Qnexa, topiramate, naltrexone, bupriopion, phentermine, losartan, losartan with hydrochlorothiazide, and the like. Suitable agents of use in combination with a compound of the present invention, include, but are not limited to:
(a) neuromedin U receptor agonist as disclosed in Published International Application No. WO2007/109135.
(b) anti-diabetic agents such as (1) PPARγ agonists such as glitazones (e.g. ciglitazone; darglitazone; englitazone; isaglitazone (MCC-555); pioglitazone (ACTOS); rosiglitazone (AVANDIA); troglitazone; rivoglitazone, BRL49653; CLX-0921 ; 5-BTZD, GW- 0207, LG-100641 , R483, and LY-300512, and the like and compounds disclosed in WO97/10813, 97/27857, 97/28115, 97/28137, 97/27847, 03/000685, and 03/0271 12 and SPPARMS (selective PPAR gamma modulators) such as Tl 31 (Amgen), FK614 (Fujisawa), netoglitazone, and metaglidasen; (2) biguanides such as buformin; metformin; and phenformin, and the like; (3) protein tyrosine phosphatase- IB (PTP-IB) inhibitors such as ISIS 113715, A- 401674, A-364504, IDD-3, IDD 2846, KP-40046, KR61639, MC52445, MC52453, C7, OC- 060062, OC-86839, OC29796, TTP-277BC1, and those agents disclosed in WO 04/041799, 04/050646, 02/26707, 02/26743, 04/092146, 03/048140, 04/089918, 03/002569, 04/065387, 04/127570, and US 2004/167183; (4) sulfonylureas such as acetohexamide; chlorpropamide; diabinese; glibencl amide; glipizide; glyburide; glimepiride; gliclazide; gϊipentide; gliquidone; glisolamide; tolazamide; and tolbutamide, and the like; (5) meglitinides such as repaglinide, metiglinide (GLUFAST) and nateglinide, and the like; (6) alpha glycoside hydrolase inhibitors such as acarbose; adiposine; camiglibose; emiglitate; miglitol; voglibose; pradimicin-Q; salbostatin; CKD-711; MDL-25,637; MDL-73,945; and MOR 14, and the like; (7) alpha-amylase inhibitors such as tendamistat, trestatin, and Al-3688, and the like; (8) insulin secreatagogues such as linogliride nateglinide, mitiglinide (GLUFAST), ID 1 101 A-4166, and the like; (9) fatty acid oxidation inhibitors, such as clomoxir, and etomoxir, and the like; (10) A2 antagonists, such as rnidaglizole; isaglidole; deriglidole; idazoxan; earoxan; and fluparoxan, and the like; (11) insulin or insulin rnimetics, such as biota, LP-100, novarapid, insulin detemir, insulin lispro, insulin glargine, insulin zinc suspension (lente and ultralente); Lys-Pro insulin, GLP-I (17-36), GLP- 1 (73-7) (insulintropin); GLP- 1 (7-36)-NH2) exenatide/Exendin-4, Exenatide LAR, Linaglutide, AVEOOlO, CJC 1 131, BIM51077, CS 872, THO318, BAY-694326, GPOlO, ALBUGON (GLP-I fused to albumin), HGX-007 (Epac agonist), S-23521 , and compounds disclosed in WO 04/022004, WO 04/37859, and the like; (12) non-thiazolidinediones such as JT- 501, and farglitazar (GW-2570/GI-262579), and the like; (13) PPARα/y dual agonists such as AVE 0847, CLX-0940, GW- 1536, GWl 929, GW-2433, KRP-297, L-796449, LBM 642, LR-90, LY510919, MK-0767, ONO 5129, SB 219994, TAK-559, TAK-654, 677954 (Glaxo Smithkline), E-3030 (Eisai), LY510929 (Lilly), AKl 09 (Asahi), DRF2655 (Dr. Reddy), DRF8351 (Dr. ReddyX MC3002 (Maxocore), TY51501 (ToaEiyo), naveglitazar, muraglitizar, peliglitazar? tesagϋtazar (GALIDA), reglitazar (JTT-501), chiglitazar, and those disclosed in WO 99/16758, WO 99/19313, WO 99/20614, WO 99/38850, WO 00/23415, WO 00/23417, WO 00/23445, WO 00/50414, WO 01/00579, WO 01/79150, WO 02/062799, WO 03/033481, WO 03/033450, WO 03/033453; and (14) other insulin sensitizing drugs; (15) VPAC2 receptor agonists; (16) GLK modulators, such as PSN105, RO 281675, RO 274375 and those disclosed in WO 03/015774, WO 03/000262, WO 03/055482, WO 04/046139, WO 04/045614, WO 04/063179, WO 04/063194, WO 04/050645, and the like; (17) retinoid modulators such as those disclosed in WO 03/000249; (18) GSK 3beta/GSK 3 inhibitors such as 4-[2-(2-bromophenyl)-4-(4-fluorophenyl- lH-imidazol-5-yl]pyridine5 CT21022, CT20026, CT-98023, SB-216763, SB4101 1 1, SB-675236, CP-70949, XD4241 and those compounds disclosed in WO 03/037869, 03/03877, 03/037891, 03/024447, 05/000192, 05/019218 and the like; (19) glycogen phosphorylase (HGLPa) inhibitors, such as AVE 5688, PSN 357, GPi-879, those disclosed in WO 03/037864, WO
03/091213, WO 04/092158, WO 05/013975, WO 05/013981, US 2004/0220229, and JP 2004- 196702, and the like; (20) ATP consumption promotors such as those disclosed in WO 03/007990; (21) fixed combinations of PPARγ agonists and metformin such as AVANDAMET; (22) PPAR pan agonists such as GSK 677954; (23) GPR40 (G-protein coupled receptor 40) also called SNORF 55 such as BG 700, and those disclosed in WO 04/041266, 04/022551, 03/099793; (24) GPRl 19 (also called RUP3; SNORF 25) such as RUP3, HGPRBMY26, PFI 007, SNORF 25; (25) adenosine receptor 2B antagonists such as ATL-618, ATl-802, E3O8O, and the like; (26) carnitine palmitoyl transferase inhibitors such as ST 1327, and ST 1326, and the like; (27) Fructose 1 ,6-bisphosρohatase inhibitors such as CS-917, MB7803, and the like; (28) glucagon antagonists such as AT77077, BAY 694326, GW 4123 X, NN2501, and those disclosed in WO 03/064404, WO 05/00781, US 2004/0209928, US 2004/029943, and the like; (30) gIucose-6-ρhosphase inhibitors; (31) phosphoenolpyruvate carboxykinase (PEPCK) inhibitors; (32) pyruvate dehydrogenase kinase (PDK) activators; (33) RXR agonists such as MC 1036, CSOOOl 8, JNJ 10166806, and those disclosed in WO 04/089916, US 6759546, and the like; (34) SGLT inhibitors such as AVE 2268, KGT 1251, T1095/RWJ 394718; (35) BLX-1002; (c) lipid lowering agents such as (1) bile acid sequestrants such as, cholestyramine, colesevelem, colestipol, dialkylaminoalkyl derivatives of a cross-linked dextran; Colestid®; LoCholest®; and Questran®, and the like; (2) HMG-CoA reductase inhibitors such as atorvastatin, itavastatin, pitavastatin, fluvastatin, lovastatin, pravastatin, rivastatin, rosuvastatin, simvastatin, rosuvastatin (ZD-4522), and the like, particularly simvastatin; (3) HMG-CoA synthase inhibitors; (4) cholesterol absorption inhibitors such as FMVP4 (Forbes Medi-Tech), KT6-971 (Kotobuki Pharmaceutical), FM-VA12 (Forbes Medi-Tech), FM-VP-24 (Forbes Medi-Tech), stanol esters, beta-sitosterol, sterol glycosides such as tiqueside; and azetidinones such as ezetimibe, and those disclosed in WO 04/005247 and the like; (5) acyl coenzyme A -cholesterol acyl transferase (ACAT) inhibitors such as avasimibe, eflucimibe, pactimibe (KY505), SMP 797 (Sumitomo), SM32504 (Sumitomo), and those disclosed in WO 03/091216, and the like; (6) CETP inhibitors such as JTT 705 (Japan Tobacco), torcetrapib, CP 532,632, BAY63-2149 (Bayer), SC 591, SC 795, and the like; (7) squalene synthetase inhibitors; (8) anti-oxidants such as probucol, and the like; (9) PP ARa agonists such as beclofibrate, benzafibrate, ciprofibrate, clofibrate, etofibrate, fenofibrate, gemcabene, and gemfibrozil, GW 7647, BM 170744 (Kowa), LY518674 (Lilly), GW590735 (GlaxoSmithkline), KRP-101 (Kyorin), DRFl 0945 (Dr. Reddy), NS-220/R1593 (Nippon Shinyaku/Roche, STl 929 (Sigma Tau) MC3001/MC3004 (MaxoCore Pharmaceuticals, gemcabene calcium, other fibric acid derivatives, such as Atromid®, Lopid®, and Tricor®, and those disclosed in US 6,548,538, and the like; (10) FXR receptor modulators such as GW 4064 (GlaxoSmithkline), SR 103912, QRX401, LN-6691 (Lion Bioscience), and those disclosed in WO 02/064125, WO 04/045511, and the like; (11) LXR receptor modulators such as GW 3965 (GlaxoSmithkline), T9013137, and XTCO179628 (X-Ceptor Therapeutics/Sanyo), and those disclosed in WO 03/031408, WO 03/063796, WO 04/072041 , and the like; (12) lipoprotein synthesis inhibitors such as niacin; (13) renin angiotensin system inhibitors; (14) PPAR δ partial agonists, such as those disclosed in WO 03/024395; (15) bile acid reabsorption inhibitors, such as BARI 1453, SC435, PHA384640, S8921 , AZD7706, and the like; and bile acid sequesterants such as colesevelam (WELCHOL/ CHOLESTAGEL), (16) PPARγ agonists such as GW 501516 (Ligand, GSK), GW 590735, GW- 0742 (GlaxoSmithkline), T659 (Amgen/Tularik), LY934 (Lilly), NNC610050 (Novo Nordisk) and those disclosed in WO97/28149, WO 01/79197, WO 02/14291, WO 02/46154, WO 02/46176, WO 02/076957, WO 03/016291, WO 03/033493, WO 03/035603, WO 03/072100, WO 03/097607, WO 04/005253, WO 04/007439, and JPl 0237049, and the like; (17) triglyceride synthesis inhibitors; (18) microsomal triglyceride transport (MTTP) inhibitors, such as implitapide, LAB687, JTTl 30 (Japan Tobacco), CP346086, and those disclosed in WO
03/072532, and the like; (19) transcription modulators; (20) squalene epoxidase inhibitors; (21) low density lipoprotein (LDL) receptor inducers; (22) platelet aggregation inhibitors; (23) 5-LO or FLAP inhibitors; and (24) niacin receptor agonists including HM74A receptor agonists; (25) PPAR modulators such as those disclosed in WO 01/25181, WO 01/79150, WO 02/79162, WO 02/081428, WO 03/016265, WO 03/033453; (26) niacin-bound chromium, as disclosed in WO 03/039535; (27) substituted acid derivatives disclosed in WO 03/040114; (28) infused HDL such as LUV/ETC-588 (Pfizer), APO-Al Milano/ETC216 (Pfizer), ETC-642 (Pfizer), ISIS301012, D4F (Bruin Pharma), synthetic trimeric ApoAl, Bioral Apo Al targeted to foam cells, and the like; (29) IBAT inhibitors such as BARI143/HMR145A/ HMR1453 (Sanofi-Aventis, PHA384640E (Pfizer), S8921 (Shionogi) AZD7806 (AstrZeneca), AKl 05 (Asah Kasei), and the like; (30) Lp-PLA2 inhibitors such as SB480848 (GlaxoSmithkline), 659032 (GlaxoSmithkϊine), 677116 (GlaxoSmithkline), and the like; (31) other agents which affect lipic composition including ETC1001/ESP31015 (Pfizer), ESP-55016 (Pfizer), AGI1067 (AtheroGenics), AC3056 (Amylin), AZD4619 (AstrZeneca); and (d) anti-hypertensive agents such as (1) diuretics, such as thiazides, including chlorthalidone, chlorthiazide, dichlorophenamide, hydroflumethiazide, indapamide, and hydrochlorothiazide; loop diuretics, such as burnetanide, ethacrynic acid, furosemide, and torsemide; potassium sparing agents, such as amiloride, and triamterene; and aldosterone antagonists, such as spironolactone, epirenone, and the like; (2) beta-adrenergic blockers such as acebutolol, atenolol, betaxolol, bevantolol, bisoprolol, bopindolol, carteolol, carvedilol, celiprolol, esmolol, indenolol, rnetaprolol, nadolol, nebivolol, penbutolol, pindolol, propanolol, sotalol, tertatolol, tilisolol, and timolol, and the like; (3) calcium channel blockers such as amlodipine, aranidipine, azelnidipine, barnidipine, benidipine, bepridil, cinaldipine, clevidipine, diltiazem, efonidipine, felodipine, gallopamil, isradipine, lacidipine, lemildipine, lercanidipine, nicardipine, nifedipine, nilvadipine, nimodepine, nisoldipine, nitrendipine, manidipine, pranidipine, and verapamil, and the like; (4) angiotensin converting enzyme (ACE) inhibitors such as benazepril; captopril; cilazapril; delapril; enalapril; fosinopril; imidapril; losinopril; moexipril; quinapril; quinaprilat; ramipril; perindopril; perindropril; quanipril; spirapril; tenocapril; trandolapril, and zofenopril, and the like; (5) neutral endopeptidase inhibitors such as omapatrilat, cadoxatril and ecadotriϊ, fosidotril, sampatrilat, AVE7688, ER4030, and the like; (6) endothelin antagonists such as tezosentan, A308165, and YM62899, and the like; (7) vasodilators such as hydralazine, clonidine, minoxidil, and nicotinyl alcohol, and the like; (8) angiotensin Il receptor antagonists such as candesartan, eprosartan, irbesartan, losartan, pratosartan, tasosartan, telmisartan, valsartan, and EXP-3137, FΪ6828K, and RNH6270, and the like; (9) α/β adrenergic blockers as nipradilol, arotinolol and amosulalol, and the like; (10) alpha 1 blockers, such as terazosin, urapidil, prazosin bunazosin, trimazosin, doxazosin, naftopidil, indoramin, WHIP 164, and XENOlO, and the like; (1 1) alpha 2 agonists such as lofexidine, tiamenidine, moxonidine, rilmenidine and guanobenz, and the like; (12) aldosterone inhibitors, and the like; (13) angiopoietin-2-binding agents such as those disclosed in WO 03/030833; and
(e) anti-obesity agents, such as (1) 5HT (serotonin) transporter inhibitors, such as paroxetine, fluoxetine, fenfluramine, fluvoxamine, sertraline, and imipramine, and those disclosed in WO 03/00663, as well as serotonin/noradrenaline re uptake inhibitors such as sibutramine (MERIDI A/REDU CTIL) and dopamine uptake inhibitor/Norepenephrine uptake inhibitors such as radafaxine hydrochloride, 353162 (GlaxoSmithkline), and the like; (2) NE (norepinephrine) transporter inhibitors, such as GW 320659, despiramine, talsupram, and nomifensine; (3) CBl (cannabinoid-1 receptor) antagonist/inverse agonists, such as rimonabant (ACCOMPLIA Sanofi Synthelabo), SR- 147778 (Sanofi Synthelabo), AVEl 625 (Sanofi-
Aventis), BAY 65-2520 (Bayer), SLV 319 (Solvay), SLV326 (Solvay), CP945598 (Pfizer), E- 6776 (Esteve), 01691 (Organix), ORG14481 (Organon), VER24343 (Veraalis), NESS0327 (Univ of Sassari/Univ of Cagliari), and those disclosed in US Patent Nos.4,973,587, 5,013,837, 5,081,122, 5,112,820, 5,292,736, 5,532,237, 5,624,941, 6,028,084, and 6,509367; and WO 96/33159, WO97/29079, WO98/31227, WO 98/33765, WO98/37061, WO98/41519,
WO98/43635, WO98/43636, WO99/02499, WOOO/10967, WOOO/10968, WO 01/09120, WO 01/58869, WO 01/64632, WO 01/64633, WO 01/64634, WO 01/70700, WO 01/96330, WO 02/076949, WO 03/006007, WO 03/007887, WO 03/020217, WO 03/026647, WO 03/026648, WO 03/027069, WO 03/027076, WO 03/027114, WO 03/037332, WO 03/040107, WO 04/096763, WO 04/111039, WO 04/1 11033, WO 04/1 1 1034, WO 04/11 1038, WO 04/013120, WO 05/000301 , WO 05/016286, WO 05/066126 and EP-658546 and the like; (4) ghrelin agonists/antagonists, such as BVT81-97 (BioVitrum), RC1291 (Rejuvenon), SRD-04677 (Sumitomo), unacylated ghrelin (TheraTechnologies), and those disclosed in WO 01/87335, WO 02/08250, WO 05/012331 , and the like; (5) H3 (histamine H3) antagonist/inverse agonists, such as thioperamide, 3~(lH-imidazol-4~yl)propyl N~(4-pentenyl)carbamate), clobenpropit, iodophenpropit, imoproxifan, GT2394 (Gliatech), and A331440, and those disclosed in WO 02/15905; and 0-[3-(lH-irm'dazol-4-yl)ρropanol]carbarnates (Kiec-Kononowicz, K, et ah, Phamiazie, 55:349-55 (2000)), piperidine-containing histamine H3-receptor antagonists (Lazewska, D. et al., Pharmazie, 56:927-32 (2001), benzophenone derivatives and related compounds (Sasse, A. etal^ Arch. Pharm.