WO2010091441A2 - Stable, functional chimeric cellobiohydrolases - Google Patents

Stable, functional chimeric cellobiohydrolases Download PDF

Info

Publication number
WO2010091441A2
WO2010091441A2 PCT/US2010/027248 US2010027248W WO2010091441A2 WO 2010091441 A2 WO2010091441 A2 WO 2010091441A2 US 2010027248 W US2010027248 W US 2010027248W WO 2010091441 A2 WO2010091441 A2 WO 2010091441A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
segment
amino acid
residue
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/027248
Other languages
French (fr)
Other versions
WO2010091441A9 (en
WO2010091441A3 (en
Inventor
Frances H. Arnold
Pete Heinzelman
Jeremy Minshull
Sridhar Govindarajan
Alan Villalobos
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
California Institute of Technology
Original Assignee
California Institute of Technology
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by California Institute of Technology filed Critical California Institute of Technology
Publication of WO2010091441A2 publication Critical patent/WO2010091441A2/en
Publication of WO2010091441A9 publication Critical patent/WO2010091441A9/en
Publication of WO2010091441A3 publication Critical patent/WO2010091441A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/02Monosaccharides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1089Design, preparation, screening or analysis of libraries using computer algorithms
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405Glucanases
    • C12N9/2434Glucanases acting on beta-1,4-glucosidic bonds
    • C12N9/2437Cellulases (3.2.1.4; 3.2.1.74; 3.2.1.91; 3.2.1.150)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01091Cellulose 1,4-beta-cellobiosidase (3.2.1.91)

