WO2010096142A1 - Oxyntomodulin analogs - Google Patents
Oxyntomodulin analogs Download PDFInfo
- Publication number
- WO2010096142A1 WO2010096142A1 PCT/US2009/068678 US2009068678W WO2010096142A1 WO 2010096142 A1 WO2010096142 A1 WO 2010096142A1 US 2009068678 W US2009068678 W US 2009068678W WO 2010096142 A1 WO2010096142 A1 WO 2010096142A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- peptide
- residue
- amino
- peptide analog
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to peptide analogs of oxyntomodulin (OXM, glucagon- 37), which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-I /glucagon receptor (GCGR) agonist, and the use of such peptide analogs for treatment of metabolic disorders such as diabetes and obesity.
- OXM oxyntomodulin
- DPP-IV dipeptidyl peptidase IV
- GCGR GLP-I /glucagon receptor
- the hormone oxyntomodulin (OXM, glucagon-37) is a posttranslational product of preproglucagon processing in the intestine and central nervous system (CNS) and is secreted from L-cells in the gut in response to food intake.
- OXM has been implicated in the regulation of food intake and energy expenditure (Jarrouse et ah, Endocrinol. 115: 102-105 (1984); Schjoldager et al., Eur. J. Clin. Invest., 18: 499-503 (1988)).
- Central or peripheral administration of OXM in rats causes a decrease in short term food intake with minimal effects on gastric emptying (Dakin et al.
- OXM peripheral administration of OXM dose-dependently inhibited both fast-induced and dark phase food intake, but unlike GLP-I , had no effect on gastric emptying, OXM also reduced levels of fasting ghrelin and increased c-fos immunoreactivity, in the arcuate nucleus (ARC). Repeated seven-day IP administration of OXM caused a reduction in the rate of body weight gain and adiposity in rats ⁇ See Dakin et al. Endocrinology, 145: 2687-2695 (2004)).
- OXM isorectic mediated by the GLP-I receptor.
- the anorectic actions of OXM require only the GLP-I receptor, as icv OXM inhibits food intake in glucagon receptor knockout mice.
- the anorectic effects of OXM are completely absent in GLP-I receptor knockout mice.
- exendin-4 but not OXM, regulates energy expenditure in mice.
- OXM appears to be a weak agonist at the GLP-I receptor, when used in pharmacological concentrations (See Baggio et a!., Gastroenterol. 127: 546-58 (2004)).
- OXM was also found to ameliorate glucose intolerance in mice fed a high fat diet (Dakin et al, Am. J. Physiol. Endocrinol, Metab. 294: E142-E147 (2008) and increase the intrinsic heart rate in mice independent of the GLP-I receptor (Sowden et al, Am. J. Physiol. Regul. Integr. Comp. Physiol. 292: R962-R970 (2007). OXM has also been shown to differentially affect GLP-I receptor beta-arrestin recruitment and signaling through Galpha (Jorgensen et al, J. Pharma. Exp. Therapeut.
- OXM has a very short half-life and is rapidly inactivated by the cell surface dipeptidyl peptidase IV (DPP-IV) (Zhu et al, J. Biol. Chem. 278: 22418-22423 (2002).
- OXM peptide analogs for inducing weight loss in humans has been the object of Published International Application Nos. WO03/022304, WO2004/062685, and WO2006/134340.
- OXM therefore shows potential as a treatment for metabolic disorders such as diabetes and obesity.
- OXM analogs that can be safely and efficaciously administered for the treatment of metabolic diseases, such as diabetes and obesity. It would be further desirable if analogs or derivatives were developed that were modified by conjugation to moieties that would improve stability and pharmacokinetics, more particularly modifications that confer resistance to DPP-IV cleavage. It would further be desirable to provide OXM analogs that are capable of acting as dual GLP-I recept ⁇ r/glucagon receptor agonists.
- the present invention provides oxyntomodulin (OXM, glucagon-37) peptide analogs, which have been modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV) and to increase in vivo half-life of the peptide analog while enabling the peptide analog to act as a dual GLP-I /glucagon receptor (GCGR) agonist, and the use of such peptide analogs for treatment of metabolic disorders such as diabetes and obesity,
- the analogs disclosed herein reduce food intake and body weight, increase metabolic rate, mediate glucose- dependent insulin secretion (GDIS) from pancreatic islets and improve glucose tolerance, thereby providing a treatment option for individuals afflicted with a metabolic disorder such as metabolic syndrome, obesity, diabetes, metabolic syndrome X, hyperglycemia, impaired fasting glucose, dyslipidemia, atherosclerosis, and other prediabetic states.
- a metabolic disorder such as metabolic syndrome, obesity, diabetes, metabolic syndrome X, hyper
- the present invention provides a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N -terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide is capable of acting as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
- the amino acid substituted for the second amino acid from the N-terminus is selected from the group consisting of D
- a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N- terminus is substituted with an amino acid selected from the group consisting of D-serine and ⁇ - aminoisobutyric acid; the C-terminus of the peptide includes a cysteine residue in which the thiol group of the cysteine residue is covalently linked to a cholesterol moiety by a hydrophilic linker; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP- 1 receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
- OXM human oxyntomodulin
- a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO:1 wherein the second amino acid from the N- terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 17, 18, and 27; and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof.
- OXM human oxyntomodulin
- the one or more amino acid substitutions selected from the group consisting of glutamic acid for the arginine at position 17, alanine for the arginine at position 18, norleucine or O-methyl-L-homoserine for the methionine at position 27.
- a peptide comprising the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N- terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; the peptide lacks the amino acid sequence RNRNNIA (SEQ ID NO: 104); and the peptide optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide; wherein the peptide acts as a dual GLP-I receptor and glucagon receptor agonist and has a serum half-life greater than the serum half-life of the human OXM, and pharmaceutically acceptable salts thereof,
- OXM human oxyntomodulin
- the amino acid substitution at position 2 is an amino acid selected from the group consisting of D-serine and ⁇ -aminoisobutyric acid and the cholesterol moiety is covalently linked to the thiol group of a cysteine by a hydrophilic linker and the cysteine residue is covalently linked to the C-terminus of the peptide by a peptide bond.
- the peptide further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 17, 18, and 27.
- the peptide further includes one or more amino acid substitutions selected from the group consisting of arginine at position 17 to glutamic acid, arginine at position 18 to alanine, methionine at position 27 to norleucine or O-methyl-L-homoserine.
- the peptide includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue at the C-terminus of the peptide.
- the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker.
- the hydrophilic linker can be a peptide or polymer such as an ethoxy polymer that includes one to ten ethoxy units.
- the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
- the peptide includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue covalently linked to the C-terminus of the peptide, which in particular embodiments is a palmitoyl.
- the lysine residue is linked to the C-terminus of the peptide by means of a linker moiety.
- the linker moiety includes one or more gamma-glutamic acid residues and in other aspects, the linker moiety is l-amino-4,7,10-tioxa-13-tridecanamine succinimic acid.
- OXM peptide analog selected from the peptide analogs presented in Table 1 and Table 2 and the use of one more of the OXM peptide analogs presented in Table 1 and Table 2 in the manufacture of a medicament for the treatment of a metabolic disorder.
- Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargyl glycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutyl glycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Ac
- NIe methionine sulfoxide
- m methionine sulfoxide
- o O-methyl-L-homoserine residue
- Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group
- Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety
- Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety
- P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L] ⁇ Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
- the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
- Z2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
- the lipid moiety is a palmitoyl.
- L] is a linker moiety.
- the linker moiety is a hydrophilic linker moiety.
- the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino- 4,7,10-tioxa-13-tridecanamine succinirnic acid.
- the peptide comprises a structure selected from OXM70 (SEQ ID NO:12);OXM110 (SEQ ID NO: 19); OXMl 15 (SEQ ID NO:21); OXMl 77 (SEQ ID NO:24); OXM212 (SEQ ID NO;27); OXM213 (SEQ ID NO;28); OXM216 (SEQ ID NO:29); OXM290 (SEQ ID NO:4 ⁇ ); OXM301 (SEQ ID N0:51); or OXM325 (SEQ ID NO:65).
- the peptide comprises a structure selected from OXM237 (SEQ ID NO:31); OXM238 (SEQ ID NO:32); OXM259 (SEQ ID NO:33); OXM260 (SEQ ID NO:34); OXM261 (SEQ ID NO:35); OXM262 (SEQ ID NO:36); OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OXM265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44); and OXM308 (SEQ ID NO:45).
- OXM237 SEQ ID NO:31
- OXM238 SEQ ID NO:32
- OXM259 SEQ ID NO:33
- OXM260 SEQ ID NO:
- the peptide comprises a structure selected from OXM291 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO:52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:54); OXM305 (SEQ ID NO:55); 0XM31 1 (SEQ ID NO:56); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO:58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO: ⁇ l); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:
- the peptide when the peptide lacks RNRNNIA (SEQ ID NO: 104), the peptide comprises the structure selected from OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM
- Xi is a D ⁇ serine, ⁇ -aminoisobutyric acid (a ⁇ b), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha- aminobutyric acid (D- Abu); Amino valeric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe);
- NIe methionine sulfoxide
- m methionine sulfoxide
- o O-methyl-L-homoserine residue
- Zi is an optionally present protecting group that, if present, is joined to the N ⁇ terminal amino group, Li is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L3 is an optionally present protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
- the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
- Z2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
- the lipid moiety is a palmitoyl
- Li is a linker moiety.
- the linker moiety is a hydrophilic linker moiety.
- the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino- 4,7,10-tioxa-13-tridecanamine succinimic acid.
- the peptide comprises a structure selected from OXM291 (SEQ ID NO:47); OXM292 (SEQ ID NO:48); OXM293 (SEQ ID NO:49); OXM294 (SEQ ID NO:50); OXM302 (SEQ ID NO.52); OXM303 (SEQ ID NO:53); OXM304 (SEQ ID NO:S4); OXM305 (SEQ ID NO:55); OXM311 (SEQ ID NO:5 ⁇ ); OXM312 (SEQ ID NO:57); OXM314 (SEQ ID NO; 58); OXM313 (SEQ ID NO:59); OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO.64); OXM327 (SEQ ID NO:6 ⁇ ); or OXM329 (SEQ ID NO:
- the peptide comprises the structure selected from OXM345 (SEQ ID NO: ⁇ 9); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO;74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO:80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO:83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO:85); OXM404 (SEQ ID NO:8 ⁇ ); OXM406 (SEQ ID NO:9
- Xj is a D-serine, ⁇ -aminoisobutyric acid (aib)., 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D- Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutyl glycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe);
- Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Lj is optional but when present is a linker moiety;
- Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and
- P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- Z2 is a cysteine residue, which in particular embodiments, can be covalently linked by its thiol group to a cholesterol moiety or a lipid moiety.
- the cholesterol moiety or lipid moiety is covalently linked to the thiol group of the cysteine by a hydrophilic linker.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units or in more specific aspects, the hydrophilic linker is an ethoxy polymer that includes four ethoxy units.
- Z2 is a lysine residue, which in particular embodiments, the ⁇ -amino group of the lysine is covalently linked to a cholesterol moiety or a lipid moiety, either directly or by means of a hydrophilic linker.
- the lipid moiety is a palmitoyl.
- L] is a linker moiety.
- the linker moiety is a hydrophilic linker moiety.
- the linker moiety comprises one or more gamma-glutamic acid residues and in other aspects, the linker moiety is 1-amino-
- the peptide comprises a structure selected from OXM290 (SEQ ID NO:46); OXM301 (SEQ ID NO:51); OXM321 (SEQ ID NO:
- the peptide comprises a structure selected from OXM70 (SEQ ID NO:12);OXM110 (SEQ ID NO: 19); OXM1 ⁇ 5 (SEQ ID NO: 12);OXM110 (SEQ ID NO: 19); OXM1 ⁇ 5 (SEQ ID NO: 12);OXM110 (SEQ ID NO: 19); OXM1 ⁇ 5 (SEQ ID NO: 12);OXM110 (SEQ ID NO: 19); OXM1 ⁇ 5 (SEQ ID NO:
- OXM177 SEQ ID NO;24
- OXM212 SEQ ID NO:27
- OXM213 SEQ ID NO:28
- OXM216 SEQ ID NO:29
- the peptide comprises a structure selected from OXM237 (SEQ ID NO:31); OXM238 (SEQ ID NO:32); OXM259 (SEQ ID NO:31);
- OXM260 SEQ ID NO:34
- OXM261 SEQ ID NO;35
- OXM262 SEQ ID NO:3 ⁇
- OXM263 (SEQ ID NO:37); OXM264 (SEQ ID NO:38); OX3VI265 (SEQ ID NO:39); OXM266 (SEQ ID NO:40); OXM267 (SEQ ID NO:41); OXM268 (SEQ ID NO:42); OXM306 (SEQ ID NO:43); OXM307 (SEQ ID NO:44); and OXM308 (SEQ ID NO:45).
- peptide analogs that are a dual GLP-I /glucagon receptor (GCGR) agonist and have a pi of less than 6,0.
- Peptide analogs comprising a cholesterol or fatty acid moiety and have a pi of less than 6 have been found to have a reduced capacity for stimulating mast cell degranulation as determined by a in vitro counterscreening assay using the human mast cell line LAD2, Therefore, further provided is a peptide analog comprising the amino acid sequence HSQGTFTSD YSKYLDSRRAQDFVQWLMNTK (SEQ ID NO: 109) in which the second amino acid from the TV-terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues; the peptide optionally includes one to
- the amino acid substituted for the second amino acid from the iV-terminus of the peptide analog is selected from the group consisting of D-serine, ⁇ - aminoisobutyric acid, and 1 -amino- 1 -cyclobutane carboxylic acid.
- the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues
- the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker, which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
- the peptide analog includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue: in particular embodiments the lipid moiety is a fatty acid such as a palmitoyl, rnyristoyl, or stearoyl moiety. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
- the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
- the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27,
- the peptide analog includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or ⁇ -aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the argini ⁇ e at position 18, lysine for the glutamine at position 20, and norleucine or O-methyl-L-homoserine for the methionine at position 27.
- the tyrosine at position 10 in the peptide analog is replaced with a lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues
- the glutamine at position 20 in the peptide analog is replaced with lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine by one or more gamma-glutamic acid residues.
- the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus
- Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl ⁇ propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe) residue,
- peptide analogs have a pi between 4 and 6, or a pi of about 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, or 5.9, or a pi of about 5.4 to 5.5.
- M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C- terminus of P.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units, which in particular aspects can include for example, four ethoxy units.
- M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P or M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position X2 or
- the lipid moiety is a palmitoyl, myristoyl, or stearoyl moiety.
- the peptide analog is OXM317 (SEQ ID NO:60); OXM318 (SEQ ID NO:61); OXM319 (SEQ ID NO:62); OXM323 (SEQ ID NO:64); OXM327 (SEQ ID NO:66); or OXM329 (SEQ ID NO;67).
- the peptide analog is OXM345 (SEQ ID NO:69); OXM355 (SEQ ID NO:70); OXM357 (SEQ ID NO:71); OXM359 (SEQ ID NO:72); OXM361 (SEQ ID NO:73); OXM373 (SEQ ID NO:74); OXM374 (SEQ ID NO:75); OXM380 (SEQ ID NO:76); OXM381 (SEQ ID NO:77); OXM383 (SEQ ID NO:78); OXM388 (SEQ ID NO:79); OXM392 (SEQ ID NO: 80); OXM395 (SEQ ID NO:81); OXM398 (SEQ ID NO:82); OXM399 (SEQ ID NO: 83); OXM400 (SEQ ID NO:84); OXM401 (SEQ ID NO: 85); OXM404 (SEQ ID NO:86); OXM406 (SEQ ID NO:87); OXM3
- a GLP-I agonist is a peptide, small molecule, or chemical compound that binds to the GLP-I receptor and stimulates the same biological activity as does GLP-I .
- an agonist for the GLP-I receptor binds to the receptor with at least 1% of the affinity as native GLP-I, In another embodiment, an agonist for the GLP-I receptor binds to the receptor with an equal or greater affinity than native GLP-I .
- a glucagon agonist is a peptide, small molecule, or chemical compound that binds to the glucagon receptor and stimulates the same biological activity as does glucagon.
- an agonist for the glucagon receptor binds to the receptor with at least 1% of the affinity as native glucagon.
- an agonist for the glucagon receptor binds to the receptor with an equal or greater affinity than native glucagon.
- a “dual GLPl /glucagon receptor agonist” is “GLPl receptor/glucagon receptor co-agonist molecule", which exhibit activity at both the glucagon receptor and the GLPl receptor.
- a dual GLPl receptor agonist and glucagon receptor agonist exhibits activity at the glucagon receptor of at least about 10% relative to native glucagon and also exhibits activity at the GLP-I receptor of at least about 10% relative to native GLP-I .
- Figure 1 shows the results of an ex vivo assay comparing glycogenolysis of native OXM to OXM(Q3E),
- the Figure shows that native OXM induces glycogenolysis in a dose dependent fashion and induces full glycogenolysis at 1.5 nM and has an approximate EC50 of 0.5 nM whereas OXM-Q3E induced only about 58% at 300 nM, consistent with its poor GCGR agonist potency.
- Figure 2 shows the results of an in vivo GCG Receptor occupancy experiment showing that glucagon (GCG) at 1.5 mpk gave 84% GCGR occupancy and 3 mpk OXM gave 31% GCGR occupancy but that OXM-Q3E gave 0% GCGR occupancy.
- GCG glucagon
- Figures 3A and 3B show the blood glucose levels and glucose infusion rates, respectively, in response to OXM and OXM-Q3E.
- Figure 4 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous (s.c.) administration of OXM and OXM-Q3E
- Figure 5A shows ex vivo measurement of glycogenolysis in perfused liver in the presence of OXM70, OXMl 10, OXM177, OXMl 15, and OXM216.
- IPGTT intraperitoneal glucose tolerance test
- Figure 5B shows GGCR occupancy following subcutaneous (s.c.) or intravenous (i.v.) administration of the OXM70, OXMl 10, OXM177, OXMl 15, and OXM2I6 compared to native OXM in a competition assay in wild-type mice.
- Figure 7 summarizes the acute in vivo efficacy of OXMl 10 and OXM 177 on reducing food intake and body weight in established DIO mice.
- Food intake was measured about two hours and 18 hours later.
- Figure 8 summarizes the acute in vivo efficacy of OXM216, OXMl 15, and OXMl 77 on reducing food intake and body weight in established DIO mice.
- Food intake was measured about two hours and 18 hours later.
- Figures 9A-D shows the pharmacological end points of a chronic body weight and food intake study in DIO mice for OXM peptide analogs OXMl 10, OXM177, and OXMl 15.
- Figure 9 A shows the cumulative change in food intake.
- Figure 9B shows the cumulative change in body weight.
- Figure 9C shows basal glucose levels over several days of the study.
- Figure 9D shows IPGTT assay on day 13 of the study.