(Weinheim) 334:45-52 (2001)), substituted N- phenylcarbamates (Reidemeister, S. et al,, Pharmazie, 55:83-6 (2000)), and proxifan derivatives (Sasse, A. et al,, J. Med. Chem.. 43:3335-43 (2000)) and histamine H3 receptor modulators such as those disclosed in WO 03/024928 and WO 03/024929; (6) melanin-concentrating hormone 1 receptor (MCHlR) antagonists, such as T-226296 (Takeda), T71 (Takeda/Amgen), AMGN- 608450, AMGN-503796 (Amgen), 856464 (GlaxoSmithkline), A224940 (Abbott), A798 (Abbott), ATCOl 75/AR224349 (Arena Pharmaceuticals), GW803430 (GlaxoSmithkine), NBI- IA (Neurocrine Biosciences), NGX-I (Neurogen), SNP-7941 (Synaptic), SNAP9847 (Synaptic), T-226293 (Schering Plough), TPΪ- 1361-17 (Saitama Medical School/University of California Irvine), and those disclosed WO 01/21169, WO 01/82925, WO 01/87834, WO 02/051809, WO 02/06245, WO 02/076929, WO 02/076947, WO 02/04433, WO 02/51809, WO 02/083134, WO 02/094799, WO 03/004027, WO 03/13574, WO 03/15769, WO 03/028641, WO 03/035624, WO 03/033476, WO 03/033480, WO 04/00461 1, WO 04/004726, WO 04/011438, WO 04/028459, WO 04/034702, WO 04/039764, WO 04/052848, WO 04/087680; and Japanese Patent Application Nos. JP 13226269, JP 1437059, JP2004315511, and the like; (7) MCH2R (melanin concentrating hormone 2R) agonist/antagonists; (8) NPYl (neuropeptide Y Yl) antagonists, such as BMS205749, BIBP3226, J-1 15814, BIBO 3304, LY-357897, CP-671906, and GΪ-264879A; and those disclosed in U.S, Patent No. 6,001,836; and WO 96/14307, WO 01/23387, WO 99/51600, WO 01/85690, WO 01/85098, WO 01/85173, and WO 01/89528; (9) NPY5 (neuropeptide Y Y5) antagonists, such as 152,804, S2367 (Shionogi), E-6999 (Esteve), GW- 56918OA, GW-594884A (GlaxoSmithkline), GW-587081X, GW-548118X; FR 235,208; FR226928, FR 240662, FR252384; 1229U91, GI-264879A, CGP71683A, C-75 (Fasgen) LY- 377897, LY366377, PD-160170, SR-120562A, SR-1208I9A,S2367 (Shionogi), JCF-104, and H409/22; and those compounds disclosed in U.S. Patent Nos. 6,140,354, 6,191 ,160, 6,258,837, 6,313,298, 6,326,375, 6,329,395, 6,335,345, 6,337,332, 6,329,395, and 6,340,683 ; and EP- 01010691 , EP-01044970, and FR252384; and PCT Publication Nos. WO 97/19682, WO 97/2082O5 WO 97/20821 , WO 97/20822, WO 97/20823, WO 98/27063, WO 00/107409, WO 00/185714, WO 00/185730, WO 00/64880, WO 00/68197, WO 00/69849, WO 01/09120, WO 01/14376, WO 01/85714, WO 01/85730, WO 01/07409, WO 01/02379, WO 01/02379, WO 01/23388, WO 01/23389, WO 01/44201, WO 01/62737, WO 01/62738, WO 01/09120, WO 02/20488, WO 02/22592, WO 02/48152, WO 02/49648, WO 02/051806, WO 02/094789, WO 03/009845, WO 03/014083, WO 03/022849, WO 03/028726, WO 05/014592, WO 05/01493; and Norman et al., i. Med. Chem. 43 :4288-4312 (2000); ( 10) leptin, such as recombinant human leptin (PEG-OB, Hoffman La Roche) and recombinant methionyl human leptin (Amgen); (H) leptin derivatives, such as those disclosed in Patent Nos. 5,552,524; 5,552,523; 5,552,522; 5,521,283; and WO 96/23513; WO 96/23514; WO 96/23515; WO 96/23516; WO 96/23517; WO 96/23518; WO 96/23519; and WO 96/23520; (12) opioid antagonists, such as nalmefene (Revex ®), 3-methoxynaItrexone, naloxone, and naltrexone; and those disclosed in WO 00/21509; (13) orexin antagonists, such as SB-334867-A (GlaxoSmithkline); and those disclosed in WO 01/96302, 01/68609, 02/44172, 02/51232, 02/51838, 02/089800, 02/090355, 03/023561, 03/032991, 03/037847, 04/004733, 04/026866, 04/041791, 04/085403, and the like; (14) BRS3 (bombesin receptor subtype 3) agonists; (15) CCK-A (cholecystokinin-A) agonists, such as AR- R 15849, GI 181771, JMV-180, A-71378, A-71623, PD170292, PD 149164, SR146131, SR125180, butabindide, and those disclosed in US 5,739,106; (16) CNTF (ciliary neurotrophic factors), such as GI-181771 (Glaxo-SmithKline); SR146131 (Sanofi Synthelabo); butabindide; and PD170,292, PD 149164 (Pfizer); (17) CNTF derivatives, such as axokine (Regeneron); and those disclosed in WO 94/09134, WO 98/22128, and WO 99/43813; (18) GHS (growth hormone secretagogue receptor) agonists, such as NN703, hexarelin, MK-0677, SM-130686, CP- 424,391 , L-692,429 and L-163,255, and those disclosed in U.S. Patent No. 6358951, U.S. Patent Application Nos. 2002/049196 and 2002/022637; and WO 01/56592, and WO 02/32888; (19) 5HT2c (serotonin receptor 2c) agonists, such as APD3546/AR10A (Arena Pharmaceuticals), ATH88651 (Athersys), ATH88740 (Athersys), BVT933 (Biovitrum/GSK), DPCA37215 (BMS), IK264; LY448100 (Lilly), PNU 22394; WAY 470 (Wyeth), WAY629 (Wyeth), WAYl 61503 (Biovitrum), R- 1065, VRl 065 (Vernalis/Roche) YM 348; and those disclosed in U.S. Patent No. 3,914,250; and PCT Publications 01/66548, 02/36596, 02/48124, 02/10169, 02/44152;
02/51844, 02/40456, 02/40457, 03/057698, 05/000849, and the like; (20) Mc3r (melanocortin 3 receptor) agonists; (21) Mc4r (melanocortin 4 receptor) agonists, such as CHIR86036 (Chiron), CHIR915 (Chiron); ME-10142 (Melacure), MB-10145 (Melacure), HS-131 (Melacure), NBI72432 (Neurocrine Biosciences), NNC 70-619 (Novo Nordisk), TTP2435 (Transtech)and those disclosed in PCT Publications WO 99/64002, 00/74679, 01/991752, 01/0125192, 01/52880, 01/74844, 01/70708, 01/70337, 01/91752, 01/010842, 02/059095, 02/059107, 02/059108, 02/0591 17, 02/062766, 02/069095, 02/12166, 02/11715, 02/12178, 02/15909, 02/38544, 02/068387, 02/068388, 02/067869, 02/081430, 03/06604, 03/007949, 03/009847, 03/009850, 03/013509, 03/031410, 03/094918, 04/028453, 04/048345, 04/050610, 04/075823, 04/083208, 04/089951 , 05/000339, and EP 1460069, and US 2005049269, and JP2005042839, and the like; (22) monoamine reuptake inhibitors, such as sibutratmine (Meridia ®/Reductil®) and salts thereof, and those compounds disclosed in U.S. Patent Nos. 4,746,680, 4,806,570, and 5,436,272, and U.S. Patent Publication No. 2002/0006964, and WO 01/27068, and WO 01/62341 ; (23) serotonin reuptake inhibitors, such as dexfenfluramine, fluoxetine, and those in U.S. Patent No. 6,365,633, and WO 01/27060, and WO 01/162341 ; (24) GLP-I (glucagon- like peptide 1) agonists; (25) Topiramate (Topimax®); (26) phytopharm compound 57 (CP 644,673); (27) ACC2 (acetyl-CoA carboxylase-2) inhibitors; (28) β3 (beta adrenergic receptor 3) agonists, such as rafebergron/AD9677/TAK677 (Dainippon/ Takeda), CL-316,243, SB 418790, BRL- 37344, L-796568, BMS-196085, BRL-35135A, CGP12177A, BTA-243, GRC1087 (Glenmark Pharmaceuticals) GW 427353 (solabegron hydrochloride), Trecadrine, Zeneca D7114, N-5984 (Nisshln Kyorin), LY-377604 (Lilly), KT07924 (Kissei), SR 591 19A, and those disclosed in US Patent Nos. 5,705,515, US 5,451 ,677; and WO94/18161, WO95/29159, WO97/46556,
WO98/04526 WO98/32753, WO 01/74782, WO 02/32897, WO 03/014113, WO 03/016276, WO 03/016307, WO 03/024948, WO 03/024953, WO 03/037881, WO 04/108674, and the like; (29) DGATl (diacylglycerol acyltransferase 1) inhibitors; (30) DGAT2 (diacylglycerol acyltransferase 2)inhibitors; (31) FAS (fatty acid synthase) inhibitors, such as Cerulenin and C75; (32) PDE (phosphodiesterase) inhibitors, such as theophylline, pentoxifylline, zaprinast, sildenafil, amrinone, milrinone, cilostamide, rolipram, and cilomilast, as well as those described in WO 03/037432, WO 03/037899; (33) thyroid hormone β agonists, such as KB-2611 (KaroBioBMS), and those disclosed in WO 02/15845; and Japanese Patent Application No. JP 2000256190; (34) UCP-I (uncoupling protein 1), 2, or 3 activators, such as phytanic acid, 4-[(E)- 2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-napthalenyl)-l-propenyl]benzoic acid (TTNPB), and retinoic acid; and those disclosed in WO 99/00123; (35) acyl-estrogens, such as oleoyl-estrorte, disclosed in del Mar-Grasa, M. et al, Obesity Research, 9:202-9 (2001); (36) glucocorticoid receptor antagonists, such as CP472555 (Pfizer), KB 3305, and those disclosed in WO 04/000869, WO 04/075864, and the like; (37) 1 lβ HSD-I (1 1-beta hydroxy steroid dehydrogenase type 1 ) inhibitors, such as BVT 3498 (AMG 331 ), BVT 2733, 3-( 1 -adamantyl)-4~ ethyl-5-(ethylthio)-4H-l,2,4-triazole, 3~(l-adamantyl)-5-(3,4,5-trimethoxyphenyl)-4-methyI-4H- 1,2,4-triazole, 3~adamantanyl-4,5,6,7,8,9,lO,l 1 ,12,3a-decahydro-l,2,4-triazolo[4,3- a][l IJannulene, and those compounds disclosed in WO 01/90091, 01/90090, 01/90092, 02/072084, 04/011410, 04/033427, 04/041264, 04/027047, 04/056744, 04/065351, 04/089415, 04/037251 , and the like; (38) SCD-I (stearoyl-CoA desaturase-1) inhibitors; (39) dipeptidyl peptidase IV (DPP-4) inhibitors, such as isoleucine thiazolidide, valine pyrrolidide, sitagliptin, saxagliptin, NVP-DPP728, LAF237 (vildagliptin), P93/01, TSL 225, TMC-2A/2B/2C, FE 99901 1, P9310/K364, VIP 0177, SDZ 274-444, GSK 823093, E 3024, SYR 322, TS021, SSR 162369, GRC 8200, K579, NN7201, CR 14023, PHX 1004, PHX 1149, PT-630, SK-0403; and the compounds disclosed in WO 02/083128, WO 02/062764, WO 02/14271, WO 03/000180, WO 03/000181, WO 03/000250, WO 03/002530, WO 03/002531, WO 03/002553, WO 03/002593, WO 03/004498, WO 03/004496, WO 03/005766, WO 03/017936, WO 03/024942, WO 03/024965, WO 03/033524, WO 03/055881, WO 03/057144, WO 03/037327, WO 04/041795, WO 04/071454, WO 04/0214870, WO 04/041273, WO 04/041820, WO 04/050658, WO 04/046106, WO 04/067509, WO 04/048532, WO 04/099185, WO 04/108730, WO
05/009956, WO 04/09806, WO 05/023762, US 2005/043292, and EP 1 258 476; (40) lipase inhibitors, such as tetrahydrolipstatin (orhstat/XENICAL), ATL962 (AHzyme/Takeda), GT389255 (Genzyme/Peptimmune)Triton WR1339, RHC80267, lipstatin, teasaponin, and diethyϊumbelliferyl phosphate, FL-386, WAY-121898, Bay-N-3176, valilactone, esteracin, ebelactone A, ebelactone B, and RHC 80267, and those disclosed in WO 01/77094, WO 04/111004, and U.S. Patent Nos. 4,598,089, 4,452,813, 5,512,565, 5,391,571 , 5,602,151, 4,405,644, 4,189,438, and 4,242,453, and the like; (41) fatty acid transporter inhibitors; (42) dicarboxylate transporter inhibitors; (43) glucose transporter inhibitors; and (44) phosphate transporter inhibitors; (45) anorectic bicyclic compounds such as 1426 (Aventis) and 1954 (Aventis), and the compounds disclosed in WO 00/18749, WO 01/32638, WO 01/62746, WO 01/62747, and WO 03/015769; (46) peptide YY and PYY agonists such as PYY336 (Nastech/Merck), AC162352 (IC Innovations/Curis/Amylin), TM30335/TM30338 (7TM
Pharma), PYY336 (Emisphere Tehcnologies), PEGylated peptide YY3-36, those disclosed in WO 03/026591 , 04/089279, and the like; (47) lipid metabolism modulators such as maslinic acid, erythrodiol, ursolic acid uvaol, betulinic acid, betulin, and the like and compounds disclosed in WO 03/01 1267; (48) transcription factor modulators such as those disclosed in WO 03/026576; (49) McSr (melanocortin 5 receptor) modulators, such as those disclosed in WO 97/19952, WO 00/15826, WO 00/15790, US 20030092041, and the like; (50) Brain derived neutotropic factor (BDNF), (51) McIr (melanocortin 1 receptor modulators such as LK-184 (Proctor & Gamble), and the like; (52) 5HT6 antagonists such as BVT74316 (BioVitrum), BVT5182c (BioVitrum), E-6795 (Esteve), E-6814 (Esteve), SB399885 (GlaxoSmithkline), SB271046 (GlaxoSmithkline), RO-046790 (Roche), and the like; (53) fatty acid transport protein 4 (FATP4); (54) acetyl-CoA carboxylase (ACC) inhibitors such as CP640186, CP610431, CP640188 (Pfizer); (55) C-terminal growth hormone fragments such as AOD9604 (Monash Univ/Metabolic Pharmaceuticals), and the like; (56) oxyntomodulin; (57) neuropeptide FF receptor antagonists such as those disclosed in WO 04/083218, and the like; (58) amylin agonists such as Symlin/pramlintide/AC137 (Amylin); (59) Hoodia and trichocaulon extracts; (60)
BVT74713 and other gut lipid appetite suppressants; (61) dopamine agonists such as bupropion (WELLBUTRIN/GlaxoSmithkline); (62) zonisamide (ZONEGRAN/Dainippon/Elan), and the like.
Specific compounds that can be used in combination with the OXM analogs disclosed herein include specific CBl antagonists/inverse agonists include those described in
WO03/077847, including: N-[3-(4-chlorophenyl)-2(5)-phenyl- 1 (5)-methylpropyl]-2-(4- trifluoromethyl-2-pyrimidyloxy)-2-methylpropanamide> /V-[3-(4-chlorophenyl)-2-(3- cyanophenyl)- 1 -methylpropyl]-2-(5-trifluoromethyl-2-pyridyloxy)-2-methylpropanamide, JV-[3- (4-chlorophenyl)-2-(5-chloro-3-pyridyl)-l-methylρropyl]-2-(5-triflιioromethyl-2-pyridyloxy)-2- methylpropanamide, and pharmaceutically acceptable salts thereof; as well as those in
WO05/000809, which includes the following: 3- { 1 -[bis(4-chlorophenyl)methyl]azetidin-3- ylidene} -3-(3,5-difluorophenyl)-2,2-dimethylpropanenitrile, 1 - { 1 -[ 1 -(4- chlorophenyl)pentyl] azetidin~3 -yl } - 1 -(3 , 5-difluorophenyI)-2-methylpropan-2-ol. 3 ~((S)-(4- chlorophenyl) {3-[(l S)-I -{3,5-difluorophenyl)-2-hydroxy-2-methylpropyl]azetidin-l- yl}methyl)benzonitrile, S-^SJ^-chlorophenylXS^tlS^l-lS^-difluoropheny^^-fluoro-l- methylproρyl]azetidin-l -yl }methyl)benzonitrile, 3-((4-chlorophenyl) {3-[ 1 -(3 ,5-difluorophenyl)- 2,2-dimelhyIρropyl]azetidin-l-yl}methyl)benzonitrile, 3-((lS)-l-{l-[(S)-(3-cyanoρhenyl)(4- cyanophenyl)methyl]azetidin-3-yl}-2-fluoi'o-2-methylpropyl)-5-fluorobenzomtrileJ 3-[(S)-{4- chloroρhenyl)(3- {(1 S)-2-fluoro~ 1 -[3-fluoro-5-(4H-l ,2 ,4-triazol-4-yl)phenyl]-2~ methylρropyl}azetidin-l -yl)methyl]benzonitrile, and 5-((4-chlorophenyI) {3-[( I S)- 1 -(3,5- difluorophenyl)-2-fluoro-2-methyIpropyl]azetidin-l-yl}methyl)thiophene-3-carbonitriϊe, and pharamecueitcally acceptable salts thereof; as well as: 3-[(iS)-(4-ch-orophenyl)(3-
Figure imgf000058_0001
l-[3-fluoro-5-(5-oxo~4,5-dihydro-l,3,4-oxadiazol-2-yl)phenyl]-2-methylpropyl}azetidin-l- yl)methyl3benzonitrileJ 3-[(5)-(4-chlorophenyl)(3-{(li$)-2-fluoro-l-[3-fluoro-5-(ls3,4-oxadiazol- 2-yl)phenyl]-2-methylpropyl } azetidin-1 -yl)methyl]benzonitrile, 3-[(.S)-(3- {(15)- l-[3-(5-amino- l,3.4-oxadiazoI-2-yl)-5-"fluoroρhenyl]-2-fluoro-2-methylproρyl} azetidin-l-yl)(4- chlorophenyl)methyl]benzonitrile, 3-[(*SΗ4-cyanophenyl)(3- {(15)-2-fluoro-l -[3-fluoro-5-(5-oxo- 4,5-dihydro-l,3,4-oxadiazol-2-yl)phenyl]-2-methylpropyl}azetidin-l-yl)methyl]benzomtrile, 3- [(-S)-(3 - (( 15)- l - E3 -(5-amino- 1 ,3 ,4-oxadiazol-2-yl)~5-fluorophenyl] -2-fluoro-2 -methylpropyl } azetidin-1 -yl)(4-cyanophenyl)methyl]benzonitrile, 3-[(5)-(4-cyanophenyϊX3-{(15)-2-lluoro-l-[3- fluoro-5-(1354-oxadiazol-2-yl)phenyl]-2-methylpropyl}azetidin-l-yl)methyl]benzonitrile, 3-[(S)- (4-chloroρhenyl)(3- {(15)-2-fluoro-l -[3-fluoro-5-(l ,2,4-oxadiazol-3-yl)phenyl]-2- methyϊpropyl } azetidin-1 -yl)methyl]benzonitrile, 3 -[(15)- 1 -(I - {(»S)-(4-cyanophenyl)[3-( 1 ,2,4- oxadiazol-3-yl)phenyl]-methyl}azetidin-3-yl)-2-fluoro-2-methylpropyl]-5-flυorobenzonitrile, 5- (3 - { 1 -[ 1 -(diphenylmelhyl )azeti din-3-yI ] -2~fluoro-2-methylpropyl } -5-fluorophenyl)- 1 H-tetrazole, 5-(3- { 1 -[ 1 -(diphenyltnethyl)azetidin-3-yl]-2-fluoro-2-methylpropyl}-5-fluorophenyl)-l -methyl- lH-tetrazole, 5-(3-{l-[l-(diphenylmethyl)azetidin-3-yl]-2-fluoro-2-methyIpropyl}-5- fluoroρhenyl)-2-methyl-2H-tetrazole, 3-[(4-chloroρhenyϊ)(3- (2-flυoro- 1 -[3-fluoro-5-(2-methyl- 2H-tetrazol-S-yl)phenyl]-2-methylproρyl}azetidin-l-yl)methyl]benzonitrile, 3-[(4- chlorophenyl)(3» {2-iluoro-l -[3-fluoro-5-(l -methyl-l//-tetrazoI-5-yl)phenyl]-2- melhylpropyl}azelidin-l -yl)methyl]benzonitrile, 3-[(4-cyanophenyl)(3- {2-fluoro-l -[3-fluoro-5- (l-methyl-l//-tetrazol-5-yl)phenyl]-2-methylpropyl}azetidin-l-yl)methyl]benzonitrile, 3-[(4- cyanoρhenyl)(3- {2-fluoro- 1 -[3-fluoro-5-(2-methyl-2//-tetrazol-5-yl)phenyl]-2- methylpropyl}azetidin-l-yl)methyl]benzonitrile, 5-{3-[(iS)-{3-[(15)-l-(3-bromo-5-fluoroρhenyI)- 2-fluoro-2-methylpropyl] azetidin- 1 -yl } (4-chlorophenyl)methyl Jphenyl } - 1 ,3 ,4-oxadiazol-2(3//)- one, 3-[(15)-l-(l-{(5)-(4-chlorophenyl)[3-(5-oxo-4,5-dihydro-l,3,4-oxadiazo]-2- yl)ρhenyl]methyl) azetidin-3-yl)-2-fluoro-2-methylρropyl]-5-fluorobenzonitrile, 3-[(15)-l-(l- {(5)-(4-cyanoρhenyl)[3-(5-oxo-4,5-dihydro-l,3,4-oxadiazol-2-yl)ρhenyl]methyl} azetidin-3-yl)- 2-fluoro-2-methylpropyl]-5-fluorobenzonitrile, 3-[( 1 S)A -( 1 - {(iS)-(4-cyanophenyl)[3-(l ,3,4- oxadiazol-2-yl)ρhenyI]methyl}azetidin-3-yl)-2-fluoro-2-methylproρyl]-5-fluorobenzonitrile, 3- [( 3 S)- 1 -( 1 - {(,S)-(4-chlorophenyl)[3-( 1 ,3 ,4-oxadiazol-2-yl)phenyl]methyl } azetidin-3 -yI)-2-fluoro- 2-methylpropyl]-5-fluorobenzonitrile5 3-((1S)- 1 - { 1 -[(_S)-[3-(5-arnino-l ,3,4-oxadiazol-2- yl)ρhenyl](4-chlorophenyl)methyl]azetidin-3-yl}-2-fluoro-2-methylpropyl)-5-fluorobenzonitrile, 3-((15)-l-{l-[(5)-[3-(5-amino-l?3,4-oxadiazol-2-yl)phenyl](4-cyanophenyl)methyl]azetidin-3- yl} -2-fluoiO~2-methyIpropyI)~5-fluorobenzonitrile, 3-[(1.S)-I -(I - {(S)-(4-cyanophenyl)[3-(l ?2,4- oxadiazol-3-yl)phenyl]methyl}azelidin-3-yl)-2-fluoro-2-methylpropylJ-5-fluorobenzonitrile, 3- [(ltS)-l-(l- {(l$)-(4-chlorophenyl)[3-(l52,4-oxadiazol-3-yl)phenyl]methyl}azetidin-3-yl)-2-fluoro- 2-methylpropyl]-5-fluorobenzonitrileJ 5-[3-((5)-(4-chlorophenyl){3-(;(lιS)-l-(3,5-difluoroρhenyl)- 2-fluoro-2-methylρropyl] azetidin- 1 -yϊ}methyl)phenyl]- 1 ,3,4-oxadiazol-2(3H)-one, 5-[3-((Λ)-(4- chlorophenyl) {3-[(l S)- 1 -(3,5-difluorophenyl)-2-fluoro-2-methylρropyl]azetidin- 1 - yl}melhyl)phenyl]-l,3,4-oxadiazol-2(3H)-one, 4-{(5)-{3-[(15)-l-(3,5-difluorophenyl)-2-fluoro- 2-methylpropyl]azetidin-l-yl}[3-(5-oxo-4,5-dihydro-l,3,4-oxadiazol-2-yl)ρhenyl]methyl}- benzonitrile, ACOMPLIA (rimonabant, N-(I -piperidinyl)-5-(4-chlorophenyl)-l -(2,4- dichlorophenyl)-4-methylpyrazole-3-carboxamide, SRl 41716A), 3-(4-chlorophenyl-N'-(4- chloroρhenyl)sulfonyl-N-methyl-4-phenyl-4,5-dihydro-l H-pyrazole-1 -carboxamide (SLV-319)} taranabant, N-[(l S,2S)-3-(4-Chlorophenyl)-2-(3-cyanophenyl)-l-methylpropyl]-2-methyl"2-[[5- (triflυoromethyl)-2-pyridinyl]oxy]propanamide, and pharmaceutically acceptable salts thereof. Specific NPY5 antagonists that can be used in combination with the OXM analogs disclosed herein include: 3-oxo-N-(5-phenyl-2-ρyrazinyl)-sρiro[isobenzoflιran-l(3H),4'- piρeridme]-r-carboxamide, 3-oxo-N-(7-trifluoromethylρyrido[3,2-b]pyridin-2-y!)spiro- [isobenzofuran-1 (3H),4'-piperidine]-l '-carboxamide, N-[5-(3-fluorophenyl)-2-pyrimidinyl]-3- oxospiro-[isobenz;ofuran-l(3H),4'-piperidine]-r-carboxamide, trans-3'-oxo-N-(5-phenyl-2- pyrimidinyl)spiro[cyclohexane- 1 , 1 '(3 Η)-isobenzofuran]-4-carboxamide, trans-3 '-oxo-N-[ 1 -(3- quinolyl)-4-imidazolyl]spiro[cyclohexane-l ,1 '(3'H)-isobenzofuran]-4-carboxamide, trans-3-oxo- N-(5-phenyl-2-pyraziny])spiro[4-azaiso-benzofuran- 1 (3H), 1 '-cyclohexane] -4 '-carboxamide, trans-N-[5-(3-fluorophenyI)-2-pyrimidinyl]-3-oxosρiro[5-azaisobenzofuran-l(3H)}r- cyclohexane] -4 '-carboxamide, trans-N-[5-(2-fluoroρhenyl)-2-pyrimidinyl]-3-oxospiro[5- azaisobenzofuran-1 (3H),1 '-cyclohexane] -4 '-carboxamide, trans-N-[l-(3,5-difluoroρhenyl)-4- imidazolyl]-3-oxosρiro[7-azaisobenzofuran-l(3H),l '-cyclohexane]-4'-carboxamide, trans-3-oxo- N-(I -ρhenyl-4-pyrazolyl)spiro[4-azaisobenzoturan- 1 (3H), 1 '-cyclohexane] -4 '-carboxamide, trans-N-[ 1 -(2-fluorophenyl)-3-pyrazolyl]-3-oxospiro[6-azaisobenzofuran-l (3H), 1 ' -cyclohexane]- 4'-carboxamidej trans-3-oxo-N-(l-ρherjyl-3-pyrazolyl)spiro[6-azaisobenzofuran-l(3H),r- cyclohexane]-4'-carboxamide, trans-3-oxo-N-(2-phenyl- 1 ,2,3-triazol-4-yl)spiro[6- azaisobenzofuran-l(3H)jl !