WO2010080992A1 - Regulators of the interferon-alpha receptor 1 (ifnar1) chain of the interferon receptor - Google Patents

Regulators of the interferon-alpha receptor 1 (ifnar1) chain of the interferon receptor Download PDF

Info

Publication number
WO2010080992A1
WO2010080992A1 PCT/US2010/020489 US2010020489W WO2010080992A1 WO 2010080992 A1 WO2010080992 A1 WO 2010080992A1 US 2010020489 W US2010020489 W US 2010020489W WO 2010080992 A1 WO2010080992 A1 WO 2010080992A1
Authority
WO
WIPO (PCT)
Prior art keywords
ifnarl
cells
ifn
perk
phosphorylation
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/020489
Other languages
French (fr)
Inventor
Serge Fuchs
J. Alan Diehl
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Pennsylvania Penn
Original Assignee
University of Pennsylvania Penn
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Pennsylvania Penn filed Critical University of Pennsylvania Penn
Priority to US13/142,814 priority Critical patent/US20120014911A1/en
Publication of WO2010080992A1 publication Critical patent/WO2010080992A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/185Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7076Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/21Interferons [IFN]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1137Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/11Protein-serine/threonine kinases (2.7.11)
    • C12Y207/1102Elongation factor 2 kinase (2.7.11.20), i.e. eEF-2K
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]

Definitions

  • ISGs mediate a plethora of IFN ⁇ effects that play key roles in anti-viral defense (Brassard, et al, 2002, J Leukoc Biol 71(4):565-581 ; Katze, et al., 2002, Nat Rev Immunol 2(9):675-687), inhibition of cell proliferation (Brassard, et al, 2002, J Leukoc Biol 71 (4):565-581 ; Kirkwood, 2002, Semin Oncol 29(3 Suppl 7): 18-26; Stark, et al., 1998, Annu Rev Biochem 67:227-264) and modulation of immune responses (Biron, 2001 , Immunity 14:661-664; Brassard, et al, 2002, J Leukoc Biol 71(4):565-581).
  • IFN ⁇ neoplastic diseases
  • cancers Kirkwood, 2002, Semin Oncol 29(3 Suppl 7): 18-26
  • chronic viral infections Brainssard, et al, 2002, J Leukoc Biol 71(4):565-581 ; Katze, et al., 2002, Nat Rev Immunol 2(9):675-687
  • multiple sclerosis Karp, et al., 2000, Immunol Today 21 (l):24-28).
  • a need for the robust synthesis of viral polypeptides poses additional problems for the virus as it challenges the capacity of the host cell to properly fold and activate proteins.
  • Accumulation of sub-optimally folded proteins in the ER of the host cell induces a series of signaling events known as the ER stress or the unfolded protein response (UPR) (Welihinda, et al., 1999, Gene Expr 7:293-300).
  • UTR unfolded protein response
  • the ER protein chaperone BiP is central to initiating virtually all branches of the response, subsequent signaling proceeds via a number of defined mechanisms that include other transmembrane sensors including ATF6, IREl and PKR-like ER kinase (PERK).
  • Viruses are known to both induce UPR and produce the means of inhibiting these responses, translation of viral proteins and to continue virus production (He, 2006, Cell Death Differ 13(3):393-403; Schroder, et al., 2006, Curr MoI Med 6( l ):5-36; Wang, et al., 2006, J Gastroenterol Hepatol 21 Suppl 3:S34-37; Waris, et al., 2002, Biochem Pharmacol 64: 1425-1430). While investigating the mechanisms that govern proteolytic degradation of Type IFN receptor it was found that IFNARl undergoes ligand-induced Tyk2 activity- dependent phosphorylation on specific Ser residues (Ser535 in humans and Ser526 in mice).
  • the method comprises contacting a cell with an effective amount of a composition comprising an inhibitor of a regulator of IFNARI, including any one or more of PERK, PTPlB, or PKD2.
  • the inhibitor is at least one of an siRNA, a microRNA, an antisense nucleic acid, a ribozyme, a transdominant negative mutant, an intracellular antibody, a peptide or a small molecule.
  • the invention also includes a method of treating a disease or disorder associated with a dysfunctional IFN response.
  • the method comprises administering to a mammal in need thereof, a therapeutically effective amount of a composition or pharmaceutical composition comprising an inhibitor of a regulator of IFNARI, including any one or more of PERK, PTPl B, or PKD2.
  • the composition or the pharmaceutical composition is administered in combination with a therapeutic agent.
  • the therapeutic agent is IFN.
  • the disease is a viral infection, cancer or an autoimmune disease.
  • an autoimmune disease amenable to the methods of the invention is multiple sclerosis.
  • the invention also includes a method of treating a disease or disorder associated with a dysfunctional IFlM response.
  • the method comprises administering to a mammal in need thereof, a therapeutically effective amount of a composition or pharmaceutical composition comprising an activator of a regulator of IFNARI, including any one or more of PERK, PTPl B, or PKD2.
  • the composition or the pharmaceutical composition is administered in combination with a therapeutic agent.
  • the disease is a viral infection, cancer or an autoimmune disease.
  • Two nonlimiting examples of autoimmune diseases amenable to the methods of the invention is systemic lupus erythematosus and psoriasis.
  • the invention also provides a method of increasing the efficacy of endogenous IFN in a mammal.
  • the method comprises administering to a mammal in need thereof, a therapeutically effective amount of a composition or pharmaceutical composition comprising an inhibitor of a regulator of IFNARI, including any one or more of PERK, PTPlB, or PKD2.
  • the invention further provides a method of increasing the efficacy of IFN-based drug treatment in a mammal.
  • the method comprises administering to a mammal in need thereof, a therapeutically effective amount of a composition or pharmaceutical composition comprising an inhibitor of a regulator of IFNARI, including of any one or more of PERK, PTPl B, or PKD2.
  • Figure 1 is a series of images demonstrating that ER stress induces IFNARl Ser535 kinase activity and promotes phosphorylation of IFNARl within its destruction motif in a manner that does not require Tyk2 activity but relies on activity of PERK.
  • Figure IA is an image depicting immunoblotting (IB) analysis of the lysates from KR-2 cells (lacking catalytic activity of Tyk2) transfected with Flag- IFNARl plasmid (0 - 3.0 ⁇ g) subjected to immunoprecipitation (IP) using anti-Flag antibody followed by immunoblotting (IB) using the indicated antibodies. Relative intensity of bands in IB using either anti-phospho-S535 (black squares) or IFNARl (Rl , gray squares) or Flag (black squares) was quantified and plotted in the right panel.
  • IB immunoblotting
  • Figure IB is an image depicting analysis of the lysates from KR-2 cells transfected with Flag-lFNARl (1.5-3.0 ⁇ g) or empty vector used as a source of kinase activity in an in vitro kinase assay using GST-IFNAR 1 as a substrate.
  • the reactions were analyzed by IB using anti-phospho-S535 antibody (upper panel; both shorter and longer exposures shown) and by Ponceau staining to detect the substrate levels (middle panel).
  • Levels of Flag-IFNARl in the cell lysates were analyzed by IB using anti-Flag antibody (lower panel).
  • Figure 1C is an image depicting analysis of the 293T cells treated with thapsigargin (TG, l ⁇ M) for 30 min. Endogenous IFNARl was immunoprecipitated and analyzed by IB using indicated antibodies. Aliquots of the whole cell lysates were analyzed for levels of phospho-and total eIF2 ⁇ .
  • Figure ID is an image depicting analysis of the cells harboring wild type (WT-5) or the kinase dead Tyk2 (KR-2) treated with IFN ⁇ .
  • Figure IE is an image depicting analysis of the WT or PERK " ⁇ MEFs treated with TG (l ⁇ M) or murine IFND (1000 U/ml) for 30 min.
  • Mouse endogenous IFNARl was analyzed for its phosphorylation and levels using the indicated antibodies.
  • Figure IF is an image depicting analysis of the MEFs from PERKfl/fl mice that received an empty vector (Mock) or vector for expression of Cre recombinase (Cre). Whole cell lysates from these cells were also analyzed by IB using the indicated antibodies.
  • Figure 2 comprising Figures 2A through 2F, is a series of images demonstrating that ER stress promotes IFNARl ubiquitination and degradation in a ligand/Jak-independent manner
  • Figure 2A is an image depicting analysis of the levels of endogenous IFNARl in 293T cells pre-treated or not with methylamine HCl (MA, 2OmM) for 1 h and then treated with TG (1 ⁇ M) for indicated time were analyzed by IP-IB. Levels of ⁇ -actin in whole cell lysates are also shown.
  • Figure 2B is an image depicting analysis of the cells harboring the WT
  • Tyk2 WT-5 or the kinase dead Tyk2 (KR-2) treated with TG as indicated and ubiquitination and levels of endogenous IFNARl were analyzed by IP-IB. Aliquots of whole cell lysates were also analyzed by IB using anti- ⁇ -actin antibody (lower panel).
  • Figure 2C is an image depicting analysis of the 293T cells pre-treated or not with MA for 1 h and then treated with cycloheximide (Chx, 50 ⁇ g/ml) alone or together with TG (1 ⁇ M) for indicated times. Levels of endogenous IFNARl were analyzed by IP-IB. Levels of c-Jun and ⁇ -actin in whole cell lysates were also determined by IB using indicated antibodies.
  • Figure 2D is an image depicting analysis of the ubiquitination of Flag- tagged IFNARl co-expressed with the indicated shRNA constructs in 293T cells was analyzed by IP using anti-Flag antibody followed by IB using anti-ubiquitin and anti-Flag antibodies as indicated. Aliquots of whole cell lysates were also analyzed by IB using anti- ⁇ -actin antibody (lower panel).
  • Figure 2E is an image depicting analysis of the PERK f1/tl MEF that either underwent acute deletion of PERK (Cre) or not (Mock) treated with 1 ⁇ M of TG (together with Chx, lO ⁇ g/ml) for 45 min as indicated.
  • Endogenous mouse IFNARl was analyzed by IP-IB using the indicated antibodies.
  • Ig heavy chain immunoglobulins.
  • Whole cel l lysates were also subjected to IB analysis to determine levels of phosphorylated ⁇ -catenin and eIF2 ⁇ as well as total levels of PERK and eIF2 ⁇ using respective antibodies.
  • NS non-specific band.
  • Figure 2F is an image depicting analysis of the mouse Flag-IFNARl expressed in PERK ⁇ MEFs that either underwent acute deletion of PERK (Cre) or not (Mock) analyzed by IB using anti-Flag antibody. Levels of PERK are shown in lower panel.
  • NS non-specific band that serves as a loading control.
  • Figure 3 comprising Figures 3 A through 3D, is a series of images demonstrating that ER stress ER stress promotes IFNARl degradation in a manner depending on IFNARl phosphorylation within its phospho-degron.
  • Figure 3 A is an image depicting a vector and a targeting strategy that were used to generate an S526A allele in mouse ES cells (C57/BL6). Position of mutated Ser residue, resistance markers, loxP sites as well as restriction sites and the probe used for Southern analysis are also shown.
  • Figure 3B is an image depicting Southern analysis of several selected ES clones that underwent homologous recombination (marked by an asterisk) performed on genomic DNA digested with Kpnl. Correct targeting yielded a 10.6 kb band in clones 106 and 252 (besides the 8.5 kb band indicative of the WT allele).
  • Figure 3C is an image depicting analysis of the embryoid bodies (EB) derived from the WT (WT/WT) or the mutant (S526A/WT) ES cells.
  • EB embryoid bodies
  • WT/WT WT/WT
  • S526A/WT mutant ES cells.
  • Cells were pre- treated or not with MA (2OmM for 1 h) and then treated with TG (l ⁇ M, 15min) as indicated.
  • Endogenous mouse IFNARl was immunoprecipitated and analyzed by IB using the indicated antibodies.
  • Phosphorylation of eIF2D and levels of PKR were also determined in aliquots of whole cell lysates by IB.
  • Figure 3D is an image depicting analysis of the EB-derived cells treated with TG (l ⁇ M) for indicated times and analyzed for total levels of endogenous IFNARl (by IP-IB). Levels of eIF2 ⁇ phosphorylation and total ⁇ -catenin were shown as stress and loading controls, respectively.
  • Figure 4 is a series of images demonstrating that viral infection promotes phosphorylation-dependent ubiquitination and downregulation of IFNARl in a Tyk2-independent and S535/526-dependent manner.
  • Figure 4A is an image depicting analysis of the ubiquitination, phosphorylation and total levels of endogenous IFNARl from KR-2 cells infected with VSV (for 16, 18 and 20 h) were analyzed by IP using anti-lFNARl antibody followed by IB using the indicated antibodies. Viral protein accumulation is shown by the levels of
  • Figure 4B is an image depicting analysis of the levels of endogenous
  • IFNARl in the lysates from Huh7 cells were analyzed by IP-IB. Levels of ⁇ -actin in the lysates aliquots are also shown.
  • Figure 4C is an image depicting analysis of the endogenous IFNARl proteins immunopurified from the indicated cells and loaded onto the gel to yield comparable levels of total IFNARl (lower panel). Phosphorylation of IFNARl was then analyzed by IB using indicated antibody (upper panel).
  • Figure 4D is an image depicting analysis of the MEFs from IFNARl-/- mice stably reconstituted with murine Flag-IFNARl (either wild type or S526A mutant) and then infected with VSV (for 16-18 h). Levels of IFNARl , VSV-M and ⁇ -actin were analyzed by IB.
  • Figure 4E is an image depicting analysis of the EB-derived eel Is of WT
  • VSV/WT mutant genotype infected (or not) with VSV for 12 h and lysed. Under these conditions, levels of VSV-M become saturated at l Ohr post-infection.
  • FIG. 5 is a series of images demonstrating the role of PERK in virus-induced degradation of IFNARl .
  • Figure 5A is an image depicting analysis of the phosphorylation and levels of endogenous IFNAR l in 2fTGH cells that received indicated shRNA constructs and then were infected with VSV (for 16, 18 and 20 h) was analyzed by IP-IB using the indicated antibodies. Aliquots of IP supernatants were used for analysis of VSV-M, p- eIF2 ⁇ and eIF2 ⁇ levels by IB.
  • Figure 5B is an image depicting analysis of the control or PERK-depleted
  • FIG. 5A 2fTGH cells (as in Figure 5A) infected with VSV (for 17 h) and then treated with Chx (1 or lO ⁇ g/ml for 1.5 h). Total levels of IFNARl were determined by IP-IB.
  • Figure 5C is an image depicting analysis of the levels of cell surface
  • IFNARl analyzed by FACS using monoclonal anti-mIFNARI antibody in MEFs from PERK mice (transduced with either empty vector (Mock) or construct for expression of Cre) either left untreated (black line) infected with VSV (for 17 h, red line) or treated with TG (1 ⁇ M for 4h, green line). Blue line represents the isotype Ig control.
  • Figure 5D is an image depicting analysis of the levels of IFNARl and actin in Huh7 cells harboring the full-length or subgenomic HCV that were co-transfected with Flag-IFNARl and indicated shRNA constructs were analyzed using indicated antibodies.
  • Figure 6 is a series of images demonstrating that viral infection inhibits Type I IFN signaling via accelerating Ser526 phosphorylation-dependent degradation of IFNARl .
  • Figure 6A is an image depicting analysis of the 2fTGH cells infected or not with VSV (for 20 h) treated with 50 IU/ml of IFN ⁇ or IFN ⁇ for 30 min. Phosphorylation of Statl and total levels of Statl, actin and VSV-M were analyzed by IB.
  • Figure 6B is an image depicting analysis of the Huh7 cell line derivatives co-transfected with Flag-STATl and either empty vector (pcDNA3) or Flag-IFNARl (WT or S535A) as indicated. Lysates from these cells treated or not with IFN ⁇ (50 IU/ml) were immunoprecipitated using anti-Flag antibody and these reactions were analyzed by IB using the indicated antibodies.
  • Figure 6C is an image depicting analysis of the EB-derived cells of wild type (WT/WT) or mutant (S526A/WT) genotype infected with VSV (for 12 h) and then treated with murine IFN- ⁇ (100 IU/ml) or IFN- ⁇ (5ng/ml) for 30 min. Phosphorylation of Statl and total levels of Statl and actin were analyzed by IB.
  • Figure 6D is an image depicting analysis of the titer of VSV produced in EB-derived cells 14 h after infection (an incubation of cells with VSV at MOI 1.0 for Ih). The effect of IFN- ⁇ (20 IU/ml) added either 16 h prior to the infection (pre-treat) or immediately after infection (co-add) was determined. Data shown (the mean ⁇ SD) are representative of two independent experiments (each in triplicate). Asterisk denotes p ⁇ 0.01 in comparison with untreated cells.
  • Figure 7 is a series of images demonstrating the role of PERK in virus-induced suppression of Type I IFN signaling.
  • Figure 7A is an image depicting analysis of the control or PERK-depleted derivatives of 21TGH cells infected with VSV (for 20 h) and treated with IFN- ⁇ or IFN- ⁇ (50 IU/ml for 30 min). Phosphorylation and total levels of Stat 1 and eIF2 ⁇ were analyzed by IB.
  • Figure 7B is an image depicting analysis of the MEFs from PERK mice transduced with either empty vector (Mock) or construct for expression of Cre were infected with VSV (for 20 h) and then treated with IFN- ⁇ (100 IU/ml) or IFN- ⁇ (5ng/ml) for 30 min. Phosphorylation and total levels of Statl were analyzed by IB.
  • Figure 7C is an image depicting analysis of the MEFs from PERK ⁇ /t1 mice transduced as indicated infected with VSV at MOI 0.1 (+) or 0.5 (++) for 20 h and treated with IFN- ⁇ for 30 min. IB analyses using indicated antibodies are shown.
  • Figure 7D is an image depicting analysis of the derivatives of Huh 7 cells co-transfected with indicated shRNA constructs and Flag-STATl and treated with IFN- ⁇ (50 IU/ml) for 30 min.
  • Statl proteins were immunoprecipitated using anti-Flag antibody and analyzed by IB using anti-phospho-Statl and anti-Statl antibody.
  • Figure 7E is an image depicting analysis of the titer of VSV produced in control or PERK-depleted derivatives of 2fTGH cells 14h after infection (an incubation of cells with VSV at MOI 1.0 for I h). The effect of IFN- ⁇ (20 IU/ml) added either 16 h prior to the infection (pre-treat) or immediately after infection (co-add) was determined. Data shown (the mean ⁇ SD) are representative of two independent experiments (each in triplicate). Asterisk denotes p ⁇ 0.01 in comparison with untreated cells.
  • Figure 7F is an image depicting analysis of the MEFs from PERK fl/tl mice transduced as indicated infected with VSV (MOI 1.0). 20 h after infection, viral titer in the culture supernatant was determined. Values represent the mean ⁇ SD of three independent experiments each performed in triplicate. VSV-M protein levels analyzed by IB in cell lysates are also shown in the inset.
  • Figure 7G is an image depicting analysis of the 2fTGH and isogenic IFNAR2-deficient U5a cells transduced with indicated shRNA constructs and then infected with VSV (MOI 1.0) for 18-20 h. Levels of VSV-M, ISGl 5 and ⁇ -actin were determined by IB. In a paral lel experiment, these cells were treated with TG (1 ⁇ M for 30 min) and analyzed for PERK levels by IP-IB (lower panel).
  • Figure 8 is an image depicting analysis of the 293T cells transfected with Flag-IFNARl or empty vector (pCDNA3) and the lysates analyzed by immunoblotting using the indicated antibodies.
  • Figure 9 is an image depicting analysis of the 2fTGH cells transfected with Flag-IFNARl or empty vector (pCDNA3) and whole cell lysates (WCE).
  • Endogenous IFNARl was immunoprecipitated and analyzed by IB using anti-pS535 and anti-IFNARl (Rl) antibodies. WCE were analyzed by immunoblotting using the indicated antibodies.
  • Figure 10 is an image depicting characterization of shRNA against human PERK. 293T cells were transfected with control shRNA plasmid or shPERK plasmid. 48 h after transfection, cells were harvested and the cells lysates were subjected to analysis for PERK levels by IP-IB. Levels of IREl in the lysates serve as loading control.
  • Figure 1 1 is an image depicting analysis of the 293T cells co-transfected with Flag-IFNARl along with control shRNA plasmid or shPERK plasmid as indicated, 48 h after transfection, cells were harvested and the cells lysates were subjected to immunoblotting analysis using the indicated antibodies.
  • Figure 12 is an image depicting analysis of the 293T cells pre-treated with methylamine (2OmM) for 1 h and then with 5mM of DTT for 30 min. Lysates were subjected to IP-IB analysis for pS535 and total IFNARI levels.
  • Figure 13 is an image depicting analysis of the 293T cells transduced with lenti viruses encoding control shRNA (shCon) or shIREl ⁇ (shlREl). The cells were treated with TG (i ⁇ M) or IFN- ⁇ (1000 IU/ml) for 30 min. pS535 and total IFNARl levels were examined using IP-IB. The effect of IREl ⁇ knockdown was also determined by direct immunoblot.
  • Figure 14 is an image depicting analysis of the 293T cells transfected with a control shRNA construct or shRNA against PERK treated with TG (l ⁇ M) or IFN- ⁇ (1000 IU/ml) for 30 min. Phosphorylation and levels of endogenous IFNARl and eIF2 ⁇ were analyzed by immunoblotting.