- FIG 10 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM70.
- IPGTT intraperitoneal glucose tolerance test
- Figure 11 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXMl 10.
- Figure 12 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXM 177.
- FIG 13 shows the results of an intraperitoneal glucose tolerance test (IPGTT) in lean mice for subcutaneous administration of OXMl 15.
- IPGTT intraperitoneal glucose tolerance test
- Figure 14A shows the metabolic rate effects of OXMl 15 in DIO Mice over lime.
- Figure 14B shows the percent change in metabolic rate caused by OXMl 15 in the DIO
- Figure 15 summarizes the acute in vivo efficacy of several +/+ peptides on reducing food intake and body weight in established DIO mice.
- Figure 16 shows single dose of several +/+ peptides on food intake on reducing food intake and body weight in established DIO mice.
- OXM-based therapy has the potential to favorably impact both obesity and, the as yet to be carefully characterized, concomitant effects on improving diabetes.
- Weight loss efficacy and reduction in food intake upon peripheral administration of OXM has been well validated in humans (Wynne et al., Diabetes 54: 2390-2395 (2005)). More recently, OXM has been shown to increase metabolic rate and specifically activity-related energy expenditure in obese subjects (Wynne et al, Int. J. Obes. 30: 1729-1736 (2006), advance online publication, April 18, 2006; doi: 10.1038/sj.ijo.0803344). OXM has also been shown to reduce body weight in humans ⁇ See,, for example, Published International Application Nos.
- the OXM peptide analogs disclosed herein are more convenient for therapeutic purposes than native OXM, which requires t.i.d. dosing.
- the tolerability profile of polypeptides of the current invention is anticipated to be similar to that of native OXM in humans, which may be superior to that of conventional GLP-I minietics like exenatide and liraglutide.
- the chronic efficacy of the OXM analogs disclosed herein may therefore be better than conventional GLP-I mimetics, such as Byetta® (Amylin
- OXM analogs disclosed herein which incorporate a balanced GLP-I receptor and GCGR co-agonism, gives enhanced reductions in food intake and body weight with chronic administration and results in improved glucose tolerance.
- OXM peptide analogs that have dual GLP-I receptor (GLP-IR) and glucagon receptor (GCGR) agonist activity are indicated herein as (+/+).
- OXM peptide analogs that are GLP-I agonists only are indicated herein as (+/O).
- OXM analogs disclosed herein can be used for is the treatment of obesity and/or diabetes. Secondary indications are metabolic syndrome, hyperglycemia, impaired fasting glucose, and other prediabetic states. Further indications include all indications for GLP-I such as irritable bowel syndrome and other absorptive diseases of the gut, ischemia, stroke, and neurological disorders including anxiety, impaired cognition, and Alzheimer's disease.
- OXM analogs disclosed herein are anticipated to exhibit at least comparable if not superior efficacy and a better safety profile than current anti-obesity agents such as orlistat (Xenical® (Roche), a lipase inhibitor) and sibutramine (Meridia® (Abbott Laboratories), a seratonin/norepinephrine re-uptake inhibitor), for which GI intolerance (diarrhea, flatulence) and hypertension are common side effects, respectively,
- the OXM peptide analogs optionally includes a protecting group covalently joined to the N-terminal amino group.
- a protecting group covalently joined to the N- terminal amino group of the peptide reduces the reactivity of the amino terminus under in vivo conditions.
- Amino protecting groups include -Ci_io alkyl, -C ⁇ io substituted alkyl, -C2-10 alkenyl, -C2.10 substituted alkenyl, aryl, -C ⁇ - ⁇ alkyl aryl, -C(O)-(CH2)i-6 ⁇ COOH, -C(O)-Ci .g alkyl, -C(O)-aryI, -C(O)-O-Ci .5 alkyl, or -C(O)-O-aryl.
- the amino terminus protecting group is selected from the group consisting of acetyl, propyl, succinyl, benzyl, benzyloxycarbonyl, and t-butyloxycarbonyl.
- Deamination of the N-terminal amino acid is another modification that is contemplated for reducing the reactivity of the amino terminus under in vivo conditions.
- the OXM peptide analogs may be modified to have a protecting group covalently joined to the C-terminal carboxy group, which reduces the reactivity of the carboxy terminus under in vivo conditions.
- carboxylic acid groups of the peptide may be provided in the form of a salt of a pharmacologically-acceptable cation or esterified to form a C ⁇ . g ester, or converted to an amide of formula NRR2 wherein R and R2 are each independently H or Ci -6 alkyl, or combined to form a heterocyclic ring, such as a 5 -or 6-membered ring.
- the carboxy terminus protecting group is preferably attached to the ⁇ - carbonyl group of the last amino acid.
- Carboxy terminus protecting groups include, but are not limited to, amide, Diethylamide, and ethylamide.
- Amino groups of the peptide, whether N- terminal or side chain, may be in the form of a pharmacologically-acceptable acid addition salt, such as the HCl, HBr, acetic, benzoic, toluene sulfonic, maleic, tartaric, and other organic salts, or may be modified to Ci -6 alkyl or dialkyl amino or further converted to an amide.
- the OXM peptide analogs that are capable of acting as dual GLP-I and glucagon agonists comprise the amino acid sequence of a human oxyntomodulin (OXM) shown in SEQ ID NO: 1 wherein the second amino acid from the N-terminus is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; a lipid or cholesterol moiety covalently linked to the OXM peptide analog; optionally one to three amino acid substitutions in addition to the substitution at position 2; and optionally has a protecting group that, if present, is joined to the C-terminal carboxy group of the peptide,
- the peptide analogs further lack the amino acid sequence RNRNNIA (SEQ ID NO: 104).
- OXM peptide analogs having the above structure will act as a dual GLP-I receptor and glucagon receptor agonist and have a serum half-life greater than the serum half-life of native human OXM.
- the OXM peptide analog can be represented by the structure
- HX1QGTFTSDYSKYLDSX2X3AQDFVQWLX4NTK (SEQ ID NO: 103) wherein Xi is a D-serine or ⁇ -aminoisobutyric acid (aib) residue; X2 is an arginine (R) or glutamic acid (E) residue; X3 is an arginine (R) or alanine (A) residue; X4 is a methionine (M), norleucine (NIe), or O-methyl-L-homoserine (0) residue;
- Z ⁇ is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Lj is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety;
- Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked Io a cholesterol moiety; and
- P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
- the OXM peptide analog can be represented by the structure
- X] is a D-serine or ⁇ -aminoisobutyric acid (aib) residue
- X2 is an arginine (R) or glutamic acid (E) residue
- X3 is an arginine (R) or alanine (A) residue
- X4 is a methionine (M), norleucine (NIe), or O-methyl-L-homoserine (o) residue
- M methionine
- NIe norleucine
- o O-methyl-L-homoserine
- Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Li is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L1-Z2 can be linked to the C- terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid (Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2 ⁇ cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (
- Zi is an optionally present protecting group that, if present, is joined to the N-termiiial amino group
- Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety
- Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety
- P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
- the OXM peptide analog can be represented by the structure Z1-P-L1-Z2 wherein P is a peptide having the amino acid sequence
- Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 - Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 - Amino- 1 -cyclopentane carboxylic acid (Acpe
- NIe methionine sulfoxide
- m methionine sulfoxide
- o O-methyl-L-homoserine residue
- Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO; 304) or a linker moiety; Z 2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- Xj is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, I-Amino-1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 - Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1-cyclopentane carboxylic acid (Acpe); X2 is
- Z] is an optionally present protecting group that, if present, is joined to the N-terminal amino group, L] is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or Z2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- L1-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure Z1-P-L1 -Z2 wherein P is a peptide having the amino acid sequence
- Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 - Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alanine (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe);
- NIe methionine sulfoxide
- m methionine sulfoxide
- o O-methyl-L-homoserine residue
- Zi is an optionally present protecting group that, if present, is joined to the N- terminal amino group, Lj is optional but when present is a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or ⁇ 2 optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof, I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid of P.
- the OXM peptide analog can be represented by the structure
- Xi is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1-cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1 -cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alpha-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl- alanine (Cpa); propargylglycine (Prg); AlJylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 - Amino- 1 -cyclopentane carboxylic acid (Acpe
- Zj is an optionally present protecting group that, if present, is joined to the N-terminal amino group, Li is optional but when present is amino acid sequence RNRNNIA (SEQ ID NO: 104) or a linker moiety; Z2 is optional but when present is a lysine (K) residue, a lysine residue covalently linked to a lipid moiety, a lysine residue covalently linked to a cholesterol moiety, a cysteine (C) residue, a cysteine residue covalently linked to a lipid moiety; a cysteine residue covalently linked to a cholesterol moiety; and P or 2/ ⁇ optionally includes a protecting group that, if present, is joined to the C-terminal carboxy group; and pharmaceutically acceptable salts thereof.
- I4-Z2 can be linked to the C-terminal amino acid of P or to an internal amino acid ofP.
- the lipid or cholesterol moiety can be directly or indirectly linked to the side chain of an amino acid.
- the lipid or cholesterol moiety is linked to the amino acid side-chain by means of a linker moiety.
- the lipid or cholesterol is directly linked to the side chain of an amino acid which is then linked to the OXM peptide analog by a linker moiety (Li).
- the linker moiety is a hydrophilic linker.
- the chemical structure of the linker moiety is not critical, however, since it serves primarily as a spacer. However, in certain embodiments, the linker moiety may itself provide improved properties to the OXM peptide analogs.
- linker moiety is covalently linked to the C-terminal amino acid of the peptide (P) and Z2 is covalently linked to the linker moiety.
- linker moiety is covalently linked to an internal amino acid of P and Z2 is covalently linked to the linker moiety.
- L1-Z2 are covalently linked to an internal amino acid of
- P, X9 can include one or more gamma glutamic acid residues.
- the OXM peptide analogs include diastereomers as well as their racemic and resolved enantiomerically pure forms.
- the amino acids are in the L-form with particular amino acids in D-form.
- individual amino acids can be represented as follows:
- OXM29, 208, 209 and 229 are peptide analogs precursors (thiolated peptides) that were used for the conjugation reaction with the bromo-cholesterol moieties.
- Cj Cys(cholest-5-en-3-yl l- ⁇ [(2R)-3-amino-2-(amino)-3-oxo ⁇ ropyl]thio ⁇ -2-oxo-6,9,12,15- tetraoxa-3-azaoctadecan-18-oate) or Cys(Oxa4-cholesterol).
- OXM peptide analogs OXM36 and OXMl 15 were prepared from OXM229, which includes the native human OXM peptide but with a D-serine at amino acid position 2 and a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated, OXM36 has the structure
- HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC ⁇ CONHz (SEQ ID N0:8) wherein C4 is a cysteine residue in which choIest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3- oxopropyl]thio ⁇ acetate is covalently linked thereto as shown below.
- OXMl 15 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC ⁇ - CONH2 (SEQ ID N0:21) wherein the C7 is a cholest-5-en-3-yl l- ⁇ [(2R)-3-amino-2-(amino)-3- oxopropyl]thio ⁇ -2-oxo-6 J 9,12,15-tetraoxa-3-azaoctadecan-18-oate (or Cys(Oxa4-cholesterol)) as shown below.
- C7 differs from C4 in that it has a hydrophilic spacer formed by four ethylene glycol repeats (ethoxy units) between the cholesterol group and the cysteine moiety.
- the C7 group increases solubility of the resulting peptide-cholesterol conjugate.
- the peptide-C ⁇ conjugate shows a less prominent serum shift than peptide-C4 conjugates. This was found to be important for maintaining an optimal balanced activity on the two receptors GLP-IR and Glucagon receptor. The results shown in the Examples illustrate this aspect.
- OXM peptide analogs OXM70 and OXM216 were prepared from OXM29, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2 and with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
- OXM70 has the structure HOQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAC4-CONH2 (SEQ ID NO: 12) wherein C4 is cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate as shown for OXM36.
- OXM216 has the structure
- OXM peptide analog OXM212 was prepared from OXM208, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2, norleucine in place of the methionine residue at position 27, with a cysteine residue in peptide linkage at the C- terminus and in which the C-terminal carboxy group has been amidated.
- OXM212 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLnNTKRNRNNIAC4-CONH2 (SEQ ID NO:26) wherein C4 is cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate as shown for OXM36.
- OXM peptide analog OXM213 was prepared from OXM209, which includes the native human OXM peptide but with ⁇ -aminoisobutyric acid at amino acid position 2, O-methyl-L- homoserine in place of the methionine residue at position 27, with a cysteine residue in peptide linkage at the C-terminus and in which the C-terminal carboxy group has been amidated.
- OXM213 has the structure HaQGTFTSDYSKYLDSRRAQDFVQWLYNTKRNRNNIAC 4 -
- HSQGTFTSDYSICYLDSRRAQDFVQWLmNTKRNRNNIAC 7 -CONH 2 (SEQ ID N0:31). It was designed to contain D-Ser (s) at position 2, Met(O) at position 27, and a Cys(0xa4- cholesterol) (C7) at position site 38.
- OXM238 was designed to contain D-Ser (s) at position 2, Met(O) at position 27, and a Cys(acetamide) (C5) at position site 38.
- This peptide has the same peptide sequence of OXM237 and is a control peptide with no cholesterol but with the cysteine thiol blocked with acetamide.
- OXM259-OXM268 and OXM306-308 (as shown in Table 1) have the amino acid sequence of OXM but wherein the amino acid at position 2 has been substituted with a non- natural amino acid to identify amino acid substitutions that confer resistance to DPP4 catalytic activity.
- OXM peptide analogs that lack the amino acid sequence RNRNNIA can also display full agonistic activity on the GLP-I and the Glucagon receptors.
- These OXM peptide analogs along with some additional peptides based upon the full-sized OXM peptide are shown in Table 2.
- These truncated OXM peptide analogs are variants of the Glucagon K (GcgK) genus of peptides that were disclosed in commonly owned International Published Application No. WO2007100535.
- the GcgK peptides are peptides where the OXM sequence has been truncated at the C terminus to eliminate the seven amino acid residues at the C-terminus.
- the resulting peptide is that one of glucagon with an extra lysine residue at the C-terminus,
- This GcgK peptide is compatible with a +/+ pattern in which the peptides show subnanomolar potency on both the GLP-IR and the GCGR.
- native OXM shows nanomolar potency on the two receptors.
- An additional advantage of the GcgK peptide is that the two basic arginine residues at the C-terminus have been eliminated. This was important in the construction of lipidated (acylated or cholesterylated) peptide analogs having dual GLP-I /GCGR agonist activity.
- the pi for lipidated based peptide analogs should be around 5. Therefore, in particular aspects the lipidated peptide analogs have a pi less than 6.0. In further aspects, the lipidated peptide analogs have a pi between 4.5 and 6.0. In a further aspect, the lipidated peptide analogs have a pi of about 5.4.
- Reduction of pi was done using one or more of the following three different strategies: 1) substitution of residues in the peptide, 2) introduction of a carboxylate group at the C terminus, and 3) introduction of negative residues such as one or more gamma-carboxy-glutamic acid residues as spacers.
- the acyl or cholesterol group is covalently linked to the peptide by means of a spacer that comprises two gamma-carboxy-glutamic acid residues.
- these peptide analogs include those peptide analogs shown in Table 2,
- peptides with a pi of about 5.4 include but are not limited to OXM345, OXM380, OXM381 , OXM392, OXM395, OXM398, OXM399, OXM400, and OXM401.
- the acyl or cholesterol group is covalently linked to an internal amino acid in the peptide analogs by means of a spacer that comprises one or two gamma-carboxy-glutamic acid residues and the peptide further includes one or more gamma-carboxy-glutamic acid residue covalently to the lysine residue at the C-terminus.
- these peptide analogs include but are not limited to OXM407, OXM408, OXM414, and OXM418.
- the acyl or cholesterol group is covalently linked to the C-terminus of the peptide by means of a spacer that comprises one gamma-carboxy-glutamic acid residue and the peptide further includes one or more amino acid substitutions to reduce the p ⁇ of the peptide.
- OXM374 is an example of such a peptide analog.
- a peptide analog comprising the amino acid sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNTK (SEQ ID NO; 109) in which the second amino acid from the TV- terminus of the peptide is substituted with an amino acid that renders the peptide resistant to cleavage and inactivation by dipeptidyl peptidase IV; the peptide includes a lipid or cholesterol moiety covalently linked to the peptide by a spacer comprising one or more gamma-glutamic acid residues; the peptide optionally includes one to three amino acid substitutions in addition to the substitution at position 2; and the peptide optionally includes a protecting group that, if present, is joined to the C-lerminal carboxy group of the peptide; wherein the peptide analog has a pi of less than 6.0 and is a dual GLP-I receptor agonist and glucagon receptor agonist, and pharmaceutically acceptable salts thereof.
- peptide analogs has a pi of less
- the amino acid substituted for the second amino acid from the TV-terminus of the peptide analog is selected from the group consisting of D-serine, ⁇ - aminoisobutyric acid, and 1 -amino- 1-cyclobutane carboxylic acid.
- the peptide analog includes a cholesterol moiety covalently linked to the thiol group of a cysteine residue that is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus of the peptide analog by a spacer comprising one or more gamma glutamic acid residues.
- the cholesterol moiety is covalently linked to the thiol group by a hydrophilic linker, which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
- a hydrophilic linker which in particular embodiments is an ethoxy polymer that includes one to twelve ethoxy units for example, an ethoxy polymer that includes four ethoxy units.
- the peptide analog includes a lipid moiety covalently linked to the ⁇ -amino group of a lysine residue: in particular embodiments the lipid moiety is a fatty acid such as a palmitoyl, myristoyl, or stearoyl moiety. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues. In a further embodiment, the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
- the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues and the lysine residue linked to the lysine residue at the C-terminus by one or more gamma-glutamic acid residues.
- the peptide analog further includes one or more amino acid substitutions at amino acid positions selected from the group consisting of positions 10, 12, 16, 17, 18, and 27.
- the peptide analog includes one or more amino acid substitutions selected from the group consisting of lysine for the tyrosine at position 10, serine for the lysine at position 12, glutamic acid or a-aminoisobutyric acid for the serine at position 16, glutamic acid for the arginine at position 17, alanine for the arginine at position 18, lysine for the glutamine at position 20, and norleucine or Omethyl-L-homoserine for the methionine at position 27.
- the tyrosine at position 10 in the peptide analog is replaced with a lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine residue by one or more gamma-glutamic acid residues
- the glutamine at position 20 in the peptide analog is replaced with lysine and the lipid moiety is covalently linked to the ⁇ -amino group of the lysine by one or more gamma-glutamic acid residues.
- the peptide analog further includes one or more gamma-glutamic acid residues covalently linked to the C-terminus.