Definitions

  • the present disclosure relates to biomolecular engineering and design, and engineered proteins and nucleic acids.
  • the disclosure provides a chimeric polypeptide comprising at least two domains from two different parental cellobiohydrolase II (CBH II) polypeptides, wherein the domains comprise from N- to C- terminus: (segment I)- (segment 2) -(segment 3) -(segment 4) -(segment 5) -(segment 6) -(segment 7) -(segment 8); wherein: segment 1 comprises a sequence that is at least 50-100% identical to amino acid residue from about 1 to about xi of SEQ ID NO: 2 ("1"), SEQ ID NO : 4 (“2") or SEQ ID NO : 6 ("3"); segment 2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x 2 of SEQ ID NO: 2
  • segment 3 comprises a sequence that is at least 50-100% identical to amino acid residue x 2 to about X 3 of SEQ ID N0:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
  • segment 4 comprises a sequence that is at least 50-100% identical to amino acid residue x 3 to about x 4 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3");
  • segment 5 comprises a sequence that is at least 50-100% identical to about amino acid residue x 4 to about x 5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 (“3”);
  • segment 6 comprises a sequence that is at least 50- 100% identical to amino acid residue x 5 to about x 6 of SEQ ID NO: 2
  • segment 7 comprises a sequence that is at least 50-100% identical to amino acid residue x 6 to about X 7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
  • segment 8 comprises a sequence that is at least 50-100% identical to amino acid residue x 7 to about x 8 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); wherein X 1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO : 2 , or residue 42, 43, 44, 45, or 46 of SEQ ID NO:4 or SEQ ID NO : 6 ; X 2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO:4 or SEQ ID NO : 6 ; x 3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO:2, or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO:4 or SEQ ID NO : 6 ; x 4 is residue residue 113,
  • segment 2 is from about amino acid residue xi to about x 2 of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 (“2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions
  • segment 3 is from about amino acid residue x 2 to about X 3 of SEQ ID NO:2 (“1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
  • segment 4 is from about amino acid residue x 3 to about x 4 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 (“3") and having about 1-10 conservative amino acid substitutions
  • segment 5 is from about amino acid residue x 4 to about x 5 of SEQ ID NO: 2 (“1"), SEQ ID NO : 4
  • segment 6 is from about amino acid residue x 5 to about X 6 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 (“2") or SEQ ID NO : 6
  • segment 7 is from about amino acid residue x 6 to about X7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions
  • segment 8 is from about amino acid residue x 7 to about x 8 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions.
  • the chimeric polypeptide has at least one segment selected from the following: segment 1 from SEQ ID NO : 2 ; segment 6 from SEQ ID NO: 6, segment 7 from SEQ ID NO : 6 and segment 8 from SEQ ID NO: 4.
  • the chimeric polypeptide can be described as having segments IX 2 X 3 X 4 X 5 332, wherein X 2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x 2 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); X 3 comprises a sequence that is at least 50-100% identical to amino acid residue X 2 to about X 3 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 (“2") or SEQ ID NO : 6
  • X4 comprises a sequence that is at least 50-100% identical to amino acid residue x 3 to about x 4 of SEQ ID NO: 2 ("1"), SEQ ID NO : 4
  • X 5 comprises a sequence that is at least 50-100% identical to about amino acid residue x 4 to about x 5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") .
  • the chimeric polypeptide comprises a segment structure selected from the group consisting of 11113132, 21333331, 21311131, 22232132, 33133132, 33213332, 13333232, 12133333, 13231111, 11313121, 11332333, 12213111, 23311333, 13111313, 31311112, 23231222, 33123313, 22212231, 21223122, 21131311, 23233133, 31212111, 12222332 and 32333113.
  • the cimeric polypeptide comprises a segment structure selected from the group set forth in Table 1.
  • the disclosure also provides a polynucleotide encoding a polypeptide as described above.
  • One of skill can readily determine the exact sequence desired using the degeneracy of the genetic code, by reference to the amino acid sequences herein and by reference to the polynucleotide sequences herein.
  • the disclosure also provides a vector comprising a polynucleotide of the disclosure as well as host cells comprising a polynucleotide or vector of the disclosure.
  • the disclosure provides an enzymatic preparation comprising a polypeptide described above.
  • the disclosure also provides a method of treating a biomass comprising cellulose, the method comprising contacting the biomass with a chimeric polypeptide as described above. [0010] The disclosure provides a method of treating a biomass comprising cellulose, the method comprising contacting the biomass with a host cell comprising and expressing a polynucleotide and chimeric polypeptide of the disclosure, respectively.
  • the disclosure also provides a method of generating a thermostable chimeric cellobiohydrolase polypeptide, comprising recombining segments from at least 2 parental cellobiohydrolase polypeptide wherein the chimeric polypeptide comprises from N- to C- terminus 8 segments wherein: segment 1 comprises a sequence that is at least 50-100% identical to amino acid residue from about 1 to about Xi of SEQ ID NO:2 ("1"), SEQ ID NO : 4 (“2") or SEQ ID NO : 6 (“3"); segment 2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x 2 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 (“2”) or SEQ ID NO : 6 ("3"); segment 3 comprises a sequence that is at least 50-100% identical to amino acid residue x 2 to about X 3 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 (“2”) or SEQ ID NO : 6 (“3”); segment 4 comprises
  • segment 7 comprises a sequence that is at least 50-100% identical to amino acid residue x 6 to about X 7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
  • segment 8 comprises a sequence that is at least 50-100% identical to amino acid residue x 7 to about x 8 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); wherein X 1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO : 2 , or residue 42, 43, 44, 45, or 46 of SEQ ID NO:4 or SEQ ID NO : 6 ; X 2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO:4 or SEQ ID NO : 6 ; x 3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO:2, or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO:2 or SEQ ID NO : 3 ; x 4 is residue residue
  • Figure 1 shows SDS-PAGE gel of candidate CBH II parent gene yeast expression culture supernatants .
  • Gel Lanes (Left-to- Right) 1-H. jeco ⁇ na, 2- Empty vector, 3-H. msolens, 4-C. thermophilum, 5-H. jeco ⁇ na (duplicate), 6-P. chrysospo ⁇ um, 1-T. emersonii, 8-Empty vector (duplicate) , 9-H. jeco ⁇ na (triplicate) .
  • Numbers at bottom of gel represent concentration of reducing sugar
  • FIG. 2A-C shows illustrations of CBH II chimera library block boundaries.
  • B Linear representation of H. msolens catalytic domain showing secondary structure elements, disulfide bonds and block divisions denoted by black arrows.
  • C Sidechain contact map denoting contacts (side chain heavy atoms within 4.5A) that can be broken upon recombination. The majority of broken contacts occur between consecutive blocks .
  • Figure 3 shows a number of broken contacts (E) and number of mutations from closest parent (m) for 23 secreted/active and 25 not secreted/not active sample set chimeras.
  • Figure 4 shows specific activity, normalized to pH 5.0, as a function of pH for parent CBH II enzymes and three thermostable chimeras. Data presented are averages for two replicates, where error bars for HJPlus and H. jeco denote values for two independent trials. 16-hr reaction, 300 ug enzyme/g PASC, 50°C, 12.5 mM sodium citrate/12.5 mM sodium phosphate buffer at pH as shown. [0016] Figure 5 shows long-time cellulose hydrolysis assay results ( ug glucose reducing sugar equivalent/ug CBH II enzyme) for parents and thermostable chimeras across a range of temperatures. Error bars indicate standard errors for three replicates of HJPlus and H. msolens CBH II enzymes. 40-hr reaction, 100 ug enzyme/g PASC, 50 mM sodium acetate, pH 4.8.
  • Figure 6 shows normalized residual activities for validation set chimeras after a 12-h incubation at 63 °C. Residual activities for CBH II enzymes in concentrated culture supernatants determined in 2-hr assay with PASC as substrate, 50 °C, 25 mM sodium acetate buffer, pH 4.8.
  • FIG. 7 Map for parent and chimera CBH II enzyme expression vector Yep352/PGK91-1- ss.
  • Vector pictured contains wild type H. jeco ⁇ na cel ⁇ a (CBH II enzyme) gene.
  • CBD/linker amino acid sequence following the ss Lys-Arg Kex2 site is: ASCSSVWGQCGGQNWSGPTCCASGSTCVYSND YYSQCLPGAASSSSSTRAASTTSRVSPTTSRSSSATPPPGSTTTRVPPVGSGTATYS (SEQ ID NO: 8) .
  • thermostable CBH II enzymes fewer than 10 natural thermostable gene sequences are annotated in the CAZy database .
  • the majority of biomass conversion processes use mixtures of fungal cellulases (primarily CBH II, cellobiohydrolase class I (CBH I), endoglucanases and ⁇ -glucosidase) to achieve high levels of cellulose hydrolysis.
  • Generating a diverse group of thermostable CBH II enzyme chimeras is the first step in building an inventory of stable, highly active cellulases from which enzyme mixtures can be formulated and optimized for specific applications and feedstocks.
  • SCHEMA has been used previously to create families of hundreds of active ⁇ -lactamase and cytochrome P450 enzyme chimeras.
  • SCHEMA uses protein structure data to define boundaries of contiguous amino acid "blocks" which minimize ⁇ £>, the library average number of amino acid sidechain contacts that are broken when the blocks are swapped among different parents. It has been shown that the probability that a ⁇ -lactamase chimera was folded and active was inversely related to the value of E for that sequence.
  • the RASPP Recombination as Shortest Path Problem
  • More than 20% of the -500 unique chimeras characterized from a ⁇ -lactamase collection comprised of 8 blocks from 3 parents (3 8 6,561 possible sequences) were catalytically active.
  • thermostabilities of SCHEMA chimeras can be predicted based on sequence-stability data from a small sample of the sequences.
  • Linear regression modeling of thermal inactivation data for 184 cytochrome P450 chimeras showed that SCHEMA blocks made additive contributions to thermostability. More than 300 chimeras were predicted to be thermostable by this model, and all 44 that were tested were more stable than the most stable parent. It was estimated that as few as 35 thermostability measurements could be used to predict the most thermostable chimeras.
  • the thermostable P450 chimeras displayed unique activity and specificity profiles, demonstrating that chimeragenesis can lead to additional useful enzyme properties.
  • the disclosure demonstrates that SCHEMA recombination of CBH II enzymes can generate chimeric cellulases that are active on phosphoric acid swollen cellulose (PASC) at high temperatures, over extended periods of time, and broad ranges of pH.
  • PASC phosphoric acid swollen cellulose
  • a diverse family of novel CBH II enzymes was constructed by swapping blocks of sequence from three fungal CBH II enzymes. Twenty-three of 48 chimeric sequences sampled from this set were secreted in active form by S. cerevisiae, and five have half-lives at 63°C that were greater than the most stable parent. Given that this 48-member sample set represents less than 1% of the total possible 6,561 sequences, the disclosure provides hundreds of active chimeras, a number that extends well beyond the approximately twenty fungal CBH II enzymes in the CAZy database.
  • thermostability data was validated by finding that all 10 catalytically active chimeras in the second CBH II validation set were more thermostable than the most stable parent, a naturally-thermostable CBH II from the thermophilic fungus, H. msolens .
  • This disclosure demonstrates that a samle of 33 new CBH II enzymes that are expressed in catalytically active form in S. cerevisiae, 15 of which are more thermostable than the most stable parent from which they were constructed. These 15 thermostable enzymes are diverse in sequence, differing from each other and their closest natural homologs at as many as 94 and 58 amino acid positions, respectively.
  • thermostabilities of CBH II chimeras in the combined sample and validation sets indicates that the four thermostabilizing blocks identified, block 1 (i.e., domain 1), parent 1 (BlPl); block 6 (i.e., domain 6), parent 3 (B6P3) ; B7P3 and B8P2, make cumulative contributions to thermal stability when present in the same chimera.
  • block 1 i.e., domain 1
  • BlPl parent 1
  • B6P3 parent 3
  • B7P3 and B8P2 B7P3 and B8P2
  • msolens enzyme contain at least two stabilizing blocks, with five of the six most thermostable chimeras in this group containing either three or four stabilizing blocks.
  • Minimizing the number of broken contacts upon recombination allows the blocks to be approximated as decoupled units that make independent contributions to the stability of the entire protein, thus leading to cumulative or even additive contributions to chimera thermostability.
  • SCHEMA was effective in minimizing such broken contacts: whereas there are 303 total interblock contacts defined in the H. msolens parent CBH II crystal structure, the CBH II SCHEMA library design results in only 33 potential broken contacts.
  • jecorma CBH II declines sharply as pH increases above the optimum value of 5, HJPlus, created by substituting stabilizing blocks onto the most industrially relevant H. jecorma CBH II enzyme, retains significantly more activity at these higher pHs ( Figure 4) .
  • the narrow pH/activity profile of H. jecorma CBH II has been attributed to the deprotonation of several carboxyl-carboxylate pairs, which destabilizes the protein above a pH of about 6.
  • HJPlus exhibits both relatively high specific activity and high thermostability.
  • Figure 5 shows that these properties lead to good performance in long-time hydrolysis experiments: HJPlus hydrolyzed cellulose at temperatures 7-15 °C higher than the parent CBH II enzymes and also had a significantly increased long-time activity relative to all the parents at their temperature optima, bettering H. jeco ⁇ na CBH II by a factor of 1.7.
  • the specific activity of the HJPlus chimera is less than that of the H. jeco ⁇ na CBH II parent, this increased long-time activity can be attributed to the ability of the thermostable HJPlus to retain activity at optimal hydrolysis temperatures over longer reaction timer .
  • thermostable chimeras shared HJPlus' s broad temperature operating range. This observation supports a positive correlation between ti /2 at elevated temperature and maximum operating temperature, and suggests that many of the thermostable chimeras among the 6,561 CBH II chimera sequences will also be capable of degrading cellulose at elevated temperatures. While this ability to hydrolyze the amorphous PASC substrate at elevated temperatures bodes well for the potential utility of thermostable fungal CBH II chimeras, studies with more challenging crystalline substrates and substrates containing lignin will provide a more complete assessment of this novel CBH II enzyme family's relevance to biomass degradation applications.
  • amino acid is a molecule having the structure wherein a central carbon atom is linked to a hydrogen atom, a carboxylic acid group (the carbon atom of which is referred to herein as a “carboxyl carbon atom”), an amino group (the nitrogen atom of which is referred to herein as an "amino nitrogen atom"), and a side chain group, R.
  • carboxylic acid group the carbon atom of which is referred to herein as a "carboxyl carbon atom”
  • amino group the nitrogen atom of which is referred to herein as an "amino nitrogen atom”
  • R side chain group
  • Protein refers to any polymer of two or more individual amino acids (whether or not naturally occurring) linked via a peptide bond.
  • the term “protein” is understood to include the terms “polypeptide” and “peptide” (which, at times may be used interchangeably herein) within its meaning.
  • proteins comprising multiple polypeptide subunits e.g., DNA polymerase III, RNA polymerase II
  • other components for example, an RNA molecule, as occurs in telomerase
  • fragments of proteins and polypeptides are also within the scope of the disclosure and may be referred to herein as "proteins.”
  • a stabilized protein comprises a chimera of two or more parental peptide segments .
  • Peptide segment or "peptide domain” refers to a portion or fragment of a larger polypeptide or protein.
  • a peptide segment or domain need not on its own have functional activity, although in some instances, a peptide segment or domain may correspond to a segment or domain of a polypeptide wherein the segment or domain has its own biological activity.
  • a stability- associated peptide segment or domain is a peptide segment or domain found in a polypeptide that promotes stability, function, or folding compared to a related polypeptide lacking the peptide segment.
  • a destabilizing-associated peptide segment is a peptide segment that is identified as causing a loss of stability, function or folding when present in a polypeptide.
  • BlPl, B6P3, B7P3 and B8P2 are segments/domains that promote thermostability in a chimeric polypeptide of the disclosure.
  • a chimera has at least 1, 2, 3, or 4 thermostabilizing segments.
  • the disclosure provides chimeras that comprise at least 8 domains (i.e., B1-B2-B3-B4-B5-B6-B7-B8) comprising 1, 2, 3 or 4 domains comprising sequences that are at least 80-100% identical to a sequence selected from the group consisting of amino acid residue from about 1 to about xi of SEQ ID NO: 2; from about amino acid residue x 5 to about x 6 of SEQ ID NO: 6; about amino acid residue x 6 to about X 7 of SEQ ID NO: 6; and about amino acid residue x 7 to about x 8 of SEQ ID NO:4; wherein: X 1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO:2, X 5 is residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO:6; x 6 is residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO:6; x 7 is residue
  • a particular amino acid sequence of a given protein ⁇ i.e., the polypeptide's "primary structure," when written from the amino-terminus to carboxy-terminus) is determined by the nucleotide sequence of the coding portion of a mRNA, which is in turn specified by genetic information, typically genomic DNA (including organelle DNA, e.g., mitochondrial or chloroplast DNA) .
  • genomic DNA including organelle DNA, e.g., mitochondrial or chloroplast DNA
  • “Fused,” “operably linked,” and “operably associated” are used interchangeably herein to broadly refer to a chemical or physical coupling of two otherwise distinct domains or peptide segments, wherein each domain or peptide segment when operably linked can provide a functional polypeptide having a desired activity. Domains or peptide segments can be directly linked or connected through peptide linkers such that they are functional or can be fused through other intermediates or chemical bonds. For example, two domains can be part of the same coding sequence, wherein the polynucleotides are in frame such that the polynucleotide when transcribed encodes a single mRNA that when translated comprises both domains as a single polypeptide.
  • both domains can be separately expressed as individual polypeptides and fused to one another using chemical methods.
  • the coding domains will be linked "in-frame" either directly of separated by a peptide linker and encoded by a single polynucleotide.
  • Various coding sequences for peptide linkers and peptide are known in the art.
  • Polynucleotide or “nucleic acid sequence” refers to a polymeric form of nucleotides. In some instances a polynucleotide refers to a sequence that is not immediately contiguous with either of the coding sequences with which it is immediately contiguous (one on the 5' end and one on the 3' end) in the naturally occurring genome of the organism from which it is derived.
  • the term therefore includes, for example, a recombinant DNA which is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (e.g., a cDNA) independent of other sequences.
  • the nucleotides of the disclosure can be ribonucleotides, deoxyribonucleotides, or modified forms of either nucleotide.
  • a polynucleotides as used herein refers to, among others, single-and double-stranded DNA, DNA that is a mixture of single- and double- stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double- stranded regions.
  • the term polynucleotide encompasses genomic DNA or RNA (depending upon the organism, i.e., RNA genome of viruses), as well as mRNA encoded by the genomic DNA, and cDNA.
  • Nucleic acid segment refers to a portion of a larger polynucleotide molecule.
  • the polynucleotide segment need not correspond to an encoded functional domain of a protein; however, in some instances the segment will encode a functional domain of a protein.
  • a polynucleotide segment can be about 6 nucleotides or more in length (e.g., 6-20, 20-50, 50-100, 100-200, 200-300, 300-400 or more nucleotides in length) .
  • a stability-associated peptide segment can be encoded by a stability-associated polynucleotide segment, wherein the peptide segment promotes stability, function, or folding compared to a polypeptide lacking the peptide segment.
  • "Chimera” refers to a combination of at least two segments or domains of at least two different parent proteins or polypeptides. As appreciated by one of skill in the art, the segments need not actually come from each of the parents, as it is the particular sequence that is relevant, and not the physical nucleic acids themselves. For example, a chimeric fungal class II cellobiohydrolases (CBH II cellulases) will have at least two segments from two different parent CBH II polypeptides.
  • CBH II cellulases chimeric fungal class II cellobiohydrolases
  • a chimeric polypeptide can comprise more than two segments from two different parent proteins. For example, there may be 2, 3, 4, 5-10, 10-20, or more parents for each final chimera or library of chimeras.
  • the segment of each parent polypeptide can be very short or very long, the segments can range in length of contiguous amino acids from 1 to about 90%, 95%, 98%, or 99% of the entire length of the protein. In one embodiment, the minimum length is 10 amino acids. In one embodiment, a single crossover point is defined for two parents.
  • the crossover location defines where one parent's amino acid segment will stop and where the next parent's amino acid segment will start.
  • a simple chimera would only have one crossover location where the segment before that crossover location would belong to a first parent and the segment after that crossover location would belong to a second parent.
  • the chimera has more than one crossover location. For example, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11-30, or more crossover locations. How these crossover locations are named and defined are both discussed below.
  • Contiguous is meant to denote that there is nothing of significance interrupting the segments. These contiguous segments are connected to form a contiguous amino acid sequence.
  • a CBH II chimera from Humicola msolens (hereinafter “1”) and H. jecori (hereinafter “2”) with two crossovers at 100 and 150, could have the first 100 amino acids from 1, followed by the next 50 from 2, followed by the remainder of the amino acids from 1, all connected in one contiguous amino acid chain.
  • the CBH II chimera could have the first 100 amino acids from 2, the next 50 from 1 and the remainder followed by 2.
  • variants of chimeras exist as well as the exact sequences.
  • Constant amino acid substitution refers to the interchangeability of residues having similar side chains, and thus typically involves substitution of the amino acid in the polypeptide with amino acids within the same or similar defined class of amino acids.
  • an amino acid with an aliphatic side chain may be substituted with another aliphatic amino acid, e.g., alanine, valine, leucine, isoleucine, and methionine;
  • an amino acid with hydroxyl side chain is substituted with another amino acid with a hydroxyl side chain, e.g., serine and threonine;
  • an amino acids having aromatic side chains is substituted with another amino acid having an aromatic side chain, e.g., phenylalanine, tyrosine, tryptophan, and histidine;
  • an amino acid with a basic side chain is substituted with another amino acid with a basis side chain, e.g., lysine, arginine, and histidine;
  • Non-conservative substitution refers to substitution of an amino acid in the polypeptide with an amino acid with significantly differing side chain properties. Non-conservative substitutions may use amino acids between, rather than within, the defined groups and affects (a) the structure of the peptide backbone in the area of the substitution (e.g., proline for glycine) (b) the charge or hydrophobicity, or (c) the bulk of the side chain.
  • an exemplary non-conservative substitution can be an acidic amino acid substituted with a basic or aliphatic amino acid; an aromatic amino acid substituted with a small amino acid; and a hydrophilic amino acid substituted with a hydrophobic amino acid.
  • isolated polypeptide refers to a polypeptide which is separated from other contaminants that naturally accompany it, e.g., protein, lipids, and polynucleotides.
  • the term embraces polypeptides which have been removed or purified from their naturally-occurring environment or expression system (e.g., host cell or in vitro synthesis) .
  • substantially pure polypeptide refers to a composition in which the polypeptide species is the predominant species present (i.e., on a molar or weight basis it is more abundant than any other individual macromolecular species in the composition) , and is generally a substantially purified composition when the object species comprises at least about 50 percent of the macromolecular species present by mole or % weight.
  • a substantially pure polypeptide composition will comprise about 60% or more, about 70% or more, about 80% or more, about 90% or more, about 95% or more, and about 98% or more of all macromolecular species by mole or % weight present in the composition.
  • the object species is purified to essential homogeneity ⁇ i.e., contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species.
  • Solvent species, small molecules ( ⁇ 500 Daltons) , and elemental ion species are not considered macromolecular species.
  • Reference sequence refers to a defined sequence used as a basis for a sequence comparison.
  • a reference sequence may be a subset of a larger sequence, for example, a segment of a full-length gene or polypeptide sequence.
  • a reference sequence can be at least 20 nucleotide or amino acid residues in length, at least 25 nucleotide or residues in length, at least 50 nucleotides or residues in length, or the full length of the nucleic acid or polypeptide.
  • sequence comparisons between two (or more) polynucleotides or polypeptides are typically performed by comparing sequences of the two polynucleotides or polypeptides over a "comparison window" to identify and compare local regions of sequence similarity.
  • sequence identity means that two amino acid sequences are substantially identical (e.g., on an amino acid-by-amino acid basis) over a window of comparison.
  • sequence similarity refers to similar amino acids that share the same biophysical characteristics.
  • percentage of sequence identity or “percentage of sequence similarity” is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical residues (or similar residues) occur in both polypeptide sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity (or percentage of sequence similarity) .
  • sequence identity and sequence similarity have comparable meaning as described for protein sequences, with the term “percentage of sequence identity” indicating that two polynucleotide sequences are identical (on a nucleotide-by-nucleotide basis) over a window of comparison.
  • a percentage of polynucleotide sequence identity or percentage of polynucleotide sequence similarity, e.g., for silent substitutions or other substitutions, based upon the analysis algorithm
  • Maximum correspondence can be determined by using one of the sequence algorithms described herein (or other algorithms available to those of ordinary skill in the art) or by visual inspection.
  • the term substantial identity or substantial similarity means that two peptide sequences, when optimally aligned, such as by the programs BLAST, GAP or BESTFIT using default gap weights or by visual inspection, share sequence identity or sequence similarity.
  • substantial identity or substantial similarity means that the two nucleic acid sequences, when optimally aligned, such as by the programs BLAST, GAP or BESTFIT using default gap weights (described elsewhere herein) or by visual inspection, share sequence identity or sequence similarity.
  • One example of an algorithm that is suitable for determining percent sequence identity or sequence similarity is the FASTA algorithm, which is described in Pearson, W. R.
  • PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity or percent sequence similarity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, (1987) J. MoI. Evol . 35:351-360. The method used is similar to the method described by Higgins & Sharp, CABIOS 5:151- 153, 1989. The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids.
  • the multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments.
  • the program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters.
  • PILEUP a reference sequence is compared to other test sequences to determine the percent sequence identity (or percent sequence similarity) relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps.
  • PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al . , (1984) Nuc . Acids Res. 12:387-395) .
  • Another example of an algorithm that is suitable for multiple DNA and amino acid sequence alignments is the CLUSTALW program (Thompson, J. D. et al . , (1994) Nuc. Acids Res. 22:4673- 4680) .
  • CLUSTALW performs multiple pairwise comparisons between groups of sequences and assembles them into a multiple alignment based on sequence identity. Gap open and Gap extension penalties were 10 and 0.05 respectively.