  • Figure 15 is an image depicting analysis of the 293T cells pre-treated with methylamine HCl (MA, 2OmM) for 1 h and then treated with TG (l ⁇ M) for indicated time. Ubiquitination of endogenous IFNARl was analyzed by IP-IB using the indicated antibodies.
  • MA, 2OmM methylamine HCl
  • TG l ⁇ M
  • Figure 16 is an image depicting analysis of the MEF cells derived from IFNARl -null mice stably transduced with either empty retrovirus ("Vector) or with retroviruses for expression of mouse Flag-tagged IFNARl (wild type or S526A mutant, "SA"). Effect of TG treatment on IFNARl ubiquitination was analyzed by IP-IB using the indicated antibodies.
  • Figure 17 is an image depicting analysis of the 2fTGH cells left untreated or infected with VSV (MOI 0.1 and 0.3 respectively) for 19 h. Levels of indicated proteins were analyzed by immunoblotting using indicated antibodies.
  • Figure 18 is an image depicting analysis of the 2fTGH cells infected with MOI 0.1 VSV for 16, 18 and 20 h. pS535 and total IFNARl levels were determined.
  • Figure 19 is an image depicting analysis of the 2fTGH cells transduced with control virus (shCON) or virus encoding shPERK (shPERK) treated with TG ( 1 ⁇ M) for 30 min.
  • PERK levels were determined by IPIB.
  • Levels of p-elF2 ⁇ or total eIF2 ⁇ were determined by direct immunoblot.
  • Figure 20 is an image depicting analysis of the 2fTGH transduced with empty virus (pLK), virus encoding shPERK (shPERK), irrelevant control shRNA (shCon) or shIREl were infected with MOI 0.1 of VSV for 20 h.
  • Total IFNARl levels were determined by IP-IB. Position of mature IFNARl is indicated by arrow. Asterisks points to a non-specific band that serves as loading control.
  • Figure 21 is an image depicting analysis of the 293T cells treated with TG (i ⁇ M) for 4 h and then the cells were re-fed with fresh medium overnight. After that incubation, cells were treated with 50 IU/ml of IFN ⁇ or IFN ⁇ for 30 min. pSTATl and STATl levels were determined by immunoblotting.
  • Figure 22 is an image depicting analysis of the parental Huh7 cells or cells harboring the subgenomic (Sub-HCV) or the full length (FL-HCV) HCV genome treated with 50 IU/ml of IFN ⁇ (0.5 h and 1 h) or IFN ⁇ (0.5 h).
  • pSTATl , STATl and ⁇ -actin levels were analyzed.
  • Figure 23 is an image depicting analysis of the WT or PKR ' ⁇ MEFs infected with MOI 0.1 of VSV for 20 h. Cells were then treated with mIFN ⁇ (50 IU/ml) for 30 min. pSTAT] and total STATl levels were determined.
  • FIG. 24 is an image depicting analysis of the WT or conventional PERK " 7 MEFs or MEFs stably expressing exogenous PERK infected with VSV. Twenty hours later, virus-containing culture supernatant was harvested and viral titer was determined. Levels of PERK expression are shown in Figure 25.
  • Figure 25 is an image depicting analysis of the WT or conventional PERK-/-MEFs or MEFs stably expressing exogenous PERK transfected with ISRE- luciferase reporter along with Renilla luciferase reporter plasmid.
  • IFN- ⁇ -induced ISRE- driven transcription was analyzed as previously described (Kumar, et al., 2003, Embo J 22(20):5480-5490). Average activity (in arbitrary units normalized per renilla luciferase) from three independent experiments is shown.
  • Lower panel depicts IB analysis of the lysates from these cells using anti-PERK antibody. Position of PERK is indicated by an arrow.
  • a non-specific (NS) band serves as a loading control.
  • Figure 26 is an image depicting analysis of the 21TGH cells harboring either shPERK or irrelevant control shRNA (shCon) infected with MOI 0.1 of VSV. Blocking antibodies against IFN- ⁇ and IFN- ⁇ (at 500U) were added to the medium at that time as indicated. Cells were harvested 16 h later and the levels of VSV-M and ⁇ -actin were analyzed by IB.
  • Figure 27 is a series of images demonstrating that PTPlB regulates the extent of IFNARl endocytosis.
  • Figure 27 A is a graph demonstrating that overexpression of PTPlB (blue line) increases the efficacy of internalization of IFNARl measured by the high throughput fluorescence assay; expression of catalytically inactive PTP 1 B mutant (D 181 A) decreases the rate of
  • Figure 27B is a graph demonstrating that knockdown of PTP I B by shRNA decreases the rate of IFNARl endocytosis.
  • Figure 27C is an image presenting commercially available inhibitors of PTPl B.
  • Figure 27D is a graph demonstrating that inhibitors of PTP I B prevent efficient endocytosis of IFNARl .
  • Figure 28, comprising Figures 28A and 28B, is a graph demonstrating pre- treatment of human 2fTGH cells with inhibitors of PTPlB potentiates the protective effect of IFN- ⁇ against viruses. Cells were pre-treated or not with SSG and then treated with different doses of IFN- ⁇ (25-lOOU/ml).
  • FIG. 29 is an image depicting PTPI B inhibitors.
  • Figure 30 is an image demonstrating that inhibition of PKD2 (but not related kinases PKDl or PKD3) by siRNA prevents phosphorylation of IFNARl on Ser535 in HeLa cells treated with IFN- ⁇ . Lower panel shows total levels of IFNARl .
  • Figure 31 is an image demonstrating that inhibition of PKD2 (but not related kinases PKD 1 or PKD3) by shRNA prevents phosphorylation of IFNAR 1 on PKD2 (but not related kinases PKD 1 or PKD3) by shRNA prevents phosphorylation of IFNAR 1 on PKD2 (but not related kinases PKD 1 or PKD3) by shRNA prevents phosphorylation of IFNAR 1 on
  • Figure 32 is an image depicting the analysis of the degradation of IFNARl in shCOO2 and ShPKD2 stable cells after treatment with interferon alpha.
  • Figure 33 is an image demonstrating that knockdown of PKD2 prevents downregulation of cell surface levels of IFNARl as measured y the FACS analysis.
  • Figure 34 is an image depicting the analysis of the effects of knockdown of PKD2 in HeLa cells on IFN- ⁇ signaling measured by activating tyrosine phosphorylation of Statl protein.
  • Cells were treated with a pulse (15 min) of IFN- ⁇ and hen incubated in IFN-free media.
  • Statl phosphorylation upper panel
  • total levels lower panel
  • Figure 35 is an image depicting the analysis of the knockdown of PKD2 in human 2fTGH cells stimulates expression of interferon-inducible genes such as PKR and Statl . Levels of these proteins and levels of actin (as loading control) are analyzed as indicated.
  • Figure 36 is an image depicting the analysis of the replication of vesicular stomatitis virus (VSV) of 2fTGH-shCON and 2fTGH-shPKD2 cells.
  • VSV vesicular stomatitis virus
  • Upper panels show the assessment of viral replication by expression of viral VSV-M protein.
  • Lower panel actually depicts the results of measurement of the titer of VSV in cells treated with indicated doses of IFN- ⁇ .
  • Figure 37 comprising Figures 37A-37E, depicts the results of example experiments demonstrating that Sangivamycin (SGM) inhibits PKD2 and increases the efficiency of IFN signaling.
  • SGM Sangivamycin
  • Figure 38 depicts the results of example experiments demonstrating that sangivamycin inhibits PKD2 and increases the efficiency of IFN signaling.
  • Figure 39 depicts the results of example experiments conducting inhibitory analysis of the degron phosphorylation of IFNARl and its interaction with 0-Trcp2.
  • A In vitro binding of 35S-labeled ⁇ -Trcp2 to GST- IFNARl (wild type or S535,539A mutant, SA) upon its phosphorylation with CK l ⁇ - depleted lysates from cells treated with IFN- ⁇ as indicated;
  • B Effect of various kinase inhibitors on phosphorylation of GST-IFNARl by the CKl ⁇ -depleted lysate from IFN- ⁇ - treated (for 10 min) cells analyzed by subsequent binding of 35S-labeled ⁇ -Trcp2;
  • C Immunoblot analysis of Flag-IFNARl immunopurified from cells pre-treated with kinase inhibitors and then treated with IFN- ⁇ as indicated;
  • D E
  • Figure 40 depicts the results of example experiments demonstrating that PKD2 mediates degron phosphorylation of IFNAR l .
  • A Immunoblot analysis of endogenous IFNARl immunopurified from HeLa cells that received indicated siRNA oligos.
  • PKD species and ⁇ -actin in whole cell lysates were also analyzed;
  • B Immunoblot analysis of Flag-IFNARl immunopurified from U3A cells that received indicated siRNA oligos;
  • C In vitro phosphorylation of GST-IFNARl on Ser535 by purified GST-PKD species was analyzed by immunoblotting;
  • D Effect of G56976 (20-20OnM) on in vitro phosphorylation of GST- IFNARl by purified GST-PKD2 (wild type or kinase dead, KD) analyzed as in panel C;
  • E Immunoblot analysis of endogenous IFNARl immunopurified from cells stably transduced with shRNA against GFP (shCON) or PKD2 (shPKD2) and then treated with IFN- ⁇ or thapsigargin (TG) was carried out as described in panel A.
  • Figure 41 depicts the results of example experiments demonstrating that PKD2 regulates ubiquitination, endocytosis and degradation of IFNARl .
  • A Immunoblot analysis of IFNARI immunopurified from HeLa cells that received indicated siRNA oligos.
  • PKD2 and ⁇ -actin in whole cell lysates were also analyzed;
  • B Effect of PKD2 knockdown (open squares) on the rate of internalization of endogenous IFNARl measured by a fluorescence-based assay are presented as % of total cell surface IFNARl level (Mean ⁇ S.E.M.);
  • C FACS analysis of IFNARl levels on the surface of cells that received indicated shRNA.
  • Green, blue, and brown signals represent cell surface expression of IFNARl after 0, 1, and 2 h of IFN- ⁇ treatment, respectively (red - isotype control);
  • D Immunoblot analysis of endogenous IFNARl in cells untreated or pre-treated with the PKD inhibitor CID755673, and then subjected to a cycloheximide (CHX) chase in the presence of IFN- ⁇ for the indicated times;
  • E Degradation of IFNARl in cells that received indicated shRNA was assessed as in panel D.
  • Figure 42 depicts the results of example experiments demonstrating the ligand-induced recruitment of PKD2 to IFNARI and stimulation of PKD2 kinase activity.
  • A Immunoblot analysis of IFNARl immunopurified from 293T cells treated with IFN- ⁇ for the indicated times.
  • Figure 43 depicts the results of example experiments assessing the role of Tyk2 and tyrosine phosphorylation of PKD2 in its activation and IFNARl degron phosphorylation.
  • A Activity of GST-PKD2 expressed in cells harboring wild type or kinase dead Tyk2, and left untreated or treated with IFN- ⁇ , was analyzed by in vitro Ser535 phosphorylation of GST-IFNARl as assessed by immunoblotting using a phospho-S535 specific antibody.
  • Figure 44 depicts the results of example experiments demonstrating that PKD2 regulates the extent of cellular responses to IFNa.
  • A Statl Tyr phosphorylation and levels in cells untreated or pre-treated with the PKD inhibitor CID755673 for 1 h and then pulse-treated with IFN- ⁇ for 15 min (followed by removal of cytokine and inhibitor and incubation of cells for the indicated times) was analyzed by immunoblotting;
  • B Analysis in cells that received indicated shRNA was carried out as in panel A;
  • C Relative activity of ISRE-driven firefly luciferase activity normalized to renilla luciferase activity in 2fTGH cells.
  • Figure 45 depicts the results of example experiments assessing the role of phosphorylation-dependent degradation of IFNARl in VEGF-stimulated angiogenesis.
  • A Immunoblot analysis of ubiquitination, phosphorylation and levels of Flag-IFNARl stably expressed in U3A cells treated with VEGF as indicated.
  • Figure 46 depicts the results of example experiments assessing the phosphorylation of endogenous IFNARl in 293T cells transfected with siRNA against PKDl or 293T cells PKD2. Levels of PKD species were also analyzed by immunoblot in WCL.
  • Figure 47 depicts the results of example experiments assessing indicated GST-tagged PKD proteins expressed in 293T cells and purified by pull down with glutathione beads were incubated with myelin basic protein (MBP) and radiolabeled ⁇ 32P-ATP. A control reaction ("CON") was carried out using the lysates from untransfected cells. Incorporation of labeled phosphate into PKD and MBP was analyzed by autoradiography. Levels of MBP (Coomassie staining) and GST-tagged PKD species (immunoblot with antibody against GST) are also shown.
  • MBP myelin basic protein
  • CON radiolabeled ⁇ 32P-ATP
  • Figure 48 depicts the results of example experiments assessing the co- immunoprecipitation of endogenous IFNARl and PKD2 from the lysates of 293T cells. Control reaction utilized an irrelevant monoclonal IgG antibody (anti-Flag).
  • Figure 49 depicts the results of example experiments assessing the phosphorylation of and levels of endogenous IFNARl immunopurified from 1 1 .1 -derived cells that harbor wild type (WT) or catalytically inactive (KR) Tyk2 treated with IFN - ⁇ as indicated.
  • WT wild type
  • KR catalytically inactive
  • Figure 50 depicts the results of example experiments assessing the cytopathogenic effect of VSV manifested in the appearance of rounded, poorly attached, dying cells upon infection of human 2fTGH cells that received indicated shRNAs and pre-treated with IFN- ⁇ as indicated and then infected with VSV (at M.O.I, of 0.5). A comparable viral load in untreated cells was verified by expression of VSV-M viral protein (analyzed by immunoblot shown in the lower panels). The extent of PKD2 knockdown is also shown.
  • Figure 51 depicts the results of example immunoblot analyses of endogenous IFNARl immunopurified from cells treated with IFN- ⁇ , H2O2 or TPA as indicated.
  • Figure 52 depicts the results of example cychoheximide chase analyses of turnover of endogenous IFNARl in human umbilical vein endothelial cells untreated or treated with VEGF. Equal loading was verified by analysis of ⁇ -actin in these samples. The graph depicts % of remaining IFNARl at the indicated time points.
  • Figure 53 depicts the results of example PCR analyses of DNA from tails of back-crossed chimeric S526A mice of the indicated gender. Presence of the SA alleles in 3 founders is indicated by a PCR product that migrates slower due to a remaining loxP site.
  • Figure 54 depicts the results of example experiments demonstrating the purification of cellular Ser535 kinase activity.
  • A Purification scheme and results from in vitro kinase activity assays that used immunoblotting with phospho-specific antibody or [ ⁇ -32P]ATP incorporation into the GST-IFNARl substrate as indicated.
  • B Phosphorylation of bacterium-produced GST- IFNARl (wild type or Ser535,539Ala mutant [SA]) by the starting fractions before loading onto either SP Sepharose (SP) or hydroxyappatite (HA) columns in the presence of radioactive [ ⁇ -32P]ATP was analyzed by SDS-PAGE and autoradiography.
  • SP SP Sepharose
  • HA hydroxyappatite
  • Figure 55 depicts the results of example experiments demonstrating that CkI ⁇ represents the major Ser535 kinase in the cell lysates.
  • IP immunoprecipitated
  • IgGs immunoglobulin Gs
  • the supernatants of these reaction mixtures were analyzed for their S535 kinase activity by an in vitro kinase assay (KA) with GST-IFNARl as a substrate, detected by immunoblotting using anti- pS535 and anti-GST antibodies (upper panels).
  • KA in vitro kinase assay
  • Induction of ER stress was shown by phosphorylation of p-eIF2a as assessed by IB using phosphor-specific antibody.
  • E 293T cells were untreated or treated with TG (1 ⁇ M for 30 min) and harvested. Lysates from these cells were immunodepleted of Ckl ⁇ as outlined for panel A.
  • Figure 56 depicts the results of example experiments demonstrating that CkI ⁇ mediates basal IFNARl phosphorylation, ubiquitination, and downregulation in cells.
  • A 293T cells were cotransfected with Flag- IFNARl and Myc-hCkl ⁇ or an empty vector. Ser535 phosphorylation of Flag-IFNARl was analyzed by Flag immunoprecipitation (IP) followed by IB of pS535. The total levels of IFNARl were determined by reprobing the blot with an anti-Flag antibody. Myc-Ckl ⁇ levels in the whole-cell lysates (WCL) are shown in the lower panel.
  • C HeLa cells were cotransfected with Flag-IFNARl and siRNA against Ckl ⁇ or a control siRNA. At 48 h after transfecti on, lysates were harvested and were subjected to IP using anti-Flag antibody followed by IB analysis using the indicated antibodies. Levels of Ckl ⁇ and Erkl/2 (as a loading control) in WCL were assessed by IB using the indicated antibodies.
  • Figure 57 depicts the results of example experiments demonstrating that Ckl ⁇ is required for efficient IFNARl downregulation in response to ER stress.
  • A HeLa cells were transfected with control siRNA or siRNA against Ckl ⁇ . After 48 h, cells were treated with vehicle control, TG (1 ⁇ M), or IFN-a (1,000 IJ/ml) for 30 min, and lysates were harvested. The lysates were subjected to IFNARl immunoprecipitation (IP) followed by IB of pSer535 and total IFNARl . The efficiency of CkI ⁇ knockdown is shown in the lower panel.
  • IP IFNARl immunoprecipitation
  • FIG. 58 depicts the results of example experiments characterizing the S535 kinase activity of several human CKl isoforms and CKl-like proteins from other organisms.
  • a 293T cells were transfected with an empty vector (Vec) or Myc-tagged Ckl ⁇ (a), CKl S (S), or CKIs (s) or, as shown in the right panel, with HA-tagged vaccinia virus Bl kinase (vvB l), the kinase-dead vvB l (KD-Bl), L. major CKl (L-CKl), or human Ckl ⁇ .
  • vvB l HA-tagged vaccinia virus Bl kinase
  • KD-Bl the kinase-dead vvB l
  • L-CKl L. major CKl
  • human Ckl ⁇ human Ckl ⁇ .
  • Phospho-S535 and total IEVARl signals were analyzed by IP-IB. Ectopic expression levels of the kinases were determined by Myc or HA IB. In the left panel, phosphorylation and total eIF2a levels are indicative of comparable levels of ER stress in cells transfected with different CKl isoforms.
  • E In vitro phosphorylation of GST-IFNARl with supernatant from L. major promastigote culture. Buffer lacking Leishmania was used as a control (Con). These fractions were incubated with ATP and GST-IFNARl (5 ⁇ g) at 3O 0 C for 30 min. The products of this kinase reaction were analyzed by IB for pS535 and GST.
  • the levels of pS535 and total IFNARl were determined by IP-IB.
  • the levels of L-CKl in whole-cell lysates (WCL) were determined by IB using anti-HA antibody.
  • B 293T cells were cotransfected with IFNARl (WT or S535A mutant) and L- CKl or an empty vector.
  • the levels of ubiquitinated, S535-phosphorylated. and total IFNARl were analyzed by IP-IB.
  • the levels of L-CKl were assessed by HA IB.
  • C MEFs derived from IFNARl 1 mice reconstituted with WT or S526A mouse IFNARl were transfected with L-CKl or an empty vector.
  • Figure 61 depicts the conserved priming site within IFNARl regulates the intrinsic stability of the protein.
  • A Alignment of primary sequences of IFNARl from indicated species. The phospho-degron sequences are shaded and serine residues within the degron are underlined. The conserved putative priming site (Ser532 in human IFlMARl) is denoted by an asterisk.
  • B Degradation of Flag-IFNARl (wild type or S532A mutant) overexpressed in 293T cells was analyzed by cycloheximide (CHX, 2 mM) chase for the indicated times followed by immunoblotting using anti-Flag antibody.
  • CHX cycloheximide
  • Figure 62 depicts the results of example experiments demonstrating that priming phosphorylation is required for the ligand- independent phosphorylation of IFNARl degron.
  • Flag-IFNARl wild type or Ser532A mutant was co- expressed in 293T cells with HA-tagged Leishmania CKl (HA-L-CKl , wild type or kinase-dead, KD) and purified by Flag immunoprecipitation. Phosphorylation of the IFNARl degron and levels of IFNARl were analyzed by immunoblotting using the indicated antibodies. Levels of HA-L-CKl in whole cell lysates (WCL) were also determined. C. Characterization of anti ⁇ pS532 antibody. Flag-IFNARl proteins (wild type, S535A or S532A mutants) were expressed in 293T cells, immunopurified, and analyzed using the indicated antibodies.
  • D. 293T cells were untreated (UN) or treated with thapsigargin (TG, 1 ⁇ M for 30min) and harvested. Lysates from these cel ls were twice immunodepleted with antibodies against CK l ⁇ and the CK l ⁇ - free supernatants (4 ⁇ g) were used alone (lanes 2-3) or together with 0.5 ⁇ g of bacterially produced recombinant GST-CKl ⁇ (lanes 1 and 4-9) for in vitro phosphorylation of GST-IFNARl (wild type, lanes 1-6, or S532A mutant, lanes 7-9) in the presence of ATP (except in lane 1 ) at 3O 0 C for 30 min as indicated.
  • Figure 63 depicts the results of example experiments demonstrating that UPR induces phosphorylation of the priming site that is required for increased ubiquitination and degradation of IFNARl .