- X ⁇ is a D-serine, ⁇ -aminoisobutyric acid (aib), 1 -Amino- 1 -cyclobutane carboxylic acid (Acb) residue, 1 -Amino- 1-cyclohexane carboxylic acid (Acx); alpha- aminobutyric acid(Abu); D- alplia-aminobutyric acid (D-Abu); Aminovaleric acid Nva); beta- cyclopropyl-alamne (Cpa); propargylglycine (Prg); Allylglycine (AIg); 2-Amino-2-cyclohexyl- propanoic acid (2-Cha); D-tertbutylglycine (D-tbg); Vinylglycine (Vg); 1 -Amino- 1 -cyclopropane carboxylic acid (Acp); or 1 -Amino- 1 -cyclopentane carboxylic acid (Acpe
- M is a cysteine residue covalently linked to a cholesterol moiety with a hydrophilic linker and the cysteine residue is linked to the C- terminus of P.
- the hydrophilic linker is an ethoxy polymer that includes one to twenty-four ethoxy units, which in particular aspects can include for example, four ethoxy units.
- M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is linked to the C-terminus of P or M is a lysine residue covalently linked to a lipid moiety by a spacer comprising one or more gamma glutamic acid residues and the lysine residue is at position X2 or
- the lipid moiety is a palmitoyl, myristoyl, or stearoyl moiety. Examples of these peptide analogs are shown in Table 2.
- C 7 Cys(cholest-5-en-3-yl 1 - ⁇ [ ⁇ 2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ -2-oxo-6,9, 12,15- tetraoxa-3-azaocladecan ⁇ 18-oate]) or Cys(Oxa4-cholestero ⁇ )
- C 9 S- ⁇ 1 -[46-(cholest-5-en-3-yloxy)-3 ,43,46-trioxo-7, 10, 13,16,19,22,25,28,31 ,34,37,40- dodecaoxa-4,44-diazahexatetracont-l-yl]-2 ) 5-dioxopy- ⁇ olidin-3-yl ⁇ -L-cysteine or Cys (mal-oxai2- cholesterol)
- OXM290 is the precursor for OXM301 and OXM291 to 294 are precursors for the remainder of the peptide analogs shown in Table 2.
- OXM301 is an analogue having D-Ser in amino acid position 2 for DPPIV resistance * substitution of GIu and Ala, respectively, for the Argi ⁇ and Argig residues, and a C(Oxa4-cholesterol) group (C7) for improved pharmacokinetic properties in vivo.
- the substitutions at Argi ⁇ and Argig were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
- OXM302 is a peptide analog that lacks the amino acid sequence RNRNMA (SEQ ID NO:96) at the C-terminus (See commonly owned International Published Application No. WO2007/100535, which is incorporated herein in its entirety). Thus, OXM302 is one amino acid longer than the glucagon peptide by one lysine residue at the C-terminus. In OXM302, which has the structure HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:96) at the C-terminus (See commonly owned International Published Application No. WO2007/100535, which is incorporated herein in its entirety). Thus, OXM302 is one amino acid longer than the glucagon peptide by one lysine residue at the C-terminus. In OXM302, which has the structure HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKC7-CONH2 (SEQ ID NO:96) at the
- OXM303 has the structure HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKC7-
- OXM304 has the structure HsQGTFTSDYSKYLDSERAQDFVQWLMNTKCv- CONH2 (SEQ ID NO: 54).
- OXM305 has the structure HSQGTFTSDYSKYLDSERAQDFVQWLMNTKCT-
- OXM311 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- K(Pa ⁇ mitoyI)-CONH2 (SEQ ID NO:56).
- the D-Ser in amino acid position 2 provides DPPIV resistance and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo,
- OXM312 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKK(PaImitoyl)-CONH 2 (SEQ ID NO:57).
- the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argi ⁇ and Argig residues improves stability and the K( ⁇ almitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- OXM314 has the structure HsQGTFTSD YSKYLDSRRAQDFVQWLMNTK-Ttds- K(Palmitoyl)-CONH2 (SEQ ID NO:58).
- the D-Ser in amino acid position 2 provides DPPIV resistance and the K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- the Ttds (l ⁇ amino-4,7,10-trioxa-13-tridecanamine succinimic acid) is a linker that acts as a flexible and hydrophilic spacer between the peptide sequence and the K( ⁇ almitoyl) group.
- OXM 313 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK-Ttds- K(PalmitoyI)-CONH2 (SEQ ID NO: 59).
- the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argi ⁇ and Argis residues improves stability and the Ttds-K( ⁇ almitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- OXM317 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E-C ⁇ CONH2 (SEQ ID NO:60).
- the peptide there is a D-Ser in amino acid position 2 for DPPIV resistance, and a gamma glutamic residue linked to cholest-5-en-3-yl ⁇ [(2R)-3 ⁇ amino-2- ⁇ ' amino)- 3 -oxopropyljthio ⁇ acetate (C4) for improves pharmacokinetic properties in vivo.
- the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the C4 group,
- OXM318 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTK ⁇ E-C ⁇ CONH2 (SEQ ID NO:61).
- the D-Ser in amino acid position 2 provides DPPIV resistance, substitution of GIu and Ala, respectively, for the Argj7 and Arg] g residues improves stability and the ⁇ E -C4 group improves the peptide analog's pharmacokinetic properties in vivo.
- OXM319 has the structure B ⁇ QGTFTSDYSKYLDSEAAQDFVQWLMNTKC?- CONH2 (SEQ ID NO: ⁇ 2).
- OXM321 has the structure
- OXM323 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKR-C-/-
- C7 provides a peptide with improved pharmacokinetic properties in vivo.
- OXM325 has the structure
- HSQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIAC7-CO2H (SEQ ID NO:65). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of GIu and Ala, respectively, for the Argi 7 and Argig residues, and a C(Oxa4-cholesterol) group (C7) improves pharmacokinetic properties in vivo.
- the substitutions at Arg ⁇ an( i Argi g were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
- OXM327 has the structure HaQGTFTSDYSKYLDSERAQDFVQWLMNTKC 7 - CONH2 (SEQ ID NO:6 ⁇ ).
- the Aib in position 2 provides DPPIV resistance
- substitution of GIu for theArg ⁇ residue provides a peptide with improved stability
- the C(Oxa4-cholesterol) group (C 7 ) provides improved pharmacokinetic properties in vivo
- OXM329 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E-C4- CO2H (SEQ ID NO:67).
- the Aib in position 2 provides DPPIV resistance and a C(Oxa4- cholesterol) group (C 7) provides a peptide with improved pharmacokinetic properties in vivo.
- the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the C4 group.
- OXM330 has the structure HsQGTFTSDYSKYLDSEAAQDFVQWLMNTKRNRNNIA- ⁇ E-K(Pam)-CONH2 (SEQ ID NO:68). It is an analogue having D-Ser in amino acid position 2 for DPPIV resistance, substitution of GIu and Ala, respectively, for the Arg ⁇ and Argi 8 residues and a -K(palmitoyl) group improves the peptide analog's pharmacokinetic properties in vivo.
- the gamma glutamic residue ( ⁇ E) is a linker that acts as a flexible spacer between the peptide sequence and the K(palmitoyl) group.
- the substitutions at Arg ⁇ -j and Argig were made to increase in vivo stability, since these residues are primary proteolytic cleavage sites.
- OXM345 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- C4-COOH (SEQ ID NO:69). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacers between the peptide sequence, and the cholesterol group, one Cys(cholesterol) at position 33 (C4).
- OXM355 has the structure HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK- ⁇ E-C4 ⁇ COOH (SEQ ID NO:70), It was designed to contain D-Ser (s) at position 2, a Lys ⁇ Ser substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol one Cys(cholesterol) at position 32 (C4). A serine in position 12 is present in the GLP-I peptide sequence. Therefore, it is expected to have at least compatible potency at the GLP-IR.
- the substitution Lysi2Ser eliminates a positive charge which results in a pi of about 5.
- OXM357 has the structure HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK- ⁇ E-C. ⁇ - COOH (SEQ ID NO:71 ). It was designed to contain D-Ser (s) at position 2, one gamma- glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol one Cys(cholesterol) (C4) at position 32. OXM357 differs from OXM345 in having only one ⁇ Glu while OXM345 has two ⁇ -Glu.
- OXM359 has the structure HsQGTFTSDYSSYLDSRRAQDFVQWLMNTK- ⁇ E-C ⁇ - COOH (SEQ ID NO:72). It was designed to contain D-Ser (s) at position 2, a Lysi 2Ser substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) at position 32 (C7). Thus, OXM359 differs from OXM355 in having C7 (cholesterol group with the tetraethylene glycol spacer) instead of C4
- OXM361 (cholesterol without an ethylene glycol spacer).
- OXM361 has the structure HsQGTFTSDYSKYLDSRAAQDFVQWLMNTK- ⁇ E-Cv-
- COOH (SEQ ID NO:73). It was designed to contain D-Ser (s) at position 2, an ArgjgAla substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) at position 32 (C 7 in the table).
- the ArgisAla substitution eliminates a positive charge which is important for the tuning of the optimal pi value to 5.
- OXM373 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E-C 4 - COOH (SEQ ID NO:74). It was designed to contain D-Ser (s) at position 2, a SerieGlu substitution, one gamma-glutamic acid at position 31 as spacers between the peptide sequence, and the cholesterol, one Cys(cholesterol) at position 32 (C4). The GIu at position 16 is present in the e ⁇ endin-4 peptide so this substitution is expected to be at least compatible with GLP-IR activation.
- OXM374 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E-C ⁇ - COOH (SEQ ID NO:75), It was designed to contain D-Ser (s) at position 2, a SerisGlu substitution, one gamma-glutamic acid at position 31 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4 ⁇ cholesterol) at position 32 (C7).
- the difference between OXM373 and 374 is due to the presence of the tetraethylene glycol spacer attached to the cholesterol group in OXM374.
- OXM380 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- C7-COOH (SEQ ID NO;76). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (C ⁇ )at position 33.
- OXM380 has the same peptide sequence of OXM345 but differs in the Oxa4 spacer linked to the cholesterol group.
- OXM381 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- C9--COOH (SEQ ID NO:77). ⁇ t was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(maleimide ⁇ Oxai2-cholesterol) (C9) at position 33.
- OXM381 has the same peptide sequence of OXM345 and OXM380 differing in the maleimide ⁇ 0xai2 spacer linked to the cholesterol. The structure of C9 is shown below.
- OXM383 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK ⁇ E- ⁇ E- C7-COOH (SEQ ID NO:78). It was designed to contain Aib ( ⁇ ) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (C7) at position 33. OXM383 differs from OXM380 only with respect to the amino acid at position 2.
- OXM388 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-C7-COOH (SEQ ⁇ D NO:79). It was designed to contain Acb at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa4-cholesterol) (C7) at position 33. OXM388 differs from OXM380 and 383 only with respect to the amino acid at position 2.
- OXM392 has the structure HsQGTFTSDYSKYLDERRAKDFVQWLMNTK- ⁇ E- ⁇ E- C10-COOH (lactam bridge between E and K) (SEQ ID NO:80). It was designed to contain Ser (s) at position 2, SerigGlu and Gln2 ⁇ Lys substitutions wherein the Gluig and Lys20 are linked with a lactam bridge on the side chains, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (Ci 0) at position 33.
- the lactam bridge is between position i (16) and i+4 (20) and is meant to stabilize the alpha-helical conformation of the peptide and to stabilize the peptide against proteolytic degradation.
- the Cio group differs from the C9 group for the thioether bond connecting the cysteine thiol group to the Oxai2-cholesterol.
- C9 there is a maleimide thioether bond while in Cio there is an acetamide thioether.
- the structure of C ⁇ Q is shown below.
- OXM395 has the structure H ⁇ QGTFTSDYSKYLDERRAKDFVQWLMNTK- ⁇ E-yE- C10-COOH (lactam bridge between E and K) (SEQ ID NO:81). It was designed to contain Aib ( ⁇ ) at position 2, SeqgGru and a Gln2 ⁇ Lys substitutions wherein the Gluig and Lys20 are linked with a lactam bridge between the side chains, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2 ⁇ cholesterol) (C 10) at position 33.
- the lactam bridge is between position 16( i ) and 20 (i+4) and is meant to stabilize the peptide's alpha-helical conformation and to stabilize the peptide against proteolytic degradation.
- OXM398 has the structure H-Acb-QGTFTSDYSKYLDERRAKDFVQWLMNTK- ⁇ E- ⁇ E-Cio-COOH (lactam bridge between E and K) (SEQ ID NO: 82).
- OXM392, 395 and 398 differ only in the amino acid that is at position 2.
- OXM399 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- Ci ⁇ -COOH (SEQ ID NO: 83). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33. OXM399 differs from OXM392 only in that it lacks the lactam bridge present in OXM392.
- OXM400 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- Cio-COOH (SEQ ID NO;84). It was designed to contain Aib ( ⁇ ) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33. OXM400 differs from OXM395 only in that it lacks the lactam bridge present in OXM395.
- OXM40I has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-Cio-COOH (SEQ ID NO:85). It was designed to contain Acb at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-cholesterol) (C io) at position 33.
- OXM401 differs from OXM398 only in that it lacks the lactam bridge present in OXM398.
- OXM399, OXM40, and 401 differ from each other in the amino acid at position 2.
- OXM404 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-
- K( ⁇ E- ⁇ almitoyl)-CONH2 (SEQ ID NO:8 ⁇ ). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM406 has the structure HsQGTFTSDYSKYLDERRAQDFVQWLMNTK- ⁇ E- ⁇ E-
- C10-CONH2 (SEQ ID NO:87). It was designed to contain D-Ser (s) at position 2, a SerieGlu substitution, two gamma-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2- c holesterol) (C 10 ) at position 33.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM407 has the structure HsQGTFTSDYSKYLDSRRAK( ⁇ E- palmitoyl)DFVQWLMNTK- ⁇ E ⁇ E-CONH2 (SEQ ID NO:88). It was designed to contain D-Ser
- OXM408 has the structure HsQGTFTSDYSKYLDSRRAK( ⁇ E- ⁇ E- pa!mitoy ⁇ )DFVQWLMNTK- ⁇ E-C ⁇ NH2 (SEQ ID NO:89).
- OXM409 has the structure HsQGTFTSDK( ⁇ E- ⁇ E- palmitoyl)SKYLDSRRADFVQWLMNTK-CONH 2 (SEQ ID NO;89). It was designed to contain D-Ser (s) at position 2 and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ B-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM410 has the structure HsQGTFTSDYSKYLDERRAK( ⁇ E- ⁇ E- palmitoyl)DFVQWLMNTK-CONH2 (SEQ ID NO;91). It was designed to contain D-Ser (s) at position 2, a Sei"i6Glu substitution, and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 20.
- the peptide in this embodiment is amidated at the C-terminus,
- OXM411 has the structure HsQGTFTSDK( ⁇ E- ⁇ E- palraitoyl)SKYLDERRAQDFVQWLMNTK:-CONH2 (SEQ ID NO:92). It was designed to contain D-Ser (s) at position 2, a Ser 16GIu substitution and a palmitoyl group linked to two ⁇ - glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-pa ⁇ mitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM412 has the structure HsQGTFTSD YSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- CJ I-COOH (SEQ ID NO:93). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxa24-cholesterol) (Ci i)at position 33. OXM412 differs from OXM399 for the length of the Oxa spacer linked to the cholesterol group. The structure of C ⁇ ⁇ is shown below.
- OXM413 has the structure HaDGTFTSDYSKYLDSRRAQDFVK(DOTA)WLmNTK- ⁇ E- ⁇ E-Ci ⁇ -CONH2 (SEQ ID NO:94). It was designed as a peptide for imaging to target GLP-
- the sequence contains Aib at position 2, an Asp at position 3 to give selectivity on the GLP- 1 R 1 a Lys(DOTA) at position 24, a Met(O) at position 27, two garama-glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2 ⁇ cholesterol) (Ci o) at position 33.
- the peptide in this embodiment is amidated at the
- OXM414 has the structure HsQGTFTSDK( ⁇ E- paIraitoyl)SKYLDERRAQDFVQWLMNTK- ⁇ E-CONH2 (SEQ ID NO:95). It was designed to contain D-Ser (s) at position 2, two ⁇ -glutamic acids at positions 31, a Ser]6Glu substitution and a palmitoyl group linked to the side chain amino group of a lysine [Lys(palmitoyl)j at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM415 has the structure
- HsQGTFTSDK(palmitoy ⁇ )SKYLDERRAQDFVQWLMNTK- ⁇ E- ⁇ E-CONH2 (SEQ ID NO;96). It was designed to contain D-Ser (s) at position 2, one ⁇ -glutamic acid at positions 31, a SerjeGIu substitution and a palmitoyl group linked to one ⁇ -glutamic acid residue and to the side chain amino group of a lysine [Lys( ⁇ E-palmitoyl)] at position 10, The peptide in this embodiment is amidated at the C-terminus.
- OXM416 has the structure H ⁇ QGTFTSDK( ⁇ E- ⁇ E- palmitoyI)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:97). It was designed to contain Aib ( ⁇ ) at position 2, a SerigGlu substitution and a palmitoyl group linked to two ⁇ - glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-paimitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM417 has the structure H-Acb ⁇ QGTFTSDK( ⁇ E- ⁇ E- palmitoyl)SKYLDERRAQDFVQWLMNTK-CONH2 (SEQ ID NO:98). It was designed to contain Acb at position 2, a SerigGlu substitution and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10. The peptide in this embodiment is amidated at the C-terminus.
- OXM418 has the structure HsQGTFTSDK( ⁇ E- ⁇ E- palmitoyl)SKYLD ⁇ RRAQDFVQWLMNTK- ⁇ E-CONH2 (SEQ ID NO:99). It was designed to contain D-Ser (s) at position 2, one gamma- glutamic acid at positions 31, a Ser ⁇ Aib ( ⁇ ) substitution and a palmitoyl group linked to two ⁇ -glutamic acid residues and to the side chain amino group of a lysine [Lys( ⁇ E- ⁇ E-palmitoyl)] at position 10.
- the peptide in this embodiment is amidated at the C-terminus.
- OXM419 has the structure H ⁇ QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- K( ⁇ E-pa ⁇ mitoyl)-CONH2 (SEQ ID NO: 100). It was designed to contain Aib ( ⁇ ) at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
- the peptide in this embodiment is amidated at the C-terminus
- OXM420 has the structure H-Acb-QGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E-K( ⁇ E-pa!mitoyl)-CONH2 (SEQ ID NO: 101). It was designed to contain Acb at position 2, two gamma-glutamic acid at positions 31 and 32 as spacer between the peptide sequence, and the palmitoyl group, one Lys( ⁇ E-palmitoyl) at position 33.
- the peptide in this embodiment is amidated at the C-terminus
- OXM421 has the structure HsQGTFTSDYSKYLDSRRAQDFVQWLMNTK- ⁇ E- ⁇ E- C12-COOH (SEQ ID NO: 102). It was designed to contain D-Ser (s) at position 2, two gamma- glutamic acid residues at positions 31 and 32 as spacer between the peptide sequence, and the cholesterol, one Cys(Oxai2-O-cholesterol) (Ci 2) at position 33.