-cyclohexane]-4'-carboxamide, and pharmaceutically acceptable salts and esters thereof. Specific ACC- 1/2 inhibitors that can be used in combination with the OXM analogs disclosed herein include: r-[(4,8-dimethoxyquinolin-2-yl)carbonyl]-6-(lH-tetrazol-5- yl)spiro[chroman-2 ,4'-piperidin]~4-one; (5- { 1 '-[(4,8-dimethoxyquinolin-2-yl)carbonyl]-4- oxospiro[chroman-2,4'-piperidin]-6-yl}-2//-tetrazol-2-yl)methyl pivalate; 5-{l'-[(8-cyclopropyl- 4-methoxyquinolJn-2-yl)carbonyl]-4-oxospiro[chroman-2,4'-piperidin]-6-yl}nicotinic acid; 1 '-(8- methoxy-4-morpholin-4-yl-2-naphthoyl)-6-(l//-tetrazol~5-yI)sρiro[chroman-2,4'-ρiperidin]-4- one; and 1 '-[(4-ethoxy-8-ethylquinolin-2-yl)carbonyl]-6-(lH-tetrazol-5-yl)spiro[chroman-2,4'" piperidin]-4-one; and pharmaceutically acceptable salts and esters thereof. Specific
MCHlR antagonist compounds that can be used in combination with the OXM analogs disclosed herein include: 1 - {4-[( 1 -ethylazetidin-3 -yl)oxy]phenyl } -4- [(4-fϊuorobenzyl)oxy]pyridin-2( 1 H)- one, 4- [ (4-fluorobenzyl)oxy] - 1 - {4-[ ( 1 -i sopropylazetidin- 3 -yl)oxy]phenyl } pyridin-2( ϊ H)-one, 1 - [4-(azetidin-3-yloxy)phenyl]-4-[(5-chloropyridin-2-yl)methoxy]pyridin-2(lH)-one, 4-[(5- chloroρyridin-2-yl)methoxy]-l - {4-[(l -ethylazetidin-3-yl)oxy]phenyl}pyridin-2(17i)-one, 4-[(5- chloroρyridin-2-yl)methoxy]-l-{4-[(l-ρropylazetidin-3-yl)oxy]phenyl}pyridin-2(lH)-ones and 4- [(5-chloropyridin-2-yl)methoxy]~l-(4-{[(25)-l-ethylazetidin-2-yl]methoxy}phenyl)pyridin- 2(l//)-one, or a pharmaceutically acceptable salt thereof.
A specific DPP-ΪV inhibitor that can be used in combination with the OXM analogs disclosed herein is 7-[(3R)-3-amino-4-(254J5-trifluoroρhenyl)butanoyl]-3-(trifluoromethyl)- 5,ό,7,8-tetrahydro-l,2j44riazolo[4,3-a]pyrazine, or a pharmaceutically acceptable salt thereof. Specific H3 (histamine H3) antagonists/inverse agonists that can be used in combination with the OXM analogs disclosed herein include: those described in WO05/077905, including:3- {4-[(l -cyclobutyl-4-piperidinyl)oxy]ρhenyl} -2-ethylρyrido[2,3-d]-pyrimidin-4(3H)-one, 3- {4- [(l-cyclobutyl-4-piperidinyl)oxy]phenyl}-2-methylpyrido[4,3-d]pyrimidin-4(3H)-one, 2-ethyI-3- (4-{3-[(3S)-3-methylpiperidin-l-yϊ]propoxy}phenyl)pyrido[2,3-d3pyrimidin-4(3H)-one 2- methyl-3-(4»{3-[(3S)-3-methylpiperidin-l-yl]propoxy}phenyl)pyrido[4,3-d]pyrimidin-4(3H)- one, 3-{4-[(l-cyclobutyl-4-piperidinyl)oxy]phenyl}-2J5-dimethyl-4(3H)-quinazolinone, 3-{4-[(l- cyclobutyl-4-piρeridinyl)oxy]ρhenyl}-2-methyl-5-triiluoromethyl-4(3H)-quinazolinone, 3-{4- [(l-cyclobutyl-4-piperidinyl)oxy]phenyl}-5-methoxy-2-methyl-4(3H)-quinazolinone, 3-{4-[(l- cyclobutylpiperidin-4-yl)oxy]phenyl}-5-fluoro~2-methyl-4(3H)-quinazolinone, 3- {4-[(l - cycIobutylpiperidin-4-yl)oxy]phenyl}-7-fluoro-2-methy]-4(3H)-quinazolinoneJ 3-{4-[(l- cyclobutylρiρeridin-4-yl)oxy]phenyl } ~6-methoxy-2-methyl-4(3 H)-quinazolinone, 3 - {4- [( 1 - cyclobutylpiperidin-4-yl)oxy]phenyl}-6-fluoro-2-methyl-4(3H)-quinazolinoneJ 3-{4-[(l- cyclobutylpiperidin~4-yl)oxy]phenyl}-8-fluoro-2-methyl-4(3H)-quinazolinone, 3-{4-[(l-cyclopentyl-4-ρiperidinyl)oxy]phenyl}-2-methylpyrido[4,3-d]pyrimidin-4(3H)-one, 3- {4-[(l-cyclobutylpiperidin-4-yl)oxy]phenyl}-6-fluoro-2-methylpyrido[3,4-d]pyrimidin-4(3H)- one, 3- {4-[(l -cyclobutyl-4-piperidinyl)oxy]phenyl}-2-ethylpyrido[4,3-d]pyrimidin-4(3H)-one, 6- methoxy-2-methyl-3- {4- [3 -(I -piperidinyl)proρoxy]phenyl }pyrido[3,4-d]pyrimidin-4(3H)-oneJ 6- methoxy-2-methyl-3-{4-f3-(l-pyrrolidinyl)propoxy]phenyl}pyrido[3,4-d]ρyrimidin-4(3H)-one, 2,5-dimethyl-3~{4-[3-(l-pyrrolidinyl)propoxy]phenyI}-4(3H)-quinazolinone, 2-methyl-3-{4-[3- (1 -pyrrolidinyl)proρoxy]phenyl } -5-trifluoromethyϊ~4(3H)-quinazolmone, 5-fluoro-2-methyl-3- {4-[3-( 1 -piperidinyl)propoxy]ρhenyl} -4(3H)-quinazolinone, 6~methoxy-2-methyl-3- {4-[3-(l - piperidinyl)propoxy]phenyl}-4(3H)-quinazolinone, 5-methoxy-2-methyl-3-(4-{3~[(3S)-3- methylpiperidin-l-yl]propoxy}pheiiyl)-4(3H)-quina2olinoiie, 7-methoxy-2~methyl-3-(4- {3-[(3S)- 3-methylpiperidin-l-yl]propoxy}phenyl)-4(3H)-quinazolinone, 2-methyl-3-(4-{3-[(3S)-3- methylρiperidin-l-yl]proρoxy}phenyl)pyrido[2,3-d]pyrimidiii-4(3H)-one, 5-fluoro-2-methyl-3- (4- {3-[(2R)-2-methylpyrrolidin-l -yl]propoxy}phenyl)-4(3H)-quinazolinone, 2-methyl-3-(4- (3- [(2R)-2-methylpyrrolidin- 1 -yI]ρropoxy}phenyl)pyrido[4,3-d]pyrimidin-4(3H)-one, 6-methoxy-2- methyl-3-(4- {3-[(2R)-2-methylpyrrolidin-l -yl]propoxy}phenyI)-4(3H)-quinazolinone, 6- methoxy-2-methyl-3-(4-{3-[(2S)-2-methylpyrroHdin-l-yl]propoxy}ρhenyl)-4(3H)-qιιinazolinorιe, and pharmaceutically acceptable salts thereof.
Specific CCKlR agonists of use in combination with the OXM analogs disclosed herein include: 3 -(4- { [ 1 -(3 -ethoxyphenyl)-2-(4-methylphenyl)- IH -imidazol-4-yl]carbonyl } - 1 - piperazinyl)- 1 -naphthoic acid; 3-(4- {[1 -(3-ethoxyphenyl)-2-(2-fluoro-4"methylphenyl)-lH - imidazol-4-yl]carbonyl}-l -piperazinyl)- 1 -naphthoic acid; 3 -(4- {[1 -(3-ethoxyphenyl)-2-(4- fluoropheny I)-IH -imidazol-4-yl]carbonyl}-l -piperazinyl)- 1 -naphthoic acid; 3-(4-{[l-(3- ethoxyphenyl)~2-(2,4-difluorophenyl)- 1 H -imidazol-4-yl]carbonyl } - 1 -piperazinyl)- 1 -naphthoic acid; and 3-(4- {[ 1 -(2,3-dihydro-l ,4-benzodioxin-6-yl)-2-(4-fluorophenyl)-li/-imidazol-4- yl]carbonyl}-l-piperazinyl)-l -naphthoic acid; and pharmaceutically acceptable salts thereof.
Specific MC4R agonists of use in combination with the OXM analogs disclosed herein include: 1) (S^-r-ltCSΛ^^-l-tert-butyl-S^^^-trifluorophenyOpiperidin^-ylJcarbonylJ-S- chloro-2-methyl-5-[l-methyl-l-(l-methyI-lH-l52,4-triazol-5-yl)ethyI]-5/7-sρiro[furo[3!4- &]pyridine-7>4'-ρiperidine]; 2) (5i?)-r-{[(3i?,4i?)-l-tert-butyl-3-(253,4-trifluorophenyl)-piperidin- 4-yl]carbonyl } ~3-chloro-2~raethyl-5-[ 1 -methyl- 1 -(I -methyl- liϊ-1 , 2,4-triazol-5-yl)ethyl]-5//- spiro[furo[3,4-ό]pyridme-7,4'-ρiperidine3; 3) 2-(l'- {[(3-S',4Λ)-l-fert-butyl-4-(2,4- difluorophenyl)ρyrrolidin-3 -yl] carbonyl } -3 -chloro-2-methyl-5H-sρiro [furo [3 ,4-δ]pyridine-7,4'- piperidin]-5-yl)-2-methylpropanenitrile; 4) 1 '- ([(35,4U)-I -tø?-butyl-4-(2,4~ difluorophenyl)pyrroΗdin-3-yl]carbonyl}-3-chloro-2-methyl-5-[l-methyl-l-(l"methyl-l//-l72,4- triazol-5-yl)ethyl]-5//-spiro[furo[3,4-ά]pyridine-7,4'-piperidine]; 5) iV-[(3i?,4i?)-3-({3-chloro-2- methyl-5-[ 1 -methyl- 1 -(I -methyl- IH-1 ,2,4-triazol-5-yl)ethyl]-l 'H,5H-spiro[furo-[3 ,4-6]pyridine- 7,4l-piperidin]-l'-yl}carbonyl)-4-(2,4-difluorophenyl)-cyclopentyl]-Λr-methyltetrahydro-2H- pyran-4-amine; 6) 2-[3-chloro-r-({(li?,2j[?)-2-(2)4-difluoroρhenyI)-4-[methy}(tetrahydro-2H- pyran-4-yl) amino] -cyclopentyl } -carbonyI)-2-methyl-5H-spiro[furo[3 ,4-έ»]pyridine-754'- piperidin]-5-yl]-2-methy]-propane-nitrile; and pharmaceutically acceptable salts thereof. Additionally, other peptide analogs and mimetics of the incretin hormone glucagon-like peptide 1 (GLP-I), may also be of use in combination with the OXM analogs disclosed herein. Methods of administrating the pharmacological compositions comprising the one or more OXM analogs disclosed herein to an individual include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The compositions can be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (for example, oral mucosa, rectal and intestinal mucosa, and the like), ocular, and the like and can be administered together with other biologically-active agents. Administration can be systemic or local, In addition, it may be advantageous to administer the composition into the central nervous system by any suitable route, including intraventricular and intrathecal injection. Intraventricular injection may be facilitated by an intraventricular catheter attached to a reservoir (for example, an Ommaya reservoir). Pulmonary administration may also be employed by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. It may also be desirable to administer the one or more OXM analogs disclosed herein locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, by injection, by means of a catheter, by means of a suppository, or by means of an implant.
Various delivery systems are known and can be used to administer the OXM analogs disclosed herein including, but not limited to, encapsulation in liposomes, microparticles, microcapsules; minicells; polymers; capsules; tablets; and the like. In one embodiment, the OXM analogs disclosed herein may be delivered in a vesicle, in particular a liposome. In a liposome, the OXM analogs disclosed herein are combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids which exist in aggregated form as micelles, insoluble monolayers, liquid crystals, or lamellar layers in aqueous solution. Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like. Preparation of such liposomal formulations is within the level of skill in the art, as disclosed, for example, in U.S. Patent No. 4,837,028 and U.S. Patent No. 4,737,323. In yet another embodiment, the OXM analogs disclosed herein can be delivered in a controlled release system including, but not limited to: a delivery pump (See, for example, Saudek, et a!., New Engl. J. Med. 321: 574 (1989) and a semi -permeable polymeric material (See, for example, Howard, et at., J. Neurosurg, 71 : 105 (1989)). Additionally, the controlled release system can be placed in proximity of the therapeutic target (for example, the brain), thus requiring only a fraction of the systemic dose. See, for example, Goodson, In: Medical Applications of Controlled Release, 1984. (CRC Press, Bocca Raton, FIa.). The amount of the compositions comprising one or more of the OXM analogs disclosed herein which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and may be determined by standard clinical techniques by those of average skill within the art. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the overall seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances, Ultimately, the attending physician will decide the amount of the composition with which to treat each individual patient. Initially, the attending physician will administer low doses of the composition and observe the patient's response. Larger doses of the composition may be administered until the optimal therapeutic effect is obtained for the patient, and at that point the dosage is not increased further. In general, the daily dose range lie within the range of from about 0.001 mg to about 100 mg per kg body weight of a mammal, preferably 0.01 mg to about 50 mg per kg, and most preferably 0.1 to 10 mg per kg, in single or divided doses. On the other hand, it may be necessary to use dosages outside these limits in some cases. However, suitable dosage ranges for intravenous administration of the compositions comprising the one or more OXM analogs disclosed herein are generally about 5-500 micrograms (μg) of active compound per kilogram (Kg) body weight. Suitable dosage ranges for intranasal administration are generally about 0.01 pg/kg body weight to 1 mg/kg body weight. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems, Suppositories generally contain active ingredient in the range of 0.5% to 10% by weight; oral formulations preferably contain 10% to 95% active ingredient. Ultimately the attending physician will decide on the appropriate duration of therapy using compositions comprising the one or more OXM analogs disclosed herein of the present invention. Dosage will also vary according to the age, weight and response of the individual patient.
Further provided is a pharmaceutical pack or kit, comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions and OXM analogs disclosed herein. Optionally associated with such container(s) may be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
All references disclosed herein are incorporated herein in their entirety, The following examples are intended to promote a further understanding of the present invention.
EXAMPLE 1 The synthesis of the Oxyntomodulin (OXM) analogs was essentially as follows. The OXM analogs shown in Table 2 below were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer APEX 396 (Advanced Chemtech) using a 40-well reaction block. Each peptide was synthesized in a single well. For peptide amides, 0.1 g of an aminomethylated polystirene LL (100-200 mesh, 0.41 mmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S)-α-[9H-Fluoren-9-yl-methoxyforraamido]-2J4- dimethoxybenzylj-phenoxyacetic acid (Rink, H., 1987, Tetrahedron Lett. 28:3787-3789; Bernatowicz, M. S. et al, 1989, Tetrahedron Lett. 30:4645-4667) was used. All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5M HOBt (Hydroxybenzotriazole) in DMF. The acylation reactions were performed for 45 minutes with six-fold excess of activated amino acid over the resin free amino groups. The amino acids were activated with equimolar amounts of HBTU (2-(lH~benzotriazole-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate) and a two-fold molar excess of DIEA (N,N-diisopropylethylamine).
Alternatively, the peptides were synthesized by solid phase using Fmoc/t-Bu chemistry on a Pioneer Peptide Synthesizer (Applied Biosystems). In this case, 0.1 g of a resin Fmoc- Linker AM-Champion, 1% cross-linked (Biosearch Technologies, Inc.) and a PEG-PS-based resin derivatized with a modified Rink linker p-[(R,S)-α-[9H-Fluoren-9-yl-methoxyformamido]- 2,4~dimethoxybenzyl]-phenoxyacetic acid (Rink, H., 1987, Tetrahedron Lett. 28:3787-3789; Bernatowicz, M. S. et al, 1989, Tetrahedron Lett. 30:4645-4667) was used. All the acylation reactions were performed for 60 minutes with a four-fold excess of activated amino acid over the resin free amino groups following the end of peptide assembly on the synthesizer; double coupling was performed for N-terminal Aib and His.
The side chain protecting groups were: OMpe (0-3 -Methyl -pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, GIn, and His; and, tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg.