  • Flag- IFNARl proteins (wild type or S532A mutant) were expressed in 293T cells.
  • the cells were pre-treated with a lysosomal inhibitor (methylamine HCl 5 I O mM) for l hr to prevent degradation of ubiquitinated receptors. Then the cells were treated with TG (1 ⁇ M for the indicated times) and Flag ⁇ IFN ARl proteins were immunopurified under denaturing conditions and analyzed by immunoblotting using antibodies against ubiquitin (upper panel) and Flag (lower panel).
  • Figure 64 depicts the results of example experiments demonstrating the role of PERK in UPRHnduced phosphorylation of priming site of IFNARl .
  • Resulting phosphorylation of GST-IFNAR 1 or contaminants and autophosphorylation of PERK was determined by SDS-PAGE followed by Coomassie staining and autoradiography. Positions of PERK, GST-IFNARl , and some irrelevant contaminants (denoted by asterisks) are indicated.
  • Figure 65 depicts the results of example experiments demonstrating that priming phosphorylation of IFNARl contributes to regulation of the extent of IFN ⁇ / ⁇ signaling.
  • A Control human Huh7 cells, and those expressing the HCV replicon, were analyzed for IFNARl levels by immunoprecipitation- immunoblotting (upper panel). The lower three panels depict the experiments where gel loading was normalized to achieve comparable levels of immunopurified IFNARl in each lane. Phosphorylation of IFNARl on Ser532 and Ser535 was determined by immunoblotting using the indicated antibodies.
  • B Control human Huh7 cells, and those expressing the HCV replicon, were analyzed for IFNARl levels by immunoprecipitation- immunoblotting (upper panel). The lower three panels depict the experiments where gel loading was normalized to achieve comparable levels of immunopurified IFNARl in each lane. Phosphorylation of IFNARl on Ser532 and Ser535 was determined by immunoblotting using the indicated antibodies.
  • B Control human Huh
  • Control human Huh7 cells and those expressing the HCV replicon, were transfected with Flag-tagged Statl alone with empty vector (Vec) or Flag-IFNARl (wild type or S532A mutant), and were untreated or treated with IFN- ⁇ (60 IU/mL for 30 min) as indicated. Lysates of these cells were immunoprecipitated using anti-Flag antibody and analyzed by immunoblotting using antibodies against phospho-Statl , total Statl , and IFNARl .
  • C Mouse embryo fibroblasts from IFNARl-null animals were reconstituted with murine Flag-IFNARl (wild type or S523A mutant, which is a mouse analogue of human S532A mutant).
  • Figure 66 depicts the results of example experiments demonstrating that PERK expression is maintained in cancer cells wherein it regulates tumor expansion in vivo.
  • IP immunoprecipitation
  • B PERK protein levels following shRNA targeting of PERK.
  • C Parental MDA-MB468 cell line, shPERK-transduced cells (shPERK), and shPERK- transduced cells reconstituted with mouse Myc-PERK (+mPERK) were treated with 2g/ml tunicamycin for the indicated intervals. Western analysis for ATF4, CHOP, or - actin.
  • FIG. 67 depicts the results of example experiments demonstrating that PERK knockdown triggers a G2/M delay.
  • A MDA- MB468 cells were infected with control shRNA or anti-PERK shRNA for the indicated intervals. Cells were pulsed with BrdU 45 min prior to harvest for FACS analysis.
  • C Proliferation rates in mammary gland sections from control (PERKloxP/loxP) and mammary gland-specific PERK knockout mice (PERK/ 0 ) on pregnancy day 16 (P l 6) and lactation day 3 (L3) were determined by immunohistochemistry for BrdU (animals were injected with BrdU 1 h prior to being euthanized).
  • D Quantification of BrdU-positive cells from (C) is shown; error bars indicate S.D. among 3 animals, 5 acini were counted per animal.
  • Figure 68 depicts the results of example experiments demonstrating that PERK knockdown triggers DNA damage response signaling pathway.
  • A Immunofluorescence staining for DNA damage-induced foci containing phospho-ATM and phospho-Chk2 following acute PERK knockdown (72 h after infection) in MDA-MB468 cells.
  • B Quantification of phospho-ATM positive cells (>3 foci) is shown; error bars indicate S.D. from 3 slides, 5 fields were counted per slide, p-value was determined by Student t-test.
  • C Western analysis of DNA damage response-associated markers following PERK knockdown.
  • FIG. 69 depicts the results of example experiments demonstrating that increased levels of Reactive Oxygen Species (ROS) in PERK knockdown cells contribute to reduced kinetics of cell growth.
  • ROS Reactive Oxygen Species
  • Figure 70 depicts the results of example experiments demonstrating that ROS accumulation triggers oxidative DNA lesions in PERK-deficient breast cancer cells and tumors.
  • A Detection of 8-oxoguanine oxidized DNA adduct (8-OxoG) using a FITC conjugated 8-OxoG binding peptide in parental MDA-MB468 cells, MDA-MB468 cells transduced with control shRNA, shPERK, or shPERK and reconstituted with mouse Myc-PERK.
  • B Quantification of 8-oxoG positive cells from 3 independent experiments.
  • D Quantification of 8-OxoG positive cells shown in (C) is provided and error bars indicate S.D. from 4 animals.
  • E Detection of 8-OxoG in paraffin sections from orthotopic tumors formed by mouse mammary tumor-derived cells transduced with empty vector (Neu/PERKloxP/loxP) or retrovirus expressing Cre recombinase (Neu/PERK/°).
  • Figure 71 depicts the results of example experiments demonstrating that ROS accumulation triggers DNA double strand breaks in PERK -deficient breast cancer cells and tumors.
  • A Immunofluorescent staining of - H2AX foci in control or PERK knockdown MDA-MB468 cells.
  • B Quantification of - H2AX positive (>5 foci) cells under standard tissue culture conditions. Error bars represent S.D. from 3 independent experiments performed in triplicate.
  • C Quantification of the COMET tail moment in control or PERK knockdown cells under standard tissue culture conditions. Error bars indicate S.D. from 3 experiments.
  • Figure 72 depicts the results of example experiments demonstrating that reduced activity of Nrf2 causes increased oxidative stress in PERK knockdown cells.
  • A Quantitative real time PCR analysis of Nrf2 target genes NQOl and GCLC in the indicated cell lines asynchronously proliferating under standard conditions.
  • B Purified recombinant Nrf2-Neh2 domain of WT, T80A, S40A or T80A/S40A, was incubated with purified recombinant AN-PERK in the in vitro kinase assay. Phosphorylated Nrf2-Neh2 was detected by autoradiography (upper panel).
  • C 293T cells were transfected with WT Nrf2 or Nrf2-T80A. 24 hours after transfection, cells were left untreated (C) or treated with tunicamycin (Tu) for 2 hours followed by immunoprecipitation with anti-Nrf2 antibody. Threonine phosphorylation was detected using a phospho-Thr reactive antibody. Nrf2 in the IP and the whole cell lysate (WCL) was detected with Nrf2 specific antibody.
  • D Proliferation of the indicated cell lines was assessed by a 6-day growth curve under standard tissue culture conditions as described in materials and methods. PERK levels were detected by IP/Western blot analysis.
  • FIG. 73 comprising Figures 73A-73I, depicts the results of example experiments demonstrating that PERK loss attenuates MMTV-Neu-driven mammary tumorigenesis in mice, but promotes spontaneous mammary tumor formation in aged mammary gland-specific PERK knockout mice.
  • C Western analysis for PERK, ErbB2, and eIF4E levels on whole protein extracts from control (Neu/PERKloxP/loxP) and PERK knockout (Neu/PERK/) mammary gland tumors or mammary gland from lactating PERKloxP/loxP dam (LlO).
  • Nrf2 was precipitated from tumor lysates prepared from MMTV-Neu/PERK/ 0 or control mice and blotted for phospho-Thr and Nrf2.
  • PERK expression was determined by immunoblot.
  • E PERK excision delays development of Neu-driven hyperplastic lesions. Representative mammary glands from 9- to 14-months old control (Neu/PERKloxP/loxP) and PERK knockout (Neu/PERK/) mice revealing pre-malignant lesions are shown.
  • G Troma-1 (cytokeratin-8) staining on lung specimens containing metastatic foci.
  • H Hematoxylin and eosin staining for tumor histology and whole mount of hyperplastic lesions in mammary glands of PERK/ 0 aged females.
  • II qRT-PCR for ErbB2 on genomic DNA from PERK/ 0 tumors and FISH analysis on paraffin sections from the same animals. Levels of ErbB2 in tumors were compared to matched spleen tissues.
  • Figure 74 depicts the results of example experiments demonstrating that PERK deficiency inhibits expansion of MDA-MB468-derived orthotopic tumors.
  • Tumor volume 36 days post-orthotopic injection of MDA ⁇ 'MB468 parental cell line, control shRNA- (shControl) or shPERK-transduced cells (shPERK) (4 mice were used per cell line). Representative images of tumors are provided.
  • Figure 75 depicts the results of example experiments demonstrating that PERK knockdown triggers a G2/M delay and attenuates growth of cancer cells in vitro.
  • A T47D cells were infected with control shRNA or anti- PERK shRNA and then pulsed with BrdU 45 min prior to being collected for FACS analysis 48 h after infection.
  • B Kinetics of growth of T47D parental cell line, control shRNA- (shControl) or shPERK-transduced cells (shPERK).
  • C Kinetics of growth of TE3 parental cell line, control shRNA- (shControl) or shPERK -transduced cells (shPERK).
  • Figure 76 depicts the results of example experiments demonstrating that PERK knockdown triggers DNA damage response signaling pathway.
  • A Immunofluorescence staining for DNA damage-induced foci containing phospho-ATM and phospho-Chk2 72 h post-PERK knockdown in T47D cells.
  • B Quantification of phospho-ATM positive cells (>3 foci) is shown; error bars indicate S. D. from 3 slides, 5 fields were counted per slide, p-value was determined by Student t- test.
  • C Down-regulation of CDK2-dependent kinase activity in PERK null tumors.
  • CDK2 complexes were immuno-purified from MMTV-Neu/PERKloxP/loxP control and MMTV-Neu/PERK/ PERK-null tumors and its activity was monitored using recombinant histone Hl as a substrate. The efficiency of PERK excision was evaluated by RT-PCR and IP/Western blot analysis.
  • Figure 77 depicts the results of example experiments demonstrating that PERK deficiency results in accumulation of DNA DSBs in orthotopic tumors in vivo.
  • A Immunohistochemistry for -H2AX in orthotopic tumors formed by uninfected MDA-MB468 cells, MDA-MB468 cells transduced with control shRNA, or with anti-PERK shRNA. Quantification of -H2AX -positive cells is provided. Error bars represent S. D. among 4 animals.
  • Figure 78 depicts the results of example experiments assessing the efficiency pf PERK excision in mouse mammary gland tumors.
  • Efficiency of PERK allele excision was determined by semiquantitative RT-PCR on genomic DNA extracted from tumors of Neu PERKI oxP/loxP (control) and Neu PERK/ mice. Ratio of the intensity of recombinant allele band to wild type (wt) allele band was determined.
  • Figure 79 depicts the results of example experiments demonstrating that DNA damage-induced checkpoint activation can be averted in PERK-deficient mouse mammary gland tumors.
  • eIF4E levels were used as a loading control.
  • the invention provides compositions and methods for regulating the IFNARl chain of Type I interferon (IFN) receptor.
  • the invention relates to regulating phosphorylation-dependent ubiquitination and degradation of IFNARl .
  • the invention relates to stabilizing IFNARl .
  • the invention is based on the discovery that inhibiting regulators of IFNARl and thereby inhibiting degradation of IFNARl serves to relieve the suppression of Type 1 IFN signaling and, therefore, provide a therapeutic benefit. This is because increasing the stability of IFNARl and Type I IFN receptor leads to augmentation of response to IFN.
  • activating the degradation of IFNARl can provide relief in diseases or disorders having pathologically increased IFN signaling, such as, by way of non-limiting examples, systemic lupus erythematosus and psoriasis.
  • the present invention relates to modulating the stability of IFNARl and Type I IFN receptor by modulating a regulator of IFNARl in a cell.
  • the invention provides compositions and methods for inhibiting degradation of IFNARl and Type I IFN in a cell by modulation of a regulator of IFNARl such as PKR-like ER-localized eIF2 ⁇ kinase (PERK), PTP lB (a tyrosine phosphatase), protein kinase D2 (PKD2), or any combination thereof.
  • a regulator of IFNARl such as PKR-like ER-localized eIF2 ⁇ kinase (PERK), PTP lB (a tyrosine phosphatase), protein kinase D2 (PKD2), or any combination thereof.
  • a regulator of IFNARl such as PKR-like ER-localized eIF2 ⁇ kinase (PERK), PTP lB (a
  • Alloantigen is an antigen that differs from an antigen expressed by the recipient.
  • antibody refers to an immunoglobulin molecule, which is able to specifically bind to a specific epitope on an antigen.
  • Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoactive portions of intact immunoglobulins.
  • Antibodies are typically tetramers of immunoglobulin molecules.
  • the antibodies in the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab) 2 , as well as single chain antibodies and humanized antibodies (Harlow et al., 1988; Houston et al., 1988; Bird et al., 1988).
  • antigen or "Ag” as used herein is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
  • antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an "antigen" as that term is used herein.
  • an antigen need not be encoded soley by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucelotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a "gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid.
  • Antisense refers particularly to the nucleic acid sequence of the non- coding strand of a double stranded DNA molecule encoding a polypeptide, or to a sequence which is substantially homologous to the non-coding strand.
  • an antisense sequence is complementary to the sequence of a double stranded DNA molecule encoding a polypeptide. It is not necessary that the antisense sequence be complementary solely to the coding portion of the coding strand of the DNA molecule.
  • the antisense sequence may be complementary to regulatory sequences specified on the coding strand of a DNA molecule encoding a polypeptide, which regulatory sequences control expression of the coding sequences.
  • autoimmune disease as used herein is defined as a disorder that results from an autoimmune response. An autoimmune disease is the result of an inappropriate and excessive response to a self-antigen.
  • autoimmune diseases include but are not limited to, Addision's disease, alopecia areata, ankylosing spondylitis, autoimmune hepatitis, autoimmune parotitis, Crohn's disease, diabetes (Type 1), dystrophic epidermolysis bullosa, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barr syndrome, Hashimoto's disease, hemolytic anemia, systemic lupus erythematosus, multiple sclerosis, myasthenia gravis, pemphigus vulgaris, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathies, thyroiditis, vasculitis, vitiligo, myxedema, pernicious anemia, ulcerative colitis, among others.
  • cancer as used herein is defined as disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like.
  • DNA as used herein is defined as deoxyribonucleic acid.
  • an effector cell refers to a cell which mediates an immune response against an antigen.
  • An example of an effector cell includes, but is not limited to a T cell and a B cell.
  • Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
  • a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • endogenous refers to any material from or produced inside an organism, cell, tissue or system.
  • exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • epitope is defined as a small chemical molecule on an antigen that can elicit an immune response, inducing B and/or T cell responses.
  • An antigen can have one or more epitopes. Most antigens have many epitopes; i.e., they are multivalent. In general, an epitope is roughly five amino acids and/or sugars in size.
  • expression is defined as the transcription and/or translation of a particular nucleotide sequence driven by its promoter.
  • expression vector refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules, siRNA, ribozymes, and the like.
  • Expression vectors can contain a variety of control sequences, which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operatively linked coding sequence in a particular host organism. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well.
  • heterologous as used herein is defined as DNA or RNA sequences or proteins that are derived from the different species.
  • Homologous refers to the subunit sequence similarity between two polymeric molecules, e.g., between two nucleic acid molecules, e.g., two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous at that position.
  • the homology between two sequences is a direct function of the number of matching or homologous positions, e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two composition sequences are homologous then the two sequences are 50% homologous, if 90% of the positions, e.g., 9 of 10, are matched or homologous, the two sequences share 90% homology.
  • the DNA sequences 5'-ATTGCC-3' and 5'-TATGGC-3 ' share 50% homology.
  • immunogen refers to a substance that is able to stimulate or induce a humoral antibody and/or cell-mediated immune response in a mammal.
  • immunoglobulin or "Ig”, as used herein is defined as a class of proteins, which function as antibodies.
  • the five members included in this class of proteins are IgA, IgG, IgM, IgD, and IgE.
  • IgA is the primary antibody that is present in body secretions, such as saliva, tears, breast milk, gastrointestinal secretions and mucus secretions of the respiratory and genitourinary tracts.
  • IgG is the most common circulating antibody.
  • IgM is the main immunoglobulin produced in the primary immune response in most mammals. It is the most efficient immunoglobulin in agglutination, complement fixation, and other antibody responses, and is important in defense against bacteria and viruses.
  • IgD is the immunoglobulin that has no known antibody function, but may serve as an antigen receptor.
  • IgE is the immunoglobulin that mediates immediate hypersensitivity by causing release of mediators from mast cells and basophils upon exposure to allergen.
  • isolated nucleic acid refers to a nucleic acid segment or fragment which has been separated from sequences which flank it in a naturally occurring state, i.e., a DNA fragment which has been removed from the sequences which are normally adjacent to the fragment, i.e., the sequences adjacent to the fragment in a genome in which it naturally occurs.
  • the term also applies to nucleic acids which have been substantially purified from other components which naturally accompany the nucleic acid, i.e., RNA or DNA or proteins, which naturally accompany it in the cell.
  • the term therefore includes, for example, a recombinant DNA which is incorporated into a vector, into an autonomously replicating plasmid or virus, or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (i.e., as a cDNA or a genomic or cDNA fragment produced by PCR or restriction enzyme digestion) independent of other sequences. It also includes a recombinant DNA which is part of a hybrid gene encoding additional polypeptide sequence.
  • nucleic acid bases In the context of the present invention, the following abbreviations for the commonly occurring nucleic acid bases are used. "A” refers to adenosine, “C” refers to cytosine, “G” refers to guanosine, “T” refers to thymidine, and “U” refers to uridine.
  • modulate is meant to refer to any change in biological state, i.e. increasing, decreasing, and the like.
  • the term “modulate” refers to the ability to regulate positively or negatively the expression, stability or activity of IFNARl , including but not limited to transcription of IFNARl mRNA, stability of IFNARl mRNA, translation of IFNAR l mRNA, stability of IFNARl polypeptide, IFNARl post-translational modifications, or any combination thereof.
  • modulate can be used to refer to an increase, decrease, masking, altering, overriding or restoring of activity, including but not limited to, IFNARl activity.
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • nucleotide as used herein is defined as a chain of nucleotides.
  • nucleic acids are polymers of nucleotides.
  • nucleic acids and polynucleotides as used herein are interchangeable.
  • nucleic acids are polynucleotides, which can be hydrolyzed into the monomeric “nucleotides.” The monomeric nucleotides can be hydrolyzed into nucleosides.
  • polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCRTM, and the like, and by synthetic means.
  • recombinant means i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCRTM, and the like, and by synthetic means.
  • polypeptide as used herein is defined as a chain of amino acid residues, usually having a defined sequence. As used herein the term polypeptide is mutually inclusive of the terms “peptide” and "protein”.
  • proliferation is used herein to refer to the reproduction or multiplication of similar forms of entities, for example proliferation of a cell. That is, proliferation encompasses production of a greater number of cells, and can be measured by, among other things, simply counting the numbers of cells, measuring incorporation of 3 H- thymidine into the cell, and the like.
  • promoter as used herein is defined as a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
  • promoter/regulatory sequence means a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence.
  • this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
  • the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
  • a “constitutive" promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
  • an “inducible" promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
  • tissue-specific promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
  • RNA as used herein is defined as ribonucleic acid.
  • recombinant DNA as used herein is defined as DNA produced by joining pieces of DNA from different sources.
  • recombinant polypeptide as used herein is defined as a polypeptide produced by using recombinant DNA methods.
  • self-antigen as used herein is defined as an antigen that is expressed by a host cell or tissue. Self-antigens may be tumor antigens, but in certain embodiments, are expressed in both normal and tumor cells. A skilled artisan would readily understand that a self-antigen may be overexpressed in a cell.
  • a “substantially purified” cell is a cell that is essentially free of other cell types. A substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state. In some instances, a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state. In some embodiments, the cells are culture in vitro. In other embodiments, the cells are not cultured in vitro.
  • T-cell as used herein is defined as a thymus-derived cell that participates in a variety of cell-mediated immune reactions.
  • B-cell as used herein is defined as a cell derived from the bone marrow and/or spleen. B cells can develop into plasma cells which produce antibodies.
  • “Therapeutically effective amount” is an amount of a composition of the invention, that when administered to a patient, ameliorates a symptom of the disease.
  • the amount of a composition of the invention which constitutes a “therapeutically effective amount” will vary depending on the composition, the disease state and its severity, the age of the patient to be treated, and the like. The therapeutically effective amount can be determined routinely by one of ordinary skill in the art having regard to his own knowledge and to this disclosure.
  • "Patient” for the purposes of the present invention includes humans and other animals, particularly mammals, and other organisms.
  • the methods are applicable to both human therapy and veterinary applications.
  • the patient is a mammal, and in a most preferred embodiment the patient is human.
  • the terms “treat,” “treating,” and “treatment,” refer to therapeutic or preventative measures described herein.