- the Cys(Oxai2 ⁇ 0-cholesterol) differs from Cys(Oxai2-cholesterol) in having the cholesterol linked through an ether bond to the Oxai2 spacer.
- the ether bond can confer more stability towards the ester bond present in the Cys(Oxa 12- cholesterol) or Ci 1 group.
- the structure of Cys(oxai2-O-cholesterol) is shown below.
- compositions comprising a therapeutically effective amount of one or more of the OXM analogs disclosed herein for the treatment of a metabolic disorder in an individual.
- Such disorders include, but are not limited to, obesity, metabolic syndrome or syndrome X, type II diabetes, complications of diabetes such as retinopathy, hypertension, dyslipidemias, cardiovascular disease, gallstones, osteoarthritis, and certain forms of cancers.
- the obesity-related disorders herein are associated with, caused by, or result from obesity.
- “Obesity” is a condition in which there is an excess of body fat.
- the operational definition of obesity is based on the Body Mass Index (BMI), calculated as body weight per height in meters squared (kg/m2).
- BMI Body Mass Index
- “Obesity” refers to a condition whereby an otherwise healthy subject has a Body Mass Index (BMI) greater than or equal to 30 kg/m2, or a condition whereby a subject with at least one co-morbidity has a BMI greater than or equal to 27 kg/m2.
- An “obese subject” is an otherwise healthy subject with a Body Mass Index (BMl) greater than or equal to 30 kg/m2 or a subject with at least one co-morbidity with a BMI greater than or equal to 27 kg/m2.
- a "subject at risk for obesity” is an otherwise healthy subject with a BMI of 25 kg/m2 to less than 30 kg/m2 or a subject with at least one co-morbidity with a BMI of 25 kg/m2 to less than 27 kg/m2.
- BMI Body Mass Index
- “obesity” refers to a condition whereby a subject with at least one obesity-induced or obesity-related co-morbidity that requires weight reduction or that would be improved by weight reduction, has a BMI greater than or equal to 25 kg/m2
- an “obese subject” refers to a subject with at least one obesity- induced or obesity-related co-morbidity that requires weight reduction or that would be improved by weight reduction, with a BMI greater than or equal to 25 kg/m2.
- a "subject at risk of obesity” is a subject with a BMI of greater than 23 kg/m2 to less than 25 kg/m2.
- Obesity-induced or obesity-related co-morbidities include, but are not limited to, diabetes, non-insulin dependent diabetes mellitus - type 2, impaired glucose tolerance, impaired fasting glucose, insulin resistance syndrome, dyslipidemia, hypertension, hyperuricacidemia, gout, coronary artery disease, myocardial infarction, angina pectoris, sleep apnea syndrome, Pickwickian syndrome, fatty liver; cerebral infarction, cerebral thrombosis, transient ischemic attack, orthopedic disorders, arthritis deformans, lumbodynia, emmeniopathy, and infertility.
- co -morbidities include: hypertension, hyperlipidemia, dyslipidemia, glucose intolerance, cardiovascular disease, sleep apnea, diabetes mellitus, and other obesity-related conditions.
- Treatment refers to the administration of the compounds of the present invention to reduce or maintain the body weight of an obese subject.
- One outcome of treatment may be reducing the body weight of an obese subject relative to that subject's body weight immediately before the administration of the compounds of the present invention.
- Another outcome of treatment may be preventing body weight regain of body weight previously lost as a result of diet, exercise, or pharmacotherapy.
- Another outcome of treatment may be decreasing the occurrence of and/or the severity of obesity-related diseases.
- the treatment may suitably result in a reduction in food or calorie intake by the subject, including a reduction in total food intake, or a reduction of intake of specific components of the diet such as carbohydrates or fats; and/or the inhibition of nutrient absorption; and/or the inhibition of the reduction of metabolic rate; and in weight reduction in patients in need thereof.
- the treatment may also result in an alteration of metabolic rate, such as an increase in metabolic rate, rather than or in addition to an inhibition of the reduction of metabolic rate; and/or in minimization of the metabolic resistance that normally results from weight loss.
- Prevention refers to the administration of the compounds of the present invention to reduce or maintain the body weight of a subject at risk of obesity.
- One outcome of prevention may be reducing the body weight of a subj ect at risk of obesity relative to that subject's body weight immediately before the administration of the compounds of the present invention.
- Another outcome of prevention may be preventing body weight regain of body weight previously lost as a result of diet, exercise, or pharmacotherapy.
- Another outcome of prevention may be preventing obesity from occurring if the treatment is administered prior to the onset of obesity in a subject at risk of obesity.
- Another outcome of prevention may be decreasing the occurrence and/or severity of obesity-related disorders if the treatment is administered prior to the onset of obesity in a subject at risk of obesity.
- Such treatment may prevent the occurrence, progression or severity of obesity-related disorders, such as, but not limited to, arteriosclerosis, Type II diabetes, polycystic ovarian disease, cardiovascular diseases, osteoarthritis, dermatological disorders, hypertension, insulin resistance, hypercholesterolemia, hypertriglyceridemia, and cholelithiasis.
- the obesity-related disorders herein are associated with, caused by, or result from obesity.
- obesity-related disorders include overeating and bulimia, hypertension, diabetes, elevated plasma insulin concentrations and insulin resistance, dyslipidemias, hyperlipidemia, endometrial, breast, prostate and colon cancer, osteoarthritis, obstructive sleep apnea, cholelithiasis, gallstones, heart disease, abnormal heart rhythms and arrythmias, myocardial infarction, congestive heart failure, coronary heart disease, sudden death, stroke, polycystic ovarian disease, craniopharyngioma, the Prader-Willi Syndrome, Frohlich's syndrome, GH-deficient subjects, normal variant short stature, Turner's syndrome, and other pathological conditions showing reduced metabolic activity or a decrease in resting energy expenditure as a percentage of total fat-free mass, e.g, children with acute lymphoblastic leukemia.
- obesity-related disorders are metabolic syndrome, also known as syndrome X, insulin resistance syndrome, sexual and reproductive dysfunction, such as infertility, hypogonadism in males and hirsutism in females, gastrointestinal motility disorders, such as obesity-related gastro-esophageal reflux, respiratory disorders, such as obesity-hypoventilation syndrome (Pickwickian syndrome), cardiovascular disorders, inflammation, such as systemic inflammation of the vasculature, arteriosclerosis, hypercholesterolemia, hyperuricaemia, lower back pain, gallbladder disease, gout, and kidney cancer.
- the compounds of the present invention are also useful for reducing the risk of secondary outcomes of obesity, such as reducing the risk of left ventricular hypertrophy.
- diabetes includes both insulin-dependent diabetes mellitus
- Type I diabetes also known as type I diabetes
- NIDDM non-insulin-dependent diabetes mellitus
- Type I diabetes or insulin-dependent diabetes
- Type II diabetes is the result of an absolute deficiency of insulin, the hormone which regulates glucose utilization.
- Type II diabetes, or insulin-independent diabetes i.e., non-insulin-dependent diabetes mellilus
- the compounds of the present invention are useful for treating both Type I and Type 0 diabetes.
- the compounds are especially effective for treating Type II diabetes.
- the compounds of the present invention are also useful for treating and/or preventing gestational diabetes mellitus.
- U.S. Patent No. 6,852,690 which is incorporated herein in its entirety, discloses methods for enhancing metabolism of nutrients comprising administering to a non-diabetic patient a formulation comprising a nutritively effective amount of one or more nutrients or any combination thereof and one or more insuHnotropic peptides.
- the OXM peptide anlogs disclosed herein are insuHnotropic and can be administered to patients with a disturbed glucose metabolism such as insulin resistance but no overt diabetes, as well as patients who for any reason cannot receive nutrition through the alimentary canal.
- Such patients include surgery patients, comatose patients, patients in shock, patients with gastrointestinal disease, patients with digestive hormone disease, and the like.
- obese patients atherosclerotic patients, vascular disease patients, patients with gestational diabetes, patients with liver disease such as liver cirrhosis, patients with acromegaly, patients with glucorticoid excess such as Cortisol treatment or Cushings disease, patients with activated counterregulatory hormones such as would occur after trauma, accidents and surgery and the like
- patients with hypertriglyceridemia and patients with chronic pancreatitis can be readily and suitably nourished according to the invention without subjecting the patient to hypo- or hyperglycemia.
- the administration to such a patient aims to provide a therapy to as rapidly as possible deliver the nutritional and caloric requirements to the patient while maintaining his plasma glucose below the so-called renal threshold of about 160 to 180 milligrams per deciliter of glucose in the blood.
- renal threshold of about 160 to 180 milligrams per deciliter of glucose in the blood.
- normal patients not having glucose levels just below the renal threshold can also be treated according to the invention as described above, patients with disturbed glucose metabolism such as hyperglycemic patients whose plasma glucose level is just above the renal threshold also find the therapy suitable for their condition,
- such patients who have a degree of hyperglycemia below the renal threshold at intermittent intervals can receive a combination treatment of nutrients plus insuHnotropic peptides according to any of the following regimens.
- compositions comprising the OXM analogs disclosed herein can be administered, if desired, in the form of salts provided the salts are pharmaceutically acceptable. Salts may be prepared using standard procedures known to those skilled in the art of synthetic organic chemistry.
- compositions comprising formula I are also useful for treating or preventing obesity and obesity-related disorders in cats and dogs.
- mamal includes companion animals such as cats and dogs.
- pharmaceutically acceptable salts refers to salts prepared from pharmaceutically acceptable non-toxic bases or acids including inorganic or organic bases and inorganic or organic acids. Salts derived from inorganic bases include aluminum, ammonium, calcium, copper, ferric, ferrous, lithium, magnesium, manganic salts, manganous, potassium, sodium, zinc, and the like. Particularly preferred are the ammonium, calcium, magnesium, potassium, and sodium salts.
- Salts derived from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, and basic ion exchange resins, such as arginine, betaine, caffeine, choline, N,N'-dibenzylethylenediamine, diethyl amine, 2- diethylaminoethanol, 2-dimethylaminoethanol, ethanolamine, ethylenediamine, N-ethyl- morpholine, N-ethylpiperidine, glucamine, glucosamine, histidine, hydrabamine, isopropylamine, lysine, methylglucamine, morphoHne, piperazine, piperidine, polyamine resins, procaine, purines, theobromine, tri ethyl amine, trimethylamine, tripropylamine, tromethamine, and the like.
- pharmaceutically acceptable salt further includes all acceptable salts such as acetate, lactobionate, benzenesulfonate, laurate, benzoate, malate, bicarbonate, maleate, bisulfate, mandelate, bitartrate, mesylate, borate, methylbromide, bromide, methylnitrate, calcium edetate, methylsulfate, camsylate, mucate, carbonate, napsylate, chloride, nitrate, clavulanate, N- methylglucamine, citrate, ammonium salt, dihydrochloride, oleate, edetate, oxalate, edisylate, pamoate (embonate), estolate, palmitate, esylate, pantothenate, fumarate, phosphate/diphosphate, gluceptate, polygalacturonate, gluconate, salicylate, glutamate, stearate, glycolly
- the term "pharmaceutically acceptable” means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredient(s), approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopoeia or other generally recognized pharmacopoeia for use in animals and, more particularly, in humans.
- carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered and includes, but is not limited to such sterile liquids as water and oils. The characteristics of the carrier will depend on the route of administration.
- compositions of the invention may comprise one ore more OXM analogs disclosed herein in such multimeric or complexed form.
- therapeutically effective amount means the total amount of each active component of the pharmaceutical composition or method that is sufficient to show a meaningful patient benefit, i.e., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions.
- a meaningful patient benefit i.e., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions.
- the term refers to that ingredient alone.
- the term refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially, or simultaneously.
- the pharmacological composition can comprise one or more OXM analogs disclosed herein; one or more OXM analogs disclosed herein and one or more other agents for treating a metabolic disorder; or the pharmacological composition comprising the one or more OXM analogs disclosed herein can be used concurrently with a pharmacological composition comprising an agent for treating a metabolic disorder.
- Such disorders include, but are not limited to, obesity, metabolic syndrome or syndrome X, type II diabetes, complications of diabetes, hypertension, dyslipidemias, cardiovascular disease, gallstones, osteoarthritis, and certain forms of cancers.
- the pharmacological composition comprises another agent for treating a metabolic disorder or the treatment includes a second pharmacological composition comprising an agent for treating a metabolic disorder
- the agent includes, but are not limited to, cannabinoid (CBl) receptor antagonists, glucagon like peptide 1 (GLP-I) receptor agonists, lipase inhibitors, leptin, tetrahydrolipstatin, 2-4-dinitrophenol ?
- Suitable agents of use in combination with a compound of the present invention include, but are not limited to:
- anti-diabetic agents such as (1) PPAR ⁇ agonists such as glitazones (e.g. ciglitazone; darglitazone; englitazone; isaglitazone (MCC-555); pioglitazone (ACTOS); rosiglitazone (AVANDIA); troglitazone; rivoglitazone, BRL49653; CLX-0921 ; 5-BTZD, GW- 0207, LG-100641 , R483, and LY-300512, and the like and compounds disclosed in WO97/10813, 97/27857, 97/28115, 97/28137, 97/27847, 03/000685, and 03/0271 12 and SPPARMS (selective PPAR gamma modulators) such as Tl 31 (Amgen), FK614 (Fujisawa), netoglitazone, and metaglidasen; (2) biguanides such as buformin;
- ATP consumption promotors such as those disclosed in WO 03/007990; (21) fixed combinations of PPAR ⁇ agonists and metformin such as AVANDAMET; (22) PPAR pan agonists such as GSK 677954; (23) GPR40 (G-protein coupled receptor 40) also called SNORF 55 such as BG 700, and those disclosed in WO 04/041266, 04/022551, 03/099793; (24) GPRl 19 (also called RUP3; SNORF 25) such as RUP3, HGPRBMY26, PFI 007, SNORF 25; (25) adenosine receptor 2B antagonists such as ATL-618, ATl-802, E3O8O, and the like; (26) carnitine palmitoyl transferase inhibitors such as ST 13
- NS-220/R1593 Nippon Shinyaku/Roche, STl 929 (Sigma Tau) MC3001/MC3004 (MaxoCore Pharmaceuticals, gemcabene calcium, other fibric acid derivatives, such as Atromid®, Lopid®, and Tricor®, and those disclosed in US 6,548,538, and the like;
- FXR receptor modulators such as GW 4064 (GlaxoSmithkline), SR 103912, QRX401, LN-6691 (Lion Bioscience), and those disclosed in WO 02/064125, WO 04/045511, and the like;
- LXR receptor modulators such as GW 3965 (GlaxoSmithkline), T9013137, and XTCO179628 (X-Ceptor Therapeutics/Sanyo), and those disclosed in WO 03/031408, WO 03/063796, WO 04/072041 , and the like;
- lipoprotein synthesis inhibitors such as niacin;
- anti-obesity agents such as (1) 5HT (serotonin) transporter inhibitors, such as paroxetine, fluoxetine, fenfluramine, fluvoxamine, sertraline, and imipramine, and those disclosed in WO 03/00663, as well as serotonin/noradrenaline re uptake inhibitors such as sibutramine (MERIDI A/REDU CTIL) and dopamine uptake inhibitor/Norepenephrine uptake inhibitors such as radafaxine hydrochloride, 353162 (GlaxoSmithkline), and the like; (2) NE (norepinephrine) transporter inhibitors, such as GW 320659, despiramine, talsupram, and nomifensine; (3) CBl (cannabinoid-1 receptor) antagonist/inverse agonists, such as rimonabant (ACCOMPLIA Sanofi Synthelabo), SR- 147778 (Sanofi Synthelabo),
- MCHlR melanin-concentrating hormone 1 receptor
- T-226296 Takeda
- T71 Takeda/Amgen
- AMGN- 608450 AMGN-503796
- Amgen 856464
- A798 Abbott
- ATCOl 75/AR224349 Arena Pharmaceuticals
- GW803430 GaxoSmithkine
- NBI- IA Neurorocrine Biosciences
- NGX-I Neurogen
- SNP-7941 Synaptic
- SNAP9847 Synaptic
- T-226293 Schering Plough
- TP ⁇ - 1361-17 Saitama Medical School/University of California Irvine
- NPY5 neuropeptide Y Y5-5 antagonists, such as 152,804, S2367 (Shionogi), E-6999 (Esteve), GW- 56918OA, GW-594884A (GlaxoSmithkline), GW-587081X, GW-548118X; FR 235,208; FR226928, FR 240662, FR252384; 1229U91, GI-264879A, CGP71683A, C-75 (Fasgen) LY- 377897, LY366377, PD-160170, SR-120562A, SR-1208I9A,S2367 (Shionogi), JCF-104, and H409/22; and
- WO 97/19682 WO 97/2082O 5 WO 97/20821 , WO 97/20822, WO 97/20823, WO 98/27063, WO 00/107409, WO 00/185714, WO 00/185730, WO 00/64880, WO 00/68197, WO 00/69849, WO 01/09120, WO 01/14376, WO 01/85714, WO 01/85730, WO 01/07409, WO 01/02379, WO 01/02379, WO 01/23388, WO 01/23389, WO 01/44201, WO 01/62737, WO 01/62738, WO 01/09120, WO 02/20488, WO 02/22592, WO 02/48152, WO 02/49648, WO 02/051806, WO 02/094789, WO 03/009845, WO 03/014083, WO 03/02
- leptin such as recombinant human leptin (PEG-OB, Hoffman La Roche) and recombinant methionyl human leptin (Amgen);
- leptin derivatives such as those disclosed in Patent Nos.