For OXMl 10 and OXM 177, Lysine-Palmitoyl was manually acylated by reaction with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l,l,3,3~tetramethyluronium hexafluorophosphate) and a 2-fold molar excess of DIEA (N,N-diisoρropylethylamine). The acylation reaction was performed for 120 minutes with a three-fold excess of activated acylant over the resin free amino groups.
At the end of the synthesis, the dry peptide-resins were individually treated with 20 mL of the cleavage mixture, 88% trifluoroacetic acid (TFA), 5% phenol, 2% triisopropylsilane and 5% water (Sole, N. A. and G. Barany, 1992, J Org, Chem. 57:5399-5403) for 1.5 hours at room temperature. Each resin was filtered and the solution was added to cold methyl -t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H2O, 20% acetonitrile, and lyophilized. The crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM c.4 cartridges (40 x 200 mm, 15 μm) and using as eluents (A) 0.1% TFA in water and (B) 0.1 % TFA in acetonitrile. The following gradient of eluent B was used: 20%-20% over five minutes and 20%-35% over 20 minutes for the OXM229 (the peptide thiolated precursor of OXM36 and OXMI l 5), OXM29 (the thiolated precursor of OXM70 and OXM216), OXM208 (the peptide thiolated precursor of OXM212), and OXM209 (the peptide thiolated precursor of 0XM213).
For peptides OXMl 10 and 177, the following gradient of eluent B was used: 32%-32% over five minutes and 32%-42% over 20 minutes flow rate 80 mL/min. Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45 C°, using H2O, 0.1 % TFA (A) and CH3CN,
0.1% TFA (B) as solvents and the following linear gradient: 20%-20% B (in five minutes) - 35%B (in 20 minutes) - 80% B (in two minutes), flow 1 mL/min. The purified peptide was characterized by electrospray mass spectrometry on a Micromass LCZ platform.
EXAMPLE 2
Synthesis of Oxyntomodulin (OXM) cholesterylated analogs OXM36, OXM70, OXMl 15, OXM212, OXM213, and OXM216 was as follows.
The reactions were run under conditions that permit the formation of a thioether bond. The cholesterylaled OXM peptides were then isolated using reverse-phase HPLC and characterized on a Micromass LCZ platform. The analogs OXM36, 70, 212, and 213 were synthesized from the thiol containing OXM peptide precursor OXM229, OXM208, and 209, respectively, by reaction with the bromo derivative, choϊest-5-en-3-yl bromoacetate having the structure
Figure imgf000065_0001
cholest-δ-en-3-yl bromoacetate to produce conjugates attached via a thioether bond. Briefly, 30 mg of peptide precursor were dissolved in one mL of DMSO (cone. 30 mg/mL) and a one molar excess of cholest-5~en-3-yl bromoacetate dissolved in THF (cone. 20 mg/mL) was added. Then 1% by volume of DIPEA (N,N-diisoρropyl-ethylamine) was added to the mixture; after 30 minutes of incubation, the peptide solution was purified by RP-HPLC and characterized on a Micromass LCZ platform.
The peptides OXMl 15 and 216 were synthesized from the thiol containing OXM peptide precursor OXM229 and OXM29 to produce analogs by reaction with the bromo derivative, cholest-5-en-3-yl l-bromo-2-oxo-ό,9,l 2,15-tetraoxa-3-azaoctadecan-l 8-oate
Figure imgf000066_0001
cholest-5-en-3-yl 1 -bromo-2-oxo-6,9,12,15-tetraoxa-3-azaoctadeca n-18-oate
to produce conjugates attached via a thioether bond. Briefly, 30 mg of peptide precursor were dissolved in J mL of DMSO (cone. 30 mg/mL) and a one molar excess of cholest-5-en-3-yl 1- bromo-2-oxo-6,9,l 2, 15-tetraoxa-3~azaoctadecan-l 8-oate dissolved in THF (cone. 20 mg/mL) was added. Then 3% by volume of DIPEA (N;N-diisopropyl-ethylamine) was added to the mixture; after 30 minutes of incubation, the peptide solution was purified by RP-HPLC and characterized on a Micromass LCZ platform.
EXAMPLE 3
PEGylation reactions were run under conditions permitting thioester bond formation. The PEGylated OXM peptide was then isolated using reverse-phase HPLC or ion exchange chromatography and size exclusion chromatography (SEC). PEGylated OXM analogs were characterized using RP-HPLC, HPLC-SEC and MALDI-Tof Mass Spectrometry.
OXM33, 34, 35, 36 and 54 peptides were synthesized from the thiol-containing OXM peptide precursor OXM229 to produce analogs with PEG covalently attached via a thioether bond.
Synthesis ofOXM33 10 mg of peptide precursor (2,2 μmoles) were dissolved in 0.2 mL of HEPES 0.1M pH 7.3, Guanidinium Chloride 6M, 2 mM EDTA. 22 mg of MPEG-M AL-5000 (NEKTAR 2F2MOH01) (4.4 μmoles) dissolved in 0.4 mL HEPES 0.1M, pH 7.3 (1 :2 mole/mole ratio of peptide to PEG) was added to this solution. After 1 hour incubation, the PEGylated peptide was purified by RP-HPLC and characterized by MALDI-TOF.
Synthesis ofOXM34
10 mg of peptide precursor (2.2 μmoles) were dissolved in 0.2 mL of HEPES 0.1 M pH 7.3, Guanidinium Chloride 6M, 2 mM EDTA. 80 mg of MPEG-MAL-20K (NEKTAR 2F2M0P01 ) (4.0 μmoles) dissolved in 0.5 mL HEPES 0.1 M, pH 7.3 (1:1.8 mole/mole ratio of peptide to PEG) was added to this solution. After 1 hour incubation, the PEGylated peptide was purified by RP-HPLC and characterized by MALDI-TOF.
Synthesis ofOXM35 10 mg of peptide precursor (0.92 μmoles) were dissolved in 0.4 mL of HEPES OJM pH
7.3, Guanidinium Chloride 6M, 2 mM EDTA. 70 mg of MPEG2-MAL-40K (NEKTAR
2D3 YOTOl) (1.7 μmoles) dissolved in 0.8 mL HEPES 0.1 M, pH 7.3 in a 1 :1.8 mole/mole ratio of peptide to PEG was added to this solution.. After 1 hour incubation, the PEGylated peptide was purified by RP-HPLC and characterized by MALDI-TOF. The control peptide OXM54, was prepared by incubating the thiol containing peptide precursor with 10 eq, of iodoacetamide in 0.1 M TrisHCl pH 7.5, 6M guanidinium chloride.
After 30 minutes incubation the peptide was purified by RP-HPLC and characterized by electrospray mass spectrometry.
Synthesis of OXMlOi, OXM105, OXM107, OXMl 13
10 mg of the corresponding peptide precursors (2.26 μmoles) were dissolved in 2 mL of urea 8M, HEPES 0. IM pH 7.3, 2 mM EDTA. 109 mg of MPEG2-MAL-40K (NEKTAR 2D3Y0T01) (2.71 μmoles) dissolved in H2O (1 :1.2 mole/mole ratio of peptide to PEG) was added to this solution.. After 1 hour incubation, the PEGylated peptide solution was acidified to 1 % acetic acid and purified by cation exchange chromatography (IXC) on TSK CM-650S with a linear gradient of NaCl in sodium acetate 50 mM pH 4.8. The IXC purified PEGylated-peptide was further purified by SEC and characterized by MALDI-TOF
Synthesis of OXM 109 10 mg of the corresponding peptide precursors (2.25 μmoles) were dissolved in 2 ml urea 8M, HEPES 0.1 M pH 7.3, 2 mM EDTA. 108 mg of MPEG2-MAL-40K (NEKTAR 2D3Y0T01) (2.7 μmoles) dissolved in 2 mL H2O (1 :1,2 mole/mole ratio of peptide to PEG) was added to this solution.. After 1 hour incubation, the PEGylated peptide solution was acidified to 1% acetic acid and purified by cation exchange chromatography (IXC) on TSK CM-650S with a linear gradient of NaCl in sodium acetate 50 mM pH 4.8. The IXC purified PEGylated-peptide was further purified by SEC and characterized by MALDI-TOF.
EXAMPLE 4
The OXM peptide analogs that that display full agonistic activity on the GLP- 1 and the Glucagon receptors and shown in Table 2 were synthesized as follows.
The peptides OXM290, 291, 292, 293 and 294 that are precursors of OXM301, OXM302, OXM303, OXM304 and OXM305 (See Table 2) were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer Simphony Protein Technologies Inc. For peptide amides, 0.5 g of a resin Aminomethylated polystirene LL (100-200 mesh, 0.41 rnmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S)~α-[9H-Fluoren- 9-yl-methoxyfoπnamido]~2,4-dimethoxybenzyI]-phenoxyacetic acid (Rink, Tetrahedron Lett. 28:3787-3789 (1987); Bernatowicz et at., Tetrahedron Lett. 30:4645-4667 (1989)) was used. All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5 M HOBt (Hydroxybenzotriazole) in DMF. The acylation reactions were performed for 60 minutes with 8- fold excess of activated amino acid over the resin free amino groups. The amino acids were activated with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l, 1 ,3,3- tetramethyluronium hexafluorophosphate), solution 0.5 M in DMF, and a 2-fold molar excess of DIEA (N ,N-diisopropylethyl amine), solution 2 M in NMP.
The side chain protecting groups were: OMpe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, GIn and His; tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-suϊfonyj for Arg; Boc-His(Trt)-OH was used in the synthesis.
At the end of the synthesis, the dry peptide-resins were individually treated with 25 mL of the cleavage mixture, 82.5% trifluoroacetic acid (TFA), 5% phenol, 5% thioanisole, 2.5% Ethandithiole, and 5% water for 1.5 hours at room temperature. Each resin was filtered and the volume of the solution was reduced then added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H2O, 20% acetonitrile, and lyophilized.
The crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM C4 cartridges (40 x 200 mm, 15 μm) and using as eluents (A) 0.1 % TFA in water and (B) 0.1 % TFA in acetonitrile. The following gradient of eluent B was used: 22%-22% over 5min and 22%-32% over 20 min for OXM301 precursor, 22%-22% over 5min and 22%-35% over 20 min for OXM302 precursor, 25%-25% over 5min and 25%-40% over 20 min for OXM303 precursor, 25%-25% over 5min and 25%-35% over 20 min for OXM304 precursor and OXM305 precursor, flow rate 80 mL/min, wavelength 214 nm. Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4,6 mm, (CPS analitica p/n ACE-213-1546), at 45 0C, using H2O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents and the following linear gradient: 25%-25% B (in 5 min) - 40%B (in 20 min) - 80% B (in 2 minutes), flow 1 mL/min. The purified peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
Synthesis of Qq conjugates was as follows. The peptides OXM301, OXM302, OXM303,
OXM304, and OXM305 were synthesized from the thiol containing OXM peptide precursor OXM290-294 respectively to produce derivatives with the C7 group covalently attached via the thioether group of the cysteine residue at the C-terminus. As an example of derivatization of the precursor: 40 mg of peptide precursor were dissolved in 1.33 mL of DMSO (cone. 30 mg/mL) and a 2.1 molar excess of eholest-5-en-3-yl l-bromo-2~oxo-6,9,12,15-tetraoxa-3-azaoctadecan- 18-oate dissolved in THF (cone. 30 mg/mL) was added. Then, 5% by volume of DIPEA (N,N- diisopropyl-ethylamine) was added to the mixture; after 30 minutes of incubation, was quenched by the drop- wise addition of ammonium acetate (solution of 1 M in water) until turbidity of the solution.
The solution was then directly loaded onto a reverse-phase Waters RCM Delta-Pak™ C4 cartridges (20 x 200 mm, 15 μm, 300A) using as eluent 0.5 M ammonium acetate, 20% MetOH, 25% acetonitriie in water, pH 7.8, at 5 mL/min. An isocratic elution was run for 15 minutes with this buffer at 30 mL/min. Then the eluents were changed to: (A) 0.2% acetic acid, 20% MetOH in water (B) 0.2% acetic acid, 20% MetOH in acetonitriie and then the following gradient was run: 25%(B)-35%(B) in 5! - 70%(B) in 20' - 80%(B) in 21 ~ 80%(B) for 3', flow 30 mL/min, wavelength 230 nm. The final peptides were characterized on an Alliance Waters Chromatograph, with a ACE
C-4 (300 A), 3 um column, 150 x 4.6 mm, (CPS analitica p/n ACE-213- 1546), at 45°C, using H2O, 0.1 % TFA (A) and CH3CN, 0.1 % TFA (B) as solvents and the following linear gradient:
40%-40% B (in 5 min) - 70%B (in 20 min) - 80% B (in 2 min), flow 1 mL/min. The peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
EXAMPLE 5
Peptides OXM237-OXM308 and OXM345-OXM414 were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer Simphony Protein Technologies Inc. For peptide amides 0.5 g of a resin Aminomethylated thioethers LL (100-200 mesh, 0.41 mmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S)-α-[9H-Fluoren- 9-yl-methoxyformamido]~2,4-dimethoxybenzy]]-phenoxyacetic acid (Rink, H., 1987, Tetrahedron Lett. 28:3787-3789; Bernatowicz, M. S. et al., 1989, Tetrahedron Lett. 30:4645- 4667) was used. For peptide acids 0.5 g of a resin Aminomethylated thioether LL (100-200 mesh, 0.41 mmol/g) (Novabiochem) resin derivatized with 4-hydroxymethylphenoxyacetic acid. All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5M HOBt (Hydroxybenzotriazole) in DMF. The acylation reactions were performed for 60 rnin with 8-fold excess of activated amino acid over the resin free amino groups. The amino acids were activated with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate), solution 0,5 M in DMF, and a 2-fold molar excess of DIEA (N,N- diisopropylethylamine), solution 2M in NMP.
The side chain protecting groups were: Ompe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys} GIn and His; tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg; Boc-His(Trt)-OH was used in the synthesis.
For peptides OXM392, 395 and 398, Glul6 and Lys20 were incorporated as GIu(OaIl) and Lys(AlIoc). At the end of the assembly the resins were dried, the protecting groups of GIu(OaIl) and Lys(Alloc) were removed and the lactam bridge was formed by incubating the resin with 5 molar excess of HBTU and 10 molar excess of DIPEA.
For lipidated peptides such as OXM404, 407, 408, 410, 411, 414, 415, 416, 417, 418, 419, 420 the lysine to be derivatized on the side chain was incorporated as Lys(AIloc). At the end of the assembly the Alloc protecting group was removed and the synthesis was completed by condensation of the γ-carboxyglutamic acid residues and the palmitic acid using HBTU and DIPEA as activators.
At the end of the synthesis, the dry peptide-resins were individually treated with 25 mL of the cleavage mixture, 82,5% trifluoro acetic acid (TFA), 5% phenol, 5% thioanisole, 2.5% ethandithiole and 5% water for 1.5 hours at room temperature. Each resin was filtered and the volume of the solution was reduced then added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H2O, 20% acetonitrile, and lyophilized.
The crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-Pak™ C4 cartridges (40 x 200 mm, 15 μm) and using as eluents (A) 0.1% TFA in water and (B) 0.1% TFA in acetonitrile. Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 x 4.6 mm, (CPS analitica p/n ACE- 213-1546), at 45 0C, using H2O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents. The purified peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
Synthesis of C5 conjugates was a follows. The peptide OXM238 was synthesized from a thiol containing OXM peptide precursor to produce derivatives with the acetamide covalently attached via the thioethers group of the cysteine residue at the C-terminus, As an example of derivatization of the precursor: 50 mg of peptide precursor were dissolved in Tris HCl buffer 0.25 M, EDTA 2mM, Urea 6M pH 8.3 (cone. 30 mg/raL) and a 10 molar excess of iodoacetamide dissolved in DMSO (cone. 30 mg/mL) was added. After 30 minutes the reaction is complete. The solution is acidified with acetic acid and purified on preparative HPLC. Synthesis of C4 conjugates was as follows. The peptides OXM345, OXM355,
OXM357, OXM373 were synthesized from the thiol containing OXM peptide precursors respectively to produce derivatives with the cholesterol group covalently attached via the thioethers group of the cysteine at the C~terminus. As an example of derivatization of the precursor: 40 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 2.1 molar excess of choIest-5-en-3-yl l~bromo-2-oxo-ό,9,12,15-tetraoxa-3~azaoctadecan-18-oate dissolved in THF (cone. 30 mg/mL) was added. Then 5% by volume of DIPEA (N ,N- dπsopropyϊ-ethylamine) was added to the mixture; after 30 min of incubation, was quenched by the drop-wise addition of ammonium acetate (solution of I M in water) until turbidity of the solution was reached.