  • the methods of “treatment” employ administration to a subject, in need of such treatment, a composition of the present invention, for example, a subject having a disorder mediated by IFNARl or a subject who ultimately may acquire such a disorder, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of the disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
  • transfected or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
  • the cell includes the primary subject cell and its progeny.
  • under transcriptional control or "operatively linked” as used herein means that the promoter is in the correct location and orientation in relation to a polynucleotide to control the initiation of transcription by RNA polymerase and expression of the polynucleotide.
  • vaccine as used herein is defined as a material used to provoke an immune response after administration of the material to a mammal.
  • a “vector” is a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
  • vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compositions, plasmids, and viruses.
  • the term “vector” includes an autonomously replicating plasmid or a virus.
  • the term should also be construed to include non-plasmid and non- viral compositions which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compositions, liposomes, and the like.
  • examples of viral vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, and the like.
  • Xenogeneic refers to a graft derived from an animal of a different species.
  • range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual and partial numbers within that range, for example, I 5 2, 3, 4, 5, 5.5 and 6. This applies regardless of the breadth of the range.
  • IFNARl and methods of treating diseases that are amenable to therapeutic effects of endogenous IFN or pharmaceutical IFN-based drugs whose effects are mediated by IFNARl using the compositions of the invention.
  • Diseases that are treated by IFN include, but are not limited to, cancer, multiple sclerosis and other autoimmune diseases, and viral infections.
  • the present invention relates to the discovery that UPR triggers activation of PERK to promote ligand-and Jak-independent phosphorylation of IFNARl within its phospho-degron, leading to IFNARl ubiquitination and degradation as well as to suppress Type I IFN signaling.
  • UPR triggers activation of PERK in the context of a viral infection.
  • the invention includes compositions and methods of targeting PERK in treatment of viral infections or other diseases that benefit from IFN..
  • the present invention also relates to the discovery that activity of PKD2 is required for ligand-and Jak-dependent phosphorylation of IFNARl within its phospho- degron, leading to IFNARl ubiquitination and degradation as well as to suppress Type I IFN signaling. Accordingly, the invention includes compositions and methods of targeting PKD in treatment of viral infections or other diseases that benefit from IFN.
  • the present invention also relates to the discovery that regardless of how phosphorylation-dependent ubiquitination of IFNARl proceeds, the endocytosis and degradation of IFNARl (as well as the extent of Type I IFN signaling) requires activity of PTPlB. Accordingly, the invention includes compositions and methods of targeting PTPlB in treatment of viral infections or other diseases that benefit from IFN.
  • compositions and methods for increasing the efficacy of endogenous IFN and/or enhancement of efficacy of an IFN- based treatment are also included in the invention.
  • the invention is based on the discovery that inhibition of a regulator of IFNARl, such as, for example, PERK, PTPlB, or PKD2, can modulate the stability of IFNARl and provide a therapeutic benefit by increasing the efficacy of endogenous IFN and/or enhancement of efficacy of an IFN-based treatment.
  • the present invention relates to the discovery that inhibition of regulator of IFNARl, such as, for example, PERK 3 PTPl B, or PKD2, provides a therapeutic benefit.
  • the invention comprises compositions and methods for modulating any of these proteins in a cell thereby enhancing IFN response in the cell.
  • the present invention includes a generic concept for inhibiting a negative regulator of stability and signaling of IFNARl or a functional equivalent thereof.
  • the negative regulator is PERK, PTPlB, and/or PKD2. Inhibiting any one or more of these proteins is associated with increasing the stability of IFNARl .
  • the invention includes inhibiting at least one of the aforementioned targets to increase the efficacy of endogenous IFN and/or enhancement of efficacy of an IFN-based treatment.
  • the invention comprises a composition comprising an inhibitor of any one or more of the following regulators: PERK, PTPlB, or PKD2.
  • the composition comprising the inhibitor is selected from the group consisting of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
  • siRNA small interfering RNA
  • microRNA an antisense nucleic acid
  • a ribozyme an expression vector encoding a transdominant negative mutant
  • an intracellular antibody a peptide and a small molecule.
  • an inhibitor useful in the methods of the invention is sangivamycin.
  • Other non-limiting example of inhibitors useful in the methods of the invention are quinoline-difluoromethylphosphonate and naphthalene- difluoromethylphosphonate, and derivatives thereof, such as those described in Han et al. (2008, Bioorganic & Medicinal Chemistry Letters 18:3200-3205).
  • inhibitors useful in the methods of the invention are trifluoromethyl sulfonyl and derivatives thereof, benzooxathiazonle and derivatives thereof, cinnamic acid and derivatives thereof, hydroxyphenyl azole and derivatives thereof, pyrrol phenoxy propionic acid and derivatives thereof, phenylalanine and derivatives thereof, 3'-carboxy- 4'-(O-carboxymethyl)-tyrosine and derivatives thereof, ertiprotfib and derivatives thereof NNC-52-1236 and derivatives thereof, A-366901 and derivatives thereof, A-321842 and derivatives thereof, 1,2-naphtoquinone and derivatives thereof, 4'- phosphenyldifluoromethyl-phenylanaline and derivatives thereof, aryldifluoromethylphosphonic acid and derivatives thereof.
  • nucleotide sequences may encode the same polypeptide. That is, an amino acid may be encoded by one of several different codons, and a person skilled in the art can readily determine that while one particular nucleotide sequence may differ from another, the polynucleotides may in fact encode polypeptides with identical amino acid sequences. As such, polynucleotides that vary due to differences in codon usage are specifically contemplated by the present invention.
  • one way to decrease the mRNA and/or protein levels of PERK, PTP 1 B, and/or PKD2 in a cell is by reducing or inhibiting expression of the nucleic acid encoding the regulator.
  • the protein level of the regulator in a cell can also be decreased using a molecule or composition that inhibits or reduces gene expression such as, for example, an antisense molecule or a ribozyme.
  • the modulating sequence is an antisense nucleic acid sequence which is expressed by a plasmid vector.
  • the antisense expressing vector is used to transfect a mammalian cell or the mammal itself, thereby causing reduced endogenous expression of a desired regulator in the cell.
  • the invention should not be construed to be limited to inhibiting expression of a regulator by transfection of cells with antisense molecules. Rather, the invention encompasses other methods known in the art for inhibiting expression or activity of a protein in the cell including, but not limited to, the use of a ribozyme, the expression of a non-functional regulator (i.e. transdominant negative mutant) and use of an intracellular antibody.
  • Antisense molecules and their use for inhibiting gene expression are well known in the art (see, e.g., Cohen, 1989, In: Oligodeoxyribonucleotides, Antisense Inhibitors of Gene Expression, CRC Press).
  • Antisense nucleic acids are DNA or RNA molecules that are complementary, as that term is defined elsewhere herein, to at least a portion of a specific mRNA molecule (Weintraub, 1990, Scientific American 262:40). In the cell, antisense nucleic acids hybridize to the corresponding mRNA, forming a double- stranded molecule thereby inhibiting the translation of genes.
  • antisense molecules may be provided to the cell via genetic expression using DNA encoding the antisense molecule as taught by Inoue, 1993, U.S. Patent No. 5, 190,931.
  • antisense molecules of the invention may be made synthetically and then provided to the cell.
  • Antisense oligomers of between about 10 to about 30, and more preferably about 15 nucleotides, are preferred, since they are easily synthesized and introduced into a target cell.
  • Synthetic antisense molecules contemplated by the invention include oligonucleotide derivatives known in the art which have improved biological activity compared to unmodified oligonucleotides (see U.S. Patent No. 5,023,243).
  • Ribozymes and their use for inhibiting gene expression are also well known in the art (see, e.g., Cech et al., 1992, J. Biol. Chem. 267: 17479-17482; Hampel et al., 1989, Biochemistry 28:4929-4933; Eckstein et al., International Publication No. WO 92/07065; Altman et al., U.S. Patent No. 5,168,053).
  • Ribozymes are RNA molecules possessing the ability to specifically cleave other single-stranded RNA in a manner analogous to DNA restriction endonucleases.
  • RNA molecules can be engineered to recognize specific nucleotide sequences in an RNA molecule and cleave it (Cech, 1988, J. Amer. Med, Assn. 260:3030).
  • ech 1988, J. Amer. Med, Assn. 260:3030.
  • a major advantage of this approach is the fact that ribozymes are sequence-specific.
  • ribozymes There are two basic types of ribozymes, namely, tetrahymena-type (Hasselhoff, 1988, Nature 334:585) and hammerhead-type. Tetrahymena-type ribozymes recognize sequences which are four bases in length, while hammerhead-type ribozymes recognize base sequences 1 1-18 bases in length. The longer the sequence, the greater the likelihood that the sequence will occur exclusively in the target mRNA species. Consequently, hammerhead-type ribozymes are preferable to tetrahymena-type ribozymes for inactivating specific mRNA species, and 18-base recognition sequences are preferable to shorter recognition sequences which may occur randomly within various unrelated mRNA molecules.
  • Ribozymes useful for inhibiting the expression of a regulator may be designed by incorporating target sequences into the basic ribozyme structure which are complementary to the mRNA sequence of the desired regulator of the present invention, including but are not limited to, PERK, PTPlB, PKD2and equivalents thereof. Ribozymes targeting the desired regulator may be synthesized using commercially available reagents (Applied Biosystems, Inc., Foster City, CA) or they may be genetically expressed from DNA encoding them.
  • the regulator can be inhibited by way of inactivating and/or sequestering the regulator.
  • inhibiting the effects of a regulator can be accomplished by using a transdominant negative mutant.
  • an antibody specific for the desired regulator, otherwise known as an antagonist to the regulator may be used.
  • the antagonist is a protein and/or composition having the desirable property of interacting with a binding partner of the regulator and thereby competing with the corresponding wild-type regulator.
  • the antagonist is a protein and/or composition having the desirable property of interacting with the regulator and thereby sequestering the regulator.
  • any antibody that can recognize and bind to an antigen of interest is useful in the present invention. That is, the antibody can inhibit a regulator of IFNARl such as PERK, PTPlB, and/or PKD2 provides a beneficial effect.
  • a regulator of IFNARl such as PERK, PTPlB, and/or PKD2 provides a beneficial effect.
  • polyclonal antibodies useful in the present invention are generated by immunizing rabbits according to standard immunological techniques well-known in the art (see, e.g., Harlow et al., 1988, In: Antibodies, A Laboratory Manual, Cold Spring
  • Such techniques include immunizing an animal with a chimeric protein comprising a portion of another protein such as a maltose binding protein or glutathione (GSH) tag polypeptide portion, and/or a moiety such that the antigenic protein of interest is rendered immunogenic (e.g., an antigen of interest conjugated with keyhole limpet hemocyanin, KLH) and a portion comprising the respective antigenic protein amino acid residues.
  • the chimeric proteins are produced by cloning the appropriate nucleic acids encoding the marker protein into a plasmid vector suitable for this purpose, such as but not limited to, pMAL-2 or pCMX.
  • the invention should not be construed as being limited solely to methods and compositions including these antibodies or to these portions of the antigens. Rather, the invention should be construed to include other antibodies, as that term is defined elsewhere herein, to antigens, or portions thereof.
  • the present invention should be construed to encompass antibodies, inter alia, bind to the specific antigens of interest, and they are able to bind the antigen present on Western blots, in solution in enzyme linked immunoassays, in fluorescence activated cells sorting (FACS) assays, in magnetic-activated cell sorting (MACS) assays, and in immunofluorescence microscopy of a cell transiently transfected with a nucleic acid encoding at least a portion of the antigenic protein, for example.
  • FACS fluorescence activated cells sorting
  • MCS magnetic-activated cell sorting
  • the antibody can specifically bind with any portion of the antigen and the full-length protein can be used to generate antibodies specific therefor.
  • the present invention is not limited to using the full-length protein as an immunogen. Rather, the present invention includes using an immunogenic portion of the protein to produce an antibody that specifically binds with a specific antigen. That is, the invention includes immunizing an animal using an immunogenic portion, or antigenic determinant, of the antigen.
  • polyclonal antibodies The generation of polyclonal antibodies is accomplished by inoculating the desired animal with the antigen and isolating antibodies which specifically bind the antigen therefrom using standard antibody production methods such as those described in, for example, Harlow et al. (1988, In: Antibodies, A Laboratory Manual, Cold Spring Harbor, NY).
  • Monoclonal antibodies directed against full length or peptide fragments of a protein or peptide may be prepared using any well known monoclonal antibody preparation procedures, such as those described, for example, in Harlow et al. (1988, In: Antibodies, A Laboratory Manual, Cold Spring Harbor, NY) and in Tuszynski et al. (1988, Blood, 72: 109-1 15). Quantities of the desired peptide may also be synthesized using chemical synthesis technology. Alternatively, DNA encoding the desired peptide may be cloned and expressed from an appropriate promoter sequence in cells suitable for the generation of large quantities of peptide. Monoclonal antibodies directed against the peptide are generated from mice immunized with the peptide using standard procedures as referenced herein.
  • Nucleic acid encoding the monoclonal antibody obtained using the procedures described herein may be cloned and sequenced using technology which is available in the art, and is described, for example, in Wright et al. (1992, Critical Rev. Immunol. 12:125-168), and the references cited therein. Further, the antibody of the invention may be "humanized” using the technology described in, for example, Wright et al., and in the references cited therein, and in Gu et al. (1997, Thrombosis and Hematocyst 77:755-759), and other methods of humanizing antibodies well-known in the art or to be developed.
  • the present invention also includes the use of humanized antibodies specifically reactive with epitopes of an antigen of interest.
  • the humanized antibodies of the invention have a human framework and have one or more complementarity determining regions (CDRs) from an antibody, typical ly a mouse antibody, specifically reactive with an antigen of interest.
  • CDRs complementarity determining regions
  • the antibody used in the invention is humanized, the antibody may be generated as described in Queen, et al. (U.S. Patent No. 6, 180,370), Wright et al., (supra) and in the references cited therein, or in Gu et al. (1997, Thrombosis and Hematocyst 77(4):755 ⁇ 759). The method disclosed in Queen et al.
  • humanized immunoglobulins that are produced by expressing recombinant DNA segments encoding the heavy and light chain complementarity determining regions (CDRs) from a donor immunoglobulin capable of binding to a desired antigen, such as an epitope on an antigen of interest, attached to DNA segments encoding acceptor human framework regions.
  • CDRs complementarity determining regions
  • the invention in the Queen patent has applicability toward the design of substantially any humanized immunoglobulin. Queen explains that the DNA segments will typically include an expression control DNA sequence operably linked to the humanized immunoglobulin coding sequences, including naturally-associated or heterologous promoter regions.
  • the expression control sequences can be eukaryotic promoter systems in vectors capable of transforming or transfecting eukaryotic host cells or the expression control sequences can be prokaryotic promoter systems in vectors capable of transforming or transfecting prokaryotic host cells.
  • the vector Once the vector has been incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of the introduced nucleotide sequences and as desired the collection and purification of the humanized light chains, heavy chains, light/heavy chain dimers or intact antibodies, binding fragments or other immunoglobulin forms may follow (Beychok, Cells of Immunoglobulin Synthesis, Academic Press, New York, (1979), which is incorporated herein by reference).
  • the invention also includes functional equivalents of the antibodies described herein.
  • Functional equivalents have binding characteristics comparable to those of the antibodies, and include, for example, hybridized and single chain antibodies, as well as fragments thereof. Methods of producing such functional equivalents are disclosed in PCT Application WO 93/213 19 and PCT Application WO 89/09622. Functional equivalents include polypeptides with amino acid sequences substantially the same as the amino acid sequence of the variable or hypervariable regions of the antibodies.
  • Substantially the same amino acid sequence is defined herein as a sequence with at least 70%, preferably at least about 80%, more preferably at least about 90%, even more preferably at least about 95%, and most preferably at least 99% homology to another amino acid sequence (or any integer in between 70 and 99), as determined by the FASTA search method in accordance with Pearson and Lipman, 1988 Proc. Nat'l. Acad. Sci. USA 85: 2444-2448.
  • Chimeric or other hybrid antibodies have constant regions derived substantially or exclusively from human antibody constant regions and variable regions derived substantially or exclusively from the sequence of the variable region of a monoclonal antibody from each stable hybridoma.
  • Single chain antibodies or Fv fragments are polypeptides that consist of the variable region of the heavy chain of the antibody linked to the variable region of the light chain, with or without an interconnecting linker.
  • the Fv comprises an antibody combining site.
  • Functional equivalents of the antibodies of the invention further include fragments of antibodies that have the same, or substantially the same, binding characteristics to those of the whole antibody. Such fragments may contain one or both Fab fragments or the F(ab') 2 fragment.
  • the antibody fragments contain all six complement determining regions of the whole antibody, although fragments containing fewer than all of such regions, such as three, four or five complement determining regions, are also functional.
  • the functional equivalents are members of the IgG immunoglobulin class and subclasses thereof, but may be or may combine with any one of the following immunoglobulin classes: IgM, IgA, IgD, or IgE, and subclasses thereof.
  • Heavy chains of various subclasses are responsible for different effector functions and thus, by choosing the desired heavy chain constant region, hybrid antibodies with desired effector function are produced.
  • exemplary constant regions are gamma 1 (IgGl), gamma 2 (IgG2), gamma 3 (IgG3), and gamma 4 (IgG4).
  • the light chain constant region can be of the kappa or lambda type.
  • the immunoglobulins of the present invention can be monovalent, divalent or polyvalent.
  • Monovalent immunoglobulins are dimers (HL) formed of a hybrid heavy chain associated through disulfide bridges with a hybrid light chain.
  • Divalent immunoglobulins are tetramers (H 2 L 2 ) formed of two dimers associated through at least one disulfide bridge.
  • Modification of nucleic acid molecules Inhibition of PERK, PTPlB, and/or PKD2 or their functional equivalents, resulting in modulation of IFNARl stability can be accomplished using a nucleic acid molecule.
  • the inhibitor is selected from the group consisting of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, and the likes.
  • siRNA small interfering RNA
  • microRNA a small interfering RNA
  • an antisense nucleic acid a ribozyme
  • an expression vector encoding a transdominant negative mutant and the likes.
  • modification of nucleic acid molecules is described in the context of an siRNA molecule.
  • the methods of modifying nucleic acid molecules can be applied to other types of nucleic acid based inhibitors of the invention.
  • an siRNA polynucleotide is an RNA nucleic acid molecule that interferes with RNA activity that is generally considered to occur via a post-transcriptional gene silencing mechanism.
  • An siRNA polynucleotide preferably comprises a double-stranded RNA (dsRNA) but is not intended to be so limited and may comprise a single-stranded RlMA (see, e.g., Martinez et al., 2002 Cell 1 10:563-74).
  • siRNA polynucleotide included in the invention may comprise other naturally occurring, recombinant, or synthetic single-stranded or double-stranded polymers of nucleotides (ribonucleotides or deoxyribonucleotides or a combination of both) and/or nucleotide analogues as provided herein (e.g., an oligonucleotide or polynucleotide or the like, typically in 5' to 3' phosphodiester linkage).
  • nucleotides ribonucleotides or deoxyribonucleotides or a combination of both
  • nucleotide analogues as provided herein (e.g., an oligonucleotide or polynucleotide or the like, typically in 5' to 3' phosphodiester linkage).
  • Preferred siRNA polynucleotides comprise double-stranded polynucleotides of about 18-30 nucleotide base pairs, preferably about ] 8, about 19, about 20, about 21 , about 22, about 23, about 24, about 25, about 26, or about 27 base pairs, and in other preferred embodiments about 19, about 20, about 21, about 22 or about 23 base pairs, or about 27 base pairs, whereby the use of "about” indicates that in certain embodiments and under certain conditions the processive cleavage steps that may give rise to functional siRNA polynucleotides that are capable of interfering with expression of a selected polypeptide may not be absolutely efficient.
  • siRNA polynucleotides may include one or more siRNA polynucleotide molecules that may differ (e.g., by nucleotide insertion or deletion) in length by one, two, three, four or more base pairs as a consequence of the variability in processing, in biosynthesis, or in artificial synthesis of the siRNA.
  • the siRNA polynucleotide of the present invention may also comprise a polynucleotide sequence that exhibits variability by differing (e.g., by nucleotide substitution, including transition or transversion) at one, two, three or four nucleotides from a particular sequence.
  • siRNA polynucleotide sequence can occur at any of the nucleotide positions of a particular siRNA polynucleotide sequence, depending on the length of the molecule, whether situated in a sense or in an antisense strand of the double-stranded polynucleotide.
  • the nucleotide difference may be found on one strand of a double- stranded polynucleotide, where the complementary nucleotide with which the substitute nucleotide would typically form hydrogen bond base pairing, may not necessarily be correspondingly substituted.
  • the siRNA polynucleotides are homogeneous with respect to a specific nucleotide sequence.
  • the si RNAs of the present invention may effect silencing of the target polypeptide expression to different degrees.
  • the siRNAs thus must first be tested for their effectiveness. Selection of siRNAs are made therefrom based on the ability of a given siRNA to interfere with or modulate the expression of the target polypeptide. Accordingly, identification of specific siRNA polynucleotide sequences that are capable of interfering with expression of a desired target polypeptide requires production and testing of each siRNA.
  • the methods for testing each siRNA and selection of suitable siRNAs for use in the present invention are fully set forth herein the Examples.