  • the BLOSUM algorithm can be used as a protein weight matrix (Henikoff and Henikoff, (1992) Proc . Natl. Acad. Sci . USA 89:10915-10919) .
  • “Functional” refers to a polypeptide which possesses either the native biological activity of the naturally-produced proteins of its type, or any specific desired activity, for example as judged by its ability to bind to ligand molecules or carry out an enzymatic reaction.
  • the disclosure describes a directed SCHEMA recombination library to generate cellobiohydrolase enzymes based on a particularly members of this enzyme family, and more particularly cellobiohydrolase II enzymes (e.g., H. msolens is parent “1" (SEQ ID NO:2), H. jeco ⁇ na is parent “2" (SEQ ID NO:4) and C. thermophilum is parent “3" (SEQ ID NO: 6)) .
  • SCHEMA is a computational based method for predicting which fragments of related proteins can be recombined without affecting the structural integrity of the protein (see, e.g., Meyer et al . , (2003) Protein Sci., 12:1686-1693) .
  • the disclosure provides CBH II polypeptides comprising a chimera of parental domains.
  • the polypeptide comprises a chimera having a plurality of domains from N- to C-terminus from different parental CBH II proteins: (segment I)- (segment 2) -(segment 3) -(segment 4) -(segment 5) -(segment 6) -(segment 7) -(segment 8) ; wherein segment 1 comprises amino acid residue from about 1 to about Xi of SEQ ID NO:2 ("1"), SEQ ID NO : 4 (“2") or SEQ ID NO : 6
  • segment 2 is from about amino acid residue xi to about x 2 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 3 is from about amino acid residue x 2 to about X3 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2”) or SEQ ID NO : 6 ("3”); segment 4 is from about amino acid residue x 3 to about x 4 of SEQ ID NO: 2 ("1"), SEQ ID NO : 4
  • segment 5 is from about amino acid residue x 4 to about x 5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3”); segment 6 is from about amino acid residue x 5 to about X 6 of SEQ ID NO:2 (“1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
  • each digit refers to a domain of a chimeric CBH II polypeptide.
  • the number denotes the parental strand of the domain.
  • a chimeric CBH II chimeric polypeptide having the sequence 12111131 indicates that the polypeptide comprises a sequence from the N-terminus to the C-terminus of: amino acids from about 1 to Xi of SEQ ID NO: 2 ("1") linked to amino acids from about xi to x 2 of SEQ ID NO: 4 (“2") linked to amino acids from about x 2 to about x 3 of SEQ ID NO: 2 linked to amino acids from about X 3 to about x 4 of SEQ ID NO: 2 linked to amino acids from about X 4 to about X 5 of SEQ ID NO: 2 linked to amino acids from about x 5 to about X 6 of SEQ ID NO : 2 linked to amino acids from about x 6 to x 7 of SEQ ID NO : 6 (“3") linked to amino acids from about x 7 to x 8 (
  • the CBH II polypeptide has a chimeric segment structure selected from the group consisting of:
  • the polypeptide has improved thermostability compared to a wild-type polypeptide of SEQ ID NO: 2,
  • the activity of the polypeptide can be measured with any one or combination of substrates as described in the examples. As will be apparent to the skilled artisan, other compounds within the class of compounds exemplified by those discussed in the examples can be tested and used.
  • the polypeptide can comprise various changes to the amino acid sequence with respect to a reference sequence.
  • the changes can be a substitution, deletion, or insertion of one or more amino acids.
  • the change can be a conservative or a non-conservative substitution.
  • a chimera may comprise a combination of conservative and non-conservative substitutions.
  • polypeptides can comprise a general structure from N-terminus to C-terminus:
  • segment 1 comprises amino acid residue from about 1 to about Xi of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having 1-10 conservative amino acid substitutions
  • segment 2 is from about amino acid residue Xi to about x 2 of SEQ ID NO: 2 ("1"), SEQ ID NO:4 (“2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions
  • segment 3 is from about amino acid residue x 2 to about x 3 of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 (“2”) or SEQ ID NO : 6 (“3") and having about 1-10 conservative amino acid substitutions
  • segment 4 is from about amino acid residue x 3 to about X 4 of SEQ ID NO:2 (“1"), SEQ ID NO : 4 (“2”) or SEQ ID NO : 6 (“3") and having about 1-10 conservative amino acid substitutions
  • segment 5 comprises amino acid residue from about 1 to about Xi of SEQ ID NO
  • segment 7 is from about amino acid residue x 6 to about X 7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 (“2") or SEQ ID NO : 6
  • segment 8 is from about amino acid residue x 7 to about x 8 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions;
  • X 1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO:2, or residue 42, 43, 44, 45, or 46 of SEQ ID NO : 4 or SEQ ID NO: 6;
  • X 2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO : 4 or SEQ ID NO: 6;
  • X 3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO : 2 , or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO : 4 or SEQ ID NO
  • the number of substitutions can be 2, 3, 4, 5, 6, 8, 9, or 10, or more amino acid substitutions (e.g., 10-20, 21-30, 31-40 and the like amino acid substitutions) .
  • the functional chimera polypeptides can have cellobiohydrolase activity along with increased thermostability, such as for a defined substrate discussed in the Examples, and also have a level of amino acid sequence identity to a reference cellobiohydrolase, or segments thereof.
  • the reference enzyme or segment can be that of a wild-type (e.g., naturally occurring) or an engineered enzyme.
  • the polypeptides of the disclosure can comprise a general structure from N-terminus to C-terminus: wherein segment 1 comprises a sequence that is at least 50- 100% identity to amino acid residue from about 1 to about xi of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 2 comprises a sequence that is at least 50-100% identity to amino acid residue xi to about x 2 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 (“2") or SEQ ID NO : 6 ("3"); segment 3 comprises a sequence that is at least 50- 100% identity to amino acid residue x 2 to about x 3 of SEQ ID NO : 2
  • segment 4 comprises a sequence that is at least 50-100% identity to amino acid residue X3 to about X 4 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
  • segment 5 comprises a sequence that is at least 50-100% identity to about amino acid residue x 4 to about x 5 of SEQ ID NO: 2
  • segment 6 comprises a sequence that is at least 50-100% identity to amino acid residue x 5 to about X 6 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
  • segment 7 comprises a sequence that is at least 50-100% identity to amino acid residue x 6 to about x 7 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 (“2") or SEQ ID NO : 6 (“3”); and segment 8 comprises a sequence that is at least 50-100% identity to amino acid residue x 7 to about X 8 of SEQ ID NO:2 (“1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
  • X 1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO:2, or residue 42, 43, 44, 45, or 46 of SEQ ID NO : 4 or SEQ ID NO: 6
  • X 2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO : 4 or SEQ ID NO: 6
  • X 3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO : 2 , or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO : 4 or SEQ ID NO : 6
  • X 4 is residue 153, 154, 155, 156, or 157 of SEQ ID NO:2, or residue 149, 150, 151, 152, 153, 154, 155 or 156 of SEQ ID NO: 4 or SEQ ID NO:
  • each segment of the chimeric polypeptide can have at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% or more sequence identity as compared to the reference segment indicated for each of the (segment 1), (segment 2), (segment 3), (segment 4) -(segment 5), (segment 6), (segment 7), and (segment 8) of SEQ ID NO:2, SEQ ID NO : 4 , or SEQ ID NO : 6.
  • the polypeptide variants can have improved thermostability compared to the enzyme activity of the wild-type polypeptide of SEQ ID NO: 2, 4, or 6.
  • the chimeric enzymes described herein may be prepared in various forms, such as lysates, crude extracts, or isolated preparations.
  • the polypeptides can be dissolved in suitable solutions; formulated as powders, such as an acetone powder (with or without stabilizers); or be prepared as lyophilizates .
  • the polypeptide can be an isolated polypeptide.
  • the polypeptides can be in the form of arrays.
  • the enzymes may be in a soluble form, for example, as solutions in the wells of mircotitre plates, or immobilized onto a substrate.
  • the substrate can be a solid substrate or a porous substrate (e.g, membrane), which can be composed of organic polymers such as polystyrene, polyethylene, polypropylene, polyfluoroethylene, polyethyleneoxy, and polyacrylamide, as well as co-polymers and grafts thereof.
  • a solid support can also be inorganic, such as glass, silica, controlled pore glass (CPG) , reverse phase silica or metal, such as gold or platinum.
  • CPG controlled pore glass
  • the configuration of a substrate can be in the form of beads, spheres, particles, granules, a gel, a membrane or a surface. Surfaces can be planar, substantially planar, or non-planar.
  • Solid supports can be porous or non-porous, and can have swelling or non-swelling characteristics.
  • a solid support can be configured in the form of a well, depression, or other container, vessel, feature, or location.
  • a plurality of supports can be configured on an array at various locations, addressable for robotic delivery of reagents, or by detection methods and/or instruments.
  • the disclosure also provides polynucleotides encoding the engineered CBH II polypeptides disclosed herein.
  • the polynucleotides may be operatively linked to one or more heterologous regulatory or control sequences that control gene expression to create a recombinant polynucleotide capable of expressing the polypeptide.
  • Expression constructs containing a heterologous polynucleotide encoding the CBH II chimera can be introduced into appropriate host cells to express the polypeptide.
  • the polynucleotide sequences will be apparent form the amino acid sequence of the engineered CBH II chimera enzymes to one of skill in the art and with reference to the polypeptide sequences and nucleic acid sequence described herein.
  • the knowledge of the codons corresponding to various amino acids coupled with the knowledge of the amino acid sequence of the polypeptides allows those skilled in the art to make different polynucleotides encoding the polypeptides of the disclosure.
  • the disclosure contemplates each and every possible variation of the polynucleotides that could be made by selecting combinations based on possible codon choices, and all such variations are to be considered specifically disclosed for any of the polypeptides described herein.
  • the polynucleotides encode the polypeptides described herein but have about 80% or more sequence identity, about 85% or more sequence identity, about 90% or more sequence identity, about 91% or more sequence identity, about 92% or more sequence identity, about 93% or more sequence identity, about 94% or more sequence identity, about 95% or more sequence identity, about 96% or more sequence identity, about 97% or more sequence identity, about 98% or more sequence identity, or about 99% or more sequence identity at the nucleotide level to a reference polynucleotide encoding the CBH II chimera polypeptides.
  • the isolated polynucleotides encoding the polypeptides may be manipulated in a variety of ways to provide for expression of the polypeptide. Manipulation of the isolated polynucleotide prior to its insertion into a vector may be desirable or necessary depending on the expression vector.
  • the techniques for modifying polynucleotides and nucleic acid sequences utilizing recombinant DNA methods are well known in the art. Guidance is provided in Sambrook et al . , 2001, Molecular Cloning: A Laboratory Manual, 3rd Ed., Cold Spring Harbor Laboratory Press; and Current Protocols in Molecular Biology, Ausubel. F. ed., Greene Pub. Associates, 1998, updates to 2007.
  • the polynucleotides are operatively linked to control sequences for the expression of the polynucleotides and/or polypeptides.
  • the control sequence may be an appropriate promoter sequence, which can be obtained from genes encoding extracellular or intracellular polypeptides, either homologous or heterologous to the host cell.
  • suitable promoters for directing transcription of the nucleic acid constructs of the present disclosure include the promoters obtained from the E. coli lac operon, Bacillus subtilis xylA and xylB genes, Bacillus megatarium xylose utilization genes (e.g.,Rygus et al., (1991) Appl .
  • control sequence may also be a suitable transcription terminator sequence, a sequence recognized by a host cell to terminate transcription.
  • the terminator sequence is operably linked to the 3' terminus of the nucleic acid sequence encoding the polypeptide. Any terminator which is functional in the host cell of choice may be used.
  • control sequence may also be a suitable leader sequence, a nontranslated region of an mRNA that is important for translation by the host cell.
  • the leader sequence is operably linked to the 5' terminus of the nucleic acid sequence encoding the polypeptide. Any leader sequence that is functional in the host cell of choice may be used.
  • control sequence may also be a signal peptide coding region that codes for an amino acid sequence linked to the amino terminus of a polypeptide and directs the encoded polypeptide into the cell's secretory pathway.
  • the 5' end of the coding sequence of the nucleic acid sequence may inherently contain a signal peptide coding region naturally linked in translation reading frame with the segment of the coding region that encodes the secreted polypeptide.
  • the 5' end of the coding sequence may contain a signal peptide coding region that is foreign to the coding sequence. The foreign signal peptide coding region may be required where the coding sequence does not naturally contain a signal peptide coding region.
  • Effective signal peptide coding regions for bacterial host cells can be the signal peptide coding regions obtained from the genes for Bacillus NClB 11837 maltogenic amylase, Bacillus stearothermophilus alpha-amylase, Bacillus licheniformis subtilism, Bacillus licheniformis beta- lactamase, Bacillus stearothermophilus neutral proteases (nprT, nprS, nprM) , and Bacillus subtilis prsA. Further signal peptides are described by Simonen and Palva, (1993) Microbiol Rev 57: 109- 137.
  • the disclosure is further directed to a recombinant expression vector comprising a polynucleotide encoding the engineered CBH II chimera polypeptides, and one or more expression regulating regions such as a promoter and a terminator, a replication origin, etc., depending on the type of hosts into which they are to be introduced.
  • the coding sequence is located in the vector so that the coding sequence is operably linked with the appropriate control sequences for expression .
  • the recombinant expression vector may be any vector (e.g., a plasmid or virus), which can be conveniently subjected to recombinant DNA procedures and can bring about the expression of the polynucleotide sequence.
  • the choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced.
  • the vectors may be linear or closed circular plasmids .
  • the expression vector may be an autonomously replicating vector, i.e., a vector that exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome.
  • the vector may contain any means for assuring self-replication.
  • the vector may be one which, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome (s) into which it has been integrated.
  • a single vector or plasmid or two or more vectors or plasmids which together contain the total DNA to be introduced into the genome of the host cell, or a transposon may be used.
  • the expression vector of the disclosure contains one or more selectable markers, which permit easy selection of transformed cells.
  • a selectable marker is a gene the product of which provides for biocide or viral resistance, resistance to heavy metals, prototrophy to auxotrophs, and the like.
  • Examples of bacterial selectable markers are the dal genes from Bacillus subtilis or Bacillus licheniformis, or markers, which confer antibiotic resistance such as ampicillin, kanamycin, chloramphenicol or tetracycline resistance. Other useful markers will be apparent to the skilled artisan.
  • the disclosure provides a host cell comprising a polynucleotide encoding the CBH II chimera polypeptide, the polynucleotide being operatively linked to one or more control sequences for expression of the polypeptide in the host cell.
  • Host cells for use in expressing the polypeptides encoded by the expression vectors of the disclosure are well known in the art and include, but are not limited to, bacterial cells, such as E.
  • coli and Bacillus megate ⁇ um eukaryotic cells, such as yeast cells, CHO cells and the like, insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, BHK, 293, and Bowes melanoma cells; and plant cells.
  • eukaryotic cells such as yeast cells, CHO cells and the like, insect cells such as Drosophila S2 and Spodoptera Sf9 cells
  • animal cells such as CHO, COS, BHK, 293, and Bowes melanoma cells
  • plant cells eukaryotic cells, such as yeast cells, CHO cells and the like, insect cells such as Drosophila S2 and Spodoptera Sf9 cells
  • animal cells such as CHO, COS, BHK, 293, and Bowes melanoma cells
  • plant cells eukaryotic cells, such as yeast cells, CHO cells and the like, insect cells such as Drosophila S2 and Spodoptera Sf
  • the CBH II chimera polypeptides of the disclosure can be made by using methods well known in the art.
  • Polynucleotides can be synthesized by recombinant techniques, such as that provided in Sambrook et al . , 2001, Molecular Cloning: A Laboratory Manual, 3rd Ed., Cold Spring Harbor Laboratory Press; and Current Protocols in Molecular Biology, Ausubel. F. ed., Greene Pub. Associates, 1998, updates to 2007.
  • Polynucleotides encoding the enzymes, or the primers for amplification can also be prepared by standard solid- phase methods, according to known synthetic methods, for example using phosphoramidite method described by Beaucage et al .
  • nucleic acid can be obtained from any of a variety of commercial sources, such as The Midland Certified Reagent Company, Midland, TX, The Great American Gene Company, Ramona, CA, ExpressGen Inc. Chicago, IL, Operon Technologies Inc., Alameda, CA, and many others.
  • Engineered enzymes expressed in a host cell can be recovered from the cells and or the culture medium using any one or more of the well known techniques for protein purification, including, among others, lysozyme treatment, sonication, filtration, salting-out, ultra-centrifugation, chromatography, and affinity separation (e.g., substrate bound antibodies) .
  • Suitable solutions for lysing and the high efficiency extraction of proteins from bacteria, such as E. coli are commercially available under the trade name CelLytic BTM from Sigma-Aldrich of St. Louis MO.
  • Chromatographic techniques for isolation of the polypeptides include, among others, reverse phase chromatography high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, and affinity chromatography. Conditions for purifying a particular enzyme will depend, in part, on factors such as net charge, hydrophobicity, hydrophilicity, molecular weight, molecular shape, etc., and will be apparent to those having skill in the art. [0084] Descriptions of SCHEMA directed recombination and synthesis of chimeric polypeptides are described in the examples herein, as well as in Otey et al . , (2006), PLoS Biol. 4(5) :ell2; Meyer et al . , (2003) Protein Sci .
  • polypeptide can be used in a variety of applications, such as, among others, biofuel generation, cellulose breakdown and the like.
  • a method for processing cellulose includes culturing a recombinant microorganism as provided herein that expresses a chimeric polypeptide of the disclosure in the presence of a suitable cellulose substrate and under conditions suitable for the catalysis by the chimeric polypeptide of the cellulose.
  • a substantially purified chimeric polypeptide of the disclosure is contacted with a cellulose substrate under conditions that allow for the chimeric polypeptide degrade the cellulose.
  • the conditions include temperatures from about 35-65 °C.
  • RNA polymerase mediated techniques e.g., NASBA
  • Appropriate culture conditions are conditions of culture medium pH, ionic strength, nutritive content, etc.; temperature; oxygen/C0 2 /nitrogen content; humidity; and other culture conditions that permit production of the compound by the host microorganism, i.e., by the metabolic action of the microorganism.
  • Appropriate culture conditions are well known for microorganisms that can serve as host cells.
  • CBH II expression plasmid construction Parent and chimeric genes encoding CBH II enzymes were cloned into yeast expression vector YEp352/PGK91-l- ⁇ ss ( Figure 6) .
  • DNA sequences encoding parent and chimeric CBH II catalytic domains were designed with S. cerevisiae codon bias using GeneDesigner software (DNA2.0) and synthesized by DNA2.0.
  • the CBH II catalytic domain genes were digested with Xhol and Kpnl, ligated into the vector between the Xhol and Kpnl sites and transformed into E. coli XL-I Blue (Stratagene) .
  • CBH II genes were sequenced using primers: CBH2L (5' - GCTGAACGTGTCATCGGTTAC-3' (SEQ ID NO: 9) and RSQ3080 (5'- GCAACACCTGGCAATTCCTTACC-3' (SEQ ID NO:10)) .
  • Oterminal His 6 parent and chimera CBH II constructs were made by amplifying the CBH II gene with forward primer CBH2LPCR ⁇ 5' ' -GCTGAACGTGTCATCGTTACTTAG-3' (SEQ ID NO: H)) and reverse primers complementary to the appropriate CBH II gene with His 6 overhangs and stop codons .
  • PCR products were ligated, transformed and sequenced as above.
  • S. cerevisiae strain YDR483W BY4742 ⁇ Mat ⁇ his3 ⁇ l leu2 ⁇ 0 lys2 ⁇ 0 ura3 ⁇ 0 ⁇ KRE2, ATCC No. 4014317 was made competent using the EZ Yeast II Transformation Kit (Zymo Research) , transformed with plasmid DNA and plated on synthetic dropout -uracil agar.
  • SDCAA dextrose casamino acids
  • PASC Phosphoric acid swollen cellulose
  • CBH II enzyme ti /2 s were measured by adding concentrated CBH II expression culture supernatant to 50 mM sodium acetate, pH 4.8 at a concentration giving A 520 of 0.5 as measured in the Nelson- Somogyi reducing sugar assay after incubation with treated PASC as described below. 37.5 uL CBH II enzyme/buffer mixtures were inactivated in a water bath at 63°C. After inactivation, 37.5 uL endoglucanase-treated PASC was added and hydrolysis was carried out for 2 hr at 50°C. Reaction supernatants were filtered through Multiscreen HTS plates (Millipore) . Nelson-Somogyi assay log (A 520 ) values, obtained using a SpectraMax microplate reader (Molecular Devices) corrected for background absorbance, were plotted versus time and CBH II enzyme half-lives obtained from linear regression using Microsoft Excel.
  • purified CBH II enzyme was added to PASC to give a final reaction volume of 75 uL 25 mM sodium acetate, pH 4.8, with 5 g/L PASC and CBH II enzyme concentration of 3 mg enzyme/g PASC. Incubation proceeded for 2 hr in a 50°C water bath and the reducing sugar concentration determined.
  • purified CBH II enzyme was added at a concentration of 300 ug/g PASC in a 75 uL reaction volume. Reactions were buffered with 12.5 mM sodium citrate/12.5 mM sodium phosphate, run for 16 hr at 50°C and reducing sugar determined.
  • CBH II enzymes Five candidate parent genes encoding CBH II enzymes were synthesized with S. cerevisiae codon bias. All five contained identical N-terminal coding sequences, where residues 1-89 correspond to the cellulose binding module (CBM) , flexible linker region and the five N-terminal residues of the H. jeco ⁇ na catalytic domain.
  • CBM cellulose binding module
  • the recombinant CBH II genes were expressed in a glycosylation-deficient dKRE2 S. cerevisiae strain. This strain is expected to attach smaller mannose oligomers to both N-linked and O-linked glycosylation sites than wild type strains, which more closely resembles the glycosylation of natively produced H. jeco ⁇ na CBH II enzyme.
  • Table 2 ClustalW multiple sequence alignment for parent CBH Il enzyme catalytic domains. Blocks 2, 4, 6 and 8 are denoted by boxes and grey shading. Blocks 1,3,5 and 7 are not shaded. (H. inso: SEQ ID NO:2; H. Jeco: SEQ ID NO:4 and C. Then SEQ ID NO:6).
  • the H. msolens CBH II catalytic domain has an ⁇ / ⁇ barrel structure in which the eight helices define the barrel perimeter and seven parallel ⁇ -sheets form the active site (Figure 2A) .
  • Two extended loops form a roof over the active site, creating a tunnel through which the substrate cellulose chains pass during hydrolysis.
  • Five of the seven block boundaries fall between elements of secondary structure, while block 4 begins and ends in the middle of consecutive ⁇ -helices ( Figures 2A, 2B) .
  • the majority of interblock sidechain contacts occur between blocks that are adjacent in the primary structure ( Figure 2C) .
  • a sample set of 48 chimera genes was designed as three sets of 16 chimeras having five blocks from one parent and three blocks from either one or both of the remaining two parents (Table 3) ; the sequences were selected to equalize the representation of each parent at each block position. The corresponding genes were synthesized and expressed. Table 3: Sequences of sample set CBH II enzyme chimeras.
  • Half-lives of thermal inactivation were measured at 63°C for concentrated culture supernatants of the parent and active chimeric CBH II enzymes.
  • the H. msolens, H. jeco ⁇ na and C. thermophilum CBH II parent half-lives were 95, 2 and 25 minutes, respectively.
  • the active sample set chimeras exhibited a broad range of half-lives, from less than 1 minute to greater than 3,000. Five of the 23 active chimeras had half-lives greater than that of the most thermostable parent, H. msolens CBH II.
  • Table 4 Cross validation values for application of 5 linear regression algorithms to CBH II enzyme chimera block stability scores. Algorithm abbreviations: ridge regression (RR), partial least square regression (PLSR) , support vector machine regression (SVMR) , linear programming support vector machine regression (LPSVMR) and linear programming boosting regression (LPBoostR) .
  • RR ridge regression
  • PLSR partial least square regression
  • SVMR support vector machine regression
  • LPSVMR linear programming support vector machine regression
  • LBoostR linear programming boosting regression
  • Block I/parent 1 B6P3, B7P3 and B8P2 were identified as having the greatest stabilizing effects, while B1P3, B2P1, B3P2, B6P2, B7P1, B7P2 and B8P3 were found to be the most strongly destabilizing blocks.
  • Table 5 Qualitative block classification results generated by five linear regression algorithms 1 for sample set CBH II enzyme chimeras. Score of +1 denotes a block with thermostability weight
  • score of 0 denotes block with weight within one standard deviation of neutral and -1 denotes block with weight more than one standard deviation below neutral (destabilizing) .
  • a chimera that has a sum score from the contributions of each block/domain of greater than 0 using a qualitative block classification, wherein the qualitatively classify blocks are defined as stabilizing, destabilizing or neutral, wherein each block' s impact on chimera thermostability is characterized using a scoring system that accounts for the thermostability contribution determined by a plurality of regression algorithms. For each algorithm, blocks with a thermostability weight value more than 1 SD above neutral were scored "+1", blocks within 1 SD of neutral were assigned zero and blocks 1 or more SD below neutral were scored "- 1". A "stability score" for each block was obtained by summing the 1, 0, -1 stability scores from each of the five models.
  • a second set of genes encoding CBH II enzyme chimeras was synthesized in order to validate the predicted stabilizing blocks and identify cellulases more thermostable than the most stable parent.
  • the 24 chimeras included in this validation set (Table 6) were devoid of the seven blocks predicted to be most destabilizing and enriched in the four most stabilizing blocks, where representation was biased toward higher stability scores.
  • the "HJPlus" 12222332 chimera was constructed by substituting the predicted most stabilizing blocks into the H. jeco ⁇ na CBH II enzyme (parent 2) .
  • Table 6 Sequences of 24 validation set CBH II enzyme chimeras, nine of which were expressed in active form.
  • Table 7 Specific activity values (ug glucose reducing sugar equivalent/ug CBH II*hr) for three thermostable CBH II chimeras and parents. Error is give as standard erros for between five and eight replicates per CBH II. 2-hour reaction, 3mg enzyme/g PASC, 50 °C, 25 mM sodium acetate, pH 4.
  • thermostable chimeras using purified enzymes was analyzed.
  • Table 3 the parent and chimera CBH II specific activities were within a factor of four of the most active parent CBH II enzyme, from H. jeco ⁇ na .
  • HJPlus The specific activity of HJPlus was greater than all other CBH II enzymes tested, except for H. jeco ⁇ na CBH II.
  • the pH dependence of cellulase activity is also important, as a broad pH/activity profile would allow the use of a CBH II chimera under a wider range of potential cellulose hydrolysis conditions.
  • H. jeco ⁇ na CBH II has been observed to have optimal activity in the pH range 4 to 6, with activity markedly reduced outside these values.
  • Figure 4 shows that the H. msolens and C. thermophilum CBH II enzymes and all three purified thermostable CBH II chimeras have pH/activity profiles that are considerably broader than that of H. jeco ⁇ na CBH II.
  • thermostable CBH II chimeras in cellulose hydrolysis was tested across a range of temperatures over a 40-hour time interval. As shown in Figure 5, all three thermostable chimeras were active on PASC at higher temperatures than the parent CBH II enzymes. The chimeras retained activity at 70°C, whereas the H. jeco ⁇ na CBH II did not hydrolyze PASC above 57°C and the stable H. msolens enzyme showed no hydrolysis above 63°C. The activity of HJPlus in longtime cellulose hydrolysis assays exceeded that of all the parents at their respective optimal temperatures.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Analytical Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present disclosure relates to CBH II chimera fusion polypetides, nucleic acids encoding the polypeptides, and host cells for producing the polypeptides.

Description

STABLE, FUNCTIONAL CHIMERIC CELLOBIOHYDROLASES
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] The application claims priority under 35 U. S. C. §119 to U.S. Provisional Application Serial Nos . 61/205,284, filed January 16, 2009, and 61/167,003, filed, April 6, 2009, the disclosure of which is incorporated herein by reference.
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH
[0002] The U.S. Government has certain rights in this invention pursuant to Grant No. GM068664 awarded by the National Institutes of Health and Grant No. DAAD19-03-0D-0004 awarded by ARO - US Army Robert Morris Acquisition Center.
TECHNICAL FIELD
[0003] The present disclosure relates to biomolecular engineering and design, and engineered proteins and nucleic acids.
BACKGROUND
[0004] The performance of cellulase mixtures in biomass conversion processes depends on many enzyme properties including stability, product inhibition, synergy among different cellulase components, productive binding versus nonproductive adsorption and pH dependence, in addition to the cellulose substrate physical state and composition. Given the multivariate nature of cellulose hydrolysis, it is desirable to have diverse cellulases to choose from in order to optimize enzyme formulations for different applications and feedstocks.
SUMMARY
[0005] The disclosure provides a chimeric polypeptide comprising at least two domains from two different parental cellobiohydrolase II (CBH II) polypeptides, wherein the domains comprise from N- to C- terminus: (segment I)- (segment 2) -(segment 3) -(segment 4) -(segment 5) -(segment 6) -(segment 7) -(segment 8); wherein: segment 1 comprises a sequence that is at least 50-100% identical to amino acid residue from about 1 to about xi of SEQ ID NO: 2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x2 of SEQ ID NO: 2
("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 3 comprises a sequence that is at least 50-100% identical to amino acid residue x2 to about X3 of SEQ ID N0:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); segment 4 comprises a sequence that is at least 50-100% identical to amino acid residue x3 to about x4 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3"); segment 5 comprises a sequence that is at least 50-100% identical to about amino acid residue x4 to about x5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 6 comprises a sequence that is at least 50- 100% identical to amino acid residue x5 to about x6 of SEQ ID NO: 2
("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 7 comprises a sequence that is at least 50-100% identical to amino acid residue x6 to about X7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); and segment 8 comprises a sequence that is at least 50-100% identical to amino acid residue x7 to about x8 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); wherein X1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO : 2 , or residue 42, 43, 44, 45, or 46 of SEQ ID NO:4 or SEQ ID NO : 6 ; X2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO:4 or SEQ ID NO : 6 ; x3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO:2, or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO:4 or SEQ ID NO : 6 ; x4 is residue 153, 154, 155, 156, or 157 of SEQ ID NO:2, or residue 149, 150, 151, 152, 153, 154, 155 or 156 of SEQ ID NO:4 or SEQ ID NO : 6 ; x5 is residue 220, 221, 222, 223, or 224 of SEQ ID NO:2, or residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO:4 or SEQ ID NO : 6 ; X6 is residue 256, 257, 258, 259, 260 or 261 of SEQ ID NO : 2 , or residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X7 is residue 312, 313, 314, 315 or 316 of SEQ ID NO : 2 , or residue 309, 310, 311, 312, 313, 314, 315 or 318 of SEQ ID NO : 4 or SEQ ID NO : 6 ; and x8 is an amino acid residue corresponding to the C-terminus of the polypeptide have the sequence of SEQ ID NO: 2, SEQ ID NO : 4 or SEQ ID NO: 6, wherein the chimeric polypeptide has cellobiohydrolase activity and improved thermostability and/or pH stability compared to a CBH II polypeptide comprising SEQ ID NO:2, 4, or 6. In one embodiment, segment 1 comprises amino acid residue from about 1 to about xi of SEQ ID NO: 2
("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3") and having 1-10 conservative amino acid substitutions; segment 2 is from about amino acid residue xi to about x2 of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 3 is from about amino acid residue x2 to about X3 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3") and having about 1-10 conservative amino acid substitutions; segment 4 is from about amino acid residue x3 to about x4 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 5 is from about amino acid residue x4 to about x5 of SEQ ID NO: 2 ("1"), SEQ ID NO : 4
("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 6 is from about amino acid residue x5 to about X6 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3") and having about 1-10 conservative amino acid substitutions; segment 7 is from about amino acid residue x6 to about X7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; and segment 8 is from about amino acid residue x7 to about x8 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions. In yet another embodiment, the chimeric polypeptide has at least one segment selected from the following: segment 1 from SEQ ID NO : 2 ; segment 6 from SEQ ID NO: 6, segment 7 from SEQ ID NO : 6 and segment 8 from SEQ ID NO: 4. In yet another embodiment, the chimeric polypeptide can be described as having segments IX2X3X4X5332, wherein X2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x2 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); X3 comprises a sequence that is at least 50-100% identical to amino acid residue X2 to about X3 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); X4 comprises a sequence that is at least 50-100% identical to amino acid residue x3 to about x4 of SEQ ID NO: 2 ("1"), SEQ ID NO : 4
("2") or SEQ ID NO : 6 ("3"); X5 comprises a sequence that is at least 50-100% identical to about amino acid residue x4 to about x5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") . In yet a further embodiment, the chimeric polypeptide comprises a segment structure selected from the group consisting of 11113132, 21333331, 21311131, 22232132, 33133132, 33213332, 13333232, 12133333, 13231111, 11313121, 11332333, 12213111, 23311333, 13111313, 31311112, 23231222, 33123313, 22212231, 21223122, 21131311, 23233133, 31212111, 12222332 and 32333113. In one embodiment, the cimeric polypeptide comprises a segment structure selected from the group set forth in Table 1.
[0006] The disclosure also provides a polynucleotide encoding a polypeptide as described above. One of skill can readily determine the exact sequence desired using the degeneracy of the genetic code, by reference to the amino acid sequences herein and by reference to the polynucleotide sequences herein.
[0007] The disclosure also provides a vector comprising a polynucleotide of the disclosure as well as host cells comprising a polynucleotide or vector of the disclosure.
[0008] The disclosure provides an enzymatic preparation comprising a polypeptide described above.
[0009] The disclosure also provides a method of treating a biomass comprising cellulose, the method comprising contacting the biomass with a chimeric polypeptide as described above. [0010] The disclosure provides a method of treating a biomass comprising cellulose, the method comprising contacting the biomass with a host cell comprising and expressing a polynucleotide and chimeric polypeptide of the disclosure, respectively. [0011] The disclosure also provides a method of generating a thermostable chimeric cellobiohydrolase polypeptide, comprising recombining segments from at least 2 parental cellobiohydrolase polypeptide wherein the chimeric polypeptide comprises from N- to C- terminus 8 segments wherein: segment 1 comprises a sequence that is at least 50-100% identical to amino acid residue from about 1 to about Xi of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x2 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3"); segment 3 comprises a sequence that is at least 50-100% identical to amino acid residue x2 to about X3 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 4 comprises a sequence that is at least 50-100% identical to amino acid residue x3 to about x4 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3"); segment 5 comprises a sequence that is at least 50-100% identical to about amino acid residue x4 to about x5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 6 comprises a sequence that is at least 50- 100% identical to amino acid residue x5 to about x6 of SEQ ID NO: 2
("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 7 comprises a sequence that is at least 50-100% identical to amino acid residue x6 to about X7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); and segment 8 comprises a sequence that is at least 50-100% identical to amino acid residue x7 to about x8 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); wherein X1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO : 2 , or residue 42, 43, 44, 45, or 46 of SEQ ID NO:4 or SEQ ID NO : 6 ; X2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO:4 or SEQ ID NO : 6 ; x3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO:2, or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO:2 or SEQ ID NO : 3 ; x4 is residue 153, 154, 155, 156, or 157 of SEQ ID NO:2, or residue 149, 150, 151, 152, 153, 154, 155 or 156 of SEQ ID NO:4 or SEQ ID NO : 6 ; x5 is residue 220, 221, 222, 223, or 224 of SEQ ID NO:2, or residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO:4 or SEQ ID NO : 6 ; X6 is residue 256, 257, 258, 259, 260 or 261 of SEQ ID NO : 2 , or residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X7 is residue 312, 313, 314, 315 or 316 of SEQ ID NO : 2 , or residue 309, 310, 311, 312, 313, 314, 315 or 318 of SEQ ID NO : 4 or SEQ ID NO : 6 ; and x8 is an amino acid residue corresponding to the C-terminus of the polypeptide have the sequence of SEQ ID NO: 2, SEQ ID NO : 4 or SEQ ID NO : 6 ; screening the chimeric polypeptide for the ability to hydrolyze cellulose at a temperature of about 63 0C.
BRIEF DESCRIPTION OF THE FIGURES
[0012] Figure 1 shows SDS-PAGE gel of candidate CBH II parent gene yeast expression culture supernatants . Gel Lanes (Left-to- Right) : 1-H. jecoπna, 2- Empty vector, 3-H. msolens, 4-C. thermophilum, 5-H. jecoπna (duplicate), 6-P. chrysospoπum, 1-T. emersonii, 8-Empty vector (duplicate) , 9-H. jecoπna (triplicate) . Numbers at bottom of gel represent concentration of reducing sugar
(ug/mL) present in reaction after 2-hr, 50°C PASC hydrolysis assay. Subsequent SDS-PAGE comparison with BSA standard allowed estimation of H. msolens expression level of 5-10 mg/L. [0013] Figure 2A-C shows illustrations of CBH II chimera library block boundaries. (A) H. msolens CBH II catalytic domain ribbon diagram with blocks distinguished by shading. CBH II enzyme is complexed with cellobio-derived isofagomine glycosidase inhibitor. (B) Linear representation of H. msolens catalytic domain showing secondary structure elements, disulfide bonds and block divisions denoted by black arrows. (C) Sidechain contact map denoting contacts (side chain heavy atoms within 4.5A) that can be broken upon recombination. The majority of broken contacts occur between consecutive blocks .
[0014] Figure 3 shows a number of broken contacts (E) and number of mutations from closest parent (m) for 23 secreted/active and 25 not secreted/not active sample set chimeras.
[0015] Figure 4 shows specific activity, normalized to pH 5.0, as a function of pH for parent CBH II enzymes and three thermostable chimeras. Data presented are averages for two replicates, where error bars for HJPlus and H. jeco denote values for two independent trials. 16-hr reaction, 300 ug enzyme/g PASC, 50°C, 12.5 mM sodium citrate/12.5 mM sodium phosphate buffer at pH as shown. [0016] Figure 5 shows long-time cellulose hydrolysis assay results ( ug glucose reducing sugar equivalent/ug CBH II enzyme) for parents and thermostable chimeras across a range of temperatures. Error bars indicate standard errors for three replicates of HJPlus and H. msolens CBH II enzymes. 40-hr reaction, 100 ug enzyme/g PASC, 50 mM sodium acetate, pH 4.8.
[0017] Figure 6 shows normalized residual activities for validation set chimeras after a 12-h incubation at 63 °C. Residual activities for CBH II enzymes in concentrated culture supernatants determined in 2-hr assay with PASC as substrate, 50 °C, 25 mM sodium acetate buffer, pH 4.8.
[0018] Figure 7 Map for parent and chimera CBH II enzyme expression vector Yep352/PGK91-1- ss. Vector pictured contains wild type H. jecoπna celδa (CBH II enzyme) gene. For both chimeric and parent CBH II enzymes, the CBD/linker amino acid sequence following the ss Lys-Arg Kex2 site is: ASCSSVWGQCGGQNWSGPTCCASGSTCVYSND YYSQCLPGAASSSSSTRAASTTSRVSPTTSRSSSATPPPGSTTTRVPPVGSGTATYS (SEQ ID NO: 8) . DETAILED DESCRIPTION
[0019] As used herein and in the appended claims, the singular forms "a," "and," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "a domain" includes a plurality of such domains and reference to "the protein" includes reference to one or more proteins, and so forth.
[0020] Also, the use of "or" means "and/or" unless stated otherwise. Similarly, "comprise," "comprises," "comprising" "include," "includes," and "including" are interchangeable and not intended to be limiting.
[0021] It is to be further understood that where descriptions of various embodiments use the term "comprising, " those skilled in the art would understand that in some specific instances, an embodiment can be alternatively described using language "consisting essentially of" or "consisting of."
[0022] Although methods and materials similar or equivalent to those described herein can be used in the practice of the disclosed methods and compositions, the exemplary methods, devices and materials are described herein.
[0023] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this disclosure belongs. Thus, as used throughout the instant application, the following terms shall have the following meanings.
[0024] Recent studies have documented the superior performance of cellulases from thermophilic fungi relative to their mesophilic counterparts in laboratory scale biomass conversion processes, where enhanced stability leads to retention of activity over longer periods of time at both moderate and elevated temperatures. Fungal cellulases are attractive because they are highly active and can be expressed in fungal hosts such as Hypocrea jecoπna (anamorph Trichoderma reesei) at levels up to 100 g/L in the supernatant. Unfortunately, the set of documented thermostable fungal cellulases is small. In the case of the processive cellobiohydrolase class II
(CBH II) enzymes, fewer than 10 natural thermostable gene sequences are annotated in the CAZy database . [0025] The majority of biomass conversion processes use mixtures of fungal cellulases (primarily CBH II, cellobiohydrolase class I (CBH I), endoglucanases and β-glucosidase) to achieve high levels of cellulose hydrolysis. Generating a diverse group of thermostable CBH II enzyme chimeras is the first step in building an inventory of stable, highly active cellulases from which enzyme mixtures can be formulated and optimized for specific applications and feedstocks. [0026] SCHEMA has been used previously to create families of hundreds of active β-lactamase and cytochrome P450 enzyme chimeras. SCHEMA uses protein structure data to define boundaries of contiguous amino acid "blocks" which minimize <£>, the library average number of amino acid sidechain contacts that are broken when the blocks are swapped among different parents. It has been shown that the probability that a β-lactamase chimera was folded and active was inversely related to the value of E for that sequence. The RASPP (Recombination as Shortest Path Problem) algorithm was used to identify the block boundaries that minimized <E> relative to the library average number of mutations, <m> . More than 20% of the -500 unique chimeras characterized from a β-lactamase collection comprised of 8 blocks from 3 parents (38 = 6,561 possible sequences) were catalytically active. A similar approach produced a 3-parent, 8-block cytochrome P450 chimera family containing more than 2,300 novel, catalytically active enzymes. Chimeras from these two collections were characterized by high numbers of mutations, 66 and 72 amino acids on average from the closest parent, respectively. SCHEMA/RASPP thus enabled design of chimera families having significant sequence diversity and an appreciable fraction of functional members.
[0027] It has also been shown that the thermostabilities of SCHEMA chimeras can be predicted based on sequence-stability data from a small sample of the sequences. Linear regression modeling of thermal inactivation data for 184 cytochrome P450 chimeras showed that SCHEMA blocks made additive contributions to thermostability. More than 300 chimeras were predicted to be thermostable by this model, and all 44 that were tested were more stable than the most stable parent. It was estimated that as few as 35 thermostability measurements could be used to predict the most thermostable chimeras. Furthermore, the thermostable P450 chimeras displayed unique activity and specificity profiles, demonstrating that chimeragenesis can lead to additional useful enzyme properties. The disclosure demonstrates that SCHEMA recombination of CBH II enzymes can generate chimeric cellulases that are active on phosphoric acid swollen cellulose (PASC) at high temperatures, over extended periods of time, and broad ranges of pH.
[0028] Using the methods described herein a number of chimeric polypeptides having cellobiohydrolases activity were generated having improved characteristics compared to the wild-type parental CBH II proteins.
[0029] A diverse family of novel CBH II enzymes was constructed by swapping blocks of sequence from three fungal CBH II enzymes. Twenty-three of 48 chimeric sequences sampled from this set were secreted in active form by S. cerevisiae, and five have half-lives at 63°C that were greater than the most stable parent. Given that this 48-member sample set represents less than 1% of the total possible 6,561 sequences, the disclosure provides hundreds of active chimeras, a number that extends well beyond the approximately twenty fungal CBH II enzymes in the CAZy database.
[0030] The approach of using the sample set sequence-stability data to identify blocks that contribute positively to chimera thermostability was validated by finding that all 10 catalytically active chimeras in the second CBH II validation set were more thermostable than the most stable parent, a naturally-thermostable CBH II from the thermophilic fungus, H. msolens . This disclosure demonstrates that a samle of 33 new CBH II enzymes that are expressed in catalytically active form in S. cerevisiae, 15 of which are more thermostable than the most stable parent from which they were constructed. These 15 thermostable enzymes are diverse in sequence, differing from each other and their closest natural homologs at as many as 94 and 58 amino acid positions, respectively. [0031] Analysis of the thermostabilities of CBH II chimeras in the combined sample and validation sets indicates that the four thermostabilizing blocks identified, block 1 (i.e., domain 1), parent 1 (BlPl); block 6 (i.e., domain 6), parent 3 (B6P3) ; B7P3 and B8P2, make cumulative contributions to thermal stability when present in the same chimera. Four of the five sample set chimeras that are more thermostable than the H. msolens CBH II contain either two or three of these stabilizing blocks (Table 1) . The ten active members of the validation set, all of which are more stable than the H. msolens enzyme, contain at least two stabilizing blocks, with five of the six most thermostable chimeras in this group containing either three or four stabilizing blocks. [0032] Minimizing the number of broken contacts upon recombination (Figure 2C) allows the blocks to be approximated as decoupled units that make independent contributions to the stability of the entire protein, thus leading to cumulative or even additive contributions to chimera thermostability. For this CBH II enzyme recombination, SCHEMA was effective in minimizing such broken contacts: whereas there are 303 total interblock contacts defined in the H. msolens parent CBH II crystal structure, the CBH II SCHEMA library design results in only 33 potential broken contacts. Given that the CBH II enzyme parents do not feature obvious structural subdomains, and only four of the eight blocks (1, 5, 7 and 8) resemble compact structural units, or modules, the low number of broken contacts demonstrates that the SCHEMA/RASPP algorithm is effective for cases in which the number of blocks appears greater than the number of structural subdivisions. As previously observed for β-lactamase and cytochrome P450 chimeras, low E values were predictive of chimera folding and activity. Although not used here, this relationship should be valuable for designing chimera sample sets that contain a high fraction of active members. [0033] The disclosure also used chimera to determine if the pH stability could be improved in CBH II enzymes. Whereas the specific activity of H. jecorma CBH II declines sharply as pH increases above the optimum value of 5, HJPlus, created by substituting stabilizing blocks onto the most industrially relevant H. jecorma CBH II enzyme, retains significantly more activity at these higher pHs (Figure 4) . The thermostable 11113132 and 13311332 chimeras, and also the H. msolens and C. thermophilum CBH II cellulase parents, have even broader pH/activity profiles than HJPlus. The narrow pH/activity profile of H. jecorma CBH II has been attributed to the deprotonation of several carboxyl-carboxylate pairs, which destabilizes the protein above a pH of about 6. The substitution of parent 3 in block 7 (B7P3) in HJPlus changes aspartate 277 to histidine, eliminating the carboxyl-carboxylate pair between D277 and D316 (of block 8) . Replacing D277 with the positively charged histidine may prevent destabilizing charge repulsion at nonacidic pH, allowing HJPlus to retain activity at higher pH than H. jecoπna CBH II. The even broader pH/activity profiles of the remaining two thermostable chimeras and the H. msolens and C. thermophilum parent CBH II enzymes may be due to the absence of acidic residues at positions corresponding to the E57-E119 carboxyl-carboxylate pair of HJPlus and H. jecoπna CBH II.
[0034] HJPlus exhibits both relatively high specific activity and high thermostability. Figure 5 shows that these properties lead to good performance in long-time hydrolysis experiments: HJPlus hydrolyzed cellulose at temperatures 7-15 °C higher than the parent CBH II enzymes and also had a significantly increased long-time activity relative to all the parents at their temperature optima, bettering H. jecoπna CBH II by a factor of 1.7. Given that the specific activity of the HJPlus chimera is less than that of the H. jecoπna CBH II parent, this increased long-time activity can be attributed to the ability of the thermostable HJPlus to retain activity at optimal hydrolysis temperatures over longer reaction timer .
[0035] The other two thermostable chimeras shared HJPlus' s broad temperature operating range. This observation supports a positive correlation between ti/2 at elevated temperature and maximum operating temperature, and suggests that many of the thermostable chimeras among the 6,561 CBH II chimera sequences will also be capable of degrading cellulose at elevated temperatures. While this ability to hydrolyze the amorphous PASC substrate at elevated temperatures bodes well for the potential utility of thermostable fungal CBH II chimeras, studies with more challenging crystalline substrates and substrates containing lignin will provide a more complete assessment of this novel CBH II enzyme family's relevance to biomass degradation applications.
[0036] "Amino acid" is a molecule having the structure wherein a central carbon atom is linked to a hydrogen atom, a carboxylic acid group (the carbon atom of which is referred to herein as a "carboxyl carbon atom"), an amino group (the nitrogen atom of which is referred to herein as an "amino nitrogen atom"), and a side chain group, R. When incorporated into a peptide, polypeptide, or protein, an amino acid loses one or more atoms of its amino acid carboxylic groups in the dehydration reaction that links one amino acid to another. As a result, when incorporated into a protein, an amino acid is referred to as an "amino acid residue." [0037] "Protein" or "polypeptide" refers to any polymer of two or more individual amino acids (whether or not naturally occurring) linked via a peptide bond. The term "protein" is understood to include the terms "polypeptide" and "peptide" (which, at times may be used interchangeably herein) within its meaning. In addition, proteins comprising multiple polypeptide subunits (e.g., DNA polymerase III, RNA polymerase II) or other components (for example, an RNA molecule, as occurs in telomerase) will also be understood to be included within the meaning of "protein" as used herein. Similarly, fragments of proteins and polypeptides are also within the scope of the disclosure and may be referred to herein as "proteins." In one embodiment of the disclosure, a stabilized protein comprises a chimera of two or more parental peptide segments .
[0038] "Peptide segment" or "peptide domain" refers to a portion or fragment of a larger polypeptide or protein. A peptide segment or domain need not on its own have functional activity, although in some instances, a peptide segment or domain may correspond to a segment or domain of a polypeptide wherein the segment or domain has its own biological activity. A stability- associated peptide segment or domain is a peptide segment or domain found in a polypeptide that promotes stability, function, or folding compared to a related polypeptide lacking the peptide segment. A destabilizing-associated peptide segment is a peptide segment that is identified as causing a loss of stability, function or folding when present in a polypeptide. For example, BlPl, B6P3, B7P3 and B8P2 are segments/domains that promote thermostability in a chimeric polypeptide of the disclosure. In some embodiments, for example, a chimera has at least 1, 2, 3, or 4 thermostabilizing segments. For example, the disclosure provides chimeras that comprise at least 8 domains (i.e., B1-B2-B3-B4-B5-B6-B7-B8) comprising 1, 2, 3 or 4 domains comprising sequences that are at least 80-100% identical to a sequence selected from the group consisting of amino acid residue from about 1 to about xi of SEQ ID NO: 2; from about amino acid residue x5 to about x6 of SEQ ID NO: 6; about amino acid residue x6 to about X7 of SEQ ID NO: 6; and about amino acid residue x7 to about x8 of SEQ ID NO:4; wherein: X1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO:2, X5 is residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO:6; x6 is residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO:6; x7 is residue 309, 310, 311, 312, 313, 314, 315 or 318 of SEQ ID NO: 4 or SEQ ID NO : 6 ; and x8 is an amino acid residue corresponding to the C-terminus of the polypeptide having the sequence of SEQ ID NO : 4.
[0039] A particular amino acid sequence of a given protein {i.e., the polypeptide's "primary structure," when written from the amino-terminus to carboxy-terminus) is determined by the nucleotide sequence of the coding portion of a mRNA, which is in turn specified by genetic information, typically genomic DNA (including organelle DNA, e.g., mitochondrial or chloroplast DNA) . Thus, determining the sequence of a gene assists in predicting the primary sequence of a corresponding polypeptide and more particular the role or activity of the polypeptide or proteins encoded by that gene or polynucleotide sequence.
[0040] "Fused," "operably linked," and "operably associated" are used interchangeably herein to broadly refer to a chemical or physical coupling of two otherwise distinct domains or peptide segments, wherein each domain or peptide segment when operably linked can provide a functional polypeptide having a desired activity. Domains or peptide segments can be directly linked or connected through peptide linkers such that they are functional or can be fused through other intermediates or chemical bonds. For example, two domains can be part of the same coding sequence, wherein the polynucleotides are in frame such that the polynucleotide when transcribed encodes a single mRNA that when translated comprises both domains as a single polypeptide. Alternatively, both domains can be separately expressed as individual polypeptides and fused to one another using chemical methods. Typically, the coding domains will be linked "in-frame" either directly of separated by a peptide linker and encoded by a single polynucleotide. Various coding sequences for peptide linkers and peptide are known in the art.
[0041] "Polynucleotide" or "nucleic acid sequence" refers to a polymeric form of nucleotides. In some instances a polynucleotide refers to a sequence that is not immediately contiguous with either of the coding sequences with which it is immediately contiguous (one on the 5' end and one on the 3' end) in the naturally occurring genome of the organism from which it is derived. The term therefore includes, for example, a recombinant DNA which is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (e.g., a cDNA) independent of other sequences. The nucleotides of the disclosure can be ribonucleotides, deoxyribonucleotides, or modified forms of either nucleotide. A polynucleotides as used herein refers to, among others, single-and double-stranded DNA, DNA that is a mixture of single- and double- stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double- stranded regions. The term polynucleotide encompasses genomic DNA or RNA (depending upon the organism, i.e., RNA genome of viruses), as well as mRNA encoded by the genomic DNA, and cDNA. [0042] "Nucleic acid segment, " "oligonucleotide segment" or "polynucleotide segment" refers to a portion of a larger polynucleotide molecule. The polynucleotide segment need not correspond to an encoded functional domain of a protein; however, in some instances the segment will encode a functional domain of a protein. A polynucleotide segment can be about 6 nucleotides or more in length (e.g., 6-20, 20-50, 50-100, 100-200, 200-300, 300-400 or more nucleotides in length) . A stability-associated peptide segment can be encoded by a stability-associated polynucleotide segment, wherein the peptide segment promotes stability, function, or folding compared to a polypeptide lacking the peptide segment. [0043] "Chimera" refers to a combination of at least two segments or domains of at least two different parent proteins or polypeptides. As appreciated by one of skill in the art, the segments need not actually come from each of the parents, as it is the particular sequence that is relevant, and not the physical nucleic acids themselves. For example, a chimeric fungal class II cellobiohydrolases (CBH II cellulases) will have at least two segments from two different parent CBH II polypeptides. The two segments are connected so as to result in a new polypeptide having cellobiohydrolase activity. In other words, a protein will not be a chimera if it has the identical sequence of either one of the full length parents. A chimeric polypeptide can comprise more than two segments from two different parent proteins. For example, there may be 2, 3, 4, 5-10, 10-20, or more parents for each final chimera or library of chimeras. The segment of each parent polypeptide can be very short or very long, the segments can range in length of contiguous amino acids from 1 to about 90%, 95%, 98%, or 99% of the entire length of the protein. In one embodiment, the minimum length is 10 amino acids. In one embodiment, a single crossover point is defined for two parents. The crossover location defines where one parent's amino acid segment will stop and where the next parent's amino acid segment will start. Thus, a simple chimera would only have one crossover location where the segment before that crossover location would belong to a first parent and the segment after that crossover location would belong to a second parent. In one embodiment, the chimera has more than one crossover location. For example, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11-30, or more crossover locations. How these crossover locations are named and defined are both discussed below. In an embodiment where there are two crossover locations and two parents, there will be a first contiguous segment from a first parent, followed by a second contiguous segment from a second parent, followed by a third contiguous segment from the first parent or yet a different parent. Contiguous is meant to denote that there is nothing of significance interrupting the segments. These contiguous segments are connected to form a contiguous amino acid sequence. For example, a CBH II chimera from Humicola msolens (hereinafter "1") and H. jecori (hereinafter "2"), with two crossovers at 100 and 150, could have the first 100 amino acids from 1, followed by the next 50 from 2, followed by the remainder of the amino acids from 1, all connected in one contiguous amino acid chain. Alternatively, the CBH II chimera could have the first 100 amino acids from 2, the next 50 from 1 and the remainder followed by 2. As appreciated by one of skill in the art, variants of chimeras exist as well as the exact sequences. Thus, not 100% of each segment need be present in the final chimera if it is a variant chimera. The amount that may be altered, either through additional residues or removal or alteration of residues will be defined as the term variant is defined. Of course, as understood by one of skill in the art, the above discussion applies not only to amino acids but also nucleic acids which encode for the amino acids .
[0044] "Conservative amino acid substitution" refers to the interchangeability of residues having similar side chains, and thus typically involves substitution of the amino acid in the polypeptide with amino acids within the same or similar defined class of amino acids. By way of example and not limitation, an amino acid with an aliphatic side chain may be substituted with another aliphatic amino acid, e.g., alanine, valine, leucine, isoleucine, and methionine; an amino acid with hydroxyl side chain is substituted with another amino acid with a hydroxyl side chain, e.g., serine and threonine; an amino acids having aromatic side chains is substituted with another amino acid having an aromatic side chain, e.g., phenylalanine, tyrosine, tryptophan, and histidine; an amino acid with a basic side chain is substituted with another amino acid with a basis side chain, e.g., lysine, arginine, and histidine; an amino acid with an acidic side chain is substituted with another amino acid with an acidic side chain, e.g., aspartic acid or glutamic acid; and a hydrophobic or hydrophilic amino acid is replaced with another hydrophobic or hydrophilic amino acid, respectively. [0045] "Non-conservative substitution" refers to substitution of an amino acid in the polypeptide with an amino acid with significantly differing side chain properties. Non-conservative substitutions may use amino acids between, rather than within, the defined groups and affects (a) the structure of the peptide backbone in the area of the substitution (e.g., proline for glycine) (b) the charge or hydrophobicity, or (c) the bulk of the side chain. By way of example and not limitation, an exemplary non-conservative substitution can be an acidic amino acid substituted with a basic or aliphatic amino acid; an aromatic amino acid substituted with a small amino acid; and a hydrophilic amino acid substituted with a hydrophobic amino acid.
[0046] "Isolated polypeptide" refers to a polypeptide which is separated from other contaminants that naturally accompany it, e.g., protein, lipids, and polynucleotides. The term embraces polypeptides which have been removed or purified from their naturally-occurring environment or expression system (e.g., host cell or in vitro synthesis) .
[0047] "Substantially pure polypeptide" refers to a composition in which the polypeptide species is the predominant species present (i.e., on a molar or weight basis it is more abundant than any other individual macromolecular species in the composition) , and is generally a substantially purified composition when the object species comprises at least about 50 percent of the macromolecular species present by mole or % weight. Generally, a substantially pure polypeptide composition will comprise about 60% or more, about 70% or more, about 80% or more, about 90% or more, about 95% or more, and about 98% or more of all macromolecular species by mole or % weight present in the composition. In some embodiments, the object species is purified to essential homogeneity {i.e., contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species. Solvent species, small molecules (<500 Daltons) , and elemental ion species are not considered macromolecular species.
[0048] "Reference sequence" refers to a defined sequence used as a basis for a sequence comparison. A reference sequence may be a subset of a larger sequence, for example, a segment of a full-length gene or polypeptide sequence. Generally, a reference sequence can be at least 20 nucleotide or amino acid residues in length, at least 25 nucleotide or residues in length, at least 50 nucleotides or residues in length, or the full length of the nucleic acid or polypeptide. Since two polynucleotides or polypeptides may each (1) comprise a sequence {i.e., a portion of the complete sequence) that is similar between the two sequences, and (2) may further comprise a sequence that is divergent between the two sequences, sequence comparisons between two (or more) polynucleotides or polypeptides are typically performed by comparing sequences of the two polynucleotides or polypeptides over a "comparison window" to identify and compare local regions of sequence similarity. [0049] "Sequence identity" means that two amino acid sequences are substantially identical (e.g., on an amino acid-by-amino acid basis) over a window of comparison. The term "sequence similarity" refers to similar amino acids that share the same biophysical characteristics. The term "percentage of sequence identity" or "percentage of sequence similarity" is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical residues (or similar residues) occur in both polypeptide sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity (or percentage of sequence similarity) . With regard to polynucleotide sequences, the terms sequence identity and sequence similarity have comparable meaning as described for protein sequences, with the term "percentage of sequence identity" indicating that two polynucleotide sequences are identical (on a nucleotide-by-nucleotide basis) over a window of comparison. As such, a percentage of polynucleotide sequence identity (or percentage of polynucleotide sequence similarity, e.g., for silent substitutions or other substitutions, based upon the analysis algorithm) also can be calculated. Maximum correspondence can be determined by using one of the sequence algorithms described herein (or other algorithms available to those of ordinary skill in the art) or by visual inspection. [0050] As applied to polypeptides, the term substantial identity or substantial similarity means that two peptide sequences, when optimally aligned, such as by the programs BLAST, GAP or BESTFIT using default gap weights or by visual inspection, share sequence identity or sequence similarity. Similarly, as applied in the context of two nucleic acids, the term substantial identity or substantial similarity means that the two nucleic acid sequences, when optimally aligned, such as by the programs BLAST, GAP or BESTFIT using default gap weights (described elsewhere herein) or by visual inspection, share sequence identity or sequence similarity. [0051] One example of an algorithm that is suitable for determining percent sequence identity or sequence similarity is the FASTA algorithm, which is described in Pearson, W. R. & Lipman, D. J., (1988) Proc. Natl. Acad. Sci . USA 85:2444. See also, W. R. Pearson, (1996) Methods Enzymology 266:227-258. Preferred parameters used in a FASTA alignment of DNA sequences to calculate percent identity or percent similarity are optimized, BL50 Matrix 15: -5, k-tuple=2; joining penalty=40, optimization=28 ; gap penalty -12, gap length penalty=-2; and width=16.
[0052] Another example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity or percent sequence similarity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, (1987) J. MoI. Evol . 35:351-360. The method used is similar to the method described by Higgins & Sharp, CABIOS 5:151- 153, 1989. The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids. The multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments. The program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters. Using PILEUP, a reference sequence is compared to other test sequences to determine the percent sequence identity (or percent sequence similarity) relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps. PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al . , (1984) Nuc . Acids Res. 12:387-395) . [0053] Another example of an algorithm that is suitable for multiple DNA and amino acid sequence alignments is the CLUSTALW program (Thompson, J. D. et al . , (1994) Nuc. Acids Res. 22:4673- 4680) . CLUSTALW performs multiple pairwise comparisons between groups of sequences and assembles them into a multiple alignment based on sequence identity. Gap open and Gap extension penalties were 10 and 0.05 respectively. For amino acid alignments, the BLOSUM algorithm can be used as a protein weight matrix (Henikoff and Henikoff, (1992) Proc . Natl. Acad. Sci . USA 89:10915-10919) . [0054] "Functional" refers to a polypeptide which possesses either the native biological activity of the naturally-produced proteins of its type, or any specific desired activity, for example as judged by its ability to bind to ligand molecules or carry out an enzymatic reaction.
[0055] The disclosure describes a directed SCHEMA recombination library to generate cellobiohydrolase enzymes based on a particularly members of this enzyme family, and more particularly cellobiohydrolase II enzymes (e.g., H. msolens is parent "1" (SEQ ID NO:2), H. jecoπna is parent "2" (SEQ ID NO:4) and C. thermophilum is parent "3" (SEQ ID NO: 6)) . SCHEMA is a computational based method for predicting which fragments of related proteins can be recombined without affecting the structural integrity of the protein (see, e.g., Meyer et al . , (2003) Protein Sci., 12:1686-1693) . This computational approached identified seven recombination points in the CBH II parental proteins, thereby allowing the formation of a library of CBH II chimera polypeptides, where each polypeptide comprise eight segments. Chimeras with higher stability are identifiable by determining the additive contribution of each segment to the overall stability, either by use of linear regression of sequence-stability data, or by reliance on consensus analysis of the MSAs of folded versus unfolded proteins. SCHEMA recombination ensures that the chimeras retain biological function and exhibit high sequence diversity by conserving important functional residues while exchanging tolerant ones.
[0056] Thus, as illustrated by various embodiments herein, the disclosure provides CBH II polypeptides comprising a chimera of parental domains. In some embodiments, the polypeptide comprises a chimera having a plurality of domains from N- to C-terminus from different parental CBH II proteins: (segment I)- (segment 2) -(segment 3) -(segment 4) -(segment 5) -(segment 6) -(segment 7) -(segment 8) ; wherein segment 1 comprises amino acid residue from about 1 to about Xi of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); segment 2 is from about amino acid residue xi to about x2 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 3 is from about amino acid residue x2 to about X3 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3"); segment 4 is from about amino acid residue x3 to about x4 of SEQ ID NO: 2 ("1"), SEQ ID NO : 4
("2") or SEQ ID NO : 6 ("3"); segment 5 is from about amino acid residue x4 to about x5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 6 is from about amino acid residue x5 to about X6 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); segment 7 is from about amino acid residue xβ to about x7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); and segment 8 is from about amino acid residue x7 to about x8 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); wherein: xi is residue 43, 44, 45, 46, or 47 of SEQ ID NO:2, or residue 42, 43, 44, 45, or 46 of SEQ ID NO : 4 or SEQ ID NO: 6; X2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO : 4 or SEQ ID NO: 6; X3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO : 2 , or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X4 is residue 153, 154, 155, 156, or 157 of SEQ ID NO:2, or residue 149, 150, 151, 152, 153, 154, 155 or 156 of SEQ ID NO : 4 or SEQ ID NO: 6; X5 is residue 220, 221, 222, 223, or 224 of SEQ ID NO:2, or residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO : 4 or SEQ ID NO : 6 ; x6 is residue 256, 257, 258, 259, 260 or 261 of SEQ ID NO:2, or residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO : 4 or SEQ ID NO: 6; X7 is residue 312, 313, 314, 315 or 316 of SEQ ID NO:2, or residue 309, 310, 311, 312, 313, 314, 315 or 318 of SEQ ID NO : 4 or SEQ ID NO: 6; and x8 is an amino acid residue corresponding to the
C-terminus of the polypeptide have the sequence of SEQ ID NO: 2, SEQ
ID NO: 4 or SEQ ID NO : 6.
[0057] Using the foregoing domain references a number of chimeric structure were generated as set forth in Table 1.
Table 1:
1 ,588 CBH if chimera sequences with T50 values predicted to be greater than the measured T50 value of 64.8 C for the H. iπsolens parent CBH il.
31313232 13132231 13212231 21113231 22112331 33211132 22223232 32123131
31323333 11221233 13331133 21133232 21222133 33211131 31213132 11221333
11212133 33123232 13232232 22221133 32333132 12311232 22223231 11211231
31313231 33123231 13232231 21133231 32333131 12321333 22322232 11231232
31333232 21311333 22121133 23211232 22132332 33231132 31213131 11231231
11232133 21331333 33223232 23221333 22132331 12311231 31312132 33123332
31333231 32213332 23111232 23211231 33313332 33231131 22322231 33123331
21323112 32213331 23121333 23231232 33313331 12331232 31312131 31321232
21323111 32312332 33223231 11311333 33333332 12331231 31233132 31321231
32113332 21211133 33322232 23231231 33333331 23122232 31233131 33122132
32113331 32312331 23111231 21122133 33213132 23122231 31332132 33122131
31223133 13321(12 33322231 11331333 33213131 11113232 31332131 12123232
21111133 32233332 23131232 11211133 33312132 11123333 23321133 12123231
31322133 13321111 23131231 11231133 33312131 11113231 23222232 32121332
32133332 32233331 11323112 33113132 12313232 11133232 23222231 32121331
32133331 32332332 11323111 33113131 12323333 12221133 11213232 21323133
21131133 21231133 11111133 33133132 33233132 11133231 11223333 13122232
32112132 32332331 11131133 33133131 12313231 31111332 11213231 13122231
32112131 32121232 32221232 31321133 33233131 31111331 11312232 22113132
32132132 32121231 32221231 31222232 33332132 31131332 11322333 22113131
32132131 13313133 22313232 31222231 33332131 13211232 11312231 22133132
21321312 32212132 22323333 12123133 12333232 31131331 11233232 22133131
33112332 32212131 22313231 32111132 12333231 13221333 11233231 23113332
21321311 13333133 22333232 13113232 32311332 13211231 11332232 23113331
33112331 32232132 22333231 13123333 32311331 13231232 11332231 23133332
11223233 32232131 31122232 32111131 32331332 22212332 31211332 23133331
33132332 33212332 31122231 13113231 32331331 13231231 31211331 12212332
11322233 33212331 11321312 32131132 12223133 22212331 31231332 21311232
33132331 22123133 11321311 13133232 12322133 11122133 31231331 12212331
31211232 33232332 22223133 32131131 31113332 22232332 12112332 21321333
31221333 33232331 22322133 13133231 31113331 22232331 31323232 21311231
31211231 23113232 23213232 33111332 31133332 33321232 12112331 12232332
21313333 23123333 23223333 33111331 32211132 33321231 11222133 21331232
31231232 23113231 23213231 33131332 13213232 23323133 31323231 12232331
31231231 23133232 23312232 11321233 31133331 31213332 12132332 21331231
21221112 23133231 23322333 33131331 13223333 31213331 12132331 23112132
21333333 11121112 23312231 13122133 32211131 31312332 32123332 23112131
21221111 12311133 23233232 12111232 13213231 31312331 32123331 23132132
12112232 11121111 11313333 12121333 13312232 31733332 21121133 23132131
12122333 12212232 23Ϊ33231 12111231 13322333 31233331 32122132 32223332 12112231 12222333 23332232 1213-5232 13312231 31332332 32122131 23111332 12132232 12212231 23332231 12131231 32231132 31332331 33122332 32223331 12132231 21321233 11221112 32313332 13233232 31121232 33122331 32322332 21213133 12331133 11333333 32313331 32231131 31121231 31221232 22111331 21312133 12232232 11221111 21311133 13233231 22321133 31221231 21221133 13323112 12232231 23222133 21212332 13332232 22222232 21313232 32322331 13323111 13311333 11213133 21222333 13332231 31212132 21323333 22131332 21233133 23122133 11312133 32333332 33211332 22222231 21313231 22131331 21332133 13331333 11233133 21212231 33211331 31212131 21333232 13323133 32123232 11113133 11332133 32333331 33231332 31232132 21333231 32222132 32123231 11133133 22211332 21331133 33231331 31232131 12122232 32222131 13111133 32223232 22221333 21232232 22122232 23311232 12122231 33311132 13131133 22111232 22211231 21232231 31112132 23321333 22113332 33311131 12321112 22121333 22231232 32213132 22122231 23311231 22113331 33222332 12321111 32223231 22231231 32213131 31112131 23331232 21223133 33222331 33122232 32322232 31323133 32312132 31132132 23331231 21322133 33331132 33122231 22111231 21112232 32312131 33323232 21123133 22133332 33331131 21211333 32322231 21122333 32233132 31132131 23221133 22133331 23123232 13321312 22131232 21112231 32233131 13222133 11311133 13121133 23123231 13321311 22131231 21132232 32332132 33323231 11212232 22112132 12321133 21231333 13211133 21132231 32332131 12211232 11222333 22112131 12222232 11123112 13231133 32113132 33213332 12221333 11212231 22132132 12222231 12313133 11323312 32113131 33213331 1221)231 11331133 22132131 13311232 11123111 11323311 11211333 33312332 12231232 11232232 33313132 13321333 21323233 33321133 32133132 33312331 12231231 11232231 33313131 13311231 12333133 33222232 32133131 33233332 23121133 31223232 23112332 22213332 13313333 33222231 11231333 33233331 11112232 21111232 23112331 13331232 32212332 11111333 33113332 33332332 11122333 21121333 33333132 22213331 32212331 11131333 33113331 33332331 11112231 31223231 33333131 22312332 13221112 11223112 33133332 33121232 11132232 31322232 23132332 13331231 13333333 11223111 11323233 33121231 32321232 21111231 23132331 22312331 13221111 11322112 33133331 33212132 11132231 31322231 21211232 11123133 32232332 11322111 31311232 33212131 32321231 21131232 21221333 22233332 32232331 13321233 31321333 12213232 31123232 21131231 21211231 22233331 22113232 22213232 31311231 12223333 31123231 32122332 21231232 22332332 22123333 22223333 31331232 12213231 22323133 32122331 21231231 22332331 22113231 22213231 31331231 12312232 33221232 13123133 12323133 22121232 22133232 22312232 21321112 12322333 33221231 33111132 32311132 31111132 ?2133231 22322333 33112132 33232132 23313232 33111131 13313232 22121231 13213133 22312231 21321111 12312231 23323333 33131132 13323333 31111131 13312133 22233232 33112131 33232131 23313231 33131131 32311131 31131132 13233133 22233231 12113232 12233232 23333232 21213232 133^3231 31131131 13332133 22332232 12123333 12233231 23333231 21223333 32222332 13221133 11121312 22332231 12113231 12332232 11321112 21213231 32222331 22212132
12311333 31121133 33132132 12332231 11321111 21312232 32331132 22212131
11121311 11221312 33132131 32211332 23223133 21322333 13333232 22232132
22122133 11221311 12133232 32211331 23322133 21312231 32331131 22232131
1£331333 22222133 12133231 23123133 11313133 21233232 13333231 23212332
33323133 23311133 32111332 32231332 11333133 21233231 33311332 23212331
23112232 23212232 32111331 32231331 22311232 21332232 33311331 23232332
33122333 23222333 31221133 32323232 22321333 21332231 33331332 23232331
23112231 23212231 32131332 12222133 22311231 12121133 22123232 11111232
11113333 23331133 21313133 32323231 31212332 13111232 33331331 11121333
23132232 11213333 32131331 31112332 31212331 13121333 31113132 11111231
23132231 23232232 21333133 31112331 22331232 13111231 22123231 11131232
11133333 11312333 12122133 13311133 22331231 32313132 31113131 11131231
12211133 23232231 13112232 31132332 31232332 32313131 31133132 31313332
21??1233 11233333 13122333 13212232 31232331 13131232 31133131 31313331
12231133 11332333 13112231 31132331 21113232 22112332 13223133 31333332
13211333 11121233 13132232 13222333 21123333 13131231 13322133 31333331
22131131 22331331 13111331 33323132 33321132 22121132 11311132 11321132
33223332 21113332 13131332 33323131 33321131 22121131 11311131 11321131
23111332 21113331 13131331 23122332 11111332 23121332 11222332 11323132
33223331 21133332 21212132 23122331 11111331 23121331 11222331 11323131
33322332 22211132 21212131 11113332 11131332 11111132 11331132 11321332
23111331 21133331 21232132 11113331 11131331 11111131 11331131 11321331
33322331 22211131 21232131 11133332 13321232 11131132 21121332 11221132
23131332 22231132 12313332 12211132 13321231 11131131 21121331 11221131
23131331 22231131 12313331 11133331 22223332 22323332 13123132 21321132
33222132 23211332 12333332 12211131 22223331 22323331 13123131 21321131
33222131 23211331 12333331 21221232 22322332 22223132 21223332 13321132
12223232 23231332 33121132 21221231 22322331 22223131 21223331 13321131
12223231 23231331 33121131 12231132 31121132 22322132 21322332 11121132
12322232 21112132 12213132 12231131 31121131 22322131 21352331 11121131
12322231 21112131 12213131 13211332 22222132 23223332 12121132 11323332
32221332 21132132 12312132 13211331 22222131 23223331 12121131 11323331
32221331 23323232 12312131 13231332 23311132 23322332 13121332 11223132
22313332 21132131 21223232 13231331 23311131 23322331 13121331 11223131
22313331 23323231 21223231 11112132 23222332 11313332 21222132 11322132
22333332 11323133 21322232 11112131 23222331 11313331 21222131 11322131
22333331 22321232 12233132 11132132 23331132 11333332 12323332 11221332
31122332 31311132 21322231 32321132 11213332 11333331 12323331 11221331
31122331 22321231 12233131 13323232 23331131 23222132 12223132 21323132
13321133 31311131 12332132 11132131 11213331 23222131 12223131 21323131
13222232 31222332 12332131 32321131 11312332 11213132 12322132 21321332
13222231 31222331 13213332 13323231 11312331 11213131 12322131 21321331 22213132 31331132 13213331 33321332 11233332 11312132 13223332 21221132
22213131 31331131 13312332 33321331 11233331 11312131 13223331 21221131
22312132 12113132 13312331 31123132 11332332 1)233132 13322332 13323132
22312131 12113131 13233332 31123131 11332331 11233131 13322331 13323131
22233132 21123232 13233331 33221132 11121232 11332132 13222132 12321132
22233131 21123231 13332332 33221131 11121231 11332131 13222131 12321131
22332132 12133132 13332331 23313132 31323332 22221332 12221332 13321332
22332131 12133131 13121232 12321232 11212132 22221331 12221331 13321331
23213332 13113332 13121231 23313131 31323331 31323132 23121132 11123132
23213331 13113331 32323132 12321231 11212131 31323131 23121131 11123131
23312332 13133332 32323131 23333132 11232132 21122332 11122332 13221132
23312331 13133331 22122332 23333131 11232131 21122331 11122331 13221131
23233332 23221232 22122331 11123232 31223132 11211332 22323132 11121332
23233331 23221231 33323332 11123231 21111132 11211331 22323131 11121331
23332332 11311232 13212132 31121332 31223131 11231332 23323332 23321132
23332331 11321333 33323331 31121331 31322132 11231331 23323331 23321131
23121232 11311231 13212131 13221232 21111131 11323232 23223132 11223332
23121231 11331232 13232132 13221231 31322131 11323231 23223131 11223331
23212132 11331231 13232131 22311132 21131132 31321332 23322132 11322332
23212131 13112132 12211332 22311131 21131131 31321331 23322131 11322331
23232132 13112131 12211331 22222332 11223232 12123332 11313132 11222132
23232131 13132132 12231332 22222331 11223231 12123331 11313131 11222131
22211332 13132131 12231331 22331132 11322232 31221132 11333132 21121132
22211331 12111332 33223132 22331131 11322231 31221131 11333131 21121131
11121133 12111331 23111132 23311332 31221332 21313132 22321332 21323332
22231332 11221133 33223131 23311331 31221331 21313131 22321331 21323331
22231331 12131332 33322132 33331332 21313332 21333132 21123332 21223132
22323232 12131331 23111131 23331331 21313331 21333131 21123331 21223131
31313132 33123132 33322131 21113132 21333332 12122132 22221132 21322132
22323231 33123131 12323232 21113131 21333331 12122131 22221131 21322131
31313131 21212332 12323231 21133132 12122332 13122332 23221332 13121132
21112332 21212331 23131132 21133131 12122331 13122331 23221331 13121131
21112331 21232332 23131131 23211132 21213132 11221232 11311332 21221332
31333132 21232331 11112332 23211131 21213131 11221231 11311331 21221331
31333131 32121132 11112331 23231132 21312132 21311332 21122132 12323132
21132332 13123232 11132332 23231131 21312131 21311331 21122131 12323131
21132331 32121131 32321332 11212332 21233132 21331332 11331332 13323332
23223232 13123231 11132331 11212331 21233131 21331331 11331331 13323331
232Ξ3231 33121332 32321331 11232332 21332132 21211132 11211132 13223132
23322232 33121331 31123332 11232331 21332131 21211131 11211131 13223131
23322231 12213332 31123331 31223332 13111^32 21231132 11231132 13322132
11313232 12213331 32221132 21111332 13111131 21231131 11231131 13322131
11323333 12312332 13223232 31223331 13131132 13313132 31321132 12321332 11313231 12312331 32221131 31322332 13131131 13313131 31321131 12321331
11333232 12233332 13223231 21111331 21211332 13333132 12123132 11123332
11333231 12233331 13322232 31322331 21211331 13333131 12123131 11123331
31311332 12332332 13322231 21131332 21231332 22123132 13123332 12221132
31311331 12332331 22313132 21131331 21231331 22123131 13123331 12221131
31331332 23113132 22313131 31222132 12313133 231J3332 11321232 13221332
31331331 12121232 22333132 31222131 12313131 23123331 11321231 13221331
12113332 23113131 33221332 23321232 21323232 12311132 13122132 11122132
12113331 12121231 22333131 23321231 21323231 12311131 13122131 11122131
11223133 23133132 33221331 13113132 12333132 12222332 12121332 23323132
11322133 23133131 23313332 13113131 12333131 21321232 12121331 23323131
12133332 32323332 23313331 13133132 13313332 12222331 21311132 22321132
12133331 12212132 31122132 13133131 13313331 21321231 21311131 22321131
22221232 32323331 23333332 11321133 13333332 12331132 21222332 23321332
31211132 12212131 31122131 11222232 13333331 12331131 21222331 23321331
22221231 21321133 23333331 11222231 22123332 13311332 21331132 21123132
31211131 21222232 23213132 21213332 22123331 13311331 21331131 21123131
31231132 21222231 12221232 21213331 13213132 23122132 12223332 23221132
31231131 12232132 23213131 21312332 13213131 23122131 12223331 23221131
12112132 12232131 23312132 21312331 13312132 13331332 12322332
12112131 13212332 12221231 21233332 13312131 13331331 12322331
21122232 13212331 23312131 21233331 13233132 11113132 23123132
21122231 13232332 23233132 21332332 13233131 11113131 23123131
12132132 13232331 23233131 12111132 13332132 11133132 12222132
12132131 32223132 23332132 21332331 13332131 11133131 12222131
13112332 22111132 23332131 12111131 12311332 22121332 13311132
13112331 32223131 22311332 21121232 12311331 22121331 13311131
13132332 32322132 22311331 21121231 22122132 13211132 13222332
13132331 22111131 11122232 12131132 22122131 13211131 13222331
32123132 32322131 22331332 12131131 12331332 13231132 13331132
11211232 22131132 11122231 13111332 12331331 13231131 13331131
Referring to the table above, each digit refers to a domain of a chimeric CBH II polypeptide. The number denotes the parental strand of the domain. For example, a chimeric CBH II chimeric polypeptide having the sequence 12111131, indicates that the polypeptide comprises a sequence from the N-terminus to the C-terminus of: amino acids from about 1 to Xi of SEQ ID NO: 2 ("1") linked to amino acids from about xi to x2 of SEQ ID NO: 4 ("2") linked to amino acids from about x2 to about x3 of SEQ ID NO: 2 linked to amino acids from about X3 to about x4 of SEQ ID NO: 2 linked to amino acids from about X4 to about X5 of SEQ ID NO: 2 linked to amino acids from about x5 to about X6 of SEQ ID NO : 2 linked to amino acids from about x6 to x7 of SEQ ID NO : 6 ("3") linked to amino acids from about x7 to x8 (e.g., the C-terminus) of SEQ ID NO : 2.
[0058] In some embodiments, the CBH II polypeptide has a chimeric segment structure selected from the group consisting of:
11113132, 21333331, 21311131, 22232132, 33133132, 33213332,
13333232, 12133333, 13231111, 11313121, 11332333, 12213111,
23311333, 13111313, 31311112, 23231222, 33123313, 22212231,
21223122, 21131311, 23233133, 31212111 and 32333113.
[0059] In some embodiments, the polypeptide has improved thermostability compared to a wild-type polypeptide of SEQ ID NO: 2,
4, or 6. The activity of the polypeptide can be measured with any one or combination of substrates as described in the examples. As will be apparent to the skilled artisan, other compounds within the class of compounds exemplified by those discussed in the examples can be tested and used.
[0060] In some embodiments, the polypeptide can comprise various changes to the amino acid sequence with respect to a reference sequence. The changes can be a substitution, deletion, or insertion of one or more amino acids. Where the change is a substitution, the change can be a conservative or a non-conservative substitution.
Accordingly a chimera may comprise a combination of conservative and non-conservative substitutions.
[0061] Thus, in some embodiments, the polypeptides can comprise a general structure from N-terminus to C-terminus:
(segment I)- (segment 2) -(segment 3) -(segment 4) -(segment 5) -(segment
6) -(segment 7) -(segment 8), wherein segment 1 comprises amino acid residue from about 1 to about Xi of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having 1-10 conservative amino acid substitutions; segment 2 is from about amino acid residue Xi to about x2 of SEQ ID NO: 2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 3 is from about amino acid residue x2 to about x3 of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 4 is from about amino acid residue x3 to about X4 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 5 is from about amino acid residue x4 to about x5 of SEQ ID N0:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 6 is from about amino acid residue x5 to about x6 of SEQ ID NO: 2 ("1"), SEQ ID NO : 4
("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 7 is from about amino acid residue x6 to about X7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3") and having about 1-10 conservative amino acid substitutions; and segment 8 is from about amino acid residue x7 to about x8 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; wherein X1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO:2, or residue 42, 43, 44, 45, or 46 of SEQ ID NO : 4 or SEQ ID NO: 6; X2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO : 4 or SEQ ID NO: 6; X3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO : 2 , or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X4 is residue 153, 154, 155, 156, or 157 of SEQ ID NO:2, or residue 149, 150, 151, 152, 153, 154, 155 or 156 of SEQ ID NO : 4 or SEQ ID NO: 6; X5 is residue 220, 221, 222, 223, or 224 of SEQ ID NO:2, or residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO : 4 or SEQ ID NO : 6 ; x6 is residue 256, 257, 258, 259, 260 or 261 of SEQ ID NO:2, or residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO : 4 or SEQ ID NO: 6; X7 is residue 312, 313, 314, 315 or 316 of SEQ ID NO:2, or residue 309, 310, 311, 312, 313, 314, 315 or 318 of SEQ ID NO : 4 or SEQ ID NO: 6; and x8 is an amino acid residue corresponding to the C-terminus of the polypeptide have the sequence of SEQ ID NO: 2, SEQ ID NO : 4 or SEQ ID NO : 6 and wherein the chimera has an algorithm as set forth in Table 1.
[0062] In some embodiments, the number of substitutions can be 2, 3, 4, 5, 6, 8, 9, or 10, or more amino acid substitutions (e.g., 10-20, 21-30, 31-40 and the like amino acid substitutions) .
[0063] In some embodiments, the functional chimera polypeptides can have cellobiohydrolase activity along with increased thermostability, such as for a defined substrate discussed in the Examples, and also have a level of amino acid sequence identity to a reference cellobiohydrolase, or segments thereof. The reference enzyme or segment, can be that of a wild-type (e.g., naturally occurring) or an engineered enzyme. Thus, in some embodiments, the polypeptides of the disclosure can comprise a general structure from N-terminus to C-terminus: wherein segment 1 comprises a sequence that is at least 50- 100% identity to amino acid residue from about 1 to about xi of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 2 comprises a sequence that is at least 50-100% identity to amino acid residue xi to about x2 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 3 comprises a sequence that is at least 50- 100% identity to amino acid residue x2 to about x3 of SEQ ID NO : 2
("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 4 comprises a sequence that is at least 50-100% identity to amino acid residue X3 to about X4 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); segment 5 comprises a sequence that is at least 50-100% identity to about amino acid residue x4 to about x5 of SEQ ID NO: 2
("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 6 comprises a sequence that is at least 50-100% identity to amino acid residue x5 to about X6 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); segment 7 comprises a sequence that is at least 50-100% identity to amino acid residue x6 to about x7 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3"); and segment 8 comprises a sequence that is at least 50-100% identity to amino acid residue x7 to about X8 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3") ; wherein X1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO:2, or residue 42, 43, 44, 45, or 46 of SEQ ID NO : 4 or SEQ ID NO: 6; X2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO : 4 or SEQ ID NO: 6; X3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO : 2 , or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X4 is residue 153, 154, 155, 156, or 157 of SEQ ID NO:2, or residue 149, 150, 151, 152, 153, 154, 155 or 156 of SEQ ID NO : 4 or SEQ ID NO: 6; X5 is residue 220, 221, 222, 223, or 224 of SEQ ID NO:2, or residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO : 4 or SEQ ID NO : 6 ; x6 is residue 256, 257, 258, 259, 260 or 261 of SEQ ID NO:2, or residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO : 4 or SEQ ID NO: 6; X7 is residue 312, 313, 314, 315 or 316 of SEQ ID NO:2, or residue 309, 310, 311, 312, 313, 314, 315 or 318 of SEQ ID NO : 4 or SEQ ID NO: 6; and x8 is an amino acid residue corresponding to the C-terminus of the polypeptide have the sequence of SEQ ID NO: 2, SEQ ID NO : 4 or SEQ ID NO : 6 and wherein the chimera has an algorithm as set forth in Table 1.
[0064] In some embodiments, each segment of the chimeric polypeptide can have at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% or more sequence identity as compared to the reference segment indicated for each of the (segment 1), (segment 2), (segment 3), (segment 4) -(segment 5), (segment 6), (segment 7), and (segment 8) of SEQ ID NO:2, SEQ ID NO : 4 , or SEQ ID NO : 6.
[0065] In some embodiments, the polypeptide variants can have improved thermostability compared to the enzyme activity of the wild-type polypeptide of SEQ ID NO: 2, 4, or 6.
[0066] The chimeric enzymes described herein may be prepared in various forms, such as lysates, crude extracts, or isolated preparations. The polypeptides can be dissolved in suitable solutions; formulated as powders, such as an acetone powder (with or without stabilizers); or be prepared as lyophilizates . In some embodiments, the polypeptide can be an isolated polypeptide. [0067] In some embodiments, the polypeptides can be in the form of arrays. The enzymes may be in a soluble form, for example, as solutions in the wells of mircotitre plates, or immobilized onto a substrate. The substrate can be a solid substrate or a porous substrate (e.g, membrane), which can be composed of organic polymers such as polystyrene, polyethylene, polypropylene, polyfluoroethylene, polyethyleneoxy, and polyacrylamide, as well as co-polymers and grafts thereof. A solid support can also be inorganic, such as glass, silica, controlled pore glass (CPG) , reverse phase silica or metal, such as gold or platinum. The configuration of a substrate can be in the form of beads, spheres, particles, granules, a gel, a membrane or a surface. Surfaces can be planar, substantially planar, or non-planar. Solid supports can be porous or non-porous, and can have swelling or non-swelling characteristics. A solid support can be configured in the form of a well, depression, or other container, vessel, feature, or location. A plurality of supports can be configured on an array at various locations, addressable for robotic delivery of reagents, or by detection methods and/or instruments.
[0068] The disclosure also provides polynucleotides encoding the engineered CBH II polypeptides disclosed herein. The polynucleotides may be operatively linked to one or more heterologous regulatory or control sequences that control gene expression to create a recombinant polynucleotide capable of expressing the polypeptide. Expression constructs containing a heterologous polynucleotide encoding the CBH II chimera can be introduced into appropriate host cells to express the polypeptide. [0069] Given the knowledge of specific sequences of the CBH II chimera enzymes (e.g., the segment structure of the chimeric CBH II) , the polynucleotide sequences will be apparent form the amino acid sequence of the engineered CBH II chimera enzymes to one of skill in the art and with reference to the polypeptide sequences and nucleic acid sequence described herein. The knowledge of the codons corresponding to various amino acids coupled with the knowledge of the amino acid sequence of the polypeptides allows those skilled in the art to make different polynucleotides encoding the polypeptides of the disclosure. Thus, the disclosure contemplates each and every possible variation of the polynucleotides that could be made by selecting combinations based on possible codon choices, and all such variations are to be considered specifically disclosed for any of the polypeptides described herein.
[0070] In some embodiments, the polynucleotides encode the polypeptides described herein but have about 80% or more sequence identity, about 85% or more sequence identity, about 90% or more sequence identity, about 91% or more sequence identity, about 92% or more sequence identity, about 93% or more sequence identity, about 94% or more sequence identity, about 95% or more sequence identity, about 96% or more sequence identity, about 97% or more sequence identity, about 98% or more sequence identity, or about 99% or more sequence identity at the nucleotide level to a reference polynucleotide encoding the CBH II chimera polypeptides. [0071] In some embodiments, the isolated polynucleotides encoding the polypeptides may be manipulated in a variety of ways to provide for expression of the polypeptide. Manipulation of the isolated polynucleotide prior to its insertion into a vector may be desirable or necessary depending on the expression vector. The techniques for modifying polynucleotides and nucleic acid sequences utilizing recombinant DNA methods are well known in the art. Guidance is provided in Sambrook et al . , 2001, Molecular Cloning: A Laboratory Manual, 3rd Ed., Cold Spring Harbor Laboratory Press; and Current Protocols in Molecular Biology, Ausubel. F. ed., Greene Pub. Associates, 1998, updates to 2007.
[0072] In some embodiments, the polynucleotides are operatively linked to control sequences for the expression of the polynucleotides and/or polypeptides. In some embodiments, the control sequence may be an appropriate promoter sequence, which can be obtained from genes encoding extracellular or intracellular polypeptides, either homologous or heterologous to the host cell. For bacterial host cells, suitable promoters for directing transcription of the nucleic acid constructs of the present disclosure, include the promoters obtained from the E. coli lac operon, Bacillus subtilis xylA and xylB genes, Bacillus megatarium xylose utilization genes (e.g.,Rygus et al., (1991) Appl . Microbiol. Biotechnol. 35:594-599; Meinhardt et al., (1989) Appl. Microbiol. Biotechnol. 30:343-350), prokaryotic beta-lactamase gene (Villa- Kamaroff et al . , (1978) Proc . Natl Acad. Sci . USA 75: 3727-3731), as well as the tac promoter (DeBoer et al . , (1983) Proc. Natl Acad. Sci. USA 80: 21-25) . Various suitable promoters are described in "Useful proteins from recombinant bacteria" in Scientific American, 1980, 242:74-94; and in Sambrook et al . , supra.
[0073] In some embodiments, the control sequence may also be a suitable transcription terminator sequence, a sequence recognized by a host cell to terminate transcription. The terminator sequence is operably linked to the 3' terminus of the nucleic acid sequence encoding the polypeptide. Any terminator which is functional in the host cell of choice may be used.
[0074] In some embodiments, the control sequence may also be a suitable leader sequence, a nontranslated region of an mRNA that is important for translation by the host cell. The leader sequence is operably linked to the 5' terminus of the nucleic acid sequence encoding the polypeptide. Any leader sequence that is functional in the host cell of choice may be used.
[0075] In some embodiments, the control sequence may also be a signal peptide coding region that codes for an amino acid sequence linked to the amino terminus of a polypeptide and directs the encoded polypeptide into the cell's secretory pathway. The 5' end of the coding sequence of the nucleic acid sequence may inherently contain a signal peptide coding region naturally linked in translation reading frame with the segment of the coding region that encodes the secreted polypeptide. Alternatively, the 5' end of the coding sequence may contain a signal peptide coding region that is foreign to the coding sequence. The foreign signal peptide coding region may be required where the coding sequence does not naturally contain a signal peptide coding region. Effective signal peptide coding regions for bacterial host cells can be the signal peptide coding regions obtained from the genes for Bacillus NClB 11837 maltogenic amylase, Bacillus stearothermophilus alpha-amylase, Bacillus licheniformis subtilism, Bacillus licheniformis beta- lactamase, Bacillus stearothermophilus neutral proteases (nprT, nprS, nprM) , and Bacillus subtilis prsA. Further signal peptides are described by Simonen and Palva, (1993) Microbiol Rev 57: 109- 137.
[0076] The disclosure is further directed to a recombinant expression vector comprising a polynucleotide encoding the engineered CBH II chimera polypeptides, and one or more expression regulating regions such as a promoter and a terminator, a replication origin, etc., depending on the type of hosts into which they are to be introduced. In creating the expression vector, the coding sequence is located in the vector so that the coding sequence is operably linked with the appropriate control sequences for expression .
[0077] The recombinant expression vector may be any vector (e.g., a plasmid or virus), which can be conveniently subjected to recombinant DNA procedures and can bring about the expression of the polynucleotide sequence. The choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced. The vectors may be linear or closed circular plasmids .
[0078] The expression vector may be an autonomously replicating vector, i.e., a vector that exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome. The vector may contain any means for assuring self-replication. Alternatively, the vector may be one which, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome (s) into which it has been integrated. Furthermore, a single vector or plasmid or two or more vectors or plasmids which together contain the total DNA to be introduced into the genome of the host cell, or a transposon, may be used.
[0079] In some embodiments, the expression vector of the disclosure contains one or more selectable markers, which permit easy selection of transformed cells. A selectable marker is a gene the product of which provides for biocide or viral resistance, resistance to heavy metals, prototrophy to auxotrophs, and the like. Examples of bacterial selectable markers are the dal genes from Bacillus subtilis or Bacillus licheniformis, or markers, which confer antibiotic resistance such as ampicillin, kanamycin, chloramphenicol or tetracycline resistance. Other useful markers will be apparent to the skilled artisan.
[0080] In another embodiment, the disclosure provides a host cell comprising a polynucleotide encoding the CBH II chimera polypeptide, the polynucleotide being operatively linked to one or more control sequences for expression of the polypeptide in the host cell. Host cells for use in expressing the polypeptides encoded by the expression vectors of the disclosure are well known in the art and include, but are not limited to, bacterial cells, such as E. coli and Bacillus megateπum; eukaryotic cells, such as yeast cells, CHO cells and the like, insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, BHK, 293, and Bowes melanoma cells; and plant cells. Other suitable host cells will be apparent to the skilled artisan. Appropriate culture mediums and growth conditions for the above-described host cells are well known in the art.
[0081] The CBH II chimera polypeptides of the disclosure can be made by using methods well known in the art. Polynucleotides can be synthesized by recombinant techniques, such as that provided in Sambrook et al . , 2001, Molecular Cloning: A Laboratory Manual, 3rd Ed., Cold Spring Harbor Laboratory Press; and Current Protocols in Molecular Biology, Ausubel. F. ed., Greene Pub. Associates, 1998, updates to 2007. Polynucleotides encoding the enzymes, or the primers for amplification can also be prepared by standard solid- phase methods, according to known synthetic methods, for example using phosphoramidite method described by Beaucage et al . , (1981) Tet Lett 22:1859-69, or the method described by Matthes et al . , (1984) EMBO J. 3:801-05, e.g., as it is typically practiced in automated synthetic methods. In addition, essentially any nucleic acid can be obtained from any of a variety of commercial sources, such as The Midland Certified Reagent Company, Midland, TX, The Great American Gene Company, Ramona, CA, ExpressGen Inc. Chicago, IL, Operon Technologies Inc., Alameda, CA, and many others. [0082] Engineered enzymes expressed in a host cell can be recovered from the cells and or the culture medium using any one or more of the well known techniques for protein purification, including, among others, lysozyme treatment, sonication, filtration, salting-out, ultra-centrifugation, chromatography, and affinity separation (e.g., substrate bound antibodies) . Suitable solutions for lysing and the high efficiency extraction of proteins from bacteria, such as E. coli, are commercially available under the trade name CelLytic BTM from Sigma-Aldrich of St. Louis MO. [0083] Chromatographic techniques for isolation of the polypeptides include, among others, reverse phase chromatography high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, and affinity chromatography. Conditions for purifying a particular enzyme will depend, in part, on factors such as net charge, hydrophobicity, hydrophilicity, molecular weight, molecular shape, etc., and will be apparent to those having skill in the art. [0084] Descriptions of SCHEMA directed recombination and synthesis of chimeric polypeptides are described in the examples herein, as well as in Otey et al . , (2006), PLoS Biol. 4(5) :ell2; Meyer et al . , (2003) Protein Sci . , 12:1686-1693; U.S. Patent Application No. 12/024,515, filed February 1, 2008; and U.S. Patent Application No. 12/027,885, filed February 7, 2008; such references incorporated herein by reference in their entirety. [0085] As discussed above, the polypeptide can be used in a variety of applications, such as, among others, biofuel generation, cellulose breakdown and the like.
[0086] For example, in one embodiment, a method for processing cellulose is provided. The method includes culturing a recombinant microorganism as provided herein that expresses a chimeric polypeptide of the disclosure in the presence of a suitable cellulose substrate and under conditions suitable for the catalysis by the chimeric polypeptide of the cellulose.
[0087] In yet another embodiment, a substantially purified chimeric polypeptide of the disclosure is contacted with a cellulose substrate under conditions that allow for the chimeric polypeptide degrade the cellulose. In one embodiment, the conditions include temperatures from about 35-65 °C.
[0088] As previously discussed, general texts which describe molecular biological techniques useful herein, including the use of vectors, promoters and many other relevant topics, include Berger and Kimmel, Guide to Molecular Cloning Techniques, Methods in Enzymology Volume 152, (Academic Press, Inc., San Diego, Calif.) ("Berger"); Sambrook et al . , Molecular Cloning--A Laboratory Manual, 2d ed., Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, N. Y., 1989 ("Sambrook") and Current Protocols in Molecular Biology, F. M. Ausubel et al., eds . , Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (supplemented through 1999) ("Ausubel") . Examples of protocols sufficient to direct persons of skill through in vitro amplification methods, including the polymerase chain reaction (PCR) , the ligase chain reaction (LCR) , Q -replicase amplification and other RNA polymerase mediated techniques (e.g., NASBA), e.g., for the production of the homologous nucleic acids of the disclosure are found in Berger, Sambrook, and Ausubel, as well as in Mullis et al.
(1987) U.S. Pat. No. 4,683,202; Innis et al., eds . (1990) PCR Protocols: A Guide to Methods and Applications (Academic Press Inc. San Diego, Calif.) ("Innis"); Arnheim & Levinson (Oct. 1, 1990) C&EN 36-47; The Journal Of NIH Research (1991) 3: 81-94; Kwoh et al.
(1989) Proc. Natl. Acad. Sci . USA 86: 1173; Guatelli et al. (1990) Proc. Nat'l. Acad. Sci. USA 87: 1874; Lomell et al. (1989) J. Clin. Chem 35: 1826; Landegren et al. (1988) Science 241: 1077-1080; Van Brunt (1990) Biotechnology 8: 291-294; Wu and Wallace (1989) Gene 4:560; Barringer et al. (1990) Gene 89:117; and Sooknanan and Malek
(1995) Biotechnology 13: 563-564. Improved methods for cloning in vitro amplified nucleic acids are described in Wallace et al . , U.S. Pat. No. 5,426,039. Improved methods for amplifying large nucleic acids by PCR are summarized in Cheng et al. (1994) Nature 369: 684- 685 and the references cited therein, in which PCR amplicons of up to 40 kb are generated. One of skill will appreciate that essentially any RNA can be converted into a double stranded DNA suitable for restriction digestion, PCR expansion and sequencing using reverse transcriptase and a polymerase. See, e.g., Ausubel, Sambrook and Berger, all supra.
[0089] Appropriate culture conditions are conditions of culture medium pH, ionic strength, nutritive content, etc.; temperature; oxygen/C02/nitrogen content; humidity; and other culture conditions that permit production of the compound by the host microorganism, i.e., by the metabolic action of the microorganism. Appropriate culture conditions are well known for microorganisms that can serve as host cells.
[0090] The following examples are meant to further explain, but not limited the foregoing disclosure or the appended claims.
EXAMPLES
[0091] CBH II expression plasmid construction. Parent and chimeric genes encoding CBH II enzymes were cloned into yeast expression vector YEp352/PGK91-l-αss (Figure 6) . DNA sequences encoding parent and chimeric CBH II catalytic domains were designed with S. cerevisiae codon bias using GeneDesigner software (DNA2.0) and synthesized by DNA2.0. The CBH II catalytic domain genes were digested with Xhol and Kpnl, ligated into the vector between the Xhol and Kpnl sites and transformed into E. coli XL-I Blue (Stratagene) . CBH II genes were sequenced using primers: CBH2L (5' - GCTGAACGTGTCATCGGTTAC-3' (SEQ ID NO: 9) and RSQ3080 (5'- GCAACACCTGGCAATTCCTTACC-3' (SEQ ID NO:10)) . Oterminal His6 parent and chimera CBH II constructs were made by amplifying the CBH II gene with forward primer CBH2LPCR {5'' -GCTGAACGTGTCATCGTTACTTAG-3' (SEQ ID NO: H)) and reverse primers complementary to the appropriate CBH II gene with His6 overhangs and stop codons . PCR products were ligated, transformed and sequenced as above.
[0092] CBH II enzyme expression in S. cerev±s±ae. S. cerevisiae strain YDR483W BY4742 {Matα his3Δl leu2Δ0 lys2Δ0 ura3Δ0 ΔKRE2, ATCC No. 4014317) was made competent using the EZ Yeast II Transformation Kit (Zymo Research) , transformed with plasmid DNA and plated on synthetic dropout -uracil agar. Colonies were picked into 5 mL overnight cultures of synthetic dextrose casamino acids (SDCAA) media (20 g/L dextrose, 6.7 g/L Difco yeast nitrogen base, 5 g/L Bacto casamino acids, 5.4 g/L Na2HPO4, 8.56 g/L NaH2PO4-H2O) supplemented with 20 ug/mL tryptophan and grown overnight at 30°C, 250 rpm. 5 mL cultures were expanded into 40 mL SDCAA in 250 mL Tunair flasks (Shelton Scientific) and shaken at 30°C, 250 rpm for 48 hours. Cultures were centrifuged, and supernatants were concentrated to 500 uL, using an Amicon ultrafiltration cell fitted with 30-kDa PES membrane, for use in ti/2 assays. Concentrated supernatants were brought tol mM phenylmethylsulfonylfluoride and 0.02% NaN3. His6-tagged CBH II proteins were purified using Ni-NTA spin columns (Qiagen) per the manufacturer's protocol and the proteins exchanged into 50 mM sodium acetate, pH 4.8, using Zeba- Spin desalting columns (Pierce) . Purified protein concentration was determined using Pierce Coomassie Plus protein reagent with BSA as standard. SDS-PAGE analysis was performed by loading either 20 uL of concentrated culture supernatant or approximately 5 ug of purified CBH II enzyme onto a 7.5% Tris-HCl gel (Biorad) and staining with SimplyBlue safe stain (Invitrogen) . CBH II supernatants or purified proteins were treated with EndoH (New England Biolabs) for 1 hr at 37°C per the manufacturer's instructions. CBH II enzyme activity in concentrated yeast culture supernatants was measured by adding 37.5 uL concentrated culture supernatant to 37.5 uL PASC and incubating for 2 hr at 50 °C. Reducing sugar equivalents formed were determined via Nelson-Somogyi assay as described below.
[0093] Half-life, specific activity, pH-activity and long-time cellulose hydrolysis measurements. Phosphoric acid swollen cellulose (PASC) was prepared. To enhance CBH II enzyme activity on the substrate, PASC was pre-incubated at a concentration of 10 g/L with 10 mg/mL A. niger endoglucanase (Sigma) in 5OmM sodium acetate, pH 4.8 for 1 hr at 37°C. Endoglucanase was inactivated by heating to 95°C for 15 minutes, PASC was washed twice with 5OmM acetate buffer and resuspended at 10 g/L in deionzed water.
[0094] CBH II enzyme ti/2s were measured by adding concentrated CBH II expression culture supernatant to 50 mM sodium acetate, pH 4.8 at a concentration giving A520 of 0.5 as measured in the Nelson- Somogyi reducing sugar assay after incubation with treated PASC as described below. 37.5 uL CBH II enzyme/buffer mixtures were inactivated in a water bath at 63°C. After inactivation, 37.5 uL endoglucanase-treated PASC was added and hydrolysis was carried out for 2 hr at 50°C. Reaction supernatants were filtered through Multiscreen HTS plates (Millipore) . Nelson-Somogyi assay log (A520) values, obtained using a SpectraMax microplate reader (Molecular Devices) corrected for background absorbance, were plotted versus time and CBH II enzyme half-lives obtained from linear regression using Microsoft Excel.
[0095] For specific activity measurements, purified CBH II enzyme was added to PASC to give a final reaction volume of 75 uL 25 mM sodium acetate, pH 4.8, with 5 g/L PASC and CBH II enzyme concentration of 3 mg enzyme/g PASC. Incubation proceeded for 2 hr in a 50°C water bath and the reducing sugar concentration determined. For pH/activity profile measurements, purified CBH II enzyme was added at a concentration of 300 ug/g PASC in a 75 uL reaction volume. Reactions were buffered with 12.5 mM sodium citrate/12.5 mM sodium phosphate, run for 16 hr at 50°C and reducing sugar determined. Long-time cellulose hydrolysis measurements were performed with 300 uL volumes of 1 g/L treated PASC in 100 mM sodium acetate, pH 4.8, 20 mM NaCl. Purified CBH II enzyme was added at 100 ug/g PASC and reactions carried out in water baths for 40 hr prior to reducing sugar determination.
[0096] Five candidate parent genes encoding CBH II enzymes were synthesized with S. cerevisiae codon bias. All five contained identical N-terminal coding sequences, where residues 1-89 correspond to the cellulose binding module (CBM) , flexible linker region and the five N-terminal residues of the H. jecoπna catalytic domain. Two of the candidate CBH II enzymes, from Humicola msolens and Chaetomium thermophilum, were secreted from S. cerevisiae at much higher levels than the other three, from Hypocrea jecoπna, Phanerochaete chrysosporium and Talaromyces emersonii (Figure 1) . Because bands in the SDS-PAGE gel for the three weakly expressed candidate parents were difficult to discern, activity assays in which concentrated culture supernatants were incubated with phosphoric acid swollen cellulose (PASC) were performed to confirm the presence of active cellulase. The values for the reducing sugar formed, presented in Figure 1, confirmed the presence of active CBH II in concentrated S. cerevisiae culture supernatants for all enzymes except T. emersonii CBH II. H. msolens and C. thermophilum sequences were chose to recombine with the most industrially relevant fungal CBH II enzyme, from H. jecoπna. The respective sequence identities of the catalytic domains are 64% {1:2), 66% (2:3) and 82% (1:3) , where H. msolens is parent 1, H. jecoπna is parent 2 and C. thermophilum is parent 3. These respective catalytic domains contain 360, 358 and 359 amino acid residues. [0097] Heterologous protein expression in the filamentous fungus H. jecoπna, the organism most frequently used to produce cellulases for industrial applications, is much more arduous than in Saccharomyces cerevisiae . The observed secretion of H. jecoπna CBH II from S. cerevisiae motivated the choice of this heterologous host. To minimize hyperglycosylation, which has been reported to reduce the activity of recombinant cellulases, the recombinant CBH II genes were expressed in a glycosylation-deficient dKRE2 S. cerevisiae strain. This strain is expected to attach smaller mannose oligomers to both N-linked and O-linked glycosylation sites than wild type strains, which more closely resembles the glycosylation of natively produced H. jecoπna CBH II enzyme. SDS- PAGE gel analysis of the CBH II proteins, both with and without EndoH treatment to remove high-mannose structures, showed that EndoH treatment did not increase the electrophoretic mobility of the enzymes secreted from this strain, confirming the absence of the branched mannose moieties that wild type S. cerevisiae strains attach to glycosylation sites in the recombinant proteins. [0098] The high resolution structure of H. insolens (pdb entry locn) was used as a template for SCHEMA to identify contacts that could be broken upon recombination. RASPP returned four candidate libraries, each with <E> below 15. The candidate libraries all have lower <E> than previously constructed chimera libraries, suggesting that an acceptable fraction of folded, active chimeras could be obtained for a relatively high <m> . Chimera sequence diversity was maximized by selecting the block boundaries leading to the greatest <m> = 50. The blocks for this design are illustrated in Figure 2B and detailed in Table 2.
Table 2: ClustalW multiple sequence alignment for parent CBH Il enzyme catalytic domains. Blocks 2, 4, 6 and 8 are denoted by boxes and grey shading. Blocks 1,3,5 and 7 are not shaded. (H. inso: SEQ ID NO:2; H. Jeco: SEQ ID NO:4 and C. Then SEQ ID NO:6).
H.inso GNPFEGVQLWANNYYRSEVHTLAIPQITDPALRAAASAVAEVPSFQWLDRNVTVDTLLVQ 60 C . ther GNPFSGVQLWANTYYSSEVHTLAIPSLS-PELAAKAAKVAEVPS F^WLDRNYTTOTLgSC 59 H. jeco GNPEVGVTPWANAYYASEVSSLAIPSLT-GAMATAAAAVAKVPSPMHI1DT-LDKTPLMEC 58
**** ** *** ** *** •**** • • • • *• **•*:
H.inso TLSEIREANQAC ANPQYAAQIWYDLPDRDCAAAASNGEWAIANNGVNNYKAYI] IEIRK] 120 C . ther TLAEIRΛANQEC ANPPYAGIFWYDLPDRDCAAAASNGEWSIANNGANNYKRYII JEIREI 119 H. jeco TLADIRTAMKNC GN—YAGQFWYDLPDRDCAALASNGEYSIADGGVAKYKNYII WIRQJ 116
** • • ** ** • * * ** * ************ ***** • • ** • • ** ** • ** •
H . inso LISFSDVRTILVIEPDSIANMVTNMNVPKCSGAAi ITYRELTIYALKQLDLPHVAMYMDAG 180 C . ther LIQYSDIETILVIEPDSLJaIMVTNMlWQKCSNiSLaJ TYKELTVYALKQLNLPHVAMYMDAG 179 H . jeco WEYSDIRTLLVIEPDSLaHLVTMLGTPKCaMaiOi IAYLEC INYAVTQLNLPNVAMYLDAG 176
•**•**•**********•***•
H.inso HAGWLGWPANIQPAAELFAKIYEDAGKPRAWGLATNVANY]BWSYSSPPPYISPHPNYD 240 C . ther HAGWLGWPANIQPAAELFAQIYRDAGRPAAVRGLATNVANY] [AWSIASPPSYTSPNPNYD 239 H. jeco HAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANY] rGHMIISPPSYTQGNAYYM 236
********** • *** • *** •
H.inso EKHYIEΛFRPI.I.EftSGFJ'-AQFIVDQGRSGKQPTGQKEWGHWCNAIGTGFGMRPTANTGH 299 C . ther EKHYIEaFAPIiLENQGfI -AKFIVDTGRNGKQPTGQLEWGHWCNVKGTGFGVRPTANTGH 298 H. jeco EKLYIHAIGPIiLANHGIK NAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGD 296
H.inso QYVDAFVWVKPGGE( IDGTSDITAARYDyHCGLEDAIiKRAPEAGQWFNEYFIQIiLRHiSkNPE 359 C . ther ELVDAFVWVKPGGE: DGTSDTSJyUaDYHCGtSDJyTrPAPEAGGWI1QAYFEQLLINiMJBE 358 H. jeco SLLDSFVWVKPGGEt !DGTSDSSAgRFDSHCaLgDlJiQgAgQAGiIWgQaYgVQLLTMMIPS 356
H
Figure imgf000042_0001
. jeco [0099] The H. msolens CBH II catalytic domain has an α/β barrel structure in which the eight helices define the barrel perimeter and seven parallel β-sheets form the active site (Figure 2A) . Two extended loops form a roof over the active site, creating a tunnel through which the substrate cellulose chains pass during hydrolysis. Five of the seven block boundaries fall between elements of secondary structure, while block 4 begins and ends in the middle of consecutive α-helices (Figures 2A, 2B) . The majority of interblock sidechain contacts occur between blocks that are adjacent in the primary structure (Figure 2C) .
[00100] A sample set of 48 chimera genes was designed as three sets of 16 chimeras having five blocks from one parent and three blocks from either one or both of the remaining two parents (Table 3) ; the sequences were selected to equalize the representation of each parent at each block position. The corresponding genes were synthesized and expressed. Table 3: Sequences of sample set CBH II enzyme chimeras.
Inactive Active
13121211 11332333 12122221 21131311 33332321 31212111 33321331 22232132 21322232 33213332 21112113 23233133 31121121 13231111 32312222 12213111 23223223 31311112 31313323 11113132 32121222 13111313 12121113 21311131 22133222 11313121 33222333 21223122 11131231 22212231 11112321 23231222 12111212 32333113 31222212 12133333 22322312 13333232 12222213 33123313 12221122 21333331 22212323 23311333 23222321 33133132 32333223 33331213 [00101] Twenty-three of the 48 sample set S. cerevisiae concentrated culture supernatants exhibited hydrolytic activity toward PASC. These results suggest that thousands of the 6,561 possible CBH II chimera sequences (see e.g., Table 1) encode active enzymes. The 23 active CBH II sample set chimeras show considerable sequence diversity, differing from the closest parental sequence and each other by at least 23 and 36 amino acid substitutions and as many as 54 and 123, respectively. Their average mutation level <m> is 36.
[00102] The correlations between E, m and the probability that a chimera is folded and active was analyzed. The amount of CBH II enzyme activity in concentrated expression culture supernatants, as measured by assaying for activity on PASC, was correlated to the intensity of CBH II bands in SDS-PAGE gels (Figure 1) . As with the H. jecoπna CBH II parent, activity could be detected for some CBH II chimeras with undetectable gel bands. There were no observations of CBH II chimeras presenting gel bands but lacking activity. The probability of a CBH II chimera being secreted in active form was inversely related to both E and m (Figure 3) .
[00103] Half-lives of thermal inactivation (ti/2) were measured at 63°C for concentrated culture supernatants of the parent and active chimeric CBH II enzymes. The H. msolens, H. jecoπna and C. thermophilum CBH II parent half-lives were 95, 2 and 25 minutes, respectively. The active sample set chimeras exhibited a broad range of half-lives, from less than 1 minute to greater than 3,000. Five of the 23 active chimeras had half-lives greater than that of the most thermostable parent, H. msolens CBH II. [00104] In attempting to construct a predictive quantitative model for CBH II chimera half-life, five different linear regression data modeling algorithms were used (Table 4) . Each algorithm was used to construct a model relating the block compositions of each sample set CBH II chimera and the parents to the log(ti/2) . These models produced thermostability weight values that quantified a block's contribution to log(ti/2) . For all five modeling algorithms, this process was repeated 1,000 times, with two randomly selected sequences omitted from each calculation, so that each algorithm produced 1,000 weight values for each of the 24 blocks. The mean and standard deviation (SD) were calculated for each block's thermostability weight. The predictive accuracy of each model algorithm was assessed by measuring how well each model predicted the ti/2s of the two omitted sequences. The correlation between measured and predicted values for the 1,000 algorithm iterations is the model algorithm's cross-validation score. For all five models, the cross-validation scores (X-val) were less than or equal to 0.57 (Table 4), indicating that linear regression modeling could not be applied to this small, 23 chimera ti/2 data set for quantitative CBH II chimera half-life prediction.
Table 4: Cross validation values for application of 5 linear regression algorithms to CBH II enzyme chimera block stability scores. Algorithm abbreviations: ridge regression (RR), partial least square regression (PLSR) , support vector machine regression (SVMR) , linear programming support vector machine regression (LPSVMR) and linear programming boosting regression (LPBoostR) .
Method Ridge PLS SVMR LSVM LPBoost X-val 0.56 0.55 0.50 0.42 0.43
[00105] Linear regression modeling was used to qualitatively classify blocks as stabilizing, destabilizing or neutral. Each block's impact on chimera thermostability was characterized using a scoring system that accounts for the thermostability contribution determined by each of the regression algorithms. For each algorithm, blocks with a thermostability weight value more than 1 SD above neutral were scored "+1", blocks within 1 SD of neutral were assigned zero and blocks 1 or more SD below neutral were scored "- 1". A "stability score" for each block was obtained by summing the 1, 0, -1 stability scores from each of the five models. Table 5 summarizes the scores for each block. Block I/parent 1 (BlPl), B6P3, B7P3 and B8P2 were identified as having the greatest stabilizing effects, while B1P3, B2P1, B3P2, B6P2, B7P1, B7P2 and B8P3 were found to be the most strongly destabilizing blocks.
Table 5: Qualitative block classification results generated by five linear regression algorithms1 for sample set CBH II enzyme chimeras. Score of +1 denotes a block with thermostability weight
(dimensionless metric for contribution of a block to chimera thermostability) greater than one standard deviation above neutral
(stabilizing) , score of 0 denotes block with weight within one standard deviation of neutral and -1 denotes block with weight more than one standard deviation below neutral (destabilizing) .
Ridge PLS SVMR LSVM LPBoost Sum Block
B1P1 1 0 1 1 0 3
B1P2 0 0 0 -1 0 -1
B1P3 -1 0 -1 -1 -1 -4
B2P1 -1 0 0 -1 -1 -3
B2P2 1 0 0 0 0 1
B2P3 1 0 0 0 0 1
B3P1 1 0 1 0 0 2
B3P2 -1 0 -1 -1 -1 -4
B3P3 1 0 1 0 0 2
B4P1 0 0 0 0 0 0
B4P2 0 0 0 0 0 0
B4P3 0 0 0 -1 0 -1
B5P1 0 0 0 0 0 0
B5P2 0 0 0 0 -1 -1
B5P3 -1 0 0 -1 0 -2
B6P1 1 0 0 -1 -1 -1
B6P2 -1 0 -1 -1 -1 -4
B6P3 1 1 1 1 1 5
B7P1 -1 0 -1 -1 -1 -4
B7P2 -1 0 -1 -1 -1 -4
B7P3 1 0 1 1 1 4
B8P1 1 0 1 -1 0 1
B8P2 1 0 1 1 0 3
B8P3 -1 0 -1 -1 -1 -4
[00106] In one embodiment of the disclosure, a chimera is provided that has a sum score from the contributions of each block/domain of greater than 0 using a qualitative block classification, wherein the qualitatively classify blocks are defined as stabilizing, destabilizing or neutral, wherein each block' s impact on chimera thermostability is characterized using a scoring system that accounts for the thermostability contribution determined by a plurality of regression algorithms. For each algorithm, blocks with a thermostability weight value more than 1 SD above neutral were scored "+1", blocks within 1 SD of neutral were assigned zero and blocks 1 or more SD below neutral were scored "- 1". A "stability score" for each block was obtained by summing the 1, 0, -1 stability scores from each of the five models. [00107] A second set of genes encoding CBH II enzyme chimeras was synthesized in order to validate the predicted stabilizing blocks and identify cellulases more thermostable than the most stable parent. The 24 chimeras included in this validation set (Table 6) were devoid of the seven blocks predicted to be most destabilizing and enriched in the four most stabilizing blocks, where representation was biased toward higher stability scores. Additionally, the "HJPlus" 12222332 chimera was constructed by substituting the predicted most stabilizing blocks into the H. jecoπna CBH II enzyme (parent 2) .
Table 6: Sequences of 24 validation set CBH II enzyme chimeras, nine of which were expressed in active form.
Inactive Active
12122132 12111131
12132332 12132331
12122331 12131331
12112132 12332331
13122332 13332331
13111132 13331332
13111332 13311331
13322332 13311332
22122132 22311331
22322132
22311332
23111332
23321131
23321332
23321331
[00108] Concentrated supernatants of S. cerevisiae expression cultures for nine of the 24 validation set chimeras, as well as the HJPlus chimera, showed activity toward PASC (Table 6) . Of the 15 chimeras for which activity was not detected, nine contained block B4P2. Of the 16 chimeras containing B4P2 in the initial sample set, only one showed activity toward PASC. Summed over both chimera sets and HJPlus, just two of 26 chimeras featuring B4P2 were active, indicating that this particular block is highly detrimental to expression of active cellulase in S. cerevisiae .
[00109] The stabilities of the 10 functional chimeric CBH II enzymes from the validation set were evaluated. Because the stable enzymes already had half-lives of more than 50 hours, residual hydrolytic activity toward PASC after a 12-hour thermal inactivation at 63°C was used as the metric for preliminary evaluation. This 12- hour incubation produced a measurable decrease in the activity of the sample set's most thermostable chimera, 11113132, and completely inactivated the thermostable H. msolens parent CBH II. All ten of the functional validation set chimeras retained a greater fraction of their activities than the most stable parent, H. msolens CBH II.
Table 7: Specific activity values (ug glucose reducing sugar equivalent/ug CBH II*hr) for three thermostable CBH II chimeras and parents. Error is give as standard erros for between five and eight replicates per CBH II. 2-hour reaction, 3mg enzyme/g PASC, 50 °C, 25 mM sodium acetate, pH 4.
Figure imgf000048_0002
Table 8: Half-lives of thermal inactivation for active CBH II sample set chimeras at 63 °C. Results for two independent trials are presented.
Figure imgf000048_0001
21333331 SOD 830
21311 131 4SO 500
22232132 280 330
33133132 200 2-90
33213332 150 130
13333232 T OO 130
12133333 70 UO
13231 1 11 SO 40
11313121 SO 45
11332333 40 40
522^ 31 11 40 40
2331 1333 35 30
131 1 1313 SO 2ϋ
313111 12 IS 15
23231222 10 10
33123313 10 10
22212231 S 15
21223122 5 10
21 13131 1 3 3
23233133 3 2
312121 11 2 3
323331 13 *1 «.1 [00110] The activities of selected thermostable chimeras using purified enzymes was analyzed. The parent CBH II enzymes and three thermostable chimeras, the most thermostable sample set chimera 11113132, the most thermostable validation set chimera 13311332 and the HJPlus chimera 12222332, were expressed with C-terminal His6 purification tags and purified. To minimize thermal inactivation of CBH II enzymes during the activity test, we used a shorter, two-hour incubation with the PASC substrate at 50°C, pH 4.8. As shown in Table 3, the parent and chimera CBH II specific activities were within a factor of four of the most active parent CBH II enzyme, from H. jecoπna . The specific activity of HJPlus was greater than all other CBH II enzymes tested, except for H. jecoπna CBH II. [00111] The pH dependence of cellulase activity is also important, as a broad pH/activity profile would allow the use of a CBH II chimera under a wider range of potential cellulose hydrolysis conditions. H. jecoπna CBH II has been observed to have optimal activity in the pH range 4 to 6, with activity markedly reduced outside these values. Figure 4 shows that the H. msolens and C. thermophilum CBH II enzymes and all three purified thermostable CBH II chimeras have pH/activity profiles that are considerably broader than that of H. jecoπna CBH II. Although Liu et al . report an optimal pH of 4 for C. thermophilum CBH II, the optimal pH of the recombinant enzyme here was near 7. Native H. msolens CBH II has a broad pH/activity profile, with maximum activity around pH 9 and approximately 60% of this maximal activity at pH 4. A similarly broad profile was observed for the recombinant enzyme. The HJPlus chimera has a much broader pH/activity profile than H. jecoπna CBH II, showing a pH dependence similar to the other two parent CBH II enzymes .
[00112] Achieving activity at elevated temperature and retention of activity over extended time intervals are two primary motivations for engineering highly stable CBH II enzymes. The performance of thermostable CBH II chimeras in cellulose hydrolysis was tested across a range of temperatures over a 40-hour time interval. As shown in Figure 5, all three thermostable chimeras were active on PASC at higher temperatures than the parent CBH II enzymes. The chimeras retained activity at 70°C, whereas the H. jecoπna CBH II did not hydrolyze PASC above 57°C and the stable H. msolens enzyme showed no hydrolysis above 63°C. The activity of HJPlus in longtime cellulose hydrolysis assays exceeded that of all the parents at their respective optimal temperatures.
[00113] While various specific embodiments have been illustrated and described, it will be appreciated that various changes can be made without departing from the spirit and scope of the invention (s) .

Claims

What is claimed is:
1. A chimeric polypeptide comprising at least two domains from two different parental cellobiohydrolase II (CBH II) polypeptides, wherein the domains comprise from N- to C- terminus: (segment I)-
(segment 2) -(segment 3) -(segment 4) -(segment 5) -(segment 6)-
(segment 7) -(segment 8) ; wherein : segment 1 comprises a sequence that is at least 50-100% identical to amino acid residue from about 1 to about xi of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO: 6 ("3"); segment 2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x2 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO: 6 ("3"); segment 3 comprises a sequence that is at least 50-100% identical to amino acid residue x2 to about x3 of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO: 6 ("3"); segment 4 comprises a sequence that is at least 50-100% identical to amino acid residue x3 to about x4 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO: 6 ("3"); segment 5 comprises a sequence that is at least 50-100% identical to about amino acid residue x4 to about x5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 6 comprises a sequence that is at least 50-100% identical to amino acid residue x5 to about x6 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 7 comprises a sequence that is at least 50-100% identical to amino acid residue x6 to about X7 of SEQ ID NO: 2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3"); and segment 8 comprises a sequence that is at least 50-100% identical to amino acid residue x7 to about x8 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO: 6 ("3"); wherein X1 is residue 43, 44, 45, 46, or 47 of SEQ ID NO:2, or residue 42, 43, 44, 45, or 46 of SEQ ID NO : 4 or SEQ ID NO: 6; X2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO : 2 , or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO : 4 or SEQ ID NO:6; X4 is residue 153, 154, 155, 156, or 157 of SEQ ID NO:2, or residue 149, 150, 151, 152, 153, 154, 155 or 156 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X5 is residue 220, 221, 222, 223, or 224 of SEQ ID NO:2, or residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO : 4 or SEQ ID NO:6; x6 is residue 256, 257, 258, 259, 260 or 261 of SEQ ID NO:2, or residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO:4 or SEQ ID NO: 6; x7 is residue 312, 313, 314, 315 or 316 of SEQ ID NO:2, or residue 309, 310, 311, 312, 313, 314, 315 or 318 of SEQ ID NO : 4 or SEQ ID NO : 6 ; and x8 is an amino acid residue corresponding to the C-terminus of the polypeptide have the sequence of SEQ ID NO:2, SEQ ID NO : 4 or SEQ ID NO : 6 wherein the chimeric polypeptide has cellobiohydrolase activity and improved thermostability and/or pH stability compared to a CBH II polypeptide comprising SEQ ID NO: 2, 4, or 6.
2. The polypeptide of claim 1, wherein segment 1 comprises amino acid residue from about 1 to about xi of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO : 6 ("3") and having 1-10 conservative amino acid substitutions; segment 2 is from about amino acid residue xi to about X2 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3") and having about 1-10 conservative amino acid substitutions; segment 3 is from about amino acid residue x2 to about x3 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 4 is from about amino acid residue x3 to about x4 of SEQ ID NO:2 ("1"), SEQ ID NO : 4
("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 5 is from about amino acid residue x4 to about X5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6
("3") and having about 1-10 conservative amino acid substitutions; segment 6 is from about amino acid residue x5 to about x6 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; segment 7 is from about amino acid residue x6 to about x7 of SEQ ID NO:2 ("1"), SEQ ID NO : 4
("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions; and segment 8 is from about amino acid residue X7 to about X8 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3") and having about 1-10 conservative amino acid substitutions .
3. The chimeric polypeptide of claim 1, wherein the chimeric polypeptide has at least one segment selected from the following: segment 1 from SEQ ID NO: 2; segment 6 from SEQ ID NO: 6, segment 7 from SEQ ID NO : 6 and segment 8 from SEQ ID NO : 4.
4. The chimeric polypeptide of claim 3, wherein the chimeric polypeptide can be described as having segments IX2X3X4X5332, wherein X2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x2 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); X3 comprises a sequence that is at least 50-100% identical to amino acid residue x2 to about x3 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); X4 comprises a sequence that is at least 50-100% identical to amino acid residue X3 to about X4 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO: 6 ("3"); X5 comprises a sequence that is at least 50-100% identical to about amino acid residue x4 to about x5 of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO: 6 ("3") .
5. The chimeric polypeptide of claim 1, wherein the chimeric polypeptide comprises a segment structure selected from the group consisting of 11113132, 21333331, 21311131, 22232132, 33133132, 33213332, 13333232, 12133333, 13231111, 11313121, 11332333, 12213111, 23311333, 13111313, 31311112, 23231222, 33123313, 22212231, 21223122, 21131311, 23233133, 31212111, 12222332 and 32333113.
6. The chimeric polypeptide of claim 1, wherein the cimeric polypeptide comprises a segment structure selected from the group set forth in Table 1.
7. A polynucleotide encoding a polypeptide of claim 1.
8. A vector comprising a polynucleotide of claim 7.
9. A host cell comprising the vector of claim 8 or the polynucleotide of claim 7.
10. An enzymatic preparation comprising a polypeptide of claim 1.
11. An enzymatic preparation comprising a polypeptide produced by a host cell of claim 9.
12. A method of treating a biomass comprising cellulose, the method comprising contacting the biomass with a polypeptide of claim 1.
13. A method of treating a biomass comprising cellulose, the method comprising contacting the biomass with a host cell of claim
14. A method of generating a thermostable chimeric cellobiohydrolase polypeptide, comprising recombining segments from at least 3 parental cellobiohydrolase polypeptide wherein the chimeric polypeptide comprises from N- to C- terminus 8 segments wherein : segment 1 comprises a sequence that is at least 50-100% identical to amino acid residue from about 1 to about xi of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO: 6 ("3"); segment 2 comprises a sequence that is at least 50-100% identical to amino acid residue xi to about x2 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 3 comprises a sequence that is at least 50-100% identical to amino acid residue x2 to about x3 of SEQ ID NO: 2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO: 6 ("3"); segment 4 comprises a sequence that is at least 50-100% identical to amino acid residue x3 to about x4 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 5 comprises a sequence that is at least 50-100% identical to about amino acid residue x4 to about x5 of SEQ ID NO:2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); segment 6 comprises a sequence that is at least 50-100% identical to amino acid residue x5 to about x6 of SEQ ID NO:2 ("1"), SEQ ID NO:4 ("2") or SEQ ID NO : 6 ("3"); segment 7 comprises a sequence that is at least 50-100% identical to amino acid residue x6 to about X7 of SEQ ID NO: 2 ("1"), SEQ ID NO : 4 ("2") or SEQ ID NO : 6 ("3"); and segment 8 comprises a sequence that is at least 50-100% identical to amino acid residue x7 to about x8 of SEQ ID NO:2 ("1"), SEQ ID NO: 4 ("2") or SEQ ID NO: 6 ("3"); wherein X1 is residue 43, 44, 45, 46, or 47 of SEQ ID N0:2, or residue 42, 43, 44, 45, or 46 of SEQ ID NO : 4 or SEQ ID NO: 6; X2 is residue 70, 71, 72, 73, or 74 of SEQ ID NO:2, or residue 68, 69, 70, 71, 72, 73, or 74 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X3 is residue 113, 114, 115, 116, 117 or 118 of SEQ ID NO : 2 , or residue 110, 111, 112, 113, 114, 115, or 116 of SEQ ID NO : 4 or SEQ ID NO:6; X4 is residue 153, 154, 155, 156, or 157 of SEQ ID NO:2, or residue 149, 150, 151, 152, 153, 154, 155 or 156 of SEQ ID NO : 4 or SEQ ID NO : 6 ; X5 is residue 220, 221, 222, 223, or 224 of SEQ ID NO:2, or residue 216, 217, 218, 219, 220, 221, 222 or 223 of SEQ ID NO : 4 or SEQ ID NO:6; x6 is residue 256, 257, 258, 259, 260 or 261 of SEQ ID NO:2, or residue 253, 254, 255, 256, 257, 258, 259 or 260 of SEQ ID NO:4 or SEQ ID NO: 6; x7 is residue 312, 313, 314, 315 or 316 of SEQ ID NO:2, or residue 309, 310, 311, 312, 313, 314, 315 or 318 of SEQ ID NO : 4 or SEQ ID NO : 6 ; and x8 is an amino acid residue corresponding to the C-terminus of the polypeptide have the sequence of SEQ ID NO: 2, SEQ ID NO : 4 or SEQ ID NO : 6 ; screening the chimeric polypeptide for the ability to hydrolyze cellulose at a temperature of about 63 0C.
15. A polypeptide identified by the method of claim 14.
PCT/US2010/027248 2009-01-16 2010-03-12 Stable, functional chimeric cellobiohydrolases Ceased WO2010091441A2 (en)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US20528409P 2009-01-16 2009-01-16
US61/205,284 2009-01-16
US16700309P 2009-04-06 2009-04-06
US61/167,003 2009-04-06

Publications (3)

Publication Number Publication Date
WO2010091441A2 true WO2010091441A2 (en) 2010-08-12
WO2010091441A9 WO2010091441A9 (en) 2010-09-30
WO2010091441A3 WO2010091441A3 (en) 2011-01-13

Family

ID=42542692

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/027248 Ceased WO2010091441A2 (en) 2009-01-16 2010-03-12 Stable, functional chimeric cellobiohydrolases

Country Status (1)

Country Link
WO (1) WO2010091441A2 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2576626A4 (en) * 2010-06-01 2013-11-20 California Inst Of Techn FUNCTIONAL AND STABLE CLASS I CELLOBIOHYDROLASTIC ENZYMES

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2007244753B2 (en) * 2006-04-28 2012-05-17 C5-6 Technologies, Inc. Thermostable cellulase and methods of use

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2576626A4 (en) * 2010-06-01 2013-11-20 California Inst Of Techn FUNCTIONAL AND STABLE CLASS I CELLOBIOHYDROLASTIC ENZYMES
US8962295B2 (en) 2010-06-01 2015-02-24 California Institute Of Technology Stable, functional chimeric cellobiohydrolase class I enzymes
US9284587B2 (en) 2010-06-01 2016-03-15 California Institute Of Technology Stable, functional chimeric cellobiohydrolase class I enzymes
US9708633B2 (en) 2010-06-01 2017-07-18 California Institute Of Technology Stable, functional chimeric cellobiohydrolase class I enzymes

Also Published As

Publication number Publication date
WO2010091441A9 (en) 2010-09-30
WO2010091441A3 (en) 2011-01-13

Similar Documents

Publication Publication Date Title
AU2010234521B2 (en) Polypeptides having cellulase activity
US9708633B2 (en) Stable, functional chimeric cellobiohydrolase class I enzymes
US9458443B2 (en) Optimized cellulase enzymes
CN118652863B (en) A polysaccharide-cleaving monooxygenase mutant and its gene, engineering bacteria, preparation method and application
JP6340647B2 (en) Super thermostable cellobiohydrolase
US20100304464A1 (en) Stable, functional chimeric cellobiohydrolases
dos Santos Goncalves et al. Biotechnological potential of mangrove sediments: identification and functional attributes of thermostable and salinity-tolerant β-glucanase
WO2010091441A2 (en) Stable, functional chimeric cellobiohydrolases
CN109486689B (en) A method for enhancing acid resistance of L-asparaginase
US9322007B2 (en) Stable fungal Cel6 enzyme variants
HK1180355A (en) Stable, functional chimeric cellobiohydrolase class i enzymes
US20130084619A1 (en) Modified cellulases with enhanced thermostability

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10739287

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 10739287

Country of ref document: EP

Kind code of ref document: A2