The solution was then directly loaded onto a reverse-phase Waters RCM Delta-Pak™ C. 4 cartridges (20 x 200 mm, 15 μm, 300A) using as eluent 0.5 M ammonium acetate, 20% MetOH, 25% acetonitrile in water, pH 7.8, at 5 mL/min. An isocratic elution was run for 15 min with this buffer at 30 mL/min. Then the eluents were changed to: (A) 0.2% acetic acid, 20% MetOH in water (B) 0.2% acetic acid, 20% MetOH in acetonitrile.
The final peptides were characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45°C, using H2O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents. The peptides were characterized by electrospray mass spectrometry on a Micromass. Synthesis of C7 conjugates was as follows. The peptides OXM359, OXM361,
OXM374, OXM380, OXM383 and OXM388 were synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxa4-cholesterol covalently attached via a tbioether bond to the cysteine residue at the C-terminus. As an example of derivatization of the precursor: 25 mg of peptide precursor were dissolved in 1.33 mL of DMSO (cone. 30 mg/mL) and a 1.1 molar excess of cholest-5-en-3~yl 1 -bromo-2-oxo-6,9, 12, 15-tetraoxa-3-azaoctadecan- 18-oate dissolved in THF (cone. 30 mg/mL) was added. Then 5% by volume of DIPEA (N,N- diisopropyl-ethyl amine) was added to the mixture; after 30 min of incubation, was quenched by the drop-wise addition of ammonium acetate (solution of 1 M in water) until turbidity of the solution was reached. The solution was then directly loaded onto a reverse-phase Waters RCM Delta-Pak™ C.
4 cartridges (20 x 200 mm, 15 μm, 300A) using as eluent 0.5 M ammonium acetate, 20% MetOH, 25% acetonitrile in water, pH 7.8, at 5 mL/min. An isocratic elution was run for 15 min with this buffer at 30 mL/rnin. Then the eluents were changed to: (A) 0.2% acetic acid, 20% MetOH in water (B) 0.2% acetic acid, 20% MetOH in acetonitrile and then the following gradient was run: 25%(B)-35%(B) in 5' - 70%(B) in 20' - 80%(B) in 2' - 80%(B) for 3', flow 30 mL/rain, wavelength 230 nm. The final peptides were characterized on an Alliance Waters Chromatograph, with a
ACE C-4 (300 A), 3 um column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 450C, using H2O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents. The peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
Synthesis of C9 conjugates was as follows. The peptide OXM381 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxal 2-cholesterol covalently attached via the maleimide thioether bond to the cysteine residue at the C-terminus. As an example of derealization of the precursor: 25 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 1.5 molar excess of cholest-5-en-3-yl yV-[43-(2,5-dioxo-2,5- dihydro- l//-pyrrol-l -yl)-41 -oxo-4,7,10, 13 , 16, 19,22,25,28,31 ,34,37-dodecaoxa-40~ azatritetracontan-l-oyl]glycinate dissolved in THF (cone. 20 mg/mL) was added. Then 2% by volume of DIPEA (N,N-diisopropyI-ethylamine) was added to the mixture; after 4-6 hours of incubation, the reaction was quenched with glacial acetic acid and directly loaded on reverse- phase HPLC and purified. The final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 x 4.6 mm, (CPS analitica p/n ACE- 213-1546), at 45°C, using H2O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents. The peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform. Synthesis of C] 0 conjugates was as follows. The peptides OXM392, 395, 398, 399,
400, and 401 were synthesized from the thiol containing OXM peptide precursors to produce derivatives with the Oxal 2-cholesterol covalently attached via a thioether bond to the cysteine residue at the C-terminus. As an example of derivatization of the precursor: 25 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 1.5 molar excess of cholest-5~en-3- yl l -bromo-2-oxo-6,9,12,15,18,21,24,27,30,33,36,39-dodecaoxa-3-azadotetracontan-42-oate in THF (cone. 20 mg/mL) was added. Then 2% by volume of DIPEA (N,N-diisopropyl- ethylamine) was added to the mixture; after 4-6 hours of incubation, the reaction was quenched with glacial acetic acid and directly loaded on reverse-phase HPLC and purified. The final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45°C, using H2O1 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents. The peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
Synthesis of C] j conjugates was as follows. The peptides OXM412 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxa24- cholesterol covalently attached via a thioether bond to the cysteine residue at the C-terminus. As an example of derivatization of the precursor: 25 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 1.5 molar excess of cholest-5-en-3-yl 1 -bromo-2-oxo- 6,9ϊ12,15,18,21,24;27;30J33536,39,42J45,48,51,54;57!60,63,66,69,72,75-tetracosaoxa-3- azaoctaheρtacontan-78-oate in THF (cone, 20 mg/mL) was added. Then 2% by volume of DIPEA (N,N-diisopropyl-ethylamine) was added to the mixture; after 4-6 hours of incubation, the reaction was quenched with glacial acetic acid and directly loaded on reverse-phase HPLC and purified.
The final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45°C, using H2O, 0.1% TFA (A) and CH3CN, 0,1% TFA (B) as solvents. The peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
Synthesis of C 12 conjugates was as follows. The peptides OXM421 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxal 2-0- cholesterol covalently attached via a thioether bond to the cysteine residue at the C-terminus. As an example of derivatization of the precursor: 25 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 1.5 molar excess of cholest-5-en-3-yl 1 -bromo-2-oxo- 6;9?12,15,18,21 >24,27,30J33536-undecaoxa-3-azaoctatriacont-78-oate in THF (cone. 20 mg/mL) was added. Then 2% by volume of DIPEA (N,N-diisopropyl-ethyl amine) was added to the mixture; after 4-6 hours of incubation, the reaction was quenched with glacial acetic acid and directly loaded on reverse-phase HPLC and purified.
The final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 mπ column, 150 x 4.6 mm, (CPS analitica ρ/n ACE-213-1546), at 45°C, using H2O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents. The peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
EXAMPLE 6 Table 3 shows the structures for the native OXM and OXM analogs that are disclosed herein.
Figure imgf000073_0001
Figure imgf000074_0001
Figure imgf000075_0001
Figure imgf000076_0001
Figure imgf000077_0001
Figure imgf000078_0001
121 HsQGTFTSDK(γE-γE-stearoyl)SKYLDαRRAQDFVQWLMNTK-γE-
MM132 C0NH2 α = α-aminoisobutyric acid (Aib); s = D-Ser; n = L-norleucine (NIe), o = O-methyl- homoserine; m = methionine sulfoxide; H2 = desamino-His (ANH2-H); Acx = 1 -Amino- 1- cyclohexane carboxylic acid; Abu - α-aminobutyric acid; D-Abu = D- α-aminobutyric acid; Nva = Aminovaleric acid; Cpa = β-cyclopropyl-alanine; Prg = propargylglycine; AIg = Allylglycine; 2-Cha = 2-Amino-2-cyclohexyl~ρroρanoic acid; D-tbg = D-tertbutylglycine; Vg == Vinylglycine; Acp - 1 -Amino- 1 -cyclopropane carboxyljc acid; Acb = 1 -Amino- 1- cyclobutane carboxylic acid; Acpe = 1 -Amino- 1-cyclopentane carboxylic acid; k= D-I ys; e= D-GIu; X= homocysteic acid; γe= D-gamma glutamic acid; C1 = Cys(mPEG)5kDa; C2 = Cys(mPEG)20kDa;
C3 = Cys(mPEG)240kDa, each corresponding to a cysteine residue PEGylated via the side- chain thiol with linear methoxyPEG (mPEG) or branched mPEG [XmPEG)2] of the indicated MW;
C4 = Cys(cholest-5-en-3-yl{[(2R)-3-amino-2-(amino)-3-oxopropyl]thio}acetate); Cs = CyS(CH2CONH2), corresponding to a cysteine residue in which the side-chain thiol was reacted with iodoacetamide;
Ce = Cys(mPEG)260kDa, each corresponding to a cysteine residue PEGylated via the side- chain thiol with linear methoxyPEG (mPEG) or branched mPEG2mPEG [(mP EG)2) of the indicated MW;
C7= Cys(cholest-5-en-3-yl l-{[(2R)-3-amino-2»(amino)-3-oxopropyl]thio}-2-oxo-6,9,l2,15- tetraoxa-3-azaoctadecan-18-oate]) or Cys(Oxa4-cholesterol)); C8= Cys(N-ethylmaleimidyl).
C9 = tS'-{l-[46-(cholest-5-en-3-yloxy)-3,43,46-trioxo-7,10,13,16,19,22,25,28,31,34,37,40- dodecaoxa-4,44-diazahexatetracont-l-yl]-2,5-dioxopyrrolidin-3-yl}-L-cysteine or Cys (mal- oxai2-cholesterol)
Cιo = -Sp-[42-(cho]est-5-en-3-yloxy)-2>42-dioxo-6,9,12,15>18,21>24,27)30,33,36,39- dodecaoxa-3-azadotetracont"l-yl]-L-cysteine or Cys (oxai2-cholesterol) Cu - 5-[78-(cholest-5-en-3-yloxy)-2,78-dioxo-
6,9, 12,15,18,21 ,24,27,30,33,36,39,42,45,48,51 ,54,57,60,63,ό6,69,72,75-tetracosaoxa-3- azaoctaheptacont-l-yϊ]-L-cysteine or Cys (oxa24-cholesterol)
C12 = (-?-[38Hcholest-5-eo-3-yloxy)-2-oxo-6,9)12,15,18,21,24,27,30,33,36-undecaoxa-3- azaoctatriacont-l-yl]-L-cysteine or Cys (oxai2-O-cholesterol) Ttds= l-amino-4,7,10-trioxa-13-tridecanamine succinimic acid γE= gamma glutamic acid palmitoyl- C14 fatty acid residue
Figure imgf000080_0001
EXAMPLE 7
The ability of GLP-I R/GCGR co-agonists to reduce body weight and food intake and improve glycemic control is demonstrated. We initially screened peptides in fluorescence cell based assays that measure production of cyclic- AMP (cAMP), using CHO cell lines stably expressing either recombinant human GLP- IR or human GCGR. Determination of Mouse and human GLP-IR and GCGR Agonist Activity was essentially as follows. CHO cells stably expressing mouse or human GLP-IR or GCGR were grown in Iscove's Modified Dulbecco's Medium (IMDM), 10% FBS, ImM L-glutamine, penicillin- streptomycin (100 μ/mL) and 750 μg G418/mL for three-four days before harvesting using Enzymefree Dissociation Media (EFDM, Specialty Media). To determine GLP-IR and GCGR activity, OXM and OXM-Q3E were diluted in assay buffer and were incubated with cells in the absence or presence of 10% mouse plasma, respectively, for 30 min at room temperature. The assay was terminated with the addition of the LANCE kit Detection buffer as per the manufacturer's instructions. The plates were held an additional hour at room temperature, then increasing cAMP levels were detected by a decrease in TR-FRET signal as measured in an EnVision counter (PerkinElmer) in comparison to a standard curve of cAMP as per the manufacturer's instructions. Data were analyzed using the linear and nonlinear regression analysis software, GraphPad Prism. Evaluation of the utility of a dual GLP-1R/GCGR co-agonists (OXM mimetic) versus a
GLP-IR selective agonist (GLP-I mimetic) was as follows. First, in order to evaluate the therapeutic utility of a dual GLP-1R/GCGR agonist (OXM mimetic), a matched peptide that was selective for only the GLP-I receptor (GLP-I mimetic), yet differs from native OXM by only one amino acid was identified. This peptide differed from native OXM by having a Glutamic acid (E) residue at position 3 instead of Glutamine (Q). A second GLP-I mimetic was identified that had an aspartic acid residue (D) in place of the Q. The efficacy of the GLP-I mimetic and the OXM mimetic in improving metabolic control in rodents were compared. These peptides and human OXM were synthesized and purified by GL Biochem (Shanghai) Ltd.
In Table 4, the in vitro potencies and receptor binding affinities of native OXM and OXM-Q3E and OXM-Q3D peptides. Mutation of the third residue from the neutral Q to an acidic residue, e.g., D or E significantly reduces the potency of native oxyntomodulin to bind the glucagon receptor, while having minimal effect on the potency for the GLP-I receptor.
We further evaluated the ability of native OXM and OXM-Q3E (GLP-I -mimetic) to interact with the GCGR in vivo, both in an ex vivo glycogenosis study and an in vivo GCGR receptor occupancy assay. As demonstration of in vivo efficacy for peptides is often confounded by inadequate pharmacokinetic properties, the perfused liver assay offers an alternative ex vivo method of assessing test peptides for activity in the functioning organ of interest.
Animals for the in vivo assays:
Lean or diet-induced obese 10-12-week-old male C57BL/6 mice were purchased from Taconic Farms (Germantown, NY) and housed in individual Tecniplast cages in a conventional SPF facility. Mice were maintained on either regular chow (Teklad 7012: 13.4% kcal from fat; Harlan Teklad) or high fat diet (Dl 2492: 60% kcal from fat; Research Diets, Inc.) with ad libitum access to water in a 12-h ligh/12-h dark cycle unless stated otherwise. Intraperitoneal glucose tolerance test. Male C57BL/6N mice were distributed by weight into treatment groups (n=6/group). On the morning of study, food was removed and mice were s.c. administered with vehicle (sterile water) OXM or OXM-Q3E at 0.01, 0.03, 0.1, 0.3, 1 or 3 mg/kg. 10 min prior the glucose challenge. Blood glucose concentrations were determined at T= -10 min and T= 0 min (baseline). Mice were then immediately challenged, intraperitoneally, with D-glucose (2 g/kg). One group of vehicle-treated mice was challenged with 0,9% saline as a negative control. Blood glucose levels were determined from tail bleeds taken at 20, 40 and 60 min after D-glucose challenge. The blood glucose excursion profile from T = 0 to T = 60 min was used to integrate the area under the curve (AUC) for each treatment. Percent inhibition values for each treatment were generated from the AUC data normalized to the saline-challenged controls. Areas under the curve (AUC) for glucose (AUC glucose) was calculated using the trapezoidal method. Statistics. Statistical analysis was done using unpaired 2-tailed Student's t test. P values <0.05 were reported as significant.
Liver Glycogenosis Assay. Humanized GCGR mice (C57B/6N) were anesthetized (Nembutal IP, 50 mg/kg) in the middle of the dark cycle. The portal vein was then cannulated and the liver was excised and perfused with a preoxygenated Krebs-Henseleit bicarbonate buffered solution for 5-10 minutes which initially was not recirculated to wash out any endogenous substrates. The liver was then placed into a 20mm NMR tube and the initial Krebs solution was exchanged for a Krebs-BSA perfusate (approx. 72ml, 2.5% BSA), which was recirculated. 31p NMR spectroscopy was performed initially to examine the ATP and inorganic phosphate (Pi) levels to assess hepatic viability. A 13c NMR- visible pool of glycogen was then created by the addition of the gluconeogenic substrate [2-13C] Pyruvate and ammonium chloride (~7 mM and 1 raM, respectively) to the perfusate, and the amount of 13c glycogen contained in the liver was monitored in real time via the Cl resonance of the glucosyl units in glycogen. After 45 minutes, OXM5 OXM-Q3E, glucagon or vehicle was perfused and the subsequent response of glycogenlevels was used to assess GCGR activation (Bergans et α/., NMR Biomed. 16: 36-46, (2003)). Glucose dependent insulin secretion (GDIS). To measure GDIS, mouse pancreatic islets were isolated by the coUagenase method using the procedure of pancreatic duct cannulation and density gradient purification (Mu et al.t Diabetes 55; 1695-704, (2006)) and were incubated with 2 or 16 mmol/L glucose. Insulin was measured in aliquots of the incubation buffer by enzymelinked immunosorbent assay with a commercial kit (ALPCO diagnostics, Windham, NH). Animal study protocols were reviewed and approved by the Merck Research Laboratories Institutional Animal Care and Use Committee in Rahway, NJ.