  • Polynucleotides of the siRNA may be prepared using any of a variety of techniques, which are useful for the preparation of specifically desired siRNA polynucleotides.
  • a polynucleotide may be amplified from a cDNA prepared from a suitable cell or tissue type.
  • Such a polynucleotide may be amplified via polymerase chain reaction (PCR).
  • PCR polymerase chain reaction
  • An amplified portion of the primer may be used to isolate a full-length gene, or a desired portion thereof, from a suitable DNA library using well known techniques.
  • a library (cDNA or genomic) is screened using one or more polynucleotide probes or primers suitable for amplification.
  • the library is size-selected to include larger polynucleotide sequences. Random primed libraries may also be preferred in order to identify 5' and other upstream regions of the genes. Genomic libraries are preferred for obtaining introns and extending 5' sequences.
  • the siRNA polynucleotide contemplated by the present invention may also be selected from a library of siRNA polynucleotide sequences.
  • a partial polynucleotide sequence may be labeled (e.g., by nick-translation or end-labeling with 32 P) using well known techniques.
  • a bacteria] or bacteriophage library may then be screened by hybridization to filters containing denatured bacterial colonies (or lawns containing phage plaques) with the labeled probe (see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual,
  • Hybridizing colonies or plaques are selected and expanded, and the DNA is isolated for further analysis.
  • amplification techniques are known in the art for obtaining a full-length coding sequence from a partial cDNA sequence. Within such techniques, amplification is generally performed via PCR.
  • One such technique is known as "rapid amplification of cDNA ends" or RACE (see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratories, Cold Spring Harbor, N. Y., 2001).
  • siRNA polynucleotide sequences useful for interfering with target polypeptide expression are presented in the Examples, the Drawings, and in the Sequence Listing included herein.
  • siRNA polynucleotides may generally be prepared by any method known in the art, including, for example, solid phase chemical synthesis. Modifications in a polynucleotide sequence may also be introduced using standard mutagenesis techniques, such as oligonucleotide-directed site- specific mutagenesis. Further, siRNAs may be chemically modified or conjugated with other molecules to improve their stability and/or delivery properties. Included as one aspect of the invention are siRNAs as described herein, wherein one or more ribose sugars has been removed therefrom.
  • siRNA polynucleotide molecules may be generated by in vitro or in vivo transcription of suitable DNA sequences (e.g., polynucleotide sequences encoding a target polypeptide, or a desired portion thereof), provided that the DNA is incorporated into a vector with a suitable RNA polymerase promoter (such as for example, T7, U6, Hl, or SP6 although other promoters may be equally useful).
  • a suitable RNA polymerase promoter such as for example, T7, U6, Hl, or SP6 although other promoters may be equally useful.
  • an siRNA polynucleotide may be administered to a mammal, as may be a DNA sequence (e.g., a recombinant nucleic acid construct as provided herein) that supports transcription (and optionally appropriate processing steps) such that a desired siRNA is generated in vivo.
  • an siRNA polynucleotide wherein the siRNA polynucleotide is capable of interfering with expression of a target polypeptide can be used to generate a silenced cell.
  • Any siRNA polynucleotide that, when contacted with a biological source for a period of time, results in a significant decrease in the expression of the target polypeptide is included in the invention.
  • the decrease is greater than about 10%, more preferably greater than about 20%, more preferably greater than about 30%, more preferably greater than about 40%, about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95% or about 98% relative to the expression level of the target polypeptide detected in the absence of the siRNA.
  • the presence of the siRNA polynucleotide in a cell does not result in or cause any undesired toxic effects, for example, apoptosis or death of a cell in which apoptosis is not a desired effect of RNA interference.
  • the siRNA polynucleotide that, when contacted with a biological source for a period of time, results in a significant decrease in the expression of the target polypeptide.
  • the decrease is about 10%-20%, more preferably about 20%-30%, more preferably about 30%-40%, more preferably about 40%-50%, more preferably about 50%-60%, more preferably about 60%-70%, more preferably about 70%-80%, more preferably about 80%-90%, more preferably about 90%-95%, more preferably about 95%-98% relative to the expression level of the target polypeptide detected in the absence of the siRNA.
  • the presence of the siRNA polynucleotide in a cell does not result in or cause any undesired toxic effects.
  • the siRNA polynucleotide that, when contacted with a biological source for a period of time, results in a significant decrease in the expression of the target polypeptide.
  • the decrease is about 10% or more, more preferably about 20% or more, more preferably about 30% or more, more preferably about 40% or more, more preferably about 50% or more, more preferably about 60% or more, more preferably about 70% or more, more preferably about 80% or more, more preferably about 90% or more, more preferably about 95 % or more, more preferably about 98% or more relative to the expression level of the target polypeptide detected in the absence of the siRNA.
  • the presence of the siRNA polynucleotide in a cell does not result in or cause any undesired toxic effects.
  • Any polynucleotide of the invention may be further modified to increase its stability in vivo. Possible modifications include, but are not limited to, the addition of flanking sequences at the 5' and/or 3' ends; the use of phosphorothioate or 2' O-methyl rather than phosphodiester linkages in the backbone; and/or the inclusion of nontraditional bases such as inosine, queosine, and wybutosine and the like, as well as acetyl-methyl-, thio-and other modified forms of adenine, cytidine, guanine, thymine, and uridine.
  • the invention includes an isolated nucleic acid encoding an inhibitor, preferably an siRNA, that inhibits a regulator of IFNARI , operably linked to a nucleic acid comprising a promoter/regulatory sequence such that the nucleic acid is preferably capable of directing expression of the protein encoded by the nucleic acid.
  • the isolated nucleic acid is an antisense nucleic acid encoding an antisense inhibitor.
  • the invention encompasses expression vectors and methods for the introduction of exogenous DNA into cells with concomitant expression of the exogenous DNA in the cells such as those described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
  • the desired polynucleotide can be cloned into a number of types of vectors.
  • the present invention should not be construed to be limited to any particular vector. Instead, the present invention should be construed to encompass a wide plethora of vectors which are readily available and/or well-known in the art.
  • a desired polynucleotide of the invention can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal viruse, and a cosmid.
  • Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
  • the expression vector is selected from the group consisting of a viral vector, a bacterial vector and a mammalian cell vector.
  • a viral vector a viral vector
  • bacterial vector a viral vector
  • mammalian cell vector a mammalian cell vector.
  • the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001), and in Ausubel et al.
  • Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses.
  • a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers. (See, e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193.
  • At least one module in each promoter functions to position the start site for R]VA synthesis.
  • the best known example of this is the TATA box, but in some promoters lacking a TATA box, such as the promoter for the mammalian terminal deoxynucleotidyl transferase gene and the promoter for the SV40 genes, a discrete element overlying the start site itself helps to fix the place of initiation.
  • promoter elements i.e., enhancers
  • enhancers regulate the frequency of transcriptional initiation.
  • these are located in the region 30-1 10 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
  • tk thymidine kinase
  • the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
  • individual elements can function either co-operatively or independently to activate transcription.
  • a promoter may be one naturally associated with a gene or polynucleotide sequence, as may be obtained by isolating the 5' non-coding sequences located upstream of the coding segment and/or exon. Such a promoter can be referred to as "endogenous.”
  • an enhancer may be one naturally associated with a polynucleotide sequence, located either downstream or upstream of that sequence.
  • certain advantages will be gained by positioning the coding polynucleotide segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a polynucleotide sequence in its natural environment.
  • a recombinant or heterologous enhancer refers also to an enhancer not normally associated with a polynucleotide sequence in its natural environment.
  • Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other prokaryotic, viral, or eukaryotic cell, and promoters or enhancers not "naturally occurring," i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression.
  • sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCRTM, in connection with the compositions disclosed herein (U.S. Patent 4,683,202, U.S. Patent 5,928,906).
  • control sequences that direct transcription and/or expression of sequences within non-nuclear organelles such as mitochondria, chloroplasts, and the like, can be employed as well.
  • promoter and/or enhancer that effectively directs the expression of the DNA segment in the cell type, organelle, and organism chosen for expression.
  • Those of skill in the art of molecular biology generally know how to use promoters, enhancers, and eel) type combinations for protein expression, for example, see Sambrook et al. (2001).
  • the promoters employed may be constitutive, tissue-specific, inducible, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, such as is advantageous in the large-scale production of recombinant proteins and/or peptides.
  • the promoter may be heterologous or endogenous.
  • a promoter sequence exemplified in the experimental examples presented herein is the immediate early cytomegalovirus (CMV) promoter sequence.
  • CMV immediate early cytomegalovirus
  • This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
  • constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, Moloney virus promoter, the avian leukemia virus promoter, Epstein-Barr virus immediate early promoter, Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the muscle creatine promoter.
  • the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention.
  • an inducible promoter in the invention provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively Jinked when such expression is desired, or turning off the expression when expression is not desired.
  • inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
  • the invention includes the use of a tissue specific promoter, which promoter is active only in a desired tissue. Tissue specific promoters are well known in the art and include, but are not limited to, the HER-2 promoter and the PSA associated promoter sequences.
  • the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
  • the selectable marker may be carried on a separate piece of DNA and used in a co- transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
  • Useful selectable markers are known in the art and include, for example, antibiotic-resistance genes, such as neo and the like.
  • Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. Reporter genes that encode for easily assayable proteins are well known in the art. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a protein whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
  • Suitable reporter genes may include genes encoding luciferase, beta- galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (see, e.g., Ui-Tei et al., 2000 FEBS Lett. 479:79-82).
  • Suitable expression systems are well known and may be prepared using well known techniques or obtained commercially. Internal deletion constructs may be generated using unique internal restriction sites or by partial digestion of non-unique restriction sites. Constructs may then be transfected into cells that display high levels of siRNA polynucleotide and/or polypeptide expression.
  • the construct with the minimal 5' flanking region showing the highest level of expression of reporter gene is identified as the promoter.
  • Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
  • the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast or insect cell by any method in the art.
  • the expression vector can be transferred into a host cell by physical, chemical or biological means. It is readily understood that the introduction of the expression vector comprising the polynucleotide of the invention yields a silenced cell with respect to a regulator.
  • Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like.
  • Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sam brook et al. (2001 , Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
  • Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
  • Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
  • Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
  • Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • a preferred colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (i.e., an artificial membrane vesicle). The preparation and use of such systems is well known in the art.
  • assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; "biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
  • molecular biological assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR
  • biochemical assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
  • Any DNA vector or delivery vehicle can be utilized to transfer the desired polynucleotide to a cell in vitro or in vivo.
  • a preferred delivery vehicle is a liposome.
  • the above-mentioned delivery systems and protocols therefore can be found in Gene Targeting Protocols, 2ed., pp 1-35 (2002) and Gene Transfer and Expression Protocols, Vol. 7, Murray ed., pp 81-89 (1991).
  • Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes may be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh et al., 1991 , Targeted Diagn Ther 4:87-103).
  • the present invention also encompasses compositions that have different structures in solution than the normal vesicular structure.
  • the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
  • lipofectamine-nucleic acid complexes are also contemplated.
  • the present invention includes an inhibitor of a regulator of IFNARl, including an inhibitor of any one or more of PERK, PTPlB, PKD2, or a functional equivalent of any of these proteins.
  • the present invention also provides compositions and methods to augment the efficacy of Type I IFlV.
  • the invention provides compositions and methods of treating diseases or disorders associated with dysfunctional IFN responses, such as cancer, autoimmune diseases, multiple sclerosis, and viral infections.
  • the present invention provides a use of an agent that is capable of inhibiting a regulator of IFNARl, including an inhibitor of any one or more of PERK, PTPlB, or PKD2, as a means to augment the efficacy of Type 1 IFN.
  • a vaccine useful for in vivo immunization comprises at least an inhibitor component, wherein the inhibitor component is able to inhibit degradation of IFNARl .
  • administration of an inhibitor of one or more of PERK, PTP lB, or PKD2 enhances the stability of IFNARl .
  • compositions of the present invention may be used in combination with existing therapeutic agents used to treat diseases or disorders associated with dysfunctional IFN responses, such as cancer, autoimmune diseases, multiple sclerosis, and viral infections.
  • the compositions of the invention may be used in combination these therapeutic agents to enhance the efficacy of Type I IFN.
  • an effective amount of a composition of the invention and a therapeutic agent is a synergistic amount.
  • a "synergistic combination" or a “synergistic amount” of a composition of the invention and a therapeutic agent is a combination or amount that is more effective in the therapeutic or prophylactic treatment of a disease than the incremental improvement in treatment outcome that could be predicted or expected from a merely additive combination of (i) the therapeutic or prophylactic benefit of the composition of the invention when administered at that same dosage as a monotherapy and (ii) the therapeutic or prophylactic benefit of the therapeutic agent when administered at the same dosage as a monotherapy.
  • the methods of the invention comprise administering a therapeutically effective amount of at least one composition that is an inhibitor of a regulator of IFNARl, including an inhibitor of any one or more of PERK, PTPlB, PKD2, or a functional equivalent of any of these proteins, to a cell, or to a subject in need thereof.
  • the methods of the invention comprise administering a therapeutically effective amount of at least one composition that is an activator of a regulator of IFNARl, including an activator of any one or more of PERK, PTPlB, PKD2, or a functional equivalent of any of these proteins, to a cell, or to a subject in need thereof.
  • the subject is a mammal.
  • the subject is a human.
  • the composition comprising the inhibitor is selected from the group consisting of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
  • siRNA small interfering RNA
  • microRNA microRNA
  • antisense nucleic acid e.g., a ribozyme
  • an expression vector encoding a transdominant negative mutant
  • intracellular antibody a peptide and a small molecule.
  • the present invention should in no way be construed to be limited to the inhibitors described herein, but rather should be construed to encompass any inhibitor of any modulator of IFNARl .
  • the methods of the invention comprise administering a therapeutically effective amount of at least one inhibitor to a subject.
  • the composition comprising the activator is selected from the group consisting of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
  • siRNA small interfering RNA
  • microRNA a microRNA
  • an antisense nucleic acid a ribozyme
  • an expression vector encoding a transdominant negative mutant an intracellular antibody
  • a peptide and a small molecule a small interfering RNA
  • the present invention should in no way be construed to be limited to the activators described herein, but rather should be construed to encompass any activator of any modulator of IFNARl .
  • the methods of the invention comprise administering a therapeutically effective amount of at least one activator to a subject.
  • inhibitors of the invention can be delivered to a cell in vitro or in vivo using vectors comprising one or more isolated inhibitor nucleic acid sequences.
  • the nucleic acid sequence has been incorporated into the genome of the vector.
  • the vector comprising a nucleic acid inhibitor described herein can be contacted with a cell in vitro or in vivo and infection or transfection can occur.
  • the cell can then be used experimentally to study, for example, the effect of a nucleic acid inhibitor in vitro.
  • the cell can be present in a biological sample obtained from a subject (e.g., blood, bone marrow, tissue, biological fluids, organs, etc.) and used in the treatment of disease, or can be obtained from cell culture.
  • viral vectors can be used to introduce an isolated nucleic acid inhibitor into animal cells.
  • viral vectors have been discussed elsewhere herein and include retrovirus, adenovirus, parvovirus (e.g., adeno-associated viruses), coronavirus, negative-strand RNA viruses such as orthomyxovirus (e.g., influenza virus), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g.
  • RNA viruses such as picornavirus and alphavirus
  • double stranded DNA viruses including adenovirus, herpesvirus (e.g., herpes simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g. vaccinia, fowlpox and canarypox).
  • herpesvirus e.g., herpes simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus
  • poxvirus e.g. vaccinia, fowlpox and canarypox
  • Other viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus and hepatitis virus, for example.
  • retroviruses examples include: avian leukosis-sarcoma, mammalian C-type, B-type viruses, D-type viruses, HTLV-BLV group, lentivirus (e.g. human immunodeficiency virus), and spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields et al., Eds., Lippincott-Raven Publishers, Philadelphia, 1996).
  • avian leukosis-sarcoma mammalian C-type
  • B-type viruses e.g. human immunodeficiency virus
  • HTLV-BLV group e.g. human immunodeficiency virus
  • spumavirus Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields et al., Eds., Lippincott-Raven Publishers, Philadelphia, 1996.
  • murine leukemia viruses include murine leukemia viruses, murine sarcoma viruses, mouse mammary tumor virus, bovine leukemia virus, feline leukemia virus, feline sarcoma virus, avian leukemia virus, human T-cell leukemia virus, baboon endogenous virus,
  • Gibbon ape leukemia virus Mason Pfizer monkey virus, simian immunodeficiency virus, simian sarcoma virus, Rous sarcoma virus, lentiviruses and baculoviruses.
  • an engineered viral vector can be used to deliver an isolated nucleic acid inhibitor of the present invention.
  • These vectors provide a means to introduce nucleic acids into cycling and quiescent cells, and have been modified to reduce cytotoxicity and to improve genetic stability.
  • the preparation and use of engineered Herpes simplex virus type 1 (Krisky et al., 1997, Gene Therapy 4: 1 120-1 125), adenoviral (Amalfitanl et al., 1998, Journal of Virology 72:926-933) attenuated lentiviral (Zufferey et al., 1997, Nature Biotechnology 15:871 -875) and adenoviral/retroviral chimeric (Feng et al., 1997, Nature Biotechnology 15:866-870) vectors are known to the skilled artisan.
  • a nucleic acid inhibitor can be delivered to cells without vectors, e.g. as "naked" nucleic acid delivery using methods known to those of skill in the art. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
  • Physical methods for introducing a nucleic acid into a host cell include, by way of examples, transfection, calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (2001, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
  • Chemical means for introducing a nucleic acid inhibitor into a host cell include, by way of examples, colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in- water emulsions, micelles, mixed micelles and liposomes.
  • colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in- water emulsions, micelles, mixed micelles and liposomes.
  • a preferred colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (i.e., an artificial membrane vesicle). The preparation and use of such systems is well known in the art.
  • nucleic acid inhibitor as described herein, can be administered or delivered to an animal cell (e.g., by virus, direct injection, or liposomes, or by any other suitable methods known in the art or later developed).
  • the methods of delivery can be modified to target certain cells, and in particular, cell surface receptor molecules.
  • the use of cationic lipids as a carrier for nucleic acid constructs provides an efficient means of delivering the nucleic acid inhibitor of the present invention.
  • cationic lipids have been used to deliver nucleic acids to cells (WO 91/17424; WO 91/16024; U.S. Pat. Nos. 4,897,355; 4,946,787; 5,049,386; and 5,208,036).
  • Cationic lipids have also been used to introduce foreign nucleic acids into frog and rat cells in vivo (Holt et al., 1990, Neuron 4:203-214; Hazinski et al., 1991 , Am. J. Respr. Cell. MoI. Biol. 4:206-209).
  • cationic lipids may be used, generally, as pharmaceutical carriers to provide biologically active substances (for example, see WO 91/17424; WO 91/16024; and WO 93/03709).
  • cationic liposomes can provide an efficient carrier for the introduction of nucleic acids into a cell.
  • liposomes can be used as carriers to deliver a nucleic acid inhibitor to a cell, tissue or organ. Liposomes comprising neutral or anionic lipids do not generally fuse with the target cell surface, but are taken up phagocytically, and the nucleic acids are subsequently subjected to the degradative enzymes of the lysosomal compartment (Straubinger et al., 1983, Methods Enzymol. 101 :512-527; Mannino et al., 1988, Biotechniques 6:682-690).
  • an isolated nucleic acid of the present invention can be a stable nucleic acid, and thus, may not be susceptible to degradative enzymes.
  • the isolated nucleic acid inhibitor of the present invention is relatively small, and therefore, liposomes are a suitable delivery vehicle for some embodiments of the present invention.
  • Methods of delivering a nucleic acid to a cell, tissue or organism, including liposome-mediated delivery, are known in the art and are described in, for example, Feigner (Gene Transfer and Expression Protocols Vol. 7, Murray, E. J. Ed., Humana Press, New Jersey, ( 1991)).
  • the invention includes an isolated nucleic acid inhibitor operably linked to a nucleic acid comprising a promoter/regulatory sequence such that the nucleic acid is preferably capable of delivering a nucleic acid inhibitor.
  • the invention encompasses expression vectors and methods for the introduction of an isolated nucleic acid inhibitor into or to cells.
  • Such delivery can be accomplished by generating a plasmid, viral, or other type of vector comprising an isolated nucleic acid inhibitor operably linked to a promoter/regulatory sequence which serves to introduce the nucleic acid inhibitor into cells in which the vector is introduced.
  • promoter/regulatory sequences useful for the methods of the present invention are available in the art and include, but are not limited to, for example, the cytomegalovirus immediate early promoter enhancer sequence, the SV40 early promoter, as well as the Rous sarcoma virus promoter, and the like.
  • inducible and tissue specific expression of an isolated nucleic acid inhibitor may be accomplished by placing an isolated nucleic acid inhibitor, with or without a tag, under the control of an inducible or tissue specific promoter/regulatory sequence.
  • tissue specific or inducible promoter/regulatory sequences which are useful for his purpose include, but are not limited to the MMTV LTR inducible promoter, and the SV40 late enhancer/promoter.
  • promoters which are well known in the art which are induced in response to inducing agents such as metals, glucocorticoids, and the like, are also contemplated in the invention.
  • the invention includes the use of any promoter/regulatory sequence, which is either known or unknown, and which is capable of driving expression of the desired protein operably linked thereto.