- opioid antagonists such as nalmefene (Revex ®), 3-methoxynaItrexone, naloxone, and naltrexone; and those disclosed in WO 00/21509; (13) orexin antagonists, such as SB-334867-A (GlaxoSmithkline); and those disclosed in WO 01/96302, 01/68609, 02/44172, 02/51232, 02/51838, 02/089800, 02/090355, 03/023561, 03/032991, 03/037847, 04/004733, 04/026866, 04/041791, 04/08540
- Patent No. 6358951 U.S. Patent Application Nos. 2002/049196 and 2002/022637; and WO 01/56592, and WO 02/32888; (19) 5HT2c (serotonin receptor 2c) agonists, such as APD3546/AR10A (Arena Pharmaceuticals), ATH88651 (Athersys), ATH88740 (Athersys), BVT933 (Biovitrum/GSK), DPCA37215 (BMS), IK264; LY448100 (Lilly), PNU 22394; WAY 470 (Wyeth), WAY629 (Wyeth), WAYl 61503 (Biovitrum), R- 1065, VRl 065 (Vernalis/Roche) YM 348; and those disclosed in U.S. Patent No. 3,914,250; and PCT Publications 01/66548, 02/36596, 02/48124, 02/10169, 02/44152;
- Mc3r melanocortin 3 receptor
- Mc4r Mcanocortin 4 receptor
- CHIR86036 Choiron
- CHIR915 Chiron
- ME-10142 Melacure
- MB-10145 Melacure
- HS-131 Melacure
- NBI72432 Neuronal Biosciences
- NNC 70-619 Novo Nordisk
- TTP2435 Transtech
- PCT Publications WO 99/64002 00/74679, 01/991752, 01/0125192, 01/52880, 01/74844, 01/70708, 01/70337, 01/91752, 01/010842, 02/059095, 02/059107, 02/059108, 02/0591 17, 02/062766, 02/069095, 02/12166, 02/11715
- GLP-I glucagon- like peptide 1 agonists
- Topiramate Topimax®
- phytopharm compound 57 CP 644,673
- ACC2 acetyl-CoA carboxylase-2
- ⁇ 3 beta adrenergic receptor 3) agonists, such as rafebergron/AD9677/TAK677 (Dainippon/ Takeda), CL-316,243, SB 418790, BRL- 37344, L-796568, BMS-196085, BRL-35135A, CGP12177A, BTA-243, GRC1087 (Glenmark Pharmaceuticals)
- GW 427353 solabegron hydrochloride
- Trecadrine Zeneca D7114, N-5984 (Nisshln Kyorin)
- LY-377604 Livothyln hydrochloride
- WO98/04526 WO98/32753, WO 01/74782, WO 02/32897, WO 03/014113, WO 03/016276, WO 03/016307, WO 03/024948, WO 03/024953, WO 03/037881, WO 04/108674, and the like;
- DGATl diacylglycerol acyltransferase 1 inhibitors
- DGAT2 diacylglycerol acyltransferase 2inhibitors
- PDE phosphodiesterase
- inhibitors such as theophylline, pentoxifylline, zaprinast, sildenafil, amrinone, milrinone, cilostamide, rolipram, and cilomilast, as well as those described in WO 03/037432, WO 03/0378
- UCP-I uncoupling protein 1
- 2, or 3 activators such as phytanic acid, 4-[(E)- 2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-napthalenyl)-l-propenyl]benzoic acid (TTNPB), and retinoic acid; and those disclosed in WO 99/00123; (35) acyl-estrogens, such as oleoyl-estrorte, disclosed in del Mar-Grasa, M.
- glucocorticoid receptor antagonists such as CP472555 (Pfizer), KB 3305, and those disclosed in WO 04/000869, WO 04/075864, and the like; (37) 1 l ⁇ HSD-I (1 1-beta hydroxy steroid dehydrogenase type 1 ) inhibitors, such as BVT 3498 (AMG 331 ), BVT 2733, 3-( 1 -adamantyl)-4 ⁇ ethyl-5-(ethylthio)-4H-l,2,4-triazole, 3 ⁇ (l-adamantyl)-5-(3,4,5-trimethoxyphenyl)-4-methyI-4H- 1,2,4-triazole, 3 ⁇ adamantanyl-4,5,6,7,8,9,lO,l 1 ,12,3a-decahydro-l,2,4-triazolo[4,3- a]
- lipase inhibitors such as tetrahydrolipstatin (orhstat/XENICAL), ATL962 (AHzyme/Takeda), GT389255 (Genzyme/Peptimmune)Triton WR1339, RHC80267, lipstatin, teasaponin, and diethy ⁇ umbelliferyl phosphate, FL-386, WAY-121898, Bay-N-3176, valilactone, esteracin, ebelactone A, ebelactone B, and RHC 80267, and those disclosed in WO 01/77094, WO 04/111004, and U.S.
- lipase inhibitors such as tetrahydrolipstatin (orhstat/XENICAL), ATL962 (AHzyme/Takeda), GT389255 (Genzyme/Peptimmune)Triton WR1339, RHC80267, lipstatin, teasaponin, and diethy ⁇ umbelliferyl phosphate, FL
- BVT74713 and other gut lipid appetite suppressants (61) dopamine agonists such as bupropion (WELLBUTRIN/GlaxoSmithkline); (62) zonisamide (ZONEGRAN/Dainippon/Elan), and the like.
- Specific compounds that can be used in combination with the OXM analogs disclosed herein include specific CBl antagonists/inverse agonists include those described in
- WO03/077847 including: N-[3-(4-chlorophenyl)-2(5)-phenyl- 1 (5)-methylpropyl]-2-(4- trifluoromethyl-2-pyrimidyloxy)-2-methylpropanamide > /V-[3-(4-chlorophenyl)-2-(3- cyanophenyl)- 1 -methylpropyl]-2-(5-trifluoromethyl-2-pyridyloxy)-2-methylpropanamide, JV-[3- (4-chlorophenyl)-2-(5-chloro-3-pyridyl)-l-methyl ⁇ ropyl]-2-(5-trifl ⁇ ioromethyl-2-pyridyloxy)-2- methylpropanamide, and pharmaceutically acceptable salts thereof; as well as those in
- WO05/000809 which includes the following: 3- ⁇ 1 -[bis(4-chlorophenyl)methyl]azetidin-3- ylidene ⁇ -3-(3,5-difluorophenyl)-2,2-dimethylpropanenitrile, 1 - ⁇ 1 -[ 1 -(4- chlorophenyl)pentyl] azetidin ⁇ 3 -yl ⁇ - 1 -(3 , 5-difluorophenyI)-2-methylpropan-2-ol.
- NPY5 antagonists that can be used in combination with the OXM analogs disclosed herein include: 3-oxo-N-(5-phenyl-2- ⁇ yrazinyl)-s ⁇ iro[isobenzofl ⁇ ran-l(3H),4'- pi ⁇ eridme]-r-carboxamide, 3-oxo-N-(7-trifluoromethyl ⁇ yrido[3,2-b]pyridin-2-y!)spiro- [isobenzofuran-1 (3H),4'-piperidine]-l '-carboxamide, N-[5-(3-fluorophenyl)-2-pyrimidinyl]-3- oxospiro-[isobenz;ofuran-l(3H),4'-piperidine]-r-carboxamide, trans-3'-oxo-N-(5-phenyl-2- pyrimidinyl)spiro[cyclohexane- 1 , 1 '(3 ⁇ )-is
- ACC- 1/2 inhibitors that can be used in combination with the OXM analogs disclosed herein include: r-[(4,8-dimethoxyquinolin-2-yl)carbonyl]-6-(lH-tetrazol-5- yl)spiro[chroman-2 ,4'-piperidin] ⁇ 4-one; (5- ⁇ 1 '-[(4,8-dimethoxyquinolin-2-yl)carbonyl]-4- oxospiro[chroman-2,4'-piperidin]-6-yl ⁇ -2//-tetrazol-2-yl)methyl pivalate; 5- ⁇ l'-[(8-cyclopropyl- 4-methoxyquinolJn-2-yl)carbonyl]-4-oxospiro[chroman-2,4'-piperidin]-6-yl ⁇ nicotinic acid; 1 '-(
- MCHlR antagonist compounds that can be used in combination with the OXM analogs disclosed herein include: 1 - ⁇ 4-[( 1 -ethylazetidin-3 -yl)oxy]phenyl ⁇ -4- [(4-f ⁇ uorobenzyl)oxy]pyridin-2( 1 H)- one, 4- [ (4-fluorobenzyl)oxy] - 1 - ⁇ 4-[ ( 1 -i sopropylazetidin- 3 -yl)oxy]phenyl ⁇ pyridin-2( ⁇ H)-one, 1 - [4-(azetidin-3-yloxy)phenyl]-4-[(5-chloropyridin-2-yl)methoxy]pyridin-2(lH)-one, 4-[(5- chloro ⁇ yridin-2-yl)methoxy]-l - ⁇ 4-[(l -ethylazetidin-3-yl)oxy]phenyl
- a specific DPP- ⁇ V inhibitor that can be used in combination with the OXM analogs disclosed herein is 7-[(3R)-3-amino-4-(2 5 4 J 5-trifluoro ⁇ henyl)butanoyl]-3-(trifluoromethyl)- 5, ⁇ ,7,8-tetrahydro-l,2j44riazolo[4,3-a]pyrazine, or a pharmaceutically acceptable salt thereof.
- H3 (histamine H3) antagonists/inverse agonists that can be used in combination with the OXM analogs disclosed herein include: those described in WO05/077905, including:3- ⁇ 4-[(l -cyclobutyl-4-piperidinyl)oxy] ⁇ henyl ⁇ -2-ethyl ⁇ yrido[2,3-d]-pyrimidin-4(3H)-one, 3- ⁇ 4- [(l-cyclobutyl-4-piperidinyl)oxy]phenyl ⁇ -2-methylpyrido[4,3-d]pyrimidin-4(3H)-one, 2-ethyI-3- (4- ⁇ 3-[(3S)-3-methylpiperidin-l-y ⁇ ]propoxy ⁇ phenyl)pyrido[2,3-d3pyrimidin-4(3H)-one 2- methyl-3-(4» ⁇ 3-[(3S)-3-methylpiperidin-l-yl]propoxy ⁇ phenyl)pyrido[
- CCKlR agonists of use in combination with the OXM analogs disclosed herein include: 3 -(4- ⁇ [ 1 -(3 -ethoxyphenyl)-2-(4-methylphenyl)- IH -imidazol-4-yl]carbonyl ⁇ - 1 - piperazinyl)- 1 -naphthoic acid; 3-(4- ⁇ [1 -(3-ethoxyphenyl)-2-(2-fluoro-4"methylphenyl)-lH - imidazol-4-yl]carbonyl ⁇ -l -piperazinyl)- 1 -naphthoic acid; 3 -(4- ⁇ [1 -(3-ethoxyphenyl)-2-(4- fluoropheny I)-IH -imidazol-4-yl]carbonyl ⁇ -l -piperazinyl)- 1 -naphthoic acid; 3-(4- ⁇
- MC4R agonists of use in combination with the OXM analogs disclosed herein include: 1) (S ⁇ -r-ltCS ⁇ -l-tert-butyl-S ⁇ -trifluorophenyOpiperidin ⁇ -ylJcarbonylJ-S- chloro-2-methyl-5-[l-methyl-l-(l-methyI-lH-l 5 2,4-triazol-5-yl)ethyI]-5/7-s ⁇ iro[furo[3 !
- peptide analogs and mimetics of the incretin hormone glucagon-like peptide 1 may also be of use in combination with the OXM analogs disclosed herein.
- Methods of administrating the pharmacological compositions comprising the one or more OXM analogs disclosed herein to an individual include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
- compositions can be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (for example, oral mucosa, rectal and intestinal mucosa, and the like), ocular, and the like and can be administered together with other biologically-active agents. Administration can be systemic or local, In addition, it may be advantageous to administer the composition into the central nervous system by any suitable route, including intraventricular and intrathecal injection. Intraventricular injection may be facilitated by an intraventricular catheter attached to a reservoir (for example, an Ommaya reservoir). Pulmonary administration may also be employed by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
- OXM analogs disclosed herein may also be desirable to administer the one or more OXM analogs disclosed herein locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, by injection, by means of a catheter, by means of a suppository, or by means of an implant.
- the OXM analogs disclosed herein may be delivered in a vesicle, in particular a liposome.
- a liposome the OXM analogs disclosed herein are combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids which exist in aggregated form as micelles, insoluble monolayers, liquid crystals, or lamellar layers in aqueous solution.
- Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like. Preparation of such liposomal formulations is within the level of skill in the art, as disclosed, for example, in U.S. Patent No. 4,837,028 and U.S. Patent No. 4,737,323.
- the OXM analogs disclosed herein can be delivered in a controlled release system including, but not limited to: a delivery pump (See, for example, Saudek, et a!., New Engl. J. Med.
- compositions comprising one or more of the OXM analogs disclosed herein which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and may be determined by standard clinical techniques by those of average skill within the art.
- in vitro assays may optionally be employed to help identify optimal dosage ranges.
- the precise dose to be employed in the formulation will also depend on the route of administration, and the overall seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances, Ultimately, the attending physician will decide the amount of the composition with which to treat each individual patient. Initially, the attending physician will administer low doses of the composition and observe the patient's response. Larger doses of the composition may be administered until the optimal therapeutic effect is obtained for the patient, and at that point the dosage is not increased further.
- the daily dose range lie within the range of from about 0.001 mg to about 100 mg per kg body weight of a mammal, preferably 0.01 mg to about 50 mg per kg, and most preferably 0.1 to 10 mg per kg, in single or divided doses. On the other hand, it may be necessary to use dosages outside these limits in some cases.
- suitable dosage ranges for intravenous administration of the compositions comprising the one or more OXM analogs disclosed herein are generally about 5-500 micrograms ( ⁇ g) of active compound per kilogram (Kg) body weight.
- Suitable dosage ranges for intranasal administration are generally about 0.01 pg/kg body weight to 1 mg/kg body weight.
- Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems, Suppositories generally contain active ingredient in the range of 0.5% to 10% by weight; oral formulations preferably contain 10% to 95% active ingredient. Ultimately the attending physician will decide on the appropriate duration of therapy using compositions comprising the one or more OXM analogs disclosed herein of the present invention. Dosage will also vary according to the age, weight and response of the individual patient.
- a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions and OXM analogs disclosed herein.
- Optionally associated with such container(s) may be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
- OXM Oxyntomodulin
- peptide amides 0.1 g of an aminomethylated polystirene LL (100-200 mesh, 0.41 mmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S)- ⁇ -[9H-Fluoren-9-yl-methoxyforraamido]-2 J 4- dimethoxybenzylj-phenoxyacetic acid (Rink, H., 1987, Tetrahedron Lett. 28:3787-3789; Bernatowicz, M. S. et al, 1989, Tetrahedron Lett. 30:4645-4667) was used.
- All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5M HOBt (Hydroxybenzotriazole) in DMF.
- the acylation reactions were performed for 45 minutes with six-fold excess of activated amino acid over the resin free amino groups.
- the amino acids were activated with equimolar amounts of HBTU (2-(lH ⁇ benzotriazole-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate) and a two-fold molar excess of DIEA (N,N-diisopropylethylamine).
- the peptides were synthesized by solid phase using Fmoc/t-Bu chemistry on a Pioneer Peptide Synthesizer (Applied Biosystems).
- the side chain protecting groups were: OMpe (0-3 -Methyl -pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, GIn, and His; and, tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg.
- Lysine-Palmitoyl was manually acylated by reaction with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l,l,3,3 ⁇ tetramethyluronium hexafluorophosphate) and a 2-fold molar excess of DIEA (N,N-diiso ⁇ ropylethylamine).
- HBTU 2-(lH-benzotriazole-l-yl)-l,l,3,3 ⁇ tetramethyluronium hexafluorophosphate
- DIEA N,N-diiso ⁇ ropylethylamine
- the dry peptide-resins were individually treated with 20 mL of the cleavage mixture, 88% trifluoroacetic acid (TFA), 5% phenol, 2% triisopropylsilane and 5% water (Sole, N. A. and G. Barany, 1992, J Org, Chem. 57:5399-5403) for 1.5 hours at room temperature. Each resin was filtered and the solution was added to cold methyl -t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice.
- the following gradient of eluent B was used: 20%-20% over five minutes and 20%-35% over 20 minutes for the OXM229 (the peptide thiolated precursor of OXM36 and OXMI l 5), OXM29 (the thiolated precursor of OXM70 and OXM216), OXM208 (the peptide thiolated precursor of OXM212), and OXM209 (the peptide thiolated precursor of 0XM213).
- Oxyntomodulin OXM cholesterylated analogs OXM36, OXM70, OXMl 15, OXM212, OXM213, and OXM216 was as follows.
- the reactions were run under conditions that permit the formation of a thioether bond.
- the cholesterylaled OXM peptides were then isolated using reverse-phase HPLC and characterized on a Micromass LCZ platform.
- the analogs OXM36, 70, 212, and 213 were synthesized from the thiol containing OXM peptide precursor OXM229, OXM208, and 209, respectively, by reaction with the bromo derivative, cho ⁇ est-5-en-3-yl bromoacetate having the structure
- cholest- ⁇ -en-3-yl bromoacetate to produce conjugates attached via a thioether bond.
- 30 mg of peptide precursor were dissolved in one mL of DMSO (cone. 30 mg/mL) and a one molar excess of cholest-5 ⁇ en-3-yl bromoacetate dissolved in THF (cone. 20 mg/mL) was added.
- 1% by volume of DIPEA N,N-diiso ⁇ ropyl-ethylamine
- the peptide solution was purified by RP-HPLC and characterized on a Micromass LCZ platform.
- the peptides OXMl 15 and 216 were synthesized from the thiol containing OXM peptide precursor OXM229 and OXM29 to produce analogs by reaction with the bromo derivative, cholest-5-en-3-yl l-bromo-2-oxo- ⁇ ,9,l 2,15-tetraoxa-3-azaoctadecan-l 8-oate
- peptide precursor were dissolved in J mL of DMSO (cone. 30 mg/mL) and a one molar excess of cholest-5-en-3-yl 1- bromo-2-oxo-6,9,l 2, 15-tetraoxa-3 ⁇ azaoctadecan-l 8-oate dissolved in THF (cone. 20 mg/mL) was added.
- PEGylation reactions were run under conditions permitting thioester bond formation.
- the PEGylated OXM peptide was then isolated using reverse-phase HPLC or ion exchange chromatography and size exclusion chromatography (SEC).
- SEC size exclusion chromatography
- PEGylated OXM analogs were characterized using RP-HPLC, HPLC-SEC and MALDI-Tof Mass Spectrometry.
- OXM33, 34, 35, 36 and 54 peptides were synthesized from the thiol-containing OXM peptide precursor OXM229 to produce analogs with PEG covalently attached via a thioether bond.
- the PEGylated peptide solution was acidified to 1% acetic acid and purified by cation exchange chromatography (IXC) on TSK CM-650S with a linear gradient of NaCl in sodium acetate 50 mM pH 4.8.
- IXC purified PEGylated-peptide was further purified by SEC and characterized by MALDI-TOF.
- OXM peptide analogs that that display full agonistic activity on the GLP- 1 and the Glucagon receptors and shown in Table 2 were synthesized as follows.
- the peptides OXM290, 291, 292, 293 and 294 that are precursors of OXM301, OXM302, OXM303, OXM304 and OXM305 were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer Simphony Protein Technologies Inc.
- peptide amides For peptide amides, 0.5 g of a resin Aminomethylated polystirene LL (100-200 mesh, 0.41 rnmol/g) (Novabiochem) resin derivatized with a modified Rink linker p-[(R,S) ⁇ -[9H-Fluoren- 9-yl-methoxyfo ⁇ namido] ⁇ 2,4-dimethoxybenzyI]-phenoxyacetic acid (Rink, Tetrahedron Lett. 28:3787-3789 (1987); Bernatowicz et at., Tetrahedron Lett. 30:4645-4667 (1989)) was used.
- All the amino acids were dissolved at a 0.5 M concentration in a solution of 0.5 M HOBt (Hydroxybenzotriazole) in DMF.
- the acylation reactions were performed for 60 minutes with 8- fold excess of activated amino acid over the resin free amino groups.