13C-NMR spectroscopy was used to non-invasively monitor glycogen and glucose levels in response to acute treatment with novel oxyntomodulin analogs in real time. Mice expressing human GCGR were anesthetized (Nembutal IP, 50 mg/kg) at approximately the middle of the dark cycle. The portal vein was then cannulated and tied off and the liver was excised. The liver was then placed into a 20 mm NMR tube and the initial Krebs solution was exchanged for a Kxebs-BSA perfusate, which was recirculated. 31p NMR spectroscopy was performed initially to examine the ATP and inorganic phosphate (Pi) levels in the liver which can be used to assess hepatic viability. A 13C NMR- visible pool of glycogen was then created by the addition of the gluconeogenic substrate [2-13C] Pyruvate + NH4CI and the amount of glycogen contained in the liver was monitored in real time via the Cl resonance of the glucosyl units in glycogen. After approximately 45 minutes, OXM or an OXM peptide analog was infused and the subsequent response of glycogen levels was used to assess human GCGR activation. The area of the Cl resonance of the glucosyl units in glycogen is plotted over time in Figure 1 for livers that received either the OXM peptide analogs, 50 pM glucagon, or media. As can be seen below, native OXM induces glycogenosis in a dose dependent fashion and induces full glycogenosis at 1.5 nM and has an approximate EC50 of 0.5 nM, in comparison, OXM-
Q3E induced only about 58% at 300 nM, consistent with its poor GCGR agonist potency. Given the ability of OXM to stimulate a robust glycogenosis response, we further examined the in vivo GCGR receptor occupancy of OXM and 0XM-Q3E in a competition assay in wild-type mice. Three cohorts of mice were dosed with either vehicle (total counts), vehicle and cold glucagon (non-specific binding), or 0XM-Q3E subcutaneously. About 15 minutes post dose, 1251-giucagon was administered intra- venously and about 15 minutes later, the liver was collected and total radioactivity assayed, As shown in Figure 2, glucagon (GCG) at 1.5 mpk gave 84% GCGR occupancy, 3 mpk OXM gave 31% GCGR occupancy, and OXM-Q3E gave 0% GCGR occupancy.
Using the matched peptides, OXM, 0XM-Q3E, we investigated both acute and chronic pharmacological effects of co-agonism of both receptors in a chronic hyperglycemic clamp and a chronic food intake (FI) and body weight (BW) study (Table 5) and in an acute intraperitoneal glucose tolerance test (IPGTT, Figure 3). While both peptides effectively improved glucose tolerance, OXM-Q3E out-performed native OXM in reducing glucose excursion in both lean and diet induced obesity (DIO) mouse models. However, the native peptide proved superior at reducing food intake and body weight (ΔBW: -6% for OXM vs -2.4% for 0XM-Q3E at 5 mg/kg) in DIO mice, an effect attributed to co-agonism of the GCGR, In both acute and chronic paradigms, native OXM did not cause increased glucose excursion.
Figure imgf000083_0001
Hyperglycemic clamp study,
DIO mice (16 wk on high fat diet) were anesthetized with xylazine and ketamine and catheterized through the right internal jugular vein 3 days before the in vivo studies. 25% glucose was infused and adjusted for the duration of the experiment to maintain hyperglycemia. Due to the short half-life of the peptides (both are rapidly inactivated by dipeptidyl peptidase IV and renally cleared (Zhu et ah, J. Biol. Chera. 278: 22418-23, (2003))), vehicle, OXM (-16 μg/kg/min) and OXM-Q3E (-16 μg/kg/min) were infused intravenously during the last 60 minutes of the study. The venous catheter was used for infusion, and blood samples were collected from the tail vein. Each animal was monitored for food intake and weight gain after surgery to ensure complete recovery. Hyperglycemic clamps were performed in conscious, unrestrained, catheterized mice as previously described (Pocai et al., Nature. 43: 1026-31 , (2005)). Briefly, plasma glucose was measured by OneTouch giucometer every 10 minutes during the 2 hour period. Twenty-five percent glucose (D-glucose, Sigma) was infused i.v. and the rate was adjusted periodically to clamp the plasma glucose levels (-20 mM). One hour after the beginning of the infusion, OXM (-16 μg/kg/min), OXM-Q3E (16 μg/kg/min) and vehicle (sterile saline) were administered for the rest of the period. Glucose infusion rate (GIR) was adjusted to body weight.
The results of the hyperglycemic clamp assay are shown in Figures 3 A and 3B, Blood glucose levels were maintained at about 20 mmol/L during the clamp. In OXM-Q3E treated animals, a quick and robust increase in glucose infusion (GIR, glucose infusion rate) was required to maintain hyperglycemia compared with vehicle-treated mice (GIRO-60 55±4 vs 6±2 mg/kg/min; OXM-Q3E vs vehicle; p<0.05). OXM also increased the glucose infusion rate required to maintain hyperglycemia (GIRO-60- 40±4 vs 6±2 mg/kg/min; OXM vs vehicle, p<0.05) but the increase in GIR was about 30% lower than that in the OXM-Q3E group (GIRO- 60= 40±4 vs 55±4 mg/kg/min; OXM vs OXM-Q3E respectively, p<0.05), and the glucose lowering effect was delayed (by about 10 minutes) compared to OXM-Q3E treated mice, *p<0.05 vs vehicle.
The effect of OXM or OXM-Q3E on glucose excursion in C57BL/6N lean mice was compared. Figure 4 shows that both native and OXM peptide anlogs reduce glucose excursion. The subcutaneous administration of either peptide, prior to dextrose challenge (Plasma Cmaχ) in an intraperitoneal glucose tolerance test (IPGTT), significantly reduced blood glucose excursion in a dose-dependent manner. A comparison of the minimal effective dose indicates that OXM- Q3E is about 10-fold more effective at reducing glucose than native peptide (in vivo EC50 0.055 nM and 0.38 nM respectively).
EXAMPLE 8 Native OXM has an in vivo half-life (ty2 ) of about 8 to 12 minutes in humans, unsuitable for sustained pharmacological therapy. Therefore, we investigated the addition of bulky substituents to the peptide to reduce renal clearance. Various molecular weight PEG moieties or N-ethyl maleimide were conjugated to the
OXM peptide at various locations throughout the molecule, by conjugation to the side chain of an introduced cysteine residue. Positions that were investigated for conjugation with either Cys- N -ethyl malemide or a Cys-PEG moiety are underlined in the following amino acid sequence for OXM (SEQ ID NO: 1 ) or placed at the C-terminus of the OXM,
HSQGT FTSDY SKYLD SRRAO DFVQW LMNTK RNRNN IA
Unexpectedly, PEGylation (5 to 80 kDa) appeared to severely diminish the ability of the peptide analog to activate either the GCGR or both GLP-IR and GCGR. In some cases, introduction of an N -ethyl maleimide-capped cysteine residue was sufficient to significantly reduce activity. The results are shown in Table 6).
Figure imgf000085_0001
EXAMPLE 9
As an alternative to PEGylation, we evaluated several lipidated OXM peptide analogs for improvements in the pharmacokinetic profile.
We initially conjugated the peptides with a cholesterol group via the cysteine side chain and again measured their ability to stimulate cAMP production in GLP-IR and GCGR transfected cell lines, C-terminal conjugation was the most favorable location for conjugation and OXM analogs with low nanomolar receptor potencies were identified. Unexpectedly, analysis of these peptides in the ex vivo liver perfusion glycogenosis assay indicated that the in vitro GCGR agonist potency was not correctly reflecting GCGR activation in the liver (See OXM70 in Figure 5). Measurement of agonist potency in 10 to 20% plasma added to the in vitro cell assay revealed a significant "serum shift" that effectively reduced the potency of the molecule by more than >40-fold (See Table 7), suggesting that the cholesteroylated molecules bound to lipid and/or protein in the plasma, reducing the effective concentration.
Figure imgf000086_0001
Figure 5 A shows ex vivo measurement of glycogenosis in perfused liver in the presence of OXM70, OXMl 10, OXM177, OXMl 15, and OXM216. Figure 5B shows GGCR occupancy following subcutaneous (s.c.) or intravenous (i.v.) administration of the OXM70, OXMl 10, OXM177, OXMl 15, and OXM216 compared to native OXM in a competition assay in wild-type mice, EXAMPLE 10
In order to mitigate the effects of plasma binding on receptor engagement we employed a modified strategy to improve the pharmacokinetics by incorporating a hydrophilic linker between the peptide and the cholesterol group. Addition of a tetra-ethoxy linker (Oxa4) between the cholesterol moiety and the peptide significantly reduced the effect observed above when plasma was added to the cell based assay, i.e., reduced the "serum shift" to as little as 2 fold as shown in Table 8. Furthermore, substituting either aminoisobutyric acid (Aib) or D-Serine (D- Ser) at amino acid position two further improved both GLP-IR and GCGR affinity. We confirmed these in vitro observations in both the ex vivo glycogenosis assay and the GCG receptor binding assay (See Table 8), obtaining results that confirmed that conjugation of a hydrophilically linked cholesterol group or an acyl chain resulted in identification of molecules that efficiently engaged and activated the GCGR.
Figure imgf000087_0001
Pharmacodynamic analysis of selected analogs. We evaluated the efficacy of various lipidated peptides to reduce body weight, food intake (DIO mice) and improve glycemic control (lean mice) following both acute and chronic administration. As shown in Figures 6 through 9, following a single subcutaneous dose, the lipidated molecules significantly reduce food intake and body weight both acutely and with sustained efficacy. As predicted from the in vitro analysis, the analogs containing either acyl groups or a hydrophilic linker were significantly more efficacious than the other site- specific lipidated OXM analogs in reducing food intake and body weight in this model. Figure 6 summarizes the acute in vivo efficacy of OXM70 on reducing food intake and body weight in established DIO mice. Figure 7 summarizes the acute in vivo efficacy of OXMl 10 and OXMl 77 on reducing food intake and body weight in established DIO mice. Figure 8 summarizes the acute in vivo efficacy of OXM216, OXMl 15, and OXM177 on reducing food intake and body weight in established DIO mice. In all three experiments, Ad libitum fed, DIO male C57BL/6 mice (about 51 g each) were weighed and dosed ip with either vehicle (water) or OXM analog OXM70, OXMl 10, OXM177, OXM216, or OXMl 15 about 30 minutes prior to the onset of the dark phase. Food intake was measured about two hours and 18 hours later. Body weight changes at lδ hours (overnight) were also measured *P < 0.05 vs. vehicle, n = 5-6 per group).
Chronic Food Intake <& Body Weight Effects
To determine the chronic effects of the analogs on energy and glucose metabolism, studies were performed in an established diet induced obesity (DIO) mouse model. Ad libitum fed male C57BL/6N wild-type mice (n = 6 per group, mean body weight ~50g) were dosed with vehicle, OXMl 15, OXM 177, OXMl 10 at 3 or 10 mg/kg every other day (Q2D) during the course of a 14-consecutive-day study. Body weight, food intake and basal glucose levels were measure daily. As shown in Figures 9A and 9B, chronic treatment with the lipidated analogs significantly reduced body weight and food intake in a dose dependent manner throughout the duration of the study. Figure 9C shows the basal glucose over the time period of the study in response to the various peptides.
All the lipidated peptides tested significantly reduced basal glucose in a dose dependent manner throughout the duration of the study compared with day O of the chronic study and with vehicle-treated animals in the same day (p<0.05). An IPGTT was carried out on day 13, showed that glucose tolerance was improved following chronic administration of the lipidated analogs, in a dose dependent manner (Figures 9D).
Improvement Glucose Tolerance
As shown in Figures 10 through 13, in C57BL/6N lean mice IPGTT, the subcutaneous administration of the OXM peptide analogs, prior to dextrose challenge timed appropriately to correspond to the Plasma Cmax? significantly reduced blood glucose excursion in a dose- dependent manner, for all lipidated analogs tested.
Metabolic Rate Effects In order to establish whether administration of the tetra-ethoxy-lmked cholestroylated
OXMl 15 analog confers a metabolic rate, a chronic study was performed, with a single injection of OXMl 15. Male B6 DIO mice (average starting body weight 55 g) were acclimated to metabolic rate chambers without food at thermoneutrality (T 29°C). A three hour period from 6:00 to 9:00 am was used to calculate resting metabolic rate. Three hours into the light phase (9:00 am), vehicle (dH^O), OXMl 15 at 3 or 10 mg/kg was administered subcutaneously. The total cycle time was set for 20 minutes, consisting of a reference reading with a 70 second settling time and a 10 second measure period as well as 60 second settle time and 10 second measure time for each of the 16 cages. Results shown in Figures 14A and B show that administration of OXMl 15 dose dependently increased the acute metabolic rate in DIO mice. Figure 15 summarizes the acute in vivo efficacy of OXM303, OXM304, and OXM305 on reducing food intake and body weight in established DIO mice and shows OXM305 as being particularly efficacious at reducing food intake and reducing body weight. Ad libitum fed, DIO male C57BL/6 mice (about 50 g each) were weighed and dosed s.c. with either vehicle (water) or
OXM analogs 30 minutes prior to the onset of the dark phase. Food intake was measured two hours, 18, and 42 hours later. Body weight changes at 18 and 42 hours (overnight) were also measured (*P < 0.05 vs. vehicle, n = 5-6 per group). Figure 16 summarizes the acute in vivo efficacy of OXM395, OXM399, OXM400, and
OXM401 on reducing food intake and body weight in established DIO mice. OXM401 is a 0/+ control peptide having the sequence HAibEGTFTSDYSKYLDSRRAQDFVQWLmNTK-γEγE-
C(OxaπChol) (SEQ ID NO:99).
Established DIO mice (~52g each) were dosed sc with vehicle (30%HBC) or peptide 1 mg/kg about 30 minutes prior to the onset of the dark phase. Food intake and body weight changes were measured over a four day time period (* P < 0.05 vs. vehicle, n - 5 per group).
EXAMPLE 11
This example shows that Hpidated peptides with a pi above 7 based on the OXM sequence stimulate mast cell degranulation while Hpidated peptides with a pi of about 5 appears not to stimulate mast degranulation.
To asses the histamine releasing potential of oxyntomoduHn analogs, we established an in vitro counterscreening assay using the human mast cell line LAD2. LAD2 cells (50,000 cells/well, 96-well plate) were incubated with compounds for 30 minutes. The degranulation of LAD2 cells was determined by quantification of the β-hexosaminidase released into the supernatants and in cell lysates after hydrolysis of 4-methylumbeIlifeiyl-N-acetyl-β-D- glucosaminide. Results are expressed as percentage of β-hexosaminidase release, calculated as percent of total content. Table 1 summarizes the degranulation potency (EC50) of OXM analogues in LAD2 cells. The results suggest that to reduce the likelihood of stimulating degranulation of mast cells, the pi for Hpidated based analogues should be around 5.
Figure imgf000090_0001
EXAMPLE 12
This example presents tables showing the in vitro potencies of various peptide analogs at the human GLP-I receptor (hGLP-lR) and the human glucagon receptor (hGCGR). The in vitro potencies shown in Tabie 10 or Table 11 were determined from the results of assays that were similar to either the cell-based cAMP assays described herein above (Table 10) or the cell-based cAMP assays described in International Published Application No. WO2008101017, which is incorporated herein in its entirety, in particular the cell-based cAMP assays described therein (Table 11).
Figure imgf000090_0002
Figure imgf000091_0001
Figure imgf000091_0002
While the present invention is described herein with reference to illustrated embodiments, it should be understood that the invention is not limited hereto. Those having ordinary skill in the art and access to the teachings herein will recognize additional modifications and embodiments within the scope thereof. Therefore, the present invention is limited only by the claims attached herein.