  • any particular plasmid vector or other vector is not a limiting factor in the invention and a wide plethora of vectors are well-known in the art, Further, it is well within the skill of the artisan to choose particular promoter/regulatory sequences and operably link those promoter/regulatory sequences to a DNA sequence encoding a desired polypeptide.
  • Such technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (2001 , Current Protocols in Molecular Biology, John Wiley & Sons, New York) and elsewhere herein.
  • an inhibitor composition of the invention comprising one or more of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule of the invention in a method of treatment can be achieved in a number of different ways, using methods known in the art.
  • siRNA small interfering RNA
  • microRNA an antisense nucleic acid
  • a ribozyme an expression vector encoding a transdominant negative mutant
  • an intracellular antibody a peptide and a small molecule of the invention in a method of treatment
  • Such methods include, but are not limited to, providing exogenous nucleic acids, antisense nucleic acids, polynucleotides, or oligonucleotides to a subject or expressing a recombinant nucleic acid, antisense nucleic acid, polynucleotide, or oligonucleotide expression cassette.
  • compositions useful for practicing the invention may be administered to deliver a dose of between 1 ng/kg/day and 100 mg/kg/day.
  • the invention envisions administration of a dose which results in a concentration of the compound of the present invention between 1 ⁇ M and 10 ⁇ M in a mammal.
  • the invention envisions administration of a dose which results in a concentration of the compound of the present invention between 1 ⁇ M and 10 ⁇ M in a cell of a mammal.
  • dosages which may be administered in a method of the invention to a subject range in amount from 0.5 ⁇ g to about 50 mg per kilogram of body weight of the animal. While the precise dosage administered will vary depending upon any number of factors, including but not limited to, the type of subject and type of disease state being treated, the age of the subject and the route of administration.
  • the dosage of the compound will vary from about 1 ⁇ g to about 10 mg per kilogram of body weight of the animal. More preferably, the dosage will vary from about 3 ⁇ g to about 1 mg per kilogram of body weight of the animal.
  • the inhibitor of the invention may be administered to a subject, or to a part of a subject such as a cell of an animal, as frequently as several times daily, or it may be administered less frequently, such as once a day, once a week, once every two weeks, once a month or even less frequently, such as once every several months or even once a year or less.
  • the frequency of the dose will be readily apparent to the skilled artisan and will depend upon any number of factors, such as, but not limited to, the type and severity of the disease being treated, the type and age of the subject, etc.
  • the formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with a carrier or one or more other accessory ingredients, and then, if necessary or desirable, shaping or packaging the product into a desired single- or multi-dose unit.
  • compositions are principally directed to pharmaceutical compositions which are suitable for ethical administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts, including mammals. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and perform such modification with merely ordinary, if any, experimentation. Subjects to which administration of the pharmaceutical compositions of the invention is contemplated include, but are not limited to, birds, humans and other primates, mammals including commercially relevant mammals such as non-human primates, cattle, pigs, horses, sheep, cats, and dogs.
  • compositions that are useful in the methods of the invention may be prepared, packaged, or sold in formulations suitable for ophthalmic, oral, rectal, vaginal, parenteral, topical, pulmonary, intranasal, buccal, or another route of administration.
  • Other contemplated formulations include projected nanoparticles, liposomal preparations, resealed erythrocytes containing the active ingredient, and immunologically-based formulations.
  • a pharmaceutical composition of the invention may be prepared, packaged, or sold in bulk, as a single unit dose, or as a plurality of single unit doses.
  • a unit dose is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
  • the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject or a convenient fraction of such a dosage such as, for example, one-half or one- third of such a dosage.
  • compositions of the invention will vary, depending upon the identity, size, and condition of the subject treated and further depending upon the route by which the composition is to be administered.
  • the composition may comprise between 0.1% and 100% (w/w) active ingredient.
  • a pharmaceutical composition of the invention may further comprise one or more additional pharmaceutically active agents.
  • Controlled- or sustained-release formulations of a pharmaceutical composition of the invention may be made using conventional technology.
  • Parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue.
  • Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like.
  • parenteral administration is contemplated to include, but is not limited to, intraocular, intravitreal, subcutaneous, intraperitoneal, intramuscular, intrasternal injection, and intratumoral.
  • Formulations of a pharmaceutical composition suitable for parenteral administration comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampules or in multi-dose containers containing a preservative. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, creams, lotions, gels, and implantable sustained-release or biodegradable formulations.
  • Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents.
  • the active ingredient is provided in dry (i.e. powder or granular) form for reconstitution with a suitable vehicle (e.g. sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition.
  • Formulations of a pharmaceutical composition suitable for topical (including mucosal) administration comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Formulations may be prepared, packaged, or sold in unit dosage form, such as in ampules or in multi-dose containers containing a preservative.
  • Formulations for topical administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, creams, lotions, gels, and implantable sustained-release or biodegradable formulations.
  • Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents.
  • the active ingredient is provided in dry (i.e. powder or granular) form for reconstitution with a suitable vehicle (e.g. sterile pyrogen-free water) prior to administration of the reconstituted composition.
  • a suitable vehicle e.g. sterile pyrogen-free water
  • the pharmaceutical compositions may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution.
  • This suspension or solution may be formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the dispersing agents, wetting agents, or suspending agents described herein.
  • Such sterile injectable formulations may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butane diol, for example.
  • a non-toxic parenterally-acceptable diluent or solvent such as water or 1,3-butane diol, for example.
  • Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono- or di-glycerides.
  • Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of a biodegradable polymer systems.
  • compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt.
  • a pharmaceutical composition of the invention may be prepared, packaged, or sold in a formulation suitable for pulmonary administration via the buccal cavity.
  • Such a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers, and preferably from about 1 to about 6 nanometers.
  • compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propel lant may be directed to disperse the powder or using a self-propelling solvent/powder-dispensing container such as a device comprising the active ingredient dissolved or suspended in a low-boiling propellant in a sealed container.
  • a self-propelling solvent/powder-dispensing container such as a device comprising the active ingredient dissolved or suspended in a low-boiling propellant in a sealed container.
  • such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. More preferably, at least 95% of the particles by weight have a diameter greater than 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers.
  • Dry powder compositions preferably include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
  • Low boiling propellants generally include liquid propellants having a boiling point of below 65 0 F at atmospheric pressure. Generally the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition.
  • the propellant may further comprise additional ingredients such as a liquid non-ionic or solid anionic surfactant or a solid diluent (preferably having a particle size of the same order as particles comprising the active ingredient).
  • compositions of the invention formulated for pulmonary delivery may also provide the active ingredient in the form of droplets of a solution or suspension.
  • Such formulations may be prepared, packaged, or sold as aqueous or dilute alcoholic solutions or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization or atomization device.
  • Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, or a preservative such as methylhydroxybenzoate.
  • the droplets provided by this route of administration preferably have an average diameter in the range from about 0.1 to about 200 nanometers.
  • formulations described herein as being useful for pulmonary delivery are also useful for intranasal delivery of a pharmaceutical composition of the invention.
  • Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered in the manner in which snuff is taken i.e. by rapid inhalation through the nasal passage from a container of the powder held close to the nares.
  • Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of the active ingredient, and may further comprise one or more of the additional ingredients described herein.
  • a pharmaceutical composition of the invention may be prepared, packaged, or sold in a formulation suitable for buccal administration.
  • Such formulations may, for example, be in the form of tablets or lozenges made using conventional methods, and may, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable or degradable composition and, optionally, one or more of the additional ingredients described herein.
  • formulations suitable for buccal administration may comprise a powder or an aerosolized or atomized solution or suspension comprising the active ingredient.
  • Such powdered, aerosolized, or aerosolized formulations, when dispersed preferably have an average particle or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.
  • compositions of the invention may also provide the active ingredient in the form of gels, hydrogels, creams, solutions or suspensions.
  • Gels and hydrogels may include but not limited to HydroxyEthyl Cellulose (HEC) gel, alginate gels or other gels or hydrogels.
  • HEC HydroxyEthyl Cellulose
  • Such formulations may be prepared, packaged, or sold as gels, hydrogels, creams, solutions, suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any suitable applicator device.
  • Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a buffering agent, a surface active agent, or a preservative such as sorbic acid or methylhydroxybenzoate.
  • additional ingredients include, but are not limited to, one or more of the following: excipients; surface active agents; dispersing agents; inert diluents; granulating and disintegrating agents; binding agents; lubricating agents; sweetening agents; flavoring agents; coloring agents; preservatives; physiologically degradable compositions such as gelatin; aqueous vehicles and solvents; oily vehicles and solvents; suspending agents; dispersing or wetting agents; emulsifying agents, demulcents; buffers; salts; thickening agents; fillers; emulsifying agents; antioxidants; antibiotics; antifungal agents; stabilizing agents; and pharmaceutically acceptable polymeric or hydrophobic materials.
  • compositions of the invention are known in the art and described, for example in Remington's Pharmaceutical Sciences (1985, Genaro, ed., Mack Publishing Co., Easton, PA), which is incorporated herein by reference.
  • Kits The invention also includes a kit comprising an inhibitor composition of the invention, or combinations thereof, and an instructional material which describes, for instance, administering the inhibitor composition of the invention, or combinations thereof, to a subject as a therapeutic treatment, or as a non-treatment use as described elsewhere herein.
  • the kit further comprises a (preferably sterile) pharmaceutically acceptable carrier suitable for dissolving or suspending the inhibitor composition of the invention, or combinations thereof, for instance, prior to administering the composition to a subject.
  • the kit comprises an applicator for administering the inhibitor composition.
  • Example 1 Virus-induced unfolded protein response attenuates anti-viral defenses via phosphorylation-dependent degradation of the Type 1 interferon receptor Phosphorylation-dependent ubiquitination and degradation of the IFNARl chain of Type I interferon (IFN) receptor is regulated by two different pathways, one of which is ligand-independent. The results presented herein demonstrate that this pathway is activated by inducers of the endoplasmic reticulum (ER) stress, including viral infection, in a PERK-dependent manner. Upon infection, activation of this pathway promotes phosphorylation-dependent ubiquitination and degradation of IFNARl, and specifically inhibits Type I IFN signaling and antiviral defenses.
  • ER endoplasmic reticulum
  • Plasmids and Reagents Vectors for bacterial expression of GST-ctIFNAR 1 and mammalian expression of human and mouse Flag-IFNARl were described previously (Kumar, et ai., 2004, J Biol Chem 279(45):46614-46620; Kumar et al,, 2007, Cancer Biol Ther 6(9); 1437-1441 ; Kumar, et al., 2003, Embo J 22(20):5480-5490); other plasmids were generous gifts (e.g., Flag-STATl , HCV constructs, and Cre). All shRNA constructs used were based on pLKO.1. Recombinant human IFN ⁇ 2 was purchased from Roche Diagnostics. Recombinant human and mouse IFN ⁇ and mouse IFN ⁇ were purchased from PBL. Thapsigargin, cycloheximide and methylamine HCl were purchased from Sigma.
  • Plasmid and viruses used are as follows: shCon (CAACAAGATGAAGAGCACCAA; SEQ ID NO: 1), shIREl ⁇ (GAGAAGATGATTGCGATGGAT; SEQ ID NO: 2) and shPERK (CCTCAAGCCATCCAACATATT; SEQ ID NO: 3) plasmids based on pLKO.
  • l -puro vector (Sigma) were used in either transient transfection experiments or were used to generate lentiviruses encoding the short hairpin sequences to infect 293T or 2fTGH cells.
  • DMEM Dulbecco's modified Eagle's medium
  • Hyclone 10% (v/v) fetal bovine serum
  • MEFs harboring PERK fl/tl were infected with control retrovirus or retrovirus expressing Cre.
  • the transduced cells were selected by puromycin for 72 hour. The surviving clones were pooled and used for further analysis.
  • IFNARl -null MEFs reconstituted with pBABE- puro-based retroviral vector encoding Flag-tagged mIFNARlwt and mIFNARl S526A were generated and cultured in the presence of 4 ⁇ g/ml of puromycin.
  • Huh7-derivative cells introduced with a complete HCV genome or a subgenomic genome were described in detail in (Luquin, et al., 2007, Antiviral Res 76(2): 194-197) and were cultured in the presence of 500 ⁇ g/ml of G41 8.
  • Mouse ES clone harboring a S526A mutation were obtained by homologous recombination.
  • the targeting vector containing this mutation ( Figure 3A) was introduced via electroporation into the C57/BL6 ES cells.
  • the cells were subjected to neomycin selection and DNA samples from survived clones were analyzed by Southern blotting using the indicated probes to identify the homologous recombinants.
  • ES cells were differentiated into embryonic bodies according to ATCC recommendations established protocol (Maatman, et al., 2003, Methods MoI Biol 209:201-230).
  • the embryonic bodies were trypsinized and plated in gelatinized plates using IMDM containing 10% FBS.
  • VSV Indiana serotype
  • Transfections and lentiviral vector-mediated gene knockdown Transfection of 293T cells and KR-2 cells using LIPOfectamine Plus and of Huh7-derivatives using LIPOfecatimine-2000 (Invitrogen) was carried out according to manufacturer's recommendations. Replication-deficient lentiviral particles encoding shRNA against GFP (shCON), hPERK and hIREl ⁇ , or the empty virus control were prepared via co-transfecting 293T cells with three other helper vectors as previously described (Dull, et al, 1998, J Virol 72(11):8463-8471).
  • Viral supernatant were concentrated by PEG8000 precipitation and were used to infect 2fTGH and U5A lines in the presence of 3 ⁇ g/ml of polybrene (Sigma). Cells were selected and maintained in the presence of 1.5 ⁇ g/ml of puromycin.
  • PERK-deficient MEFs and its WT counterparts were generous gifts from David Ron (New York University).
  • PKR ⁇ MEFs and their WT counterparts were generous gifts of R. Kaufman (University of Michigan).
  • 293T cells were transfected with shRNA plasmids using LIPOfectamine Plus reagent (Invitrogen) according to manufacture's instructions.
  • Studies on HCV were carried out using HCV genomic and subgenomic replicon system. Stable derivatives of Huh7 human hepatic cell line that express either incomplete genome of HCV (lacking structural proteins) or complete HCV genome (that expresses structural proteins as well) were generated and characterized as previously described (Luquin, et al., 2007, Antiviral Res 76(2): 194- 197).
  • Viral titer determination MEFs were infected with an apparent MOIO.1 of VSV for 1 h before the initial inoculum was removed and the cell layer was fed with medium after washed once with PBS. 20 h after infection, the virus-containing culture supernatant was harvested and the viral titer is determined according to previously published report (Sharma, et al., 2003, Science 300(5622): 1 148-1151). At the time of harvesting cells for biochemical analyses, cells were infected almost uniformly judging by saturation in the levels of viral markers.
  • Virus packaging was done in 293T cells as described elsewhere (Dull et al., 1998). Target cells were infected with concentrated virus in the presence of 3 ⁇ g/ml of polybrene. 48 h after transduction, 2fTGH and 293T cells were selected in medium containing 1.5 and 3 ⁇ g/ml of puromycin, respectively.
  • Monoclonal antibody 23Hl 2 specific for the M protein of VSV (VSV- M), was kindly provided by D. S.
  • PERK kinase assay using GST-cIFNARl as a substrate was performed using kinase buffer containing 20 mM HEPES 7.4, 50 mM KCI, 2 mM MgOAC, 2 mM MnC12, 20 ⁇ M ATP and 1.5 mM DTT. Recombinant PERK ⁇ N and GST-IFNARl were described previously (Cullinan et al., 2003, MoI Cell Biol 23:7198-7209; Kumar, et al., 2003, Embo J 22(20):5480-5490).
  • lysates from these transfected cells displayed an elevated ability to phosphorylate bacterially produced GST-IFNARl protein on Ser535 ( Figure IB) indicating that forced expression of IFNARl activates a signal transduction pathway inducing an unknown protein kinase activity that phosphorylates IFNARl within its degron.
  • Overexpression of secretory and transmembrane proteins (such as
  • IFNARl may overpower the ability of a cell to properly fold these proteins in the ER and, therefore initiate the UPR (Welihinda, et al., 1999, Gene Expr 7:293-300).
  • forced expression of IFNARl induced the markers of the UPR such as BiP and ATF4 and promoted phosphorylation of eIF2 ⁇ .
  • Similar results along with phosphorylation of endogenous IFNARl on Ser535 were obtained upon overexpression of unrelated IFN ⁇ receptor IFNARl ( Figure 9). It appears that eIF2 ⁇ phosphorylation was dependent on PERK as evident from experiments using RNAi approach to knock down this kinase ( Figures 10-1 1 ).
  • thapsigargin a known inducer of UPR stimulated phosphorylation of endogenous IFNARl on Ser535 in the absence of IFN ( Figure 1C). Similar results were obtained using other known UPR stimuli such as DTT ( Figure 12) and tunicamycin (not shown).
  • the UPR promotes IFNARl ubiquitination and degradation by inducing degron phosphorylation in a ligand-and Tyk2-independent manner
  • thapsigargin treatment induced ubiquitination of IFNARl and downregulated this receptor in human fibrosarcoma cells that express either wild type (WT) or catalytically inactive (KR) Tyk2 (Figure 2B) as well as in 293T cells ( Figure 15).
  • Ligand-independent stimulation of IFNARl ubiquitination by thapsigargin was also seen in IFNARl -null mouse fibroblasts reconstituted with IFNARlWT but not with IFNARl SA mutant lacking phosphorylation site ( Figure 16).
  • mice embryonic stem (ES) cells that harbor one mutant IFNARl S526A allele introduced via a homologous recombination approach was generated ( Figure 3A-B). These cells were grown as embryoid bodies (EB) and differentiated into fibroblast-like cells for analysis. Although treatment with thapsigargin induced a comparable level of eIF2 ⁇ phosphorylation in both wild type and S526A knock-in cells, the latter displayed a grossly reduced phosphorylation of IFNARl on Ser526 ( Figure 3C).
  • VSV and HCV accelerate the degradation of IFNARl via induction of PERK-dependent IFNARl degron phosphorylation
  • HCV hepatitis C virus
  • HCV hepatitis C virus
  • VSV and HCV attenuate cellular responses to Type I IFN via PERK-dependent phosphorylation and downregulation of IFNARl
  • IFNARl Attenuated anti-viral defense observed in cells from IFNARl+/-mice suggests that levels of IFNARl are important for Type I IFN signaling (Hwang et al., 1995, Proc Natl Acad Sci U S A 92(24): 1 1284- 1 1288; Muller, et al, 1994, Science 264(5167): 1918- 1921 ). Therefore, IFNARl downregulation triggered by UPR activation is expected to inhibit cellular responses to IFN- ⁇ / ⁇ .
  • PERK-deficient cells contained fewer viruses; however, even when exposed to a five-fold higher viral titer to achieve a comparable expression of VSV-M, these cells remained competent in IFN- ⁇ -induced activation of Statl (Figure 7C), Such protection was not seen in infected MEFs lacking a related kinase, PKR ( Figure 23). Specific role of PERK was further corroborated by data demonstrating that PERK knockdown in Huh7 cells expressing complete HCV genome also restored the ability of these cells to conduct Type I IFN signaling ( Figure 7D). These data suggest that PERK plays an important role in virus-mediated inhibition of cellular responses to IFN- ⁇ / ⁇ . PERK knockdown in human cells increased their overall resistance to
  • Ligand-stimulated, Jak-dependent ubiquitination and degradation of Type I IFN receptor plays a key role in the negative regulation of IFN- ⁇ / ⁇ signaling (Kumar, et al., 2003, Embo J 22(20):5480-5490).
  • recent evidence suggested the existence of a ligand-and Jak-independent pathway that controls stability of IFNARl in a phosphorylation-dependent manner.
  • the importance of the latter pathway remained unclear as it was largely observed under the conditions of IFNARl overexpression (Liu, et al., 2008, Biochem Biophys Res Commun 367(2):388-393).
  • IFNARl ligand-independent degradation of IFNARl could be of particular importance for a virus that has penetrated a na ⁇ ve cell and started to produce massive amounts of viral proteins to prepare for replication.
  • activation of ER-triggered IFNARl degron phosphorylation and ensuing degradation is expected to dramatically reduce the sensitivity of an infected cell to either exogenous or endogenously produced and secreted IFN- ⁇ / ⁇ (as seen in Figures 6-7). It is believed that such alterations benefit the offending virus in at least two ways.
  • IFNARl prevents an efficient induction of expression and activities of diverse anti-viral proteins (including 2 -5' oligoadenylate synthetases, the Mx proteins, PKR, and the double-stranded-RNA-specific adenosine deaminase) that are known to suppress various steps of viral replication (reviewed in (Guidotti et al., 2001 , Annu Rev Immunol 19:65-91)).
  • diverse anti-viral proteins including 2 -5' oligoadenylate synthetases, the Mx proteins, PKR, and the double-stranded-RNA-specific adenosine deaminase
  • IFNAR 1 inhibitors of PERK-dependent phosphorylation of IFNAR 1 represent a potent anti-viral activity.
  • Type I IFN also plays an important immunomodulatory role (Tompkins, 1999, J Interferon Cytokine Res 19(8): 817-828), it is believed that the effects of inhibitors of PERK-dependent phosphorylation of IFNARl is even more pronounced in vivo.
  • the inhibitors can be useful in treatment of patients with chronic viral infections (e.g., hepatitis C), multiple sclerosis and some malignancies.