- the amino acids were activated with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l, 1 ,3,3- tetramethyluronium hexafluorophosphate), solution 0.5 M in DMF, and a 2-fold molar excess of DIEA (N ,N-diisopropylethyl amine), solution 2 M in NMP.
- the side chain protecting groups were: OMpe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys, GIn and His; tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-su ⁇ fonyj for Arg; Boc-His(Trt)-OH was used in the synthesis.
- the dry peptide-resins were individually treated with 25 mL of the cleavage mixture, 82.5% trifluoroacetic acid (TFA), 5% phenol, 5% thioanisole, 2.5% Ethandithiole, and 5% water for 1.5 hours at room temperature. Each resin was filtered and the volume of the solution was reduced then added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H2O, 20% acetonitrile, and lyophilized.
- TFA trifluoroacetic acid
- the crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM C4 cartridges (40 x 200 mm, 15 ⁇ m) and using as eluents (A) 0.1 % TFA in water and (B) 0.1 % TFA in acetonitrile.
- the following gradient of eluent B was used: 22%-22% over 5min and 22%-32% over 20 min for OXM301 precursor, 22%-22% over 5min and 22%-35% over 20 min for OXM302 precursor, 25%-25% over 5min and 25%-40% over 20 min for OXM303 precursor, 25%-25% over 5min and 25%-35% over 20 min for OXM304 precursor and OXM305 precursor, flow rate 80 mL/min, wavelength 214 nm.
- Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4,6 mm, (CPS analitica p/n ACE-213-1546), at 45 0 C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents and the following linear gradient: 25%-25% B (in 5 min) - 40%B (in 20 min) - 80% B (in 2 minutes), flow 1 mL/min.
- the purified peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- OXM304, and OXM305 were synthesized from the thiol containing OXM peptide precursor OXM290-294 respectively to produce derivatives with the C7 group covalently attached via the thioether group of the cysteine residue at the C-terminus.
- derivatization of the precursor 40 mg of peptide precursor were dissolved in 1.33 mL of DMSO (cone. 30 mg/mL) and a 2.1 molar excess of eholest-5-en-3-yl l-bromo-2 ⁇ oxo-6,9,12,15-tetraoxa-3-azaoctadecan- 18-oate dissolved in THF (cone. 30 mg/mL) was added.
- DIPEA N,N- diisopropyl-ethylamine
- OXM237-OXM308 and OXM345-OXM414 were synthesized by solid phase using Fmoc/t-Bu chemistry on a peptide multisynthesizer Simphony Protein Technologies Inc.
- the amino acids were activated with equimolar amounts of HBTU (2-(lH-benzotriazole-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate), solution 0,5 M in DMF, and a 2-fold molar excess of DIEA (N,N- diisopropylethylamine), solution 2M in NMP.
- HBTU 2-(lH-benzotriazole-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate
- DIEA N,N- diisopropylethylamine
- the side chain protecting groups were: Ompe (O-3-Methyl-pent-3-yl) for Asp; tert-butyl for GIu, Ser, D-Ser, Thr and Tyr; trityl for Asn, Cys ⁇ GIn and His; tert-butoxy-carbonyl for Lys, Trp; and, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for Arg; Boc-His(Trt)-OH was used in the synthesis.
- Glul6 and Lys20 were incorporated as GIu(OaIl) and Lys(AlIoc).
- the resins were dried, the protecting groups of GIu(OaIl) and Lys(Alloc) were removed and the lactam bridge was formed by incubating the resin with 5 molar excess of HBTU and 10 molar excess of DIPEA.
- lipidated peptides such as OXM404, 407, 408, 410, 411, 414, 415, 416, 417, 418, 419, 420 the lysine to be derivatized on the side chain was incorporated as Lys(AIloc).
- Alloc protecting group was removed and the synthesis was completed by condensation of the ⁇ -carboxyglutamic acid residues and the palmitic acid using HBTU and DIPEA as activators.
- the dry peptide-resins were individually treated with 25 mL of the cleavage mixture, 82,5% trifluoro acetic acid (TFA), 5% phenol, 5% thioanisole, 2.5% ethandithiole and 5% water for 1.5 hours at room temperature. Each resin was filtered and the volume of the solution was reduced then added to cold methyl-t-butyl ether in order to precipitate the peptide. After centrifugation, the peptide pellets were washed with fresh cold methyl-t-butyl ether to remove the organic scavengers. The process was repeated twice. Final pellets were dried, resuspended in H 2 O, 20% acetonitrile, and lyophilized.
- TFA trifluoro acetic acid
- the crude peptides were purified by reverse-phase HPLC using preparative Waters RCM Delta-PakTM C 4 cartridges (40 x 200 mm, 15 ⁇ m) and using as eluents (A) 0.1% TFA in water and (B) 0.1% TFA in acetonitrile.
- Analytical HPLC was performed on a Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 um column, 150 x 4.6 mm, (CPS analitica p/n ACE- 213-1546), at 45 0 C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the purified peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- C5 conjugates were a follows.
- the peptide OXM238 was synthesized from a thiol containing OXM peptide precursor to produce derivatives with the acetamide covalently attached via the thioethers group of the cysteine residue at the C-terminus,
- derivatization of the precursor 50 mg of peptide precursor were dissolved in Tris HCl buffer 0.25 M, EDTA 2mM, Urea 6M pH 8.3 (cone. 30 mg/raL) and a 10 molar excess of iodoacetamide dissolved in DMSO (cone. 30 mg/mL) was added. After 30 minutes the reaction is complete. The solution is acidified with acetic acid and purified on preparative HPLC.
- Synthesis of C4 conjugates was as follows. The peptides OXM345, OXM355,
- OXM357, OXM373 were synthesized from the thiol containing OXM peptide precursors respectively to produce derivatives with the cholesterol group covalently attached via the thioethers group of the cysteine at the C ⁇ terminus.
- derivatization of the precursor 40 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 2.1 molar excess of choIest-5-en-3-yl l ⁇ bromo-2-oxo- ⁇ ,9,12,15-tetraoxa-3 ⁇ azaoctadecan-18-oate dissolved in THF (cone. 30 mg/mL) was added.
- DIPEA N ,N- d ⁇ sopropy ⁇ -ethylamine
- the final peptides were characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45°C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass. Synthesis of C7 conjugates was as follows.
- OXM374, OXM380, OXM383 and OXM388 were synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxa4-cholesterol covalently attached via a tbioether bond to the cysteine residue at the C-terminus.
- derivatization of the precursor 25 mg of peptide precursor were dissolved in 1.33 mL of DMSO (cone. 30 mg/mL) and a 1.1 molar excess of cholest-5-en-3 ⁇ yl 1 -bromo-2-oxo-6,9, 12, 15-tetraoxa-3-azaoctadecan- 18-oate dissolved in THF (cone.
- ACE C-4 300 A
- 3 um column 150 x 4.6 mm
- (CPS analitica p/n ACE-213-1546) at 45 0 C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- Synthesis of C9 conjugates was as follows.
- the peptide OXM381 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxal 2-cholesterol covalently attached via the maleimide thioether bond to the cysteine residue at the C-terminus.
- 25 mg of peptide precursor were dissolved in DMSO (cone.
- the final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 urn column, 150 x 4.6 mm, (CPS analitica p/n ACE-213-1546), at 45°C, using H 2 O, 0.1% TFA (A) and CH3CN, 0,1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- Synthesis of C 12 conjugates was as follows.
- the peptides OXM421 was synthesized from the thiol containing OXM peptide precursor to produce derivatives with the Oxal 2-0- cholesterol covalently attached via a thioether bond to the cysteine residue at the C-terminus.
- derivatization of the precursor 25 mg of peptide precursor were dissolved in DMSO (cone. 30 mg/mL) and a 1.5 molar excess of cholest-5-en-3-yl 1 -bromo-2-oxo- 6 ; 9 ?
- the final peptide was characterized on an Alliance Waters Chromatograph, with a ACE C-4 (300 A), 3 m ⁇ column, 150 x 4.6 mm, (CPS analitica ⁇ /n ACE-213-1546), at 45°C, using H 2 O, 0.1% TFA (A) and CH3CN, 0.1% TFA (B) as solvents.
- the peptides were characterized by electrospray mass spectrometry on a Micromass LCZ platform.
- C 3 Cys(mPEG) 2 40kDa, each corresponding to a cysteine residue PEGylated via the side- chain thiol with linear methoxyPEG (mPEG) or branched mPEG [XmPEG) 2 ] of the indicated MW;
- C 4 Cys(cholest-5-en-3-yl ⁇ [(2R)-3-amino-2-(amino)-3-oxopropyl]thio ⁇ acetate);
- Cs CyS(CH 2 CONH 2 ), corresponding to a cysteine residue in which the side-chain thiol was reacted with iodoacetamide;
- C 7 Cys(cholest-5-en-3-yl l- ⁇ [(2R)-3-amino-2»(amino)-3-oxopropyl]thio ⁇ -2-oxo-6,9,l2,15- tetraoxa-3-azaoctadecan-18-oate]) or Cys(Oxa4-cholesterol));
- C 8 Cys(N-ethylmaleimidyl).
- CHO cells stably expressing mouse or human GLP-IR or GCGR were grown in Iscove's Modified Dulbecco's Medium (IMDM), 10% FBS, ImM L-glutamine, penicillin- streptomycin (100 ⁇ /mL) and 750 ⁇ g G418/mL for three-four days before harvesting using Enzymefree Dissociation Media (EFDM, Specialty Media).
- IMDM Iscove's Modified Dulbecco's Medium
- FBS Iscove's Modified Dulbecco's Medium
- ImM L-glutamine penicillin- streptomycin
- EFDM Enzymefree Dissociation Media
- OXM and OXM-Q3E were diluted in assay buffer and were incubated with cells in the absence or presence of 10% mouse plasma, respectively, for 30 min at room temperature. The assay was terminated with the addition of the LANCE kit Detection buffer as per the manufacturer's instructions.
- GLP-IR selective agonist was as follows. First, in order to evaluate the therapeutic utility of a dual GLP-1R/GCGR agonist (OXM mimetic), a matched peptide that was selective for only the GLP-I receptor (GLP-I mimetic), yet differs from native OXM by only one amino acid was identified. This peptide differed from native OXM by having a Glutamic acid (E) residue at position 3 instead of Glutamine (Q). A second GLP-I mimetic was identified that had an aspartic acid residue (D) in place of the Q. The efficacy of the GLP-I mimetic and the OXM mimetic in improving metabolic control in rodents were compared. These peptides and human OXM were synthesized and purified by GL Biochem (Shanghai) Ltd.
- Percent inhibition values for each treatment were generated from the AUC data normalized to the saline-challenged controls. Areas under the curve (AUC) for glucose (AUC glucose) was calculated using the trapezoidal method. Statistics. Statistical analysis was done using unpaired 2-tailed Student's t test. P values ⁇ 0.05 were reported as significant.
- 31p NMR spectroscopy was performed initially to examine the ATP and inorganic phosphate (Pi) levels to assess hepatic viability.
- a 13c NMR- visible pool of glycogen was then created by the addition of the gluconeogenic substrate [2-13C] Pyruvate and ammonium chloride ( ⁇ 7 mM and 1 raM, respectively) to the perfusate, and the amount of 13c glycogen contained in the liver was monitored in real time via the Cl resonance of the glucosyl units in glycogen.
- GDIS Glucose dependent insulin secretion
- Insulin was measured in aliquots of the incubation buffer by enzymelinked immunosorbent assay with a commercial kit (ALPCO diagnostics, Windham, NH). Animal study protocols were reviewed and approved by the Merck Research Laboratories Institutional Animal Care and Use Committee in Rahway, NJ.
- 13C-NMR spectroscopy was used to non-invasively monitor glycogen and glucose levels in response to acute treatment with novel oxyntomodulin analogs in real time.
- Mice expressing human GCGR were anesthetized (Nembutal IP, 50 mg/kg) at approximately the middle of the dark cycle.
- the portal vein was then cannulated and tied off and the liver was excised.
- the liver was then placed into a 20 mm NMR tube and the initial Krebs solution was exchanged for a Kxebs-BSA perfusate, which was recirculated.
- 31p NMR spectroscopy was performed initially to examine the ATP and inorganic phosphate (Pi) levels in the liver which can be used to assess hepatic viability.
- glucagon at 1.5 mpk gave 84% GCGR occupancy
- 3 mpk OXM gave 31% GCGR occupancy
- OXM-Q3E gave 0% GCGR occupancy.
- OXM, 0XM-Q3E Using the matched peptides, OXM, 0XM-Q3E, we investigated both acute and chronic pharmacological effects of co-agonism of both receptors in a chronic hyperglycemic clamp and a chronic food intake (FI) and body weight (BW) study (Table 5) and in an acute intraperitoneal glucose tolerance test (IPGTT, Figure 3). While both peptides effectively improved glucose tolerance, OXM-Q3E out-performed native OXM in reducing glucose excursion in both lean and diet induced obesity (DIO) mouse models.
- DIO diet induced obesity
- the native peptide proved superior at reducing food intake and body weight ( ⁇ BW: -6% for OXM vs -2.4% for 0XM-Q3E at 5 mg/kg) in DIO mice, an effect attributed to co-agonism of the GCGR, In both acute and chronic paradigms, native OXM did not cause increased glucose excursion.
- DIO mice (16 wk on high fat diet) were anesthetized with xylazine and ketamine and catheterized through the right internal jugular vein 3 days before the in vivo studies. 25% glucose was infused and adjusted for the duration of the experiment to maintain hyperglycemia. Due to the short half-life of the peptides (both are rapidly inactivated by dipeptidyl peptidase IV and renally cleared (Zhu et ah, J. Biol. Chera. 278: 22418-23, (2003))), vehicle, OXM (-16 ⁇ g/kg/min) and OXM-Q3E (-16 ⁇ g/kg/min) were infused intravenously during the last 60 minutes of the study.
- the venous catheter was used for infusion, and blood samples were collected from the tail vein. Each animal was monitored for food intake and weight gain after surgery to ensure complete recovery.
- Hyperglycemic clamps were performed in conscious, unrestrained, catheterized mice as previously described (Pocai et al., Nature. 43: 1026-31 , (2005)). Briefly, plasma glucose was measured by OneTouch giucometer every 10 minutes during the 2 hour period. Twenty-five percent glucose (D-glucose, Sigma) was infused i.v. and the rate was adjusted periodically to clamp the plasma glucose levels (-20 mM).
- OXM 16 ⁇ g/kg/min
- OXM-Q3E 16 ⁇ g/kg/min
- vehicle sterile saline
- EXAMPLE 8 Native OXM has an in vivo half-life (ty 2 ) of about 8 to 12 minutes in humans, unsuitable for sustained pharmacological therapy. Therefore, we investigated the addition of bulky substituents to the peptide to reduce renal clearance. Various molecular weight PEG moieties or N-ethyl maleimide were conjugated to the
- OXM peptide at various locations throughout the molecule, by conjugation to the side chain of an introduced cysteine residue. Positions that were investigated for conjugation with either Cys- N -ethyl malemide or a Cys-PEG moiety are underlined in the following amino acid sequence for OXM (SEQ ID NO: 1 ) or placed at the C-terminus of the OXM,
- Figure 5 A shows ex vivo measurement of glycogenosis in perfused liver in the presence of OXM70, OXMl 10, OXM177, OXMl 15, and OXM216.
- Figure 5B shows GGCR occupancy following subcutaneous (s.c.) or intravenous (i.v.) administration of the OXM70, OXMl 10, OXM177, OXMl 15, and OXM216 compared to native OXM in a competition assay in wild-type mice, EXAMPLE 10
- Figure 7 summarizes the acute in vivo efficacy of OXMl 10 and OXMl 77 on reducing food intake and body weight in established DIO mice.
- Figure 8 summarizes the acute in vivo efficacy of OXM216, OXMl 15, and OXM177 on reducing food intake and body weight in established DIO mice.
- OXMl 15 analog confers a metabolic rate
- a chronic study was performed, with a single injection of OXMl 15.
- Male B6 DIO mice (average starting body weight 55 g) were acclimated to metabolic rate chambers without food at thermoneutrality (T 29°C). A three hour period from 6:00 to 9:00 am was used to calculate resting metabolic rate. Three hours into the light phase (9:00 am), vehicle (dH ⁇ O), OXMl 15 at 3 or 10 mg/kg was administered subcutaneously.
- the total cycle time was set for 20 minutes, consisting of a reference reading with a 70 second settling time and a 10 second measure period as well as 60 second settle time and 10 second measure time for each of the 16 cages.
- FIG. 14A and B show that administration of OXMl 15 dose dependently increased the acute metabolic rate in DIO mice.
- Figure 15 summarizes the acute in vivo efficacy of OXM303, OXM304, and OXM305 on reducing food intake and body weight in established DIO mice and shows OXM305 as being particularly efficacious at reducing food intake and reducing body weight.
- Ad libitum fed, DIO male C57BL/6 mice (about 50 g each) were weighed and dosed s.c. with either vehicle (water) or
- OXM401 on reducing food intake and body weight in established DIO mice.
- OXM401 is a 0/+ control peptide having the sequence HAibEGTFTSDYSKYLDSRRAQDFVQWLmNTK- ⁇ E ⁇ E-
- Established DIO mice ( ⁇ 52g each) were dosed sc with vehicle (30%HBC) or peptide 1 mg/kg about 30 minutes prior to the onset of the dark phase. Food intake and body weight changes were measured over a four day time period (* P ⁇ 0.05 vs. vehicle, n - 5 per group).
- LAD2 cells 50,000 cells/well, 96-well plate
- the degranulation of LAD2 cells was determined by quantification of the ⁇ -hexosaminidase released into the supernatants and in cell lysates after hydrolysis of 4-methylumbeIlifeiyl-N-acetyl- ⁇ -D- glucosaminide. Results are expressed as percentage of ⁇ -hexosaminidase release, calculated as percent of total content.
- Table 1 summarizes the degranulation potency (EC 50 ) of OXM analogues in LAD2 cells. The results suggest that to reduce the likelihood of stimulating degranulation of mast cells, the pi for Hpidated based analogues should be around 5.
- This example presents tables showing the in vitro potencies of various peptide analogs at the human GLP-I receptor (hGLP-lR) and the human glucagon receptor (hGCGR).
- the in vitro potencies shown in Tabie 10 or Table 11 were determined from the results of assays that were similar to either the cell-based cAMP assays described herein above (Table 10) or the cell-based cAMP assays described in International Published Application No. WO2008101017, which is incorporated herein in its entirety, in particular the cell-based cAMP assays described therein (Table 11).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Diabetes (AREA)
- Endocrinology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Hematology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Obesity (AREA)
- Child & Adolescent Psychology (AREA)
- Emergency Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Physical Water Treatments (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Priority Applications (18)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES09840594.7T ES2524477T3 (en) | 2009-02-19 | 2009-12-18 | Oxintomodulin analogues |
| HRP20141215AT HRP20141215T1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| CA2754350A CA2754350C (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| JP2011551052A JP5756961B2 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analog |
| CN200980158734.XA CN102573872B (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| SI200931091T SI2398483T1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| AU2009340439A AU2009340439B2 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| PL09840594T PL2398483T3 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| EP09840594.7A EP2398483B1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| SG2011060183A SG173791A1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| BRPI0924307A BRPI0924307B8 (en) | 2009-02-19 | 2009-12-18 | oxyntomodulin analogues |
| RU2011134596/04A RU2542362C2 (en) | 2009-02-19 | 2009-12-18 | Oxyintomoduline |
| US13/202,524 US20120165503A1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| DK09840594.7T DK2398483T3 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogues |
| HK12106315.1A HK1165333B (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
| MX2011008717A MX2011008717A (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs. |
| ZA2011/06051A ZA201106051B (en) | 2009-02-19 | 2011-08-17 | Oxyntomodulin analogs |
| IL214729A IL214729A (en) | 2009-02-19 | 2011-08-18 | Oxyntomodulin analogs |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/US2009/034448 WO2010096052A1 (en) | 2009-02-19 | 2009-02-19 | Oxyntomodulin analogs |
| USPCT/US2009/034448 | 2009-02-19 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010096142A1 true WO2010096142A1 (en) | 2010-08-26 |
Family
ID=42634127
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/034448 Ceased WO2010096052A1 (en) | 2009-02-19 | 2009-02-19 | Oxyntomodulin analogs |
| PCT/US2009/068678 Ceased WO2010096142A1 (en) | 2009-02-19 | 2009-12-18 | Oxyntomodulin analogs |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/034448 Ceased WO2010096052A1 (en) | 2009-02-19 | 2009-02-19 | Oxyntomodulin analogs |
Country Status (23)
| Country | Link |
|---|---|
| US (2) | US20120165503A1 (en) |
| EP (1) | EP2398483B1 (en) |
| JP (1) | JP5756961B2 (en) |
| KR (1) | KR101634139B1 (en) |
| CN (1) | CN102573872B (en) |
| AU (1) | AU2009340439B2 (en) |
| BR (1) | BRPI0924307B8 (en) |
| CA (1) | CA2754350C (en) |
| CL (1) | CL2011002036A1 (en) |
| CY (1) | CY1116917T1 (en) |
| DK (1) | DK2398483T3 (en) |
| ES (1) | ES2524477T3 (en) |
| HR (1) | HRP20141215T1 (en) |
| IL (1) | IL214729A (en) |
| MX (1) | MX2011008717A (en) |
| PE (1) | PE20120621A1 (en) |
| PL (1) | PL2398483T3 (en) |
| PT (1) | PT2398483E (en) |
| RU (1) | RU2542362C2 (en) |
| SG (1) | SG173791A1 (en) |
| SI (1) | SI2398483T1 (en) |
| WO (2) | WO2010096052A1 (en) |
| ZA (1) | ZA201106051B (en) |
Cited By (47)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012177443A2 (en) | 2011-06-22 | 2012-12-27 | Indiana University Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
| US20120329707A1 (en) * | 2011-06-22 | 2012-12-27 | Indiana University Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
| US8367607B2 (en) | 2009-12-22 | 2013-02-05 | Eli Lilly And Company | Oxyntomodulin peptide analogue |
| US8415296B2 (en) | 2009-12-22 | 2013-04-09 | Eli Lilly And Company | Oxyntomodulin peptide analogue |
| WO2014049610A2 (en) | 2012-09-26 | 2014-04-03 | Cadila Healthcare Limited | Peptides as gip, glp-1 and glucagon receptors triple-agonist |
| CN103732618A (en) * | 2011-06-10 | 2014-04-16 | 韩美科学株式会社 | Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising same |
| WO2014056872A1 (en) | 2012-10-09 | 2014-04-17 | Sanofi | Exendin-4 derivatives as dual glp1/glucagon agonists |
| WO2014147124A1 (en) | 2013-03-21 | 2014-09-25 | Sanofi-Aventis Deutschland Gmbh | Synthesis of hydantoin containing peptide products |
| WO2014147129A1 (en) | 2013-03-21 | 2014-09-25 | Sanofi-Aventis Deutschland Gmbh | Synthesis of cyclic imide containing peptide products |
| WO2014161835A1 (en) | 2013-04-03 | 2014-10-09 | Sanofi | Modified blood glucose regulating proteins with altered pharmacological activity profile and preparation thereof |
| WO2015086733A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Dual glp-1/glucagon receptor agonists |
| WO2015086731A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Exendin-4 peptide analogues as dual glp-1/glucagon receptor agonists |
| JP2015525226A (en) * | 2012-06-14 | 2015-09-03 | サノフイ | Exendin-4 peptide analog |
| WO2015155139A1 (en) | 2014-04-07 | 2015-10-15 | Sanofi | Exendin-4 derivatives as peptidic dual glp-1 / glucagon receptor agonists |
| WO2015155141A1 (en) | 2014-04-07 | 2015-10-15 | Sanofi | Peptidic dual glp-1 / glucagon receptor agonists derived from exendin-4 |
| WO2015155140A1 (en) | 2014-04-07 | 2015-10-15 | Sanofi | Dual glp-1 / glucagon receptor agonists derived from exendin-4 |
| WO2016193371A1 (en) | 2015-06-05 | 2016-12-08 | Sanofi | Prodrugs comprising an glp-1/glucagon dual agonist linker hyaluronic acid conjugate |
| WO2016198628A1 (en) | 2015-06-12 | 2016-12-15 | Sanofi | Non-acylated exendin-4 derivatives as dual glp-1/glucagon receptor agonists |
| WO2016198624A1 (en) | 2015-06-12 | 2016-12-15 | Sanofi | Exendin-4 derivatives as trigonal glp-1/glucagon/gip receptor agonists |
| US9593155B2 (en) | 2009-02-19 | 2017-03-14 | Merck Sharp & Dohme Corp. | Oxyntomodulin analogs |
| WO2017062334A1 (en) * | 2015-10-05 | 2017-04-13 | Merck Sharp & Dohme Corp. | Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors |
| US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
| US9724420B2 (en) | 2012-11-06 | 2017-08-08 | Hanmi Pharm. Co., Ltd. | Liquid formulation of protein conjugate comprising an oxyntomodulin derivative covalently linked to a non-peptidyl polymer to an immunoglobulin FC region |
| US9731031B2 (en) | 2011-06-17 | 2017-08-15 | Hanmi Science Co., Ltd. | Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof |
| US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
| US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
| US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
| US9901621B2 (en) | 2012-07-25 | 2018-02-27 | Hanmi Pharm. Co., Ltd. | Composition for treating hyperlipidemia comprising oxyntomodulin derivative |
| US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
| US9944687B2 (en) | 2011-07-04 | 2018-04-17 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
| WO2018100174A1 (en) | 2016-12-02 | 2018-06-07 | Sanofi | Conjugates comprising an glp-1/glucagon dual agonist, a linker and hyaluronic acid |
| US10039809B2 (en) | 2013-12-18 | 2018-08-07 | The California Institute For Biomedical Research | Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof |
| US10233230B2 (en) | 2014-09-16 | 2019-03-19 | Hanmi Pharm. Co., Ltd. | Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease |
| US10286078B2 (en) | 2013-09-13 | 2019-05-14 | The California Institute For Biomedical Research | Modified therapeutic agents and compositions thereof |
| US10413593B2 (en) | 2014-10-24 | 2019-09-17 | Merck Sharp & Dohme Corp. | Co-agonists of the glucagon and GLP-1 receptors |
| US10493125B2 (en) | 2015-12-09 | 2019-12-03 | Merck Sharp & Dohme Corp. | Co-agonists of the glucagon and GLP-1 receptors |
| US10513550B2 (en) | 2014-12-30 | 2019-12-24 | Hanmi Pharm Co., Ltd | Glucagon derivatives |
| US10550168B2 (en) | 2012-11-06 | 2020-02-04 | Hanmi Pharm. Co., Ltd. | Composition for treating diabetes or diabesity comprising oxyntomodulin analog |
| WO2020125744A1 (en) | 2018-12-21 | 2020-06-25 | 江苏恒瑞医药股份有限公司 | Bispecific protein |
| US10869929B2 (en) | 2016-01-29 | 2020-12-22 | Merck Sharp & Dohme Corp. | Phosphonate linkers and their use to facilitate cellular retention of compounds |
| US11471512B2 (en) | 2019-03-01 | 2022-10-18 | Merck Sharp & Dohme Llc | Pharmaceutical compositions of a peptide |
| US11510993B2 (en) | 2015-10-06 | 2022-11-29 | Merck Sharp & Dohme Llc | Antibody drug conjugate for anti-inflammatory applications |
| US20230220035A1 (en) * | 2020-04-29 | 2023-07-13 | Dong-A St Co., Ltd. | Long-acting glp-1 and glucagon receptor dual agonist |
| EP4324519A3 (en) * | 2015-06-30 | 2024-07-24 | Hanmi Pharm. Co., Ltd. | Glucagon derivative and a composition comprising a long acting conjugate of the same |
| US12329823B2 (en) | 2021-06-09 | 2025-06-17 | The Scripps Research Institute | Long-acting dual GIP/GLP-1 peptide conjugates and methods of use |
| US12583900B2 (en) | 2019-12-04 | 2026-03-24 | The Scripps Research Institute | Peptide conjugates and methods of use |
Families Citing this family (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2628241C (en) | 2005-11-07 | 2016-02-02 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
| CN101578102B (en) | 2007-01-05 | 2013-07-17 | 印第安纳大学研究及科技有限公司 | Glucagon analogs exhibiting enhanced solubility in physiological pH buffers |
| MX2009008241A (en) | 2007-02-15 | 2009-10-08 | Univ Indiana Res & Tech Corp | Glucagon/glp-1 receptor co-agonists. |
| CA2707861A1 (en) | 2007-10-30 | 2009-05-07 | Indiana University Research And Technology Corporation | Glucagon antagonists |
| JP5771005B2 (en) | 2007-10-30 | 2015-08-26 | インディアナ ユニバーシティー リサーチ アンド テクノロジー コーポレーションIndiana University Research And Technology Corporation | Glucagon antagonist and compound showing GLP-1 agonist activity |
| EP2300037B1 (en) | 2008-06-17 | 2016-03-30 | Indiana University Research and Technology Corporation | Glucagon/glp-1 receptor co-agonists |
| TWI541023B (en) | 2008-06-17 | 2016-07-11 | 印第安納大學科技研究公司 | Glucagon analogs exhibiting enhanced solubility and stability in physiological ph buffers |
| TWI474835B (en) | 2008-06-17 | 2015-03-01 | Univ Indiana Res & Tech Corp | Gip-based mixed agonists for treatment of metabolic disorders and obesity |
| RU2550696C2 (en) | 2008-12-19 | 2015-05-10 | Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн | Amide-based prodrugs of glucagon superfamily peptides |
| WO2010148089A1 (en) | 2009-06-16 | 2010-12-23 | Indiana University Research And Technology Corporation | Gip receptor-active glucagon compounds |
| AP3329A (en) | 2009-07-13 | 2015-06-30 | Zealand Pharma As | Acylated glucagon analogues |
| US8703701B2 (en) | 2009-12-18 | 2014-04-22 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| EP2528618A4 (en) | 2010-01-27 | 2015-05-27 | Univ Indiana Res & Tech Corp | CONJUGATES OF GLUCAGON ANTAGONIST AND GIP AGONIST AND COMPOSITIONS FOR THE TREATMENT OF METABOLIC DISORDERS AND OBESITY |
| CA2797133C (en) | 2010-04-27 | 2019-08-06 | Zealand Pharma A/S | Peptide conjugates of glp-1 receptor agonists and gastrin and their use |
| CA2797095A1 (en) | 2010-05-13 | 2011-11-17 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
| WO2011143208A1 (en) | 2010-05-13 | 2011-11-17 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting g protein-coupled receptor activity |
| MX2012014576A (en) | 2010-06-24 | 2013-02-21 | Univ Indiana Res & Tech Corp | Amide based glucagon superfamily peptide prodrugs. |
| WO2012088116A2 (en) | 2010-12-22 | 2012-06-28 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting gip receptor activity |
| WO2012150503A2 (en) * | 2011-05-03 | 2012-11-08 | Zealand Pharma A/S | Glu-glp-1 dual agonist signaling-selective compounds |
| WO2012153196A2 (en) * | 2011-05-10 | 2012-11-15 | Zealand Pharma A/S | Glu-glp-1 dual agonist signaling-selective compounds |
| TW201326194A (en) | 2011-11-03 | 2013-07-01 | Zealand Pharma As | GLP-1 gastrin receptor agonist peptide conjugates |
| HK1198810A1 (en) * | 2011-11-17 | 2015-06-12 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting glucocorticoid receptor activity |
| US9340600B2 (en) | 2012-06-21 | 2016-05-17 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| MX356957B (en) | 2012-07-23 | 2018-06-20 | Zealand Pharma As | Glucagon analogues. |
| TWI608013B (en) | 2012-09-17 | 2017-12-11 | 西蘭製藥公司 | Glucagon analog |
| WO2014096179A1 (en) * | 2012-12-19 | 2014-06-26 | Novo Nordisk A/S | Novel glp-1 receptor agonists with cholesterol efflux activity |
| LT3057984T (en) | 2013-10-17 | 2018-12-27 | Zealand Pharma A/S | Acylated glucagon analogues |
| US9988429B2 (en) | 2013-10-17 | 2018-06-05 | Zealand Pharma A/S | Glucagon analogues |
| KR102310392B1 (en) | 2013-11-06 | 2021-10-13 | 질랜드 파마 에이/에스 | Glucagon-glp-1-gip triple agonist compounds |
| AU2014345569B2 (en) | 2013-11-06 | 2020-08-13 | Zealand Pharma A/S | GIP-GLP-1 dual agonist compounds and methods |
| CA2939763A1 (en) * | 2014-02-18 | 2015-08-27 | Novo Nordisk A/S | Stable glucagon analogues and use for treatment of hypoglycaemia |
| CN104926934B (en) * | 2014-09-23 | 2016-11-09 | 蒋先兴 | oxyntomodulin analogs |
| RU2716985C2 (en) | 2014-10-29 | 2020-03-17 | Зилэнд Фарма А/С | Gip agonist compounds and methods |
| CR20170293A (en) * | 2014-12-30 | 2017-11-03 | Hanmi Pharm Ind Co Ltd | GLUCAGON DERIVATIVES WITH IMPROVED STABILITY |
| JP6989385B2 (en) | 2015-04-16 | 2022-01-05 | ジーランド ファーマ アクティーゼルスカブ | Acylated glucagon analog |
| WO2017074798A2 (en) * | 2015-10-27 | 2017-05-04 | Merck Sharp & Dohme Corp. | Long-acting co-agonists of the glucagon and glp-1 receptors |
| JP6712323B2 (en) | 2015-12-31 | 2020-06-17 | ハンミ ファーマシューティカル カンパニー リミテッド | Triple activator with activity on all glucagon, GLP-1 and GIP receptors |
| SG11201811697SA (en) | 2016-06-29 | 2019-01-30 | Hanmi Pharmaceutical Co Ltd | Glucagon derivative, conjugate thereof, composition comprising same and therapeutic use thereof |
| SG10201911851VA (en) | 2016-12-09 | 2020-02-27 | Zealand Pharma As | Acylated glp-1/glp-2 dual agonists |
| CN108299553B (en) * | 2017-01-13 | 2021-07-16 | 博瑞生物医药(苏州)股份有限公司 | Oxyntomodulin modifier |
| CN106986924A (en) * | 2017-03-23 | 2017-07-28 | 中国药科大学 | Oxyntomodulin(OXM)Analog and its application |
| SMT202400097T1 (en) * | 2017-08-16 | 2024-05-14 | Dong A St Co Ltd | Acylated oxyntomodulin peptide analog |
| CA3220650A1 (en) | 2017-09-25 | 2019-03-28 | Merck Sharp & Dohme Llc | Long-acting co-agonists of the glucagon and glp-1 receptors |
| CN115304666B (en) * | 2017-11-24 | 2025-09-19 | 浙江道尔生物科技有限公司 | Glucagon analogues for the treatment of metabolic disorders |
| CN115109166B (en) * | 2017-11-24 | 2025-07-18 | 浙江道尔生物科技有限公司 | Multi-domain active protein for treating metabolic diseases |
| WO2020098657A1 (en) * | 2018-11-12 | 2020-05-22 | 天津药物研究院有限公司 | Glucagon-derived peptide having dual receptor agonistic action and use thereof |
| CN110684082B (en) * | 2019-10-08 | 2021-12-10 | 江苏诺泰澳赛诺生物制药股份有限公司 | GIP and GLP-1 dual-agonist polypeptide compound, pharmaceutically acceptable salt and application |
| EP3842449A1 (en) | 2019-12-23 | 2021-06-30 | Merck Sharp & Dohme Corp. | Stapled olefin co-agonists of the glucagon and glp-1 receptors |
| EP3842061A1 (en) | 2019-12-23 | 2021-06-30 | Merck Sharp & Dohme Corp. | Stapled triazole co-agonists of the glucagon and glp-1 receptors |
| EP3842060A1 (en) | 2019-12-23 | 2021-06-30 | Merck Sharp & Dohme Corp. | Stapled lactam co-agonists of the glucagon and glp-1 receptors |
| EP4148064A4 (en) * | 2020-05-09 | 2024-06-12 | Tianjin Institute Of Pharmaceutical Research Co., Ltd. | POLYPEPTIDE DERIVATIVE WITH AGONISTIC DOUBLE RECEPTOR ACTIVITY AND USE THEREOF |
| CN112898405B (en) * | 2021-01-22 | 2023-02-28 | 深圳市图微安创科技开发有限公司 | Polypeptide compound and application thereof in preventing or treating diabetes or diabetic complications |
| CN119930789A (en) * | 2023-11-06 | 2025-05-06 | 成都奥达生物科技有限公司 | A GCG agonist compound |
Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4275152A (en) * | 1977-02-03 | 1981-06-23 | Eastman Kodak Company | Hydrolysis of protein-bound cholesterol esters |
| US20040235710A1 (en) * | 2001-08-28 | 2004-11-25 | Defelippis Michael Rosario | Pre-mixes of glp-1 and basal insulin |
| US20050095679A1 (en) * | 2003-10-30 | 2005-05-05 | Crescent Innovations, Inc. | Method for producing medical and commercial grade poly-gamma-glutamic acid of high molecular weight |
| US20060252916A1 (en) * | 2002-06-04 | 2006-11-09 | Eli Lilly And Company | Modified glucagon-like peptide-1 analogs |
| WO2007100535A2 (en) * | 2006-02-22 | 2007-09-07 | Merck & Co., Inc. | Oxyntomodulin derivatives |
| US20080125574A1 (en) * | 2006-09-08 | 2008-05-29 | Ambrx, Inc. | Modified Human Plasma Polypeptide or Fc Scaffolds and Their Uses |
| WO2008101017A2 (en) * | 2007-02-15 | 2008-08-21 | Indiana Unversity Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
| US20080318837A1 (en) * | 2003-12-26 | 2008-12-25 | Nastech Pharmaceutical Company Inc. | Pharmaceutical Formation For Increased Epithelial Permeability of Glucose-Regulating Peptide |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2002353784B2 (en) | 2001-09-24 | 2008-04-10 | Oregon Health And Science University | Assessment of neurons in the arcuate nucleus to screen for agents that modify feeding behavior |
| AU2003201998C1 (en) * | 2002-01-10 | 2012-10-25 | Imperial Innovations Limited | Modification of feeding behavior |
| CA2612063A1 (en) * | 2005-06-13 | 2006-12-21 | Imperial Innovations Limited | Oxyntomodulin analogues and their effects on feeding behaviour |
| JP5231732B2 (en) | 2006-10-26 | 2013-07-10 | 株式会社東芝 | COOLING DEVICE AND ELECTRONIC DEVICE HAVING THE SAME |
| EP2300037B1 (en) | 2008-06-17 | 2016-03-30 | Indiana University Research and Technology Corporation | Glucagon/glp-1 receptor co-agonists |
| RU2550696C2 (en) | 2008-12-19 | 2015-05-10 | Индиана Юниверсити Рисерч Энд Текнолоджи Корпорейшн | Amide-based prodrugs of glucagon superfamily peptides |
| WO2010096052A1 (en) | 2009-02-19 | 2010-08-26 | Merck Sharp & Dohme Corp. | Oxyntomodulin analogs |
-
2009
- 2009-02-19 WO PCT/US2009/034448 patent/WO2010096052A1/en not_active Ceased
- 2009-12-18 RU RU2011134596/04A patent/RU2542362C2/en active
- 2009-12-18 SI SI200931091T patent/SI2398483T1/en unknown
- 2009-12-18 SG SG2011060183A patent/SG173791A1/en unknown
- 2009-12-18 PT PT98405947T patent/PT2398483E/en unknown
- 2009-12-18 ES ES09840594.7T patent/ES2524477T3/en active Active
- 2009-12-18 AU AU2009340439A patent/AU2009340439B2/en not_active Ceased
- 2009-12-18 PE PE2011001525A patent/PE20120621A1/en not_active Application Discontinuation
- 2009-12-18 CN CN200980158734.XA patent/CN102573872B/en not_active Expired - Fee Related
- 2009-12-18 WO PCT/US2009/068678 patent/WO2010096142A1/en not_active Ceased
- 2009-12-18 MX MX2011008717A patent/MX2011008717A/en active IP Right Grant
- 2009-12-18 PL PL09840594T patent/PL2398483T3/en unknown
- 2009-12-18 KR KR1020117021805A patent/KR101634139B1/en not_active Expired - Fee Related
- 2009-12-18 JP JP2011551052A patent/JP5756961B2/en not_active Expired - Fee Related
- 2009-12-18 EP EP09840594.7A patent/EP2398483B1/en active Active
- 2009-12-18 HR HRP20141215AT patent/HRP20141215T1/en unknown
- 2009-12-18 CA CA2754350A patent/CA2754350C/en not_active Expired - Fee Related
- 2009-12-18 DK DK09840594.7T patent/DK2398483T3/en active
- 2009-12-18 BR BRPI0924307A patent/BRPI0924307B8/en not_active IP Right Cessation
- 2009-12-18 US US13/202,524 patent/US20120165503A1/en not_active Abandoned
-
2011
- 2011-08-17 ZA ZA2011/06051A patent/ZA201106051B/en unknown
- 2011-08-18 IL IL214729A patent/IL214729A/en active IP Right Grant
- 2011-08-19 CL CL2011002036A patent/CL2011002036A1/en unknown
-
2014
- 2014-12-18 CY CY20141101064T patent/CY1116917T1/en unknown
-
2015
- 2015-04-14 US US14/686,760 patent/US9593155B2/en not_active Expired - Fee Related
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4275152A (en) * | 1977-02-03 | 1981-06-23 | Eastman Kodak Company | Hydrolysis of protein-bound cholesterol esters |
| US20040235710A1 (en) * | 2001-08-28 | 2004-11-25 | Defelippis Michael Rosario | Pre-mixes of glp-1 and basal insulin |
| US20060252916A1 (en) * | 2002-06-04 | 2006-11-09 | Eli Lilly And Company | Modified glucagon-like peptide-1 analogs |
| US20050095679A1 (en) * | 2003-10-30 | 2005-05-05 | Crescent Innovations, Inc. | Method for producing medical and commercial grade poly-gamma-glutamic acid of high molecular weight |
| US20080318837A1 (en) * | 2003-12-26 | 2008-12-25 | Nastech Pharmaceutical Company Inc. | Pharmaceutical Formation For Increased Epithelial Permeability of Glucose-Regulating Peptide |
| WO2007100535A2 (en) * | 2006-02-22 | 2007-09-07 | Merck & Co., Inc. | Oxyntomodulin derivatives |
| US20080125574A1 (en) * | 2006-09-08 | 2008-05-29 | Ambrx, Inc. | Modified Human Plasma Polypeptide or Fc Scaffolds and Their Uses |
| WO2008101017A2 (en) * | 2007-02-15 | 2008-08-21 | Indiana Unversity Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP2398483A4 * |
Cited By (89)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9593155B2 (en) | 2009-02-19 | 2017-03-14 | Merck Sharp & Dohme Corp. | Oxyntomodulin analogs |
| US8415296B2 (en) | 2009-12-22 | 2013-04-09 | Eli Lilly And Company | Oxyntomodulin peptide analogue |
| US8367607B2 (en) | 2009-12-22 | 2013-02-05 | Eli Lilly And Company | Oxyntomodulin peptide analogue |
| US9765131B2 (en) | 2011-06-10 | 2017-09-19 | Hanmi Science Co., Ltd. | Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same |
| US9527898B2 (en) | 2011-06-10 | 2016-12-27 | Hanmi Science Co., Ltd. | Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same |
| CN103732618A (en) * | 2011-06-10 | 2014-04-16 | 韩美科学株式会社 | Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising same |
| US9522946B2 (en) | 2011-06-10 | 2016-12-20 | Hanmi Science Co., Ltd. | Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same |
| CN103732618B (en) * | 2011-06-10 | 2018-10-09 | 韩美科学株式会社 | It is novel to secrete the sour pharmaceutical composition for treating obesity for adjusting peptide derivant and acid adjusting peptide derivant is secreted comprising this |
| US10442848B2 (en) | 2011-06-10 | 2019-10-15 | Hanmi Science Co., Ltd. | Oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same |
| JP2017043624A (en) * | 2011-06-10 | 2017-03-02 | ハンミ サイエンス カンパニー リミテッド | Novel oxyntomodulin derivative and composition for treating obesity comprising the same |
| US11872283B2 (en) | 2011-06-17 | 2024-01-16 | Hanmi Science Co., Ltd | Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof |
| US9731031B2 (en) | 2011-06-17 | 2017-08-15 | Hanmi Science Co., Ltd. | Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof |
| US10363320B2 (en) | 2011-06-17 | 2019-07-30 | Hanmi Science Co., Ltd. | Conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof |
| US10174093B2 (en) | 2011-06-22 | 2019-01-08 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US9156902B2 (en) | 2011-06-22 | 2015-10-13 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| WO2012177443A2 (en) | 2011-06-22 | 2012-12-27 | Indiana University Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
| US9758562B2 (en) | 2011-06-22 | 2017-09-12 | Indiana University and Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US10730923B2 (en) | 2011-06-22 | 2020-08-04 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8729017B2 (en) * | 2011-06-22 | 2014-05-20 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US20120329707A1 (en) * | 2011-06-22 | 2012-12-27 | Indiana University Research And Technology Corporation | Glucagon/glp-1 receptor co-agonists |
| US9944687B2 (en) | 2011-07-04 | 2018-04-17 | Imperial Innovations Limited | Compounds and their effects on feeding behaviour |
| JP2015525226A (en) * | 2012-06-14 | 2015-09-03 | サノフイ | Exendin-4 peptide analog |
| US9181305B2 (en) | 2012-06-14 | 2015-11-10 | Sanofi | Exendin-4 peptide analogues |
| US9901621B2 (en) | 2012-07-25 | 2018-02-27 | Hanmi Pharm. Co., Ltd. | Composition for treating hyperlipidemia comprising oxyntomodulin derivative |
| US10493132B2 (en) | 2012-07-25 | 2019-12-03 | Hanmi Pharm. Co., Ltd. | Composition for treating hyperlipidemia comprising oxyntomodulin derivative |
| WO2014049610A2 (en) | 2012-09-26 | 2014-04-03 | Cadila Healthcare Limited | Peptides as gip, glp-1 and glucagon receptors triple-agonist |
| US9365632B2 (en) | 2012-10-09 | 2016-06-14 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
| WO2014056872A1 (en) | 2012-10-09 | 2014-04-17 | Sanofi | Exendin-4 derivatives as dual glp1/glucagon agonists |
| US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
| US10279041B2 (en) | 2012-11-06 | 2019-05-07 | Hanmi Pharm Co. Ltd. | Liquid formulation of long-lasting protein conjugate comprising the oxyntomodulin and an immunoglobulin fragment |
| US9724420B2 (en) | 2012-11-06 | 2017-08-08 | Hanmi Pharm. Co., Ltd. | Liquid formulation of protein conjugate comprising an oxyntomodulin derivative covalently linked to a non-peptidyl polymer to an immunoglobulin FC region |
| US10550168B2 (en) | 2012-11-06 | 2020-02-04 | Hanmi Pharm. Co., Ltd. | Composition for treating diabetes or diabesity comprising oxyntomodulin analog |
| US11071785B2 (en) | 2012-11-06 | 2021-07-27 | Hanmi Pharm. Co., Ltd. | Liquid formulation of long-lasting protein conjugate comprising the oxyntomodulin and an immunoglobulin Fc region |
| US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
| US10253079B2 (en) | 2012-12-21 | 2019-04-09 | Sanofi | Functionalized Exendin-4 derivatives |
| US9745360B2 (en) | 2012-12-21 | 2017-08-29 | Sanofi | Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists |
| US10450343B2 (en) | 2013-03-21 | 2019-10-22 | Sanofi-Aventis Deutschland Gmbh | Synthesis of cyclic imide containing peptide products |
| WO2014147129A1 (en) | 2013-03-21 | 2014-09-25 | Sanofi-Aventis Deutschland Gmbh | Synthesis of cyclic imide containing peptide products |
| US10087221B2 (en) | 2013-03-21 | 2018-10-02 | Sanofi-Aventis Deutschland Gmbh | Synthesis of hydantoin containing peptide products |
| WO2014147124A1 (en) | 2013-03-21 | 2014-09-25 | Sanofi-Aventis Deutschland Gmbh | Synthesis of hydantoin containing peptide products |
| WO2014161835A1 (en) | 2013-04-03 | 2014-10-09 | Sanofi | Modified blood glucose regulating proteins with altered pharmacological activity profile and preparation thereof |
| US10987427B2 (en) | 2013-09-13 | 2021-04-27 | The Scripps Research Institute | Modified therapeutic agents and compositions thereof |
| US10286078B2 (en) | 2013-09-13 | 2019-05-14 | The California Institute For Biomedical Research | Modified therapeutic agents and compositions thereof |
| US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
| US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
| US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
| WO2015086731A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Exendin-4 peptide analogues as dual glp-1/glucagon receptor agonists |
| WO2015086733A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Dual glp-1/glucagon receptor agonists |
| US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
| US11865160B2 (en) | 2013-12-18 | 2024-01-09 | The Scripps Research Institute | Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof |
| US10039809B2 (en) | 2013-12-18 | 2018-08-07 | The California Institute For Biomedical Research | Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof |
| US12337028B2 (en) | 2013-12-18 | 2025-06-24 | The Scripps Research Institute | Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof |
| US11007252B2 (en) | 2013-12-18 | 2021-05-18 | The Scripps Research Institute | Modified therapeutic agents, stapled peptide lipid conjugates, and compositions thereof |
| US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| WO2015155139A1 (en) | 2014-04-07 | 2015-10-15 | Sanofi | Exendin-4 derivatives as peptidic dual glp-1 / glucagon receptor agonists |
| US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| WO2015155141A1 (en) | 2014-04-07 | 2015-10-15 | Sanofi | Peptidic dual glp-1 / glucagon receptor agonists derived from exendin-4 |
| WO2015155140A1 (en) | 2014-04-07 | 2015-10-15 | Sanofi | Dual glp-1 / glucagon receptor agonists derived from exendin-4 |
| US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
| US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
| US10233230B2 (en) | 2014-09-16 | 2019-03-19 | Hanmi Pharm. Co., Ltd. | Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease |
| US10435459B2 (en) | 2014-09-16 | 2019-10-08 | Hanmi Pharm. Co., Ltd. | Use of a long acting GLP-1/glucagon receptor dual agonist for the treatment of non-alcoholic fatty liver disease |
| US10413593B2 (en) | 2014-10-24 | 2019-09-17 | Merck Sharp & Dohme Corp. | Co-agonists of the glucagon and GLP-1 receptors |
| US11254724B2 (en) | 2014-12-30 | 2022-02-22 | Hanmi Pharm. Co., Ltd. | Glucagon derivatives |
| US10513550B2 (en) | 2014-12-30 | 2019-12-24 | Hanmi Pharm Co., Ltd | Glucagon derivatives |
| US12018060B2 (en) | 2014-12-30 | 2024-06-25 | Hanmi Pharm Co., Ltd. | Glucagon derivatives |
| WO2016193371A1 (en) | 2015-06-05 | 2016-12-08 | Sanofi | Prodrugs comprising an glp-1/glucagon dual agonist linker hyaluronic acid conjugate |
| US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
| WO2016198628A1 (en) | 2015-06-12 | 2016-12-15 | Sanofi | Non-acylated exendin-4 derivatives as dual glp-1/glucagon receptor agonists |
| WO2016198624A1 (en) | 2015-06-12 | 2016-12-15 | Sanofi | Exendin-4 derivatives as trigonal glp-1/glucagon/gip receptor agonists |
| EP4324519A3 (en) * | 2015-06-30 | 2024-07-24 | Hanmi Pharm. Co., Ltd. | Glucagon derivative and a composition comprising a long acting conjugate of the same |
| EP4523705A3 (en) * | 2015-06-30 | 2025-06-11 | Hanmi Pharm. Co., Ltd. | Glucagon derivative and a composition comprising a long acting conjugate of the same |
| US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
| WO2017062334A1 (en) * | 2015-10-05 | 2017-04-13 | Merck Sharp & Dohme Corp. | Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors |
| US11773150B2 (en) | 2015-10-05 | 2023-10-03 | Merck Sharp & Dohme Llc | Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors |
| US10800826B2 (en) | 2015-10-05 | 2020-10-13 | Merck Sharp & Dohme Corp. | Antibody peptide conjugates that have agonist activity at both the glucagon and glucagon-like peptide 1 receptors |
| US11510993B2 (en) | 2015-10-06 | 2022-11-29 | Merck Sharp & Dohme Llc | Antibody drug conjugate for anti-inflammatory applications |
| US10493125B2 (en) | 2015-12-09 | 2019-12-03 | Merck Sharp & Dohme Corp. | Co-agonists of the glucagon and GLP-1 receptors |
| US11883500B2 (en) | 2016-01-29 | 2024-01-30 | Merck Sharp & Dohme Llc | Phosphonate linkers and their use to facilitate cellular retention of compounds |
| US10869929B2 (en) | 2016-01-29 | 2020-12-22 | Merck Sharp & Dohme Corp. | Phosphonate linkers and their use to facilitate cellular retention of compounds |
| US11554172B2 (en) | 2016-01-29 | 2023-01-17 | Merck Sharp & Dohme Llc | Phosphonate linkers and their use to facilitate cellular retention of compounds |
| US10792367B2 (en) | 2016-12-02 | 2020-10-06 | Sanofi | Conjugates comprising an GLP-1/glucagon dual agonist, a linker and hyaluronic acid |
| US11141489B2 (en) | 2016-12-02 | 2021-10-12 | Sanofi | Conjugates comprising an GLP-1/Glucagon dual agonist, a linker and hyaluronic acid |
| WO2018100174A1 (en) | 2016-12-02 | 2018-06-07 | Sanofi | Conjugates comprising an glp-1/glucagon dual agonist, a linker and hyaluronic acid |
| WO2020125744A1 (en) | 2018-12-21 | 2020-06-25 | 江苏恒瑞医药股份有限公司 | Bispecific protein |
| US11471512B2 (en) | 2019-03-01 | 2022-10-18 | Merck Sharp & Dohme Llc | Pharmaceutical compositions of a peptide |
| US12583900B2 (en) | 2019-12-04 | 2026-03-24 | The Scripps Research Institute | Peptide conjugates and methods of use |
| US20230220035A1 (en) * | 2020-04-29 | 2023-07-13 | Dong-A St Co., Ltd. | Long-acting glp-1 and glucagon receptor dual agonist |
| US12329823B2 (en) | 2021-06-09 | 2025-06-17 | The Scripps Research Institute | Long-acting dual GIP/GLP-1 peptide conjugates and methods of use |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2398483B1 (en) | Oxyntomodulin analogs | |
| EP1999143B1 (en) | Neuromedin u receptor agonists and uses thereof | |
| US20110301079A1 (en) | Neuromedin u receptor agonists and uses thereof | |
| US20090104210A1 (en) | Peptide compounds for treating obesity and insulin resistance | |
| WO2011005611A1 (en) | Neuromedin u receptor agonists and uses thereof | |
| US11542313B2 (en) | Incretin analogs and uses thereof | |
| US20140045746A1 (en) | Antidiabetic tricyclic compounds | |
| WO2010138343A1 (en) | Neuromedin u receptor agonists | |
| BRPI1001307B1 (en) | oxygen injection in the flotation basin of the process of removing polluting substances in water courses | |
| HK1165333B (en) | Oxyntomodulin analogs | |
| US20100143383A1 (en) | Oxgr1 agonists for use in therapies for metabolic disorders |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200980158734.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09840594 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2754350 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011551052 Country of ref document: JP Ref document number: MX/A/2011/008717 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 214729 Country of ref document: IL |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011002036 Country of ref document: CL Ref document number: 6329/DELNP/2011 Country of ref document: IN Ref document number: 001525-2011 Country of ref document: PE Ref document number: 12011501665 Country of ref document: PH Ref document number: 2009840594 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009340439 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2009340439 Country of ref document: AU Date of ref document: 20091218 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20117021805 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011134596 Country of ref document: RU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13202524 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: PI0924307 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: PI0924307 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: PI0924307 Country of ref document: BR Kind code of ref document: A2 Effective date: 20110819 |




