Claims

WHAT IS CLAIMED:
1. A peptide analog comprising the amino acid sequence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO: 109) in which
(A) the second amino acid from the TV-terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; (B) the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues;
(C) the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and
(D) the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide analog has a pi of less than 6.0 and is a dual GLP-I receptor agonist and glucagon receptor agonist, and pharmaceutically acceptable salts thereof.
2. The peptide analog of Claim 1, wherein the amino acid substituted for the second amino acid from the iV-terminus is selected from the group consisting of D-serine, α- aminoisobutyric acid, and 1 -amino- 1 -cyclobutane carboxylic acid.
3. The peptide analog of Claim 1 , wherein the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalentJy linked to the ε- amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues.
4. The peptide analog of Claim 3, wherein the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker.
5. The peptide analog of Claim 4, wherein the hydrophilic linker is an ethoxy polymer that includes one to twelve ethoxy units.
6. The peptide analog of Claim 4, wherein the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
7. The peptide analog of Claim 1 , wherein the peptide analog includes a lipid moiety covalently linked to the ε-amino group of a lysine residue.
8. The peptide analog of Claim 7, wherein the lipid moiety is a palmitoyl group.
9. The peptide analog of claim 7, wherein the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues.
10. The peptide analog of claim 7, wherein the lipid moiety is covalently linked to the ε-amino group of the lysine residue at the C-terminus by one or more gamma- glutamic acid residues.
11. The peptide analog of claim 7, wherein the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma- glutamic acid residues.
12. The peptide analog of Claim 1, wherein the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27.
13. The peptide analog of Claim 1 , wherein the peptide analog further includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or a-aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the arginine at position 18, lysine for the glutamine at position 20, and norleucine or O-methyl-L-homoserine for the methionine at position 27.
14. The peptide analog of claim 13, wherein tyrosine at position 10 is replaced with a lysine and the lipid moiety is covalently linked to the ε-amino group of the lysine residue by one or more gamma-glutamic acid residues.
15. The peptide analog of claim 13, wherein glutamine at position 20 is replaced with lysine and the lipid moiety is covalently linked to the s-amino group of the lysine by one or more gamma-glutamic acid residues.
16. The peptide analog of claim 14, wherein the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus.
17. The peptide analog of claim 15, wherein the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus.
18. Use of one more of the peptide analogs of claims 1 - 17 in the manufacture of a medicament for the treatment of a metabolic disorder.
19. A peptide analog comprising the structure
Zi-P-M-Z2 wherein P is a peptide having the amino acid sequence
HXi QGTFTSDX2SX3YLDX4X5X6AX7DFVQWLX8NTKX9X! o (SEQ ID
NO: 110)
wherein Xi is a D-serine, α-aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1-cyclohexane carboxylic acid (Acx); alpha- amiπobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Ammovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe) residue;
X2 is a tyrosine (Y) or lysine (K) residue; X3 is serine (S) or lysine (K) residue;
X4 is serine (S), α-aminoisobutyric acid (aib), or glutamic acid (E) residue; X5 is an arginine (R) or glutamic acid (E) residue; Xβ is an arginine (R) or alanine (A) residue; X7 is a ghαtamine (Q) or lysine (K) residue; Xg is a methionine (M), norleucine (NIe), methionine sulfoxide (m), or O-methyl-
L-homoserine (o) residue;
X9 is a gamma glutamic acid (γGlu) residue; X] 0 is a gamma glutamic acid (γGlu) residue or absent; Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group,
M is (i) a cysteine residue covalently linked to a cholesterol moiety by a hydrophilic linker, (ii) a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues, or (iii) a lipid moiety, wherein M is covalently linked to C~terminal or internal amino acid of P by a spacer comprising one or more gamma-glutamic acid residues; and
Z2 is an optionally present protecting group that, if present, is joined to the C- terminal carboxy group; and pharmaceutically acceptable salts thereof, wherein the peptide analog or salt thereof has a pi of less than 6.0 and is a dual GLP-I receptor agonist and glucagon receptor agonist.
20. The peptide analog of claim 19, wherein M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C~terminus of P.
21. The peptide analog of claim 19, wherein M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P,
22. The peptide analog of claim 19, wherein M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position Xj or X7 of P.
23. The peptide analog of Claim 19, wherein the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units.
24. The peptide analog of Claim 19, wherein the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
25. The peptide analog of Claim 19, wherein the lipid moiety is a palmitoyl moiety.
26. The peptide analog of Claim 19, wherein the peptide analog is OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO;66); or OXM329 (SEQ ID NO:67).
27. The peptide analog of Claim 19, wherein the peptide analog is OXM345
(SEQ ID NO;69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:7ό); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO;83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO;85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM407 (SEQ ID NO;88); OXM408 (SEQ ID NO:89); OXM410 (SEQ ID NO:91); OXM41 1 (SEQ ID NO:92); OXM412 (SEQ ID NO:93); OXM414 (SEQ ID NO:95); OXM415 (SEQ ID NO:96); OXM416 (SEQ ID NO:97; OXM417 (SEQ ID NO:98); OXM418 (SEQ ID NO:99; OXM419 (SEQ ID NO: 100; OXM420 (SEQ ID NO:101); or OXM421 (SEQ ID NO:102).
PCT/US2009/068678 2009-02-19 2009-12-18 Oxyntomodulin analogs Ceased WO2010096142A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
ES09840594.7T ES2524477T3 (en) 2009-02-19 2009-12-18 Oxintomodulin analogues
HRP20141215AT HRP20141215T1 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
CA2754350A CA2754350C (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
JP2011551052A JP5756961B2 (en) 2009-02-19 2009-12-18 Oxyntomodulin analog
CN200980158734.XA CN102573872B (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
SI200931091T SI2398483T1 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
AU2009340439A AU2009340439B2 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
PL09840594T PL2398483T3 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
EP09840594.7A EP2398483B1 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
SG2011060183A SG173791A1 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
BRPI0924307A BRPI0924307B8 (en) 2009-02-19 2009-12-18 oxyntomodulin analogues
RU2011134596/04A RU2542362C2 (en) 2009-02-19 2009-12-18 Oxyintomoduline
US13/202,524 US20120165503A1 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
DK09840594.7T DK2398483T3 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogues
HK12106315.1A HK1165333B (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs
MX2011008717A MX2011008717A (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs.
ZA2011/06051A ZA201106051B (en) 2009-02-19 2011-08-17 Oxyntomodulin analogs
IL214729A IL214729A (en) 2009-02-19 2011-08-18 Oxyntomodulin analogs

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
PCT/US2009/034448 WO2010096052A1 (en) 2009-02-19 2009-02-19 Oxyntomodulin analogs
USPCT/US2009/034448 2009-02-19

Publications (1)

Publication Number Publication Date
WO2010096142A1 true WO2010096142A1 (en) 2010-08-26

Family

ID=42634127

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2009/034448 Ceased WO2010096052A1 (en) 2009-02-19 2009-02-19 Oxyntomodulin analogs
PCT/US2009/068678 Ceased WO2010096142A1 (en) 2009-02-19 2009-12-18 Oxyntomodulin analogs

Family Applications Before (1)

Application Number Title Priority Date Filing Date
PCT/US2009/034448 Ceased WO2010096052A1 (en) 2009-02-19 2009-02-19 Oxyntomodulin analogs

Country Status (23)

Country Link
US (2) US20120165503A1 (en)
EP (1) EP2398483B1 (en)
JP (1) JP5756961B2 (en)
KR (1) KR101634139B1 (en)
CN (1) CN102573872B (en)
AU (1) AU2009340439B2 (en)
BR (1) BRPI0924307B8 (en)
CA (1) CA2754350C (en)
CL (1) CL2011002036A1 (en)
CY (1) CY1116917T1 (en)
DK (1) DK2398483T3 (en)
ES (1) ES2524477T3 (en)
HR (1) HRP20141215T1 (en)
IL (1) IL214729A (en)
MX (1) MX2011008717A (en)
PE (1) PE20120621A1 (en)
PL (1) PL2398483T3 (en)
PT (1) PT2398483E (en)
RU (1) RU2542362C2 (en)
SG (1) SG173791A1 (en)
SI (1) SI2398483T1 (en)
WO (2) WO2010096052A1 (en)
ZA (1) ZA201106051B (en)

Cited By (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012177443A2 (en) 2011-06-22 2012-12-27 Indiana University Research And Technology Corporation Glucagon/glp-1 receptor co-agonists
US20120329707A1 (en) * 2011-06-22 2012-12-27 Indiana University Research And Technology Corporation Glucagon/glp-1 receptor co-agonists
US8367607B2 (en) 2009-12-22 2013-02-05 Eli Lilly And Company Oxyntomodulin peptide analogue
US8415296B2 (en) 2009-12-22 2013-04-09 Eli Lilly And Company Oxyntomodulin peptide analogue
WO2014049610A2 (en) 2012-09-26 2014-04-03 Cadila Healthcare Limited Peptides as gip, glp-1 and glucagon receptors triple-agonist
CN103732618A (en) * 2011-06-10 2014-04-16 韩美科学株式会社 Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising same
WO2014056872A1 (en) 2012-10-09 2014-04-17 Sanofi Exendin-4 derivatives as dual glp1/glucagon agonists
WO2014147124A1 (en) 2013-03-21 2014-09-25 Sanofi-Aventis Deutschland Gmbh Synthesis of hydantoin containing peptide products
WO2014147129A1 (en) 2013-03-21 2014-09-25 Sanofi-Aventis Deutschland Gmbh Synthesis of cyclic imide containing peptide products
WO2014161835A1 (en) 2013-04-03 2014-10-09 Sanofi Modified blood glucose regulating proteins with altered pharmacological activity profile and preparation thereof
WO2015086733A1 (en) 2013-12-13 2015-06-18 Sanofi Dual glp-1/glucagon receptor agonists
WO2015086731A1 (en) 2013-12-13 2015-06-18 Sanofi Exendin-4 peptide analogues as dual glp-1/glucagon receptor agonists
JP2015525226A (en) * 2012-06-14 2015-09-03 サノフイ Exendin-4 peptide analog
WO2015155139A1 (en) 2014-04-07 2015-10-15 Sanofi Exendin-4 derivatives as peptidic dual glp-1 / glucagon receptor agonists
WO2015155141A1 (en) 2014-04-07 2015-10-15 Sanofi Peptidic dual glp-1 / glucagon receptor agonists derived from exendin-4
WO2015155140A1 (en) 2014-04-07 2015-10-15 Sanofi Dual glp-1 / glucagon receptor agonists derived from exendin-4
WO2016193371A1 (en) 2015-06-05 2016-12-08 Sanofi Prodrugs comprising an glp-1/glucagon dual agonist linker hyaluronic acid conjugate
WO2016198628A1 (en) 2015-06-12 2016-12-15 Sanofi Non-acylated exendin-4 derivatives as dual glp-1/glucagon receptor agonists
WO2016198624A1 (en) 2015-06-12 2016-12-15 Sanofi Exendin-4 derivatives as trigonal glp-1/glucagon/gip receptor agonists
US9593155B2 (en) 2009-02-19 2017-03-14 Merck Sharp & Dohme Corp. Oxyntomodulin analogs
WO2017062334A1 (en) * 2015-10-05 2017-04-13 Merck Sharp & Dohme Corp. Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9724420B2 (en) 2012-11-06 2017-08-08 Hanmi Pharm. Co., Ltd. Liquid formulation of protein conjugate comprising an oxyntomodulin derivative covalently linked to a non-peptidyl polymer to an immunoglobulin FC region
US9731031B2 (en) 2011-06-17 2017-08-15 Hanmi Science Co., Ltd. Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9901621B2 (en) 2012-07-25 2018-02-27 Hanmi Pharm. Co., Ltd. Composition for treating hyperlipidemia comprising oxyntomodulin derivative
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US9944687B2 (en) 2011-07-04 2018-04-17 Imperial Innovations Limited Compounds and their effects on feeding behaviour
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
WO2018100174A1 (en) 2016-12-02 2018-06-07 Sanofi Conjugates comprising an glp-1/glucagon dual agonist, a linker and hyaluronic acid
US10039809B2 (en) 2013-12-18 2018-08-07 The California Institute For Biomedical Research Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof
US10233230B2 (en) 2014-09-16 2019-03-19 Hanmi Pharm. Co., Ltd. Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease
US10286078B2 (en) 2013-09-13 2019-05-14 The California Institute For Biomedical Research Modified therapeutic agents and compositions thereof
US10413593B2 (en) 2014-10-24 2019-09-17 Merck Sharp & Dohme Corp. Co-agonists of the glucagon and GLP-1 receptors
US10493125B2 (en) 2015-12-09 2019-12-03 Merck Sharp & Dohme Corp. Co-agonists of the glucagon and GLP-1 receptors
US10513550B2 (en) 2014-12-30 2019-12-24 Hanmi Pharm Co., Ltd Glucagon derivatives
US10550168B2 (en) 2012-11-06 2020-02-04 Hanmi Pharm. Co., Ltd. Composition for treating diabetes or diabesity comprising oxyntomodulin analog
WO2020125744A1 (en) 2018-12-21 2020-06-25 江苏恒瑞医药股份有限公司 Bispecific protein
US10869929B2 (en) 2016-01-29 2020-12-22 Merck Sharp & Dohme Corp. Phosphonate linkers and their use to facilitate cellular retention of compounds
US11471512B2 (en) 2019-03-01 2022-10-18 Merck Sharp & Dohme Llc Pharmaceutical compositions of a peptide
US11510993B2 (en) 2015-10-06 2022-11-29 Merck Sharp & Dohme Llc Antibody drug conjugate for anti-inflammatory applications
US20230220035A1 (en) * 2020-04-29 2023-07-13 Dong-A St Co., Ltd. Long-acting glp-1 and glucagon receptor dual agonist
EP4324519A3 (en) * 2015-06-30 2024-07-24 Hanmi Pharm. Co., Ltd. Glucagon derivative and a composition comprising a long acting conjugate of the same
US12329823B2 (en) 2021-06-09 2025-06-17 The Scripps Research Institute Long-acting dual GIP/GLP-1 peptide conjugates and methods of use
US12583900B2 (en) 2019-12-04 2026-03-24 The Scripps Research Institute Peptide conjugates and methods of use

Families Citing this family (53)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2628241C (en) 2005-11-07 2016-02-02 Indiana University Research And Technology Corporation Glucagon analogs exhibiting physiological solubility and stability
CN101578102B (en) 2007-01-05 2013-07-17 印第安纳大学研究及科技有限公司 Glucagon analogs exhibiting enhanced solubility in physiological pH buffers
MX2009008241A (en) 2007-02-15 2009-10-08 Univ Indiana Res & Tech Corp Glucagon/glp-1 receptor co-agonists.
CA2707861A1 (en) 2007-10-30 2009-05-07 Indiana University Research And Technology Corporation Glucagon antagonists
JP5771005B2 (en) 2007-10-30 2015-08-26 インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションIndiana University Research And Technology Corporation Glucagon antagonist and compound showing GLP-1 agonist activity
EP2300037B1 (en) 2008-06-17 2016-03-30 Indiana University Research and Technology Corporation Glucagon/glp-1 receptor co-agonists
TWI541023B (en) 2008-06-17 2016-07-11 印第安納大學科技研究公司 Glucagon analogs exhibiting enhanced solubility and stability in physiological ph buffers
TWI474835B (en) 2008-06-17 2015-03-01 Univ Indiana Res & Tech Corp Gip-based mixed agonists for treatment of metabolic disorders and obesity
RU2550696C2 (en) 2008-12-19 2015-05-10 Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн Amide-based prodrugs of glucagon superfamily peptides
WO2010148089A1 (en) 2009-06-16 2010-12-23 Indiana University Research And Technology Corporation Gip receptor-active glucagon compounds
AP3329A (en) 2009-07-13 2015-06-30 Zealand Pharma As Acylated glucagon analogues
US8703701B2 (en) 2009-12-18 2014-04-22 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
EP2528618A4 (en) 2010-01-27 2015-05-27 Univ Indiana Res & Tech Corp CONJUGATES OF GLUCAGON ANTAGONIST AND GIP AGONIST AND COMPOSITIONS FOR THE TREATMENT OF METABOLIC DISORDERS AND OBESITY
CA2797133C (en) 2010-04-27 2019-08-06 Zealand Pharma A/S Peptide conjugates of glp-1 receptor agonists and gastrin and their use
CA2797095A1 (en) 2010-05-13 2011-11-17 Indiana University Research And Technology Corporation Glucagon superfamily peptides exhibiting nuclear hormone receptor activity
WO2011143208A1 (en) 2010-05-13 2011-11-17 Indiana University Research And Technology Corporation Glucagon superfamily peptides exhibiting g protein-coupled receptor activity
MX2012014576A (en) 2010-06-24 2013-02-21 Univ Indiana Res & Tech Corp Amide based glucagon superfamily peptide prodrugs.
WO2012088116A2 (en) 2010-12-22 2012-06-28 Indiana University Research And Technology Corporation Glucagon analogs exhibiting gip receptor activity
WO2012150503A2 (en) * 2011-05-03 2012-11-08 Zealand Pharma A/S Glu-glp-1 dual agonist signaling-selective compounds
WO2012153196A2 (en) * 2011-05-10 2012-11-15 Zealand Pharma A/S Glu-glp-1 dual agonist signaling-selective compounds
TW201326194A (en) 2011-11-03 2013-07-01 Zealand Pharma As GLP-1 gastrin receptor agonist peptide conjugates
HK1198810A1 (en) * 2011-11-17 2015-06-12 Indiana University Research And Technology Corporation Glucagon superfamily peptides exhibiting glucocorticoid receptor activity
US9340600B2 (en) 2012-06-21 2016-05-17 Indiana University Research And Technology Corporation Glucagon analogs exhibiting GIP receptor activity
MX356957B (en) 2012-07-23 2018-06-20 Zealand Pharma As Glucagon analogues.
TWI608013B (en) 2012-09-17 2017-12-11 西蘭製藥公司 Glucagon analog
WO2014096179A1 (en) * 2012-12-19 2014-06-26 Novo Nordisk A/S Novel glp-1 receptor agonists with cholesterol efflux activity
LT3057984T (en) 2013-10-17 2018-12-27 Zealand Pharma A/S Acylated glucagon analogues
US9988429B2 (en) 2013-10-17 2018-06-05 Zealand Pharma A/S Glucagon analogues
KR102310392B1 (en) 2013-11-06 2021-10-13 질랜드 파마 에이/에스 Glucagon-glp-1-gip triple agonist compounds
AU2014345569B2 (en) 2013-11-06 2020-08-13 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
CA2939763A1 (en) * 2014-02-18 2015-08-27 Novo Nordisk A/S Stable glucagon analogues and use for treatment of hypoglycaemia
CN104926934B (en) * 2014-09-23 2016-11-09 蒋先兴 oxyntomodulin analogs
RU2716985C2 (en) 2014-10-29 2020-03-17 Зилэнд Фарма А/С Gip agonist compounds and methods
CR20170293A (en) * 2014-12-30 2017-11-03 Hanmi Pharm Ind Co Ltd GLUCAGON DERIVATIVES WITH IMPROVED STABILITY
JP6989385B2 (en) 2015-04-16 2022-01-05 ジーランド ファーマ アクティーゼルスカブ Acylated glucagon analog
WO2017074798A2 (en) * 2015-10-27 2017-05-04 Merck Sharp & Dohme Corp. Long-acting co-agonists of the glucagon and glp-1 receptors
JP6712323B2 (en) 2015-12-31 2020-06-17 ハンミ ファーマシューティカル カンパニー リミテッド Triple activator with activity on all glucagon, GLP-1 and GIP receptors
SG11201811697SA (en) 2016-06-29 2019-01-30 Hanmi Pharmaceutical Co Ltd Glucagon derivative, conjugate thereof, composition comprising same and therapeutic use thereof
SG10201911851VA (en) 2016-12-09 2020-02-27 Zealand Pharma As Acylated glp-1/glp-2 dual agonists
CN108299553B (en) * 2017-01-13 2021-07-16 博瑞生物医药(苏州)股份有限公司 Oxyntomodulin modifier
CN106986924A (en) * 2017-03-23 2017-07-28 中国药科大学 Oxyntomodulin(OXM)Analog and its application
SMT202400097T1 (en) * 2017-08-16 2024-05-14 Dong A St Co Ltd Acylated oxyntomodulin peptide analog
CA3220650A1 (en) 2017-09-25 2019-03-28 Merck Sharp & Dohme Llc Long-acting co-agonists of the glucagon and glp-1 receptors
CN115304666B (en) * 2017-11-24 2025-09-19 浙江道尔生物科技有限公司 Glucagon analogues for the treatment of metabolic disorders
CN115109166B (en) * 2017-11-24 2025-07-18 浙江道尔生物科技有限公司 Multi-domain active protein for treating metabolic diseases
WO2020098657A1 (en) * 2018-11-12 2020-05-22 天津药物研究院有限公司 Glucagon-derived peptide having dual receptor agonistic action and use thereof
CN110684082B (en) * 2019-10-08 2021-12-10 江苏诺泰澳赛诺生物制药股份有限公司 GIP and GLP-1 dual-agonist polypeptide compound, pharmaceutically acceptable salt and application
EP3842449A1 (en) 2019-12-23 2021-06-30 Merck Sharp & Dohme Corp. Stapled olefin co-agonists of the glucagon and glp-1 receptors
EP3842061A1 (en) 2019-12-23 2021-06-30 Merck Sharp & Dohme Corp. Stapled triazole co-agonists of the glucagon and glp-1 receptors
EP3842060A1 (en) 2019-12-23 2021-06-30 Merck Sharp & Dohme Corp. Stapled lactam co-agonists of the glucagon and glp-1 receptors
EP4148064A4 (en) * 2020-05-09 2024-06-12 Tianjin Institute Of Pharmaceutical Research Co., Ltd. POLYPEPTIDE DERIVATIVE WITH AGONISTIC DOUBLE RECEPTOR ACTIVITY AND USE THEREOF
CN112898405B (en) * 2021-01-22 2023-02-28 深圳市图微安创科技开发有限公司 Polypeptide compound and application thereof in preventing or treating diabetes or diabetic complications
CN119930789A (en) * 2023-11-06 2025-05-06 成都奥达生物科技有限公司 A GCG agonist compound

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4275152A (en) * 1977-02-03 1981-06-23 Eastman Kodak Company Hydrolysis of protein-bound cholesterol esters
US20040235710A1 (en) * 2001-08-28 2004-11-25 Defelippis Michael Rosario Pre-mixes of glp-1 and basal insulin
US20050095679A1 (en) * 2003-10-30 2005-05-05 Crescent Innovations, Inc. Method for producing medical and commercial grade poly-gamma-glutamic acid of high molecular weight
US20060252916A1 (en) * 2002-06-04 2006-11-09 Eli Lilly And Company Modified glucagon-like peptide-1 analogs
WO2007100535A2 (en) * 2006-02-22 2007-09-07 Merck & Co., Inc. Oxyntomodulin derivatives
US20080125574A1 (en) * 2006-09-08 2008-05-29 Ambrx, Inc. Modified Human Plasma Polypeptide or Fc Scaffolds and Their Uses
WO2008101017A2 (en) * 2007-02-15 2008-08-21 Indiana Unversity Research And Technology Corporation Glucagon/glp-1 receptor co-agonists
US20080318837A1 (en) * 2003-12-26 2008-12-25 Nastech Pharmaceutical Company Inc. Pharmaceutical Formation For Increased Epithelial Permeability of Glucose-Regulating Peptide

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2002353784B2 (en) 2001-09-24 2008-04-10 Oregon Health And Science University Assessment of neurons in the arcuate nucleus to screen for agents that modify feeding behavior
AU2003201998C1 (en) * 2002-01-10 2012-10-25 Imperial Innovations Limited Modification of feeding behavior
CA2612063A1 (en) * 2005-06-13 2006-12-21 Imperial Innovations Limited Oxyntomodulin analogues and their effects on feeding behaviour
JP5231732B2 (en) 2006-10-26 2013-07-10 株式会社東芝 COOLING DEVICE AND ELECTRONIC DEVICE HAVING THE SAME
EP2300037B1 (en) 2008-06-17 2016-03-30 Indiana University Research and Technology Corporation Glucagon/glp-1 receptor co-agonists
RU2550696C2 (en) 2008-12-19 2015-05-10 Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн Amide-based prodrugs of glucagon superfamily peptides
WO2010096052A1 (en) 2009-02-19 2010-08-26 Merck Sharp & Dohme Corp. Oxyntomodulin analogs

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4275152A (en) * 1977-02-03 1981-06-23 Eastman Kodak Company Hydrolysis of protein-bound cholesterol esters
US20040235710A1 (en) * 2001-08-28 2004-11-25 Defelippis Michael Rosario Pre-mixes of glp-1 and basal insulin
US20060252916A1 (en) * 2002-06-04 2006-11-09 Eli Lilly And Company Modified glucagon-like peptide-1 analogs
US20050095679A1 (en) * 2003-10-30 2005-05-05 Crescent Innovations, Inc. Method for producing medical and commercial grade poly-gamma-glutamic acid of high molecular weight
US20080318837A1 (en) * 2003-12-26 2008-12-25 Nastech Pharmaceutical Company Inc. Pharmaceutical Formation For Increased Epithelial Permeability of Glucose-Regulating Peptide
WO2007100535A2 (en) * 2006-02-22 2007-09-07 Merck & Co., Inc. Oxyntomodulin derivatives
US20080125574A1 (en) * 2006-09-08 2008-05-29 Ambrx, Inc. Modified Human Plasma Polypeptide or Fc Scaffolds and Their Uses
WO2008101017A2 (en) * 2007-02-15 2008-08-21 Indiana Unversity Research And Technology Corporation Glucagon/glp-1 receptor co-agonists

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP2398483A4 *

Cited By (89)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9593155B2 (en) 2009-02-19 2017-03-14 Merck Sharp & Dohme Corp. Oxyntomodulin analogs
US8415296B2 (en) 2009-12-22 2013-04-09 Eli Lilly And Company Oxyntomodulin peptide analogue
US8367607B2 (en) 2009-12-22 2013-02-05 Eli Lilly And Company Oxyntomodulin peptide analogue
US9765131B2 (en) 2011-06-10 2017-09-19 Hanmi Science Co., Ltd. Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
US9527898B2 (en) 2011-06-10 2016-12-27 Hanmi Science Co., Ltd. Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
CN103732618A (en) * 2011-06-10 2014-04-16 韩美科学株式会社 Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising same
US9522946B2 (en) 2011-06-10 2016-12-20 Hanmi Science Co., Ltd. Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
CN103732618B (en) * 2011-06-10 2018-10-09 韩美科学株式会社 It is novel to secrete the sour pharmaceutical composition for treating obesity for adjusting peptide derivant and acid adjusting peptide derivant is secreted comprising this
US10442848B2 (en) 2011-06-10 2019-10-15 Hanmi Science Co., Ltd. Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
JP2017043624A (en) * 2011-06-10 2017-03-02 ハンミ サイエンス カンパニー リミテッド Novel oxyntomodulin derivative and composition for treating obesity comprising the same
US11872283B2 (en) 2011-06-17 2024-01-16 Hanmi Science Co., Ltd Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
US9731031B2 (en) 2011-06-17 2017-08-15 Hanmi Science Co., Ltd. Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
US10363320B2 (en) 2011-06-17 2019-07-30 Hanmi Science Co., Ltd. Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
US10174093B2 (en) 2011-06-22 2019-01-08 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
US9156902B2 (en) 2011-06-22 2015-10-13 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
WO2012177443A2 (en) 2011-06-22 2012-12-27 Indiana University Research And Technology Corporation Glucagon/glp-1 receptor co-agonists
US9758562B2 (en) 2011-06-22 2017-09-12 Indiana University and Technology Corporation Glucagon/GLP-1 receptor co-agonists
US10730923B2 (en) 2011-06-22 2020-08-04 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
US8729017B2 (en) * 2011-06-22 2014-05-20 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
US20120329707A1 (en) * 2011-06-22 2012-12-27 Indiana University Research And Technology Corporation Glucagon/glp-1 receptor co-agonists
US9944687B2 (en) 2011-07-04 2018-04-17 Imperial Innovations Limited Compounds and their effects on feeding behaviour
JP2015525226A (en) * 2012-06-14 2015-09-03 サノフイ Exendin-4 peptide analog
US9181305B2 (en) 2012-06-14 2015-11-10 Sanofi Exendin-4 peptide analogues
US9901621B2 (en) 2012-07-25 2018-02-27 Hanmi Pharm. Co., Ltd. Composition for treating hyperlipidemia comprising oxyntomodulin derivative
US10493132B2 (en) 2012-07-25 2019-12-03 Hanmi Pharm. Co., Ltd. Composition for treating hyperlipidemia comprising oxyntomodulin derivative
WO2014049610A2 (en) 2012-09-26 2014-04-03 Cadila Healthcare Limited Peptides as gip, glp-1 and glucagon receptors triple-agonist
US9365632B2 (en) 2012-10-09 2016-06-14 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
WO2014056872A1 (en) 2012-10-09 2014-04-17 Sanofi Exendin-4 derivatives as dual glp1/glucagon agonists
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10279041B2 (en) 2012-11-06 2019-05-07 Hanmi Pharm Co. Ltd. Liquid formulation of long-lasting protein conjugate comprising the oxyntomodulin and an immunoglobulin fragment
US9724420B2 (en) 2012-11-06 2017-08-08 Hanmi Pharm. Co., Ltd. Liquid formulation of protein conjugate comprising an oxyntomodulin derivative covalently linked to a non-peptidyl polymer to an immunoglobulin FC region
US10550168B2 (en) 2012-11-06 2020-02-04 Hanmi Pharm. Co., Ltd. Composition for treating diabetes or diabesity comprising oxyntomodulin analog
US11071785B2 (en) 2012-11-06 2021-07-27 Hanmi Pharm. Co., Ltd. Liquid formulation of long-lasting protein conjugate comprising the oxyntomodulin and an immunoglobulin Fc region
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US10253079B2 (en) 2012-12-21 2019-04-09 Sanofi Functionalized Exendin-4 derivatives
US9745360B2 (en) 2012-12-21 2017-08-29 Sanofi Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists
US10450343B2 (en) 2013-03-21 2019-10-22 Sanofi-Aventis Deutschland Gmbh Synthesis of cyclic imide containing peptide products
WO2014147129A1 (en) 2013-03-21 2014-09-25 Sanofi-Aventis Deutschland Gmbh Synthesis of cyclic imide containing peptide products
US10087221B2 (en) 2013-03-21 2018-10-02 Sanofi-Aventis Deutschland Gmbh Synthesis of hydantoin containing peptide products
WO2014147124A1 (en) 2013-03-21 2014-09-25 Sanofi-Aventis Deutschland Gmbh Synthesis of hydantoin containing peptide products
WO2014161835A1 (en) 2013-04-03 2014-10-09 Sanofi Modified blood glucose regulating proteins with altered pharmacological activity profile and preparation thereof
US10987427B2 (en) 2013-09-13 2021-04-27 The Scripps Research Institute Modified therapeutic agents and compositions thereof
US10286078B2 (en) 2013-09-13 2019-05-14 The California Institute For Biomedical Research Modified therapeutic agents and compositions thereof
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
WO2015086731A1 (en) 2013-12-13 2015-06-18 Sanofi Exendin-4 peptide analogues as dual glp-1/glucagon receptor agonists
WO2015086733A1 (en) 2013-12-13 2015-06-18 Sanofi Dual glp-1/glucagon receptor agonists
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US11865160B2 (en) 2013-12-18 2024-01-09 The Scripps Research Institute Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof
US10039809B2 (en) 2013-12-18 2018-08-07 The California Institute For Biomedical Research Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof
US12337028B2 (en) 2013-12-18 2025-06-24 The Scripps Research Institute Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof
US11007252B2 (en) 2013-12-18 2021-05-18 The Scripps Research Institute Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
WO2015155139A1 (en) 2014-04-07 2015-10-15 Sanofi Exendin-4 derivatives as peptidic dual glp-1 / glucagon receptor agonists
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
WO2015155141A1 (en) 2014-04-07 2015-10-15 Sanofi Peptidic dual glp-1 / glucagon receptor agonists derived from exendin-4
WO2015155140A1 (en) 2014-04-07 2015-10-15 Sanofi Dual glp-1 / glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US10233230B2 (en) 2014-09-16 2019-03-19 Hanmi Pharm. Co., Ltd. Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease
US10435459B2 (en) 2014-09-16 2019-10-08 Hanmi Pharm. Co., Ltd. Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease
US10413593B2 (en) 2014-10-24 2019-09-17 Merck Sharp & Dohme Corp. Co-agonists of the glucagon and GLP-1 receptors
US11254724B2 (en) 2014-12-30 2022-02-22 Hanmi Pharm. Co., Ltd. Glucagon derivatives
US10513550B2 (en) 2014-12-30 2019-12-24 Hanmi Pharm Co., Ltd Glucagon derivatives
US12018060B2 (en) 2014-12-30 2024-06-25 Hanmi Pharm Co., Ltd. Glucagon derivatives
WO2016193371A1 (en) 2015-06-05 2016-12-08 Sanofi Prodrugs comprising an glp-1/glucagon dual agonist linker hyaluronic acid conjugate
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
WO2016198628A1 (en) 2015-06-12 2016-12-15 Sanofi Non-acylated exendin-4 derivatives as dual glp-1/glucagon receptor agonists
WO2016198624A1 (en) 2015-06-12 2016-12-15 Sanofi Exendin-4 derivatives as trigonal glp-1/glucagon/gip receptor agonists
EP4324519A3 (en) * 2015-06-30 2024-07-24 Hanmi Pharm. Co., Ltd. Glucagon derivative and a composition comprising a long acting conjugate of the same
EP4523705A3 (en) * 2015-06-30 2025-06-11 Hanmi Pharm. Co., Ltd. Glucagon derivative and a composition comprising a long acting conjugate of the same
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
WO2017062334A1 (en) * 2015-10-05 2017-04-13 Merck Sharp & Dohme Corp. Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors
US11773150B2 (en) 2015-10-05 2023-10-03 Merck Sharp & Dohme Llc Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors
US10800826B2 (en) 2015-10-05 2020-10-13 Merck Sharp & Dohme Corp. Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors
US11510993B2 (en) 2015-10-06 2022-11-29 Merck Sharp & Dohme Llc Antibody drug conjugate for anti-inflammatory applications
US10493125B2 (en) 2015-12-09 2019-12-03 Merck Sharp & Dohme Corp. Co-agonists of the glucagon and GLP-1 receptors
US11883500B2 (en) 2016-01-29 2024-01-30 Merck Sharp & Dohme Llc Phosphonate linkers and their use to facilitate cellular retention of compounds
US10869929B2 (en) 2016-01-29 2020-12-22 Merck Sharp & Dohme Corp. Phosphonate linkers and their use to facilitate cellular retention of compounds
US11554172B2 (en) 2016-01-29 2023-01-17 Merck Sharp & Dohme Llc Phosphonate linkers and their use to facilitate cellular retention of compounds
US10792367B2 (en) 2016-12-02 2020-10-06 Sanofi Conjugates comprising an GLP-1/glucagon dual agonist, a linker and hyaluronic acid
US11141489B2 (en) 2016-12-02 2021-10-12 Sanofi Conjugates comprising an GLP-1/Glucagon dual agonist, a linker and hyaluronic acid
WO2018100174A1 (en) 2016-12-02 2018-06-07 Sanofi Conjugates comprising an glp-1/glucagon dual agonist, a linker and hyaluronic acid
WO2020125744A1 (en) 2018-12-21 2020-06-25 江苏恒瑞医药股份有限公司 Bispecific protein
US11471512B2 (en) 2019-03-01 2022-10-18 Merck Sharp & Dohme Llc Pharmaceutical compositions of a peptide
US12583900B2 (en) 2019-12-04 2026-03-24 The Scripps Research Institute Peptide conjugates and methods of use
US20230220035A1 (en) * 2020-04-29 2023-07-13 Dong-A St Co., Ltd. Long-acting glp-1 and glucagon receptor dual agonist
US12329823B2 (en) 2021-06-09 2025-06-17 The Scripps Research Institute Long-acting dual GIP/GLP-1 peptide conjugates and methods of use

Also Published As

Publication number Publication date
PT2398483E (en) 2014-12-04
ZA201106051B (en) 2014-07-30
KR101634139B1 (en) 2016-06-28
KR20120068755A (en) 2012-06-27
WO2010096052A1 (en) 2010-08-26
EP2398483A1 (en) 2011-12-28
CN102573872B (en) 2016-03-23
US20120165503A1 (en) 2012-06-28
SG173791A1 (en) 2011-10-28
EP2398483A4 (en) 2013-03-06
BRPI0924307A8 (en) 2017-12-12
US9593155B2 (en) 2017-03-14
EP2398483B1 (en) 2014-09-24
RU2542362C2 (en) 2015-02-20
PL2398483T3 (en) 2015-03-31
AU2009340439B2 (en) 2015-07-16
CN102573872A (en) 2012-07-11
CA2754350C (en) 2019-07-09
BRPI0924307B1 (en) 2020-05-05
SI2398483T1 (en) 2015-01-30
US20150307580A1 (en) 2015-10-29
CA2754350A1 (en) 2010-08-26
JP5756961B2 (en) 2015-07-29
PE20120621A1 (en) 2012-06-08
BRPI0924307B8 (en) 2021-05-25
AU2009340439A1 (en) 2011-09-15
ES2524477T3 (en) 2014-12-09
MX2011008717A (en) 2012-09-28
BRPI0924307A2 (en) 2017-08-22
CL2011002036A1 (en) 2012-02-03
CY1116917T1 (en) 2017-04-05
IL214729A (en) 2016-06-30
IL214729A0 (en) 2011-11-30
HRP20141215T1 (en) 2015-02-13
HK1165333A1 (en) 2012-10-05
RU2011134596A (en) 2013-03-27
DK2398483T3 (en) 2014-10-27
JP2012518035A (en) 2012-08-09

Similar Documents

Publication Publication Date Title
EP2398483B1 (en) Oxyntomodulin analogs
EP1999143B1 (en) Neuromedin u receptor agonists and uses thereof
US20110301079A1 (en) Neuromedin u receptor agonists and uses thereof
US20090104210A1 (en) Peptide compounds for treating obesity and insulin resistance
WO2011005611A1 (en) Neuromedin u receptor agonists and uses thereof
US11542313B2 (en) Incretin analogs and uses thereof
US20140045746A1 (en) Antidiabetic tricyclic compounds
WO2010138343A1 (en) Neuromedin u receptor agonists
BRPI1001307B1 (en) oxygen injection in the flotation basin of the process of removing polluting substances in water courses
HK1165333B (en) Oxyntomodulin analogs
US20100143383A1 (en) Oxgr1 agonists for use in therapies for metabolic disorders

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980158734.X

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09840594

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2754350

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2011551052

Country of ref document: JP

Ref document number: MX/A/2011/008717

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 214729

Country of ref document: IL

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2011002036

Country of ref document: CL

Ref document number: 6329/DELNP/2011

Country of ref document: IN

Ref document number: 001525-2011

Country of ref document: PE

Ref document number: 12011501665

Country of ref document: PH

Ref document number: 2009840594

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2009340439

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2009340439

Country of ref document: AU

Date of ref document: 20091218

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20117021805

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2011134596

Country of ref document: RU

WWE Wipo information: entry into national phase

Ref document number: 13202524

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: PI0924307

Country of ref document: BR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: PI0924307

Country of ref document: BR

ENP Entry into the national phase

Ref document number: PI0924307

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20110819