  • chronic viral infections e.g., hepatitis C
  • multiple sclerosis e.g., multiple sclerosis
  • UPR for example, proteasome inhibitors (Fribley, et al., 2004, MoI Cell Biol 24(22):9695-9704; Nawrocki, et al., 2005, Cancer Res 65(24): 1 1510-1 1519; Obeng, et al., 2006, Blood 1 O7(12):49O7- 4916))
  • IFNARl e.g., inhibitors of PERK-dependent pathway
  • Example 2 Specific inhibition of PTPIB to augment the efficacy of endogenous and pharmaceutical Type I IFN Type 1 interferons (IFN) including diverse types of IFN ⁇ and IFN ⁇ are endogenously produced cytokine proteins that possess potent anti-tumor, anti-viral and immunomodulatory activities.
  • IFN Type 1 interferons
  • IFNs are being produced industrially; currently, several formulations have been developed and approved by FDA including Roferon-A (Roche US Pharmaceutical), Pegasys (Hoffmann-La Roche Inc.); Intron-A, Rebetron, Peg-lntron (Schering Plough Corporation), Alferon-N (Hemispherx Biopharma, Inc), Avonex (Biogen IDEC), Betaseron (Bayer Healthcare Pharmaceuticals Inc), and Infergen (Amgen, Inc). These modalities are often used in treatment of various cancers (e.g., leukemias and malignant melanoma), viral infections (e.g., hepatitis C) and autoimmune diseases (e.g., multiple sclerosis).
  • IFNs IFN- stimulated genes
  • This signal transduction cascade is under tight control of several layers of negative regulation that could be ligand specific (i.e., leads to suppression of only Type I IFNs signaling -that is receptor downregulation) or shared with other cytokines (for example, interferon gamma, growth hormone, interleukin 6, etc).
  • Nonspecific mechanisms include: (i) induction of Shpl/2 protein tyrosine phosphatases (PTP) that remove phospho-groups from JAKs and STATs, (ii) induction of SOCS proteins that inhibit and degrade JAKs; and (iii) induction of PlAS proteins that inhibit STAT transcriptional activities.
  • PTP Shpl/2 protein tyrosine phosphatases
  • Inhibitors of non-specific regulators are therefore expected to display substantial toxicity because they would be affecting numerous physiologic processes (e.g., hematopoiesis).
  • potent, IFNs as drugs pose a number of problems.
  • PTPl B inhibition of PTPl B can be accomplished using, but not limited to, genetic (e.g., RNAi) and pharmacologic approaches (known inhibitors of PTPlB).
  • the inhibitors of PTPl B is believed to be useful as anti-viral agents per se or used in the context of augmenting the effect of administered IFN-based drug.
  • IFNARl ubiquitination It has been demonstrated that lysosomal degradation of IFNARl requires its ubiquitination (Kumar et al., 2003 Embo J 22:5480-90). Further studies delineated the mechanisms by which IFNARl ubiquitination promotes endocytosis of this receptor. These mechanisms involve the unmasking of the Tyr466-based linear endocytic motif within the intracellular domain of IFNARl (Kumar et al., 2007 J Cell Biol 179:935-50).
  • Table 1 Conservation of Tyr-based endocvtic motif (YXX ⁇ bold font) in the proximal parts of the intracellular domains of IFNARl proteins from different species
  • IFNARl Upon IFN- ⁇ / ⁇ treatment, IFNARl undergoes ubiquitination that unmasks Tyr466 and allows it to interact with AP2 endocytic machinery complex leading to IFNARl endocytosis and subsequent lysosomal degradation of this receptor (Kumar et al., 2008 J Biol Chem 283: 18566-72). Tyr-based linear endocytic motifs are known to serve as a recognition site for the AP50 subunit of the AP2 complex (Bonifacino et al., 2003 Annu Rev Biochem 72:395-447).
  • tyrosine phosphatase activities play a role in regulating IFNARl endocytosis.
  • Data presented herein demonstrate that protein tyrosine phosphatase 1 B (known to interact with Tyk2, (Myers et al., 2001 J Biol Chem 276:47771-4.)) plays an important role in regulating the endocytosis of IFNARl and its ability to mediate anti-viral effects of IFN- ⁇ / ⁇ ( Figure 27).
  • the data presented herein demonstrates a novel endocytic mechanism that governs the downregulation of the IFNARl chain of IFN receptor. Remarkably, this downregulation depends on specific de-phosphorylation of a specific Tyr residue within IFNARl. This residue is present in most of known mammalian IFNARl sequences except in mouse IFNARl. Dephosphorylation of this Tyr is mediated by PTPIB -a tyrosine phosphatase that is an attractive target for treatment of diabetes and obesity against which selective inhibitors are being developed.
  • the results presented herein demonstrate that selective inhibition of PTPlB prevents IFNARl endocytosis and augments IFN responses (including anti-viral defense) in human but not mouse cells.
  • FIG. 29 depicts a list of PTPl B inhibitors being developed by pharmaceutical companies for treatment of diabetes and obesity (as reviewed in (Hooft van Huijsduijnen et al., 2004 J Med Chem 47:4142-6; Hooft van Huijsduijnen et al., 2002 Drug Discov Today 7: 1013-9)). These and additional inhibitors such as Trodusquemine (Geneara) and [(3-bromo-7-cyano-2-naphthyl)(difluoro)-methyl]phosphonic acid Merck) could be further used.
  • Trodusquemine Geneeara
  • [(3-bromo-7-cyano-2-naphthyl)(difluoro)-methyl]phosphonic acid Merck could be further used.
  • Example 3 Specific inhibition of protein kinase D2 (PKD2) to augment the efficacy of endogenous and pharmaceutical Type I IFN
  • Type I interferons including diverse types of IFNa and IFNP are endogenously produced cytokine proteins that possess potent anti-tumor, anti-viral and immunomodulatory activities. This is why IFNs are being produced industrially; currently, several formulations have been developed and approved by FDA including Roferon-A (Roche US Pharmaceutical), Pegasys (Hoffmann-La Roche Inc.); Intron-A, Rebetron, Peg-Intron (Schering Plough Corporation), Alferon-N (Hemispherx Biopharma, Inc), Avonex (Biogen IDEC), Betaseron (Bayer Healthcare Pharmaceuticals Inc), and Infergen (Amgen, Inc). These modalities are often used in treatment of various cancers (e.g., leukemias and malignant melanoma), viral infections (e.g., hepatitis C) and autoimmune diseases (e.g., multiple sclerosis).
  • cancers e.g., leukemias and malignant melanoma
  • IFNs IFN- stimulated genes
  • This signal transduction cascade is under tight control of several layers of negative regulation that could be ligand specific (i.e., leads to suppression of only Type I IFNs signaling -that is receptor downregulation) or shared with other cytokines (for example, interferon gamma, growth hormone, interleukin 6, etc).
  • Nonspecific mechanisms include: (i) induction of Shpl/2 protein tyrosine phosphatases (PTP) that remove phospho-groups from JAKs and STATs, (ii) induction of SOCS proteins that inhibit and degrade JAKs; and (iii) induction of PIAS proteins that inhibit STAT transcriptional activities.
  • PTP Shpl/2 protein tyrosine phosphatases
  • SOCS proteins that inhibit and degrade JAKs
  • PIAS proteins that inhibit STAT transcriptional activities.
  • IFNARl (its disappearance from cell surface) was shown to be a pivotal regulator of the extent of cellular responses to IFN. Research conducted in my lab and other groups over several years delineated the mechanisms of IFNARl downregulation. IFN stimulates a protein kinase that phosphorylates IFNARl on specific serine residues (Ser535 and Ser539 in human IFNARl).
  • This phosphorylation enables the recruitment of the beta-TrCP E3 ubiquitin ligase that ubiquitinates IFNARl (Kumar, et al., 2003, Embo J 22:5480-5490). This ubiquitination promotes exposure of a linear Tyr based endocytic motif within IFNARI that mediates internalization of this receptor followed by its lysosomal degradation (Kumar, et al., 2007, J Cel l Biol 179:935- 950). Phosphorylation of IFNARl by an IFN-inducible kinase plays a critical role in modulating cellular responses to IFN.
  • IFNARl mutant that cannot be phosphorylated demonstrated that this phosphorylation is critical for IFN signaling in general and efficacy of IFN in growth inhibition of human cancer cells in particular (Kumar, et al., 2003, Embo J 22:5480-5490). Human melanoma cells harboring this mutant exhibit a substantial delay in growth in vivo in xenograft mouse model (Kumar, et al., 2007, Cancer Biol Ther 6: 1437-1441). These studies demonstrate that inhibition of IFNARl kinase is a way to increase the efficacy of Type I IFN.
  • PTD2 Protein kinase D2
  • PKD2 Protein kinase D2
  • PKD2 is an IFNARl kinase that regulates IFNARI phosphorylation, ubiquitination, abundance and signaling. It has been observed that PKD2 can be inhibited using genetic (RNAi) and pharmacologic approaches (known inhibitors of PKD that are non-specific). Specific PKD2 inhibitors are believed to have anti-viral/anti- tumor/immunomodulatory effects per se or ability to augment the effect of administered IFN-based drug.
  • RNAi genetic
  • PKD2 inhibitors are believed to have anti-viral/anti- tumor/immunomodulatory effects per se or ability to augment the effect of administered IFN-based drug.
  • the invention encompasses compositions and methods relating to the use of selective inhibitors of PKD2 in order to stabilize IFNARl and the entire Type I IFN receptor.
  • This stabilization leads to an augmented response to IFN, which, in turn, translates into either a higher efficacy of endogenous IFlM or into an enhancement of efficacy of an IFN-based in treatment the diseases including (but not limited to) cancer, multiple sclerosis and viral infections.
  • IFN- ⁇ / ⁇ stimulate phosphorylation of Ser535 within human IFNARl (Ser526 in mouse receptor) to promote its interaction with the ⁇ Trcp E3 ubiquitin ligase.
  • This ligase stimulates IFNARl ubiquitination that leads to endocytosis of IFNARl and subsequent lysosomal degradation of IFNARl .
  • the latter decreases the sensitivity of cells to IFN- ⁇ / ⁇ (Kumar et al., 2003 Embo J, 22:5480-90).
  • the data presented herein identify protein kinase D2 (PKD2, a.k.a.
  • Prkd2 as a key kinase activated by IFN- ⁇ / ⁇ and promoting IFNARl phosphorylation. These data also show that inhibition of PKD2 promotes the signaling and anti-viral effects of IFN- ⁇ / ⁇ .
  • PKD2 inhibitors as sole agents in treatment of diseases that are treated by Type I IFN is envisioned.
  • these agents can be used in treatment of such diseases in combination with Type I IFN in order to (i) increase its efficacy (ii) decrease the dose and related development of anti-IFN antibody-dependent resistance and side effects, as well as decrease the costs and duration of treatment.
  • Use of selective PKD2 inhibitors allows for the specific augmentation of the efficacy of Type I IFN and to be used not only against cancers but also against viral infections and autoimmune diseases.
  • Figures 37 and 38 depict the results of example experiments demonstrating that sangivamycin inhibits PKD2 and increases the efficiency of IFN signaling.
  • Extracellular ligands induce signaling pathways that mediate their functions but also limit them by the proteolytic elimination of cognate receptors.
  • protein kinase D2 (PKD2) controls the ligand-inducible phosphorylation-dependent ubiquitination and degradation of the IFNARl chain of the Type I interferon (IFN) receptor.
  • IFN- ⁇ induces PKD2 in a Tyk2-activity-and tyrosine phosphorylation-dependent manner.
  • Activated PKD2 directly phosphorylates key serine residues within the degron of IFNARl leading to recruitment of the ⁇ -Trcp-based E3 ubiquitin ligase, and ubiquitination and degradation of IFNARl .
  • PKD2 Inhibition or knockdown of PKD2 augments IFN- ⁇ signaling and anti-viral defenses.
  • PKD2-mediated phosphorylation and ubiquitination of IFNARl is also induced by vascular endothelial growth factor (VEGF); the ability of VEGF to induce efficient angiogenesis depends on IFNARl degradation.
  • VEGF vascular endothelial growth factor
  • protein kinase D2 is a Type T IFN-inducible kinase that can be activated via tyrosine phosphorylation and, in turn, is capable of phosphorylating the serines within the degron of IFNARl .
  • PKD2 expression and activity are important for regulating ubiquitination and degradation of IFNARl and for control of the extent of IFN- ⁇ signaling and anti-viral defenses.
  • VEGF vascular endothelial growth factor
  • VEGF promotes IFNARl phosphorylation and accelerates IFNARl proteolytic turnover, which is required for efficient angiogenesis.
  • the lysates from 293T cells were depleted of CKl ⁇ (as described previously (Liu, et al., 2009, MoI Cell Biol 29(24):6401-12) were incubated with GST-IFNARl proteins (wild type or S535,539A mutant that migrates slower on SDS-PAGE due to the presence of four additional amino acids in the linker), ATP and kinase inhibitors (as indicated) for 30 min at 30 0 C.
  • GST-IFNARl were purified and incubated with in vitro translated and 35S-methionine-labeled ⁇ -Trcp2 for 1 h at 4°C; this binding was later analyzed by autoradiography and Coomassie staining.
  • In vitro serine phosphorylation of GST-IFNARl (analyzed by autoradiography or IB with pS535 antibody) by cell extracts or PKD preparations and tyrosine phosphorylation of GST-PKD2 by Tyk2 was carried out and analyzed as described elsewhere herein.
  • the Iysates from 293T cells underwent two rounds of immunodepletion of CKl ⁇ as described elsewhere (Liu, et al., 2009, MoI Cell Biol 29(24):6401 -12).
  • GST-IFNARl proteins wild type or S535,539A mutant that migrates slower on SDS-PAGE due to the presence of four additional amino acids in the linker (Liu et al., 2009, Cell Host Microbe 5(l):72-83)) were expressed and purified from bacterial cells using glutathione Sepharose.
  • Purified bacterial proteins (2 ⁇ g) were incubated in the presence of CKl ⁇ - depleted cell Iysates (5 ⁇ g), unlabeled ATP (0.5mM) in total volume of 20 ⁇ L (containing 25mM Tris-HCL pH 7.5, 5mM MgC12, 10OmM KCl, ImM EGTA, ImM Na3VO4, 0.1 mM DTT and 3.5% glycerol) for 30 min at 3O 0 C.
  • the following kinase inhibitors were added to the reaction in 1 ⁇ L of DMSO to the final concentration indicated: H89 (200 nM), BAY43-9006 (50 nM), Bis-I (25 nM), Go6976 (25 nM), LY294002 (1.5 ⁇ M), SP600125 (100 nM), D4476 (400 nM), SB203580 (100 nM).
  • H89 200 nM
  • BAY43-9006 50 nM
  • Bis-I 25 nM
  • Go6976 25 nM
  • LY294002 1.5 ⁇ M
  • SP600125 100 nM
  • D4476 400 nM
  • SB203580 100 nM
  • the beads were then washed three times with 0.5 mL of binding buffer and incubated with 2 ⁇ L of in vitro translated and 35S-methionine-labeled ⁇ -Trcp2 for 1 h at 4°C. Beads were then washed three times with 1 mL of binding buffer, and the proteins were eluted using Laemmli buffer, resolved by SDS-PAGE, and analyzed by autoradiography and Coomassie staining.
  • mice with a S526A substitution within IFNARl were generated using previously characterized ES cells carrying the mutation (Liu et al., 2009, Cell Host Microbe 5(l):72-83).
  • ES cells were transduced with Cre-expressing vector to excise the Neo cassette, re-selected and used to generate germline chimeras, which were then crossed with C57/BL6 females to obtain heterozygotes.
  • Cre-expressing vector to excise the Neo cassette
  • C57/BL6 females to obtain heterozygotes.
  • These clones were microinjected into albino C57/BL6 blastocysts to generate germline chimeras, which were then crossed with C57/BL6 females to obtain heterozygotes.
  • mice Genotypes of the mice were determined by analyzing DNA with primers annealing to IFNARl sequences that would flank the removed neomycin cassette of the mutant allele and that of mutation site. The latter were sequenced to confirm a Ser526 to Ala substitution. Animals were maintained in a specific pathogen-free environment and tested negative for pathogens in routine screening. Matrigel Plug assay (Medhora et al., 2003, Am J Physiol Heart Circ Physiol 284:H215- 224) and CD31 immunohistochemistry (Chiodoni et al., 2006, J Exp Med 203:2441 - 2450) was carried out as described elsewhere.
  • siRNA oligos including siPKD l Hs_PRKCM_2_HP Validated siRNA, SI00301350
  • siPKD2 Hs_PRKD2_5_HP Validated siRNA, S102224768
  • siPKD3 Hs_PRKCNJ_HP Validated siRNA, SI00301357
  • DMEM Dulbecco's modified Eagle's medium
  • Hyclone fetal bovine serum
  • 1-derivatives also received G418 (400 ⁇ g/ml).
  • Human umbilical vein endothelial cells were a gift. These cel ls were maintained in Vasculife endothelial cell culture medium (LIFELINE Cell Technology, Inc).
  • Transient transfections of 293T cells or 2fTGH and their derivatives using LIPOfectamine Plus (Invitrogen) and of HeLa cells using LIPOfectamine-2000 (Invitrogen) were carried out according to manufacturer's recommendations.
  • replication-deficient lentiviral particles encoding shRNA against PKD2 or vector control were prepared via co-transfecting 293T cells with three other helper vectors as described previously (Dull et al., 1998, J Virol 72:8463-8471). Viral supernatants were concentrated by PEG8000 precipitation and used to infect HeLa cells or 2fTGH cells in the presence of polybrene (3 ⁇ g/mL, Sigma). Cells were selected and maintained in the presence of puromycin (2 ⁇ g/mL). Chemicals, antibodies and immunotechniques
  • Antibodies against Flag, GST and ⁇ -actin (Sigma), HA (12CA, Roche), CKl ⁇ , PKD1/2 (PKC ⁇ ), PKD3 (PKCv), Tyk2, intracellular domain of hlFNARl and PKR, (Santa Cruz), anti-pan-phospho-tyrosine (4G 10), phospho-Statl and Statl (Cell signaling), phospho-S710 of PKD2 (Biosource), PKD2 (Bethyl Laboratories), mIFNARl (Leinco) and ubiquitin (FK2, Biomol) were purchased.
  • IFNARl internalization assay was carried out using the fluorescence- based assay that determines the internalization of IFNARl by measuring the loss of cell- surface immunoreactivity of endogenous receptor using AA3 antibody as described elsewhere (Kumar et al., 2007, J Cell Biol 179:935-950). The same antibody in combination with anti-mouse-biotin (Jackson Laboratory) and streptavidin-PE (e- Bioscience) was used for analysis of cell surface human IFNARl levels using the FACSCalibur flow cytometer (BD Pharmingen). Levels of mIFNARl were determined using an anti-mlFNARl antibody (Leinco). Recombinant human IFN- ⁇ 2 (Roferon) was purchased from Roche.
  • Thapsigargin, cycloheximide, TPA and methylamine HCL were purchased from Sigma. H89, Bisindolylmaleimide (Bis-I), G56976, SP600125, SB203580, LY294002 and D4476 were from Calbiochem. BAY 43-9006 was a kind gift of M. Herlyn, Recombinant human VEGF (293-VE) and mouse VEGF (493-MV) used at 100 ng/ml were purchased from R&D Systems. CID755673 was purchased from TOCRIS Bioscience.
  • the anti-viral effect of IFN- ⁇ was assessed by pre-treating cells overnight prior to infection with VSV (Indiana serotype, propagated in HeLa cells) at a MOI of 0.1 for 1 h. After removing the virus inoculums, cells were then fed with fresh medium and incubated for 20 h. Culture supernatant was harvested and viral titer was determined in HeLa cells overlaid with methylcellulose as described elsewhere (Sharma et al., 2003, Science 300: 1 148-1 151) and plaque-forming units (pfu/mL) calculated. Cells were observed to determine the cytopathic effect, and expression of VSV-M protein was analyzed by immunoblotting.
  • the absorbance was read at 540 nm.
  • immunohistochemistry was carried out using an anti-CD31 antibody as described elsewhere (Chiodoni, et al., 2006, J Exp Med 203 :2441-2450).
  • PKD2 mediates ligand-inducible phosphorylation, ubiquitination and degradation of IFNARl .
  • kinase C family PKA, PI-3K-Akt-IKK, and MAPK (JNK, p38, Erk and their downstream kinases; reviewed in (Du et al., 2007, J Cell Biochem 102: 1087-1094; Larner et al., 1996, Biotherapy 8: 175-181 ; Platanias, 2005, Nat Rev Immunol 5:375-386).
  • JNK, p38, Erk and their downstream kinases reviewed in (Du et al., 2007, J Cell Biochem 102: 1087-1094; Larner et al., 1996, Biotherapy 8: 175-181 ; Platanias, 2005, Nat Rev Immunol 5:375-386).
  • Various pharmacologic kinase inhibitors (whose activity was verified in kinase-specific assays) were added in vitro to the phosphorylation-binding assay.
  • PKD protein kinase D
  • PKD protein kinase D
  • PKD protein kinase D
  • PKD represents a family of serine/threonine protein kinases that is comprised of three members (PKD l/PKC ⁇ , PKD2 and PKD3/PKCv). These kinases are responsive to activation by numerous stimuli including the phorbol esters and oxidative radicals (reviewed in (Rozengurt et al., 2005, J Biol Chem 280: 13205-13208; Rykx et al., 2003, FEBS Lett 546:81-86; Wang, 2006, Trends Pharmacol Sci 27:317-323)).
  • RNAi approach was used to determine the putative role of various PKD isoforms.
  • siRNA specific against PKD2 but not PKDl or PKD3 markedly inhibited IFN- ⁇ -stimulated IFNARl phosphorylation on Ser535 ( Figure 40A).
  • Similar data were obtained on exogenous Flag-IFNARl stably expressed in U3A human fibrosarcoma cells ( Figure 40B).
  • PKD2 is activated in response to IFNa in a Tyk2-dependent manner
  • Ligand-inducible phosphorylation of the IFNARl degron depends on the kinase activity of Tyk2. Indeed, this phosphorylation was observed in 1 1.
  • l-Tyk2-null human cells reconstituted with wild type Tyk2 but not with catalytically inactive Tyk2KR mutant (Marijanovic et al., 2006, Biochem J 397:31-38) and Figure 49).
  • IFN- ⁇ treatment activated GST-PKD2 (as assessed by its ability to phosphorylate GST- IFNARl on Ser535 in vitro) in 1 l . l-Tyk2WT but not in 1 l .l-Tyk2KR cells ( Figure 43A).
  • HA-tagged Tyk2 was expressed and immunopurified from cells (treated or not with IFN- ⁇ ) and then incubated with recombinant bacterially produced PKD2 in the presence of ATP. The reaction was analyzed by immunoblotting using an anti-phospho-Tyr antibody. In this assay, tyrosine phosphorylation of PKD2 was easily detected when recombinant Src protein was used as positive control ( Figure 43C, lane 6). In the presence of HA-Tyk2, a noticeable tyrosine phosphorylation signal on PKD2 was also observed in an ATP-dependent manner ( Figure 43C, compare lanes 2 and 4).
  • GST-PKD2 expression constructs (depicted as GST-PKD2*) were generated that contained silent mutations making them insensitive to shPKD2 that were used for kinase knockdown.
  • HeLa cells were stably transduced with control shRNA or shPKD2 and with empty vector or GST-PKD2* constructs (wild type or Y438 mutant). Consistent with data shown in Figure 4OB, knockdown of endogenous PKD2 impeded IFN- ⁇ -induced phosphorylation of IFNARl on Ser535 ( Figure 43E, lane 2 vs. lane 4).
  • HeLa cells do not harbor human papillomavirus genes.
  • IFN- ⁇ IFN-stimulated response element
  • the ratio in activity of the firefly luciferase reporter driven by an IFN-stimulated response element (ISRE) to CMV-driven renilla luciferase was noticeably increased.
  • Pre-treatment of cells with the PKD inhibitor CID755673 robustly augmented this transcriptional activity (Figure 44C). Consistent with this result, ligand- induced ISRE-driven luciferase activity was much higher in cells where PKD2 was knocked out ( Figure 44D).
  • cells that harbored shRNA against PKD2 exhibited a noticeably higher expression of the products of interferon-stimulated genes such as PKR and Statl (Figure 44E).
  • Type I IFNs are known to inhibit angiogenesis (Sidky et al., 1987, Cancer Res 47:5155-5161), a process that involves proliferation and migration of endothelial cells induced by VEGF (reviewed in (Ferrara, 2004, Endocr Rev 25:581 -61 1 ; Ho et a!., 2007, Int J Biochem Cell Biol 39:1349- 1357)), it was hypothesized that VEGF- stimulated IFNARl Ser535 phosphorylation might be of functional importance.
  • VEGF vascular endothelial growth factor
  • VEGF stimulates numerous signaling pathways that confer its ability to promote angiogenesis (Ferrara, 2004, Endocr Rev 25:581-61 1 ; Kowanetz et al., 2006, Clin Cancer Res 12:5018-5022). It was investigated whether phosphorylation-dependent degradation of IFNARl may contribute to this function of VEGF. In order to test this possibility one may either modulate PKD2 kinase activity/expression or alter the availability of the degron's phospho-acceptor site within IFlMARl .
  • PKD2 activation is crucial for VEGF-stimulated growth and migration of endothelial cell, as well as angiogenesis per se (Hao et al, 2009, J Biol Chem 284:799-806).
  • VEGF-activated PKD2 may mediate these biological outcomes via phosphorylating diverse substrates
  • another approach that focuses on altering IFNARl itself was warranted to determine the role of PKD2-mediated IFNARl phosphorylation.
  • PKD2 is a ligand-inducible regulator of IFNARl stability
  • Ligand-stimulated lysosomal degradation of IFNARl plays an important role in limiting the magnitude and duration of Type I IFN signaling. Previous studies demonstrated that this degradation is mediated by IFNARl ubiquitination (Kumar et al., 2007, J Cell Biol 179:935-950), which is facilitated by the SCF ⁇ Trcp E3 ubiquitin ligase. This ligase is recruited to the receptor upon phosphorylation of its degron (Kumar et al., 2004, J Biol Chem 279:46614-46620; Kumar et al., 2003, Embo J 22:5480-5490).
  • IFNARl Unlike ligand-independent phosphorylation, ubiquitination and degradation of IFNARl (Liu et al., 2008, Biochem Biophys Res Commun 367:388-393), the IFN-inducible events rely on Tyk2 kinase activity (Marijanovic et al., 2006, Biochem J 397:31-38).
  • Tyk2 is a tyrosine protein kinase that displays poor (if any) ability to phosphorylate serine residues (Barbieri et al., 1994, Eur J Biochem 223:427-435), the existence of a ligand-activated Tyk2-dependent serine kinase has been proposed (Kumar et ah, 2004, J Biol Chem 279:46614-46620; Marijanovic et ah, 2006, Biochem J 397:31-38).
  • Example 5 Mammalian Casein Kinase Ia and Its Leishmanial Ortholog Regulate Stability of IFNARl and Type I Interferon Signaling
  • IFN Type I interferon
  • casein kinase Ia (CK l ⁇ ) as a bona fide major IFNARl kinase that confers basal turnover of IFNARl and cooperates with ER stress stimuli to mediate phosphorylation-dependent degradation of IFNARl .
  • Activity of CK l ⁇ was required for phosphorylation and downregulation of IFNARl in response to ER stress and viral infection. While many forms of CK l were capable of phosphorylating IFNARl in vitro, human and L-CK l produced by the protozoan Leishmania major were also capable of increasing IFNARl degron phosphorylation in cells.
  • casein kinase Ia (CKl ⁇ ) as a major bona fide kinase of IFNARl that mediates basal phosphorylation, ubiquitination, and turnover of IFNARl .
  • Experiments using genetic and pharmacological approaches further demonstrate the involvement of CKl ⁇ in ligand-independent degron phosphorylation and degradation of IFNARl stimulated by ER stress inducers, including VSV.
  • CKl activity secreted by Leishmania is also capable of phosphorylating the IFNARl degron.
  • Basal IFNARl Ser535 kinase activity was measured in vitro using bacterially expressed glutathione S-transferase (GST)-IFNARl (1 ⁇ g) as a substrate, lysates from indicated cells (1 ⁇ g intact or 4 ⁇ g immunodepleted) as a source of kinase, and immunoblotting (IB) with anti-pS535 antibody as a method of detection, as described in detail elsewhere (Liu et al., 2009, Cell Host Microbe 5:72-83; Liu et al., 2008, Biochem. Biophys. Res. Commun. 367:388-393).
  • GST glutathione S-transferase
  • IB immunoblotting
  • Untreated HeLa cells were harvested, suspended in 10 mM Tris-HCl (pH 8.0), 10 mM KCl, 1.5 mM MgC12, 0.5 mM dithiothreitol, 0.2 mM EDTA, and a cocktail of protease inhibitors (suspension buffer), and lysed by passing through a 23-gauge needle. After centrifugation, the nuclear pellet was discarded and the supernatant was ultracentrifuged at 100,000 X g for 60 min. Following centrifugation, the supernatant was kept at 4 0 C in buffers containing a cocktail of protease inhibitors.
  • HeLa cell S lOO extract -10 mg/ml was precipitated with ammonium sulfate (50% to 60% saturation), and the pellet was redissolved, dialyzed, and applied onto a SP Sepharose (Amersham-Pharmacia) column and eluted with a linear gradient (100 to 2,000 mM NaCl) in buffer A containing 100 mM phosphate buffer, 50 mM KCI, 0.1 mM EDTA, and 10% glycerol.
  • Active fractions were concentrated on a hydroxyappatite column (Bio-Rad), eluted stepwise using orthophosphate buffer, concentrated, and separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE).
  • SDS-PAGE sodium dodecyl sulfate-polyacrylamide gel electrophoresis
  • Five major bands were excised and subjected to in-gel tryptic digestion followed by nano-electrospray ionization (ESI) liquid chromatography-mass spectrometry (MS) by using a Waters Q-ToF mass spectrometer with a Waters nanoAcquity UPLC apparatus.
  • ESI nano-electrospray ionization
  • MS liquid chromatography-mass spectrometry
  • the resulting tandem MS (MS/MS) spectra of the peptides derived from one of the bands contained several peptides (including DIKPDNFLMGIGR (SEQ ID NO: 16), YASINAHLGIEQSR (SEQ ID NO: 17), TSLPWQGLK (SEQ ID NO: 18), KMSTPVEVLCK (SEQ ID NO: 19), and FEEAPD YMYLR (SEQ ID NO:20)) that were identified as derivatives of human CSNKlAl (CKl ⁇ ).
  • DIKPDNFLMGIGR SEQ ID NO: 16
  • YASINAHLGIEQSR SEQ ID NO: 17
  • TSLPWQGLK SEQ ID NO: 18
  • KMSTPVEVLCK SEQ ID NO: 19
  • FEEAPD YMYLR SEQ ID NO:20
  • Human CK l ⁇ and L-CKl cDNA (described in Allocco et al., 2006, Int. J. Parasitol. 36: 1249-1259) were subcloned into a pEF-BOS vector with a hemagglutinin (HA) tag.
  • HA hemagglutinin
  • a point mutation of K40R in L-CKl was introduced via site- directed mutagenesis.
  • Vaccinia virus Bl kinase and its kinase-dead mutant form (K149Q [KD]) expression constructs were previously described (Santos et al., 2004, Virology 328:254-265).
  • Recombinant human IFN-a2a was purchased from Roche.
  • RNA small interfering RNA oligos against the luciferase gene (5'-CUUACGCU GAGUACUUCGAdTdT-3 1 (SEQ ID NO:21 )) or hCKl ⁇ (5 1 - CCAGGCAUCCCCAGUUGCUd TdT-3' (SEQ ID NO:22)) were purchased from Dharmacon Inc.
  • siRNA oligos that contained several substitutions (underlined) of correct bases in siCKl ⁇ were used as another control (siCon#2, 5 T -CCAGGCUAGGCCAGU UGCUdTdT-3' (SEQ ID NO:23)).
  • mice All cells were maintained in Dulbecco's modified Eagle's medium supplemented with 10% (vol/vol) fetal bovine serum (FBS; HyClone) unless otherwise specified.
  • Mouse bone marrow-derived macrophages from the C57/BL6 mice were obtained by cultivating bone marrow cell isolates in RPMI medium containing 10% FBS and 30% of the L929 cell supernatant (a source of macrophage colony-stimulating factor) for 7 days according to a standard protocol.
  • Human peripheral blood monocytes were obtained from University of Pennsylvania Human Immunology Core, and derivation of dendritic cells was done according to a standard protocol (Sallusto et al., 1994, J. Exp. Med. 179: 1 109-1 1 18).
  • a cell proliferation assay was carried out using the CellTiter 96 nonradioactive cell proliferation assay kit (catalog number G4001 ; Promega) according to the manufacturer's recommendations.
  • HeLa or 2fTGH cells were inoculated with a multiplicity (MOI) of 0.1 of VSV for 1 h, washed, and added with fresh medium. At 12.5 h later, uninfected or infected cells were treated with D4476 or vehicle (dimethyl sulfoxide [DMSO]). Total cell lysates were harvested at different ensuing time points. For Leishmania infections, the macrophages were resuspended in 106 cells/ml and were infected with a 10-fold excess of L. major (50%) metacyclic in suspension culture for 4 h. Cells were subsequently washed two times to remove free parasites and further incubated as indicated.
  • MOI multiplicity
  • Antibodies against pSTATl and p-eIF2a Cell Signaling
  • eIF2a Biosources
  • CKIa BD Pharmingen
  • STATl Myc tag
  • HA tag GST
  • CK l ⁇ Santa Cruz
  • Flag tag 3-actin (Sigma)
  • ubiquitin clone FK2; Biomol
  • Monoclonal antibody 23Hl 2 specific for the M protein of VSV (VSV-M) was used.
  • Antibodies which recognize endogenous IRNAR I Goldman et al., 1999, J. Interferon Cytokine Res.
  • Flow cytometry Cell surface levels of IFNARl in human and mouse cells were determined by staining cells with anti-hIFNARI (AA3 [20]) or anti-mIFNARI (Leinco) in combination with anti-mouse-biotin (Jackson Laboratory) and streptavidin-phycoerythrin (e-Bioscience). Cell surface antigen levels were examined by using a FACSCalibur flow cytometer (BD Pharmingen), The data were analyzed with the FlowJo program (Tree Star).
  • CKl ⁇ is a kinase that directly phosphorylates the IFNARl degron
  • the detection of a major ligand and JAK-independent Ser535 kinase activity in lysates from human cells was previously reported. Such activity could be monitored by an in vitro kinase assay using the bacterially expressed cytoplasmic domain of IFNARl fused with GST (GST-IFNARl ) as a substrate, the cell lysates as the source of kinase, and anti-phospho-Ser535 immunoblotting as a mode of detection (Liu et al., 2008, Biochem. Biophys. Res. Commun. 367:388-393).
  • CK l ⁇ might function as a direct basal Ser535 IFNARl kinase in human cells, immunodepletion of HeLa cell lysate using the antibody against CK l ⁇ (but using neither control irrelevant monoclonal or polyclonal antibodies nor antibody against CK lE) indeed decreased the efficacy of GST-IFNARl phosphorylation in vitro by this lysate ( Figure 55A). Furthermore, while RNA interference (RNAi)-mediated knockdown of CKl ⁇ in
  • CK l ⁇ purified from the lysates from these cells did not display a higher activity in an in vitro kinase reaction with GST-IFNARl as a substrate ( Figure 55D).
  • CK l ⁇ was immunodepleted from the lysates of cells treated or not with TG.
  • the supernatants of these reaction mixtures were not efficient in mediating phosphorylation of GST-IFNARl on Ser535 ( Figure 55E, lanes 2 and 3).
  • the depleted lysates from TG-treated cells noticeably increased the efficacy of IFNARl phosphorylation ( Figure 55E, lanes 1 1 and 12).
  • CKl ⁇ is required for efficient phosphorylation and down-regulation of IFNARl via the lJRand-independent pathway.
  • Ligand-independent phosphorylation and degradation of IFNARl could be further stimulated by inducers of ER stress, such as TG and infection with VSV (Liu et al., 2009, Cell Host Microbe 5:72-83).
  • Knockdown of endogenous CKl ⁇ by RNAi noticeably decreased the extent of Ser535 phosphorylation in the cells treated with TG.
  • phosphorylation of IFNARl in response to IFN- ⁇ was not affected by siRNA against CKl ⁇ ( Figure 57A).
  • RNAi was not used because of the potential pleiotropic effects of loss of CKl ⁇ on viral replication and expression of viral proteins reported in literature (Bhattacharya et al., 2009, Virus Res. 141 : 101-104; Boyle et al, 2004, J. Virol. 78: 1992-2005; Campagna et al., 2007, J. Gen. Virol.
  • Casein kinase 1 comprises a large family of evolutionarily conserved kinases that include numerous isoforms in mammalian cells as well as CKl orthologs and CKl -like proteins expressed in some lower organisms. It was next examined whether different members in the CK l superfamily are capable of phosphorylating S535 of IFNARl in vitro and in the cells. Vaccinia virus is known to express a CK l -like kinase Bl (vvBl) that plays an important role in its replication (Rempel et al., 1992, J. Virol. 66:4413-4426).
  • mammalian IFNARl encounters L-CK 1 when the cells are infected with Leishmania parasites that shuffle between sandflies and mammalian hosts during the infectious life cycle.
  • Leishmania promastigotes are released from the insect gut to invade macrophages and dendritic cells in the mammalian hosts via phagocytosis to become mammal -parasitizing amastigotes (reviewed in Polonio et al., 2008, Int. J. MoI. Med. 22:277-286).
  • L-CKl has been cloned and, based on studies that used inhibitors of this kinase, is implicated in controlling the growth of Leishmania (Allocco et al., 2006, Int. J. Parasitol. 36: 1249-1259; Donald et al., 2005, MoI. Biochem. Parasitol. 141 : 15-27;
  • L-CKl down regulates IFNARl at least in part through a phosphorylation-dependent mechanism.
  • Example 6 Inducible priming phosphorylation promotes ligand-independent degradation of the IFNARl chain of Type I interferon receptor
  • IFNs Type I interferons
  • This serine serves as a priming site that promotes subsequent phosphorylation of IFNARl within its degron by CKl ⁇ . These events play an important role in regulating ubiquitination and degradation of IFNARl as well as the extent of Type I IFN signaling.
  • TG Thapsigargin
  • CHX cycloheximide
  • methylamine HCl purchased from Sigma.
  • Human pCDNA3-Flag-IFNARl mammalian expression construct and retroviral pBABE-puro-based construct for expression of Flag-tagged mouse IFNARl as well as GST-IFNARl bacterial expression vector were described previously (Aaronson et al., 2002, Science 296:1653-1655). Mutants lacking the priming sites (Ser532 in human IFNARl and Ser523 in mouse IFNARl) were generated by site directed mutagenesis. Sequence of mutants was confirmed by dideoxy sequencing. Constructs for expression of human Myc-tagged CK l ⁇ was described previously
  • Construct for bacterial expression of GST-CKl ⁇ was described in (Chen et al., 2005, MoI Cell Biol 25:6509-6520). Construct for bacterial expression of constitutively active PERK ( ⁇ N- PERK described in (Cullina et al., 2003, MoI Cell Biol 23:7198-7209)) as well as for mammalian expression of wild type or catalytically inactive PERK (K618R, (Cullina et al., 2003, MoI Cell Biol 23:7198-7209)) were previously described. Human IFN- ⁇ (Roche) and murine IFN(3 (PBL) were purchased.
  • DMEM Dulbecco's modified Eagle's medium
  • Hyclone 10% (v/v) fetal bovine serum
  • Human HeLa and 293T cells were obtained from ATCC.
  • Mouse embryo fibroblasts (MEFs) from IFNARI -/-mice and their wild type counterparts were gifted.
  • To obtain reconstituted cells expressing wild type or mutant IFNARl these cells were transduced by pBabe-Puro-based mIFNARl constructs and selected in puromycin for two weeks before analysis.
  • VSV-M Monoclonal antibodies against human IFNARl that were used for immunoprecipitation (EA 12) or immunoblotting (GB8) were described in detail elsewhere (Goldman et al., 1999, J Interferon Cytokine Res 19: 15-26). Monoclonal 23Hl 2 antibody against the M protein of VSV (VSV-M) was a generous gift.
  • Antibodies against IFNARl phosphorylated on Ser535 were described previously.
  • Polyclonal antibody against IFNARl phosphorylated on Ser532 was raised in rabbits using synthetic mono phospho-peptide EDHKKYSSQTpSQDSGNYSNEDE (SEQ ID NO:24) in collaboration with PhosphoSolutions Inc. (Golden, CO).
  • Antibody was further affinity purified using mono- phosphopeptide affinity columns and tested for specificity by immunoblotting.
  • kinase assays were carried out as described in detail elsewhere (Liu et al., 2009, MoI Cell Biol 29: 6401-6412). Briefly, 2 ⁇ g of substrates (bacterially expressed and purified GST-IFNARl , wild type, or S532A mutant) were incubated with 4 ⁇ g of lysate (from untreated or thapsigargin treated cells) that were cleared of CKl ⁇ (by immunodepletion) and 0.25 ⁇ g of bacterially produced GST-CKl ⁇ (where indicated) in kinase buffer (25 mM Tris HCl, pH 7.4, 10 mM MgC12, 1 mM NaF, 1 mM NaVO3) and ATP (1 mM).
  • kinase buffer 25 mM Tris HCl, pH 7.4, 10 mM MgC12, 1 mM NaF, 1 mM NaVO3
  • ⁇ N-PERK or undepleted lysates from 293T cells were used as a source of kinase activity.
  • Radiolabel was provided as 32P- ⁇ -ATP (l ⁇ Ci, Amersham). The reactions were carried out at 3O 0 C for 30 minutes shaking at 600 rpm on the tabletop incubator. Products were analyzed either by immunoblotting with phospho-specific antibodies or by autoradiography.
  • UPR stimulates Ser535 phosphorylation of IFNARl and accelerates ubiquitination and degradation of this receptor in a manner that relies on PERK activity (Liu et al., 2009, Cell Host Microbe 5:72-83). Whether PERK is required for phosphorylation of the priming site within IFNARl was next investigated. Transfection of HeLa cells with shRNA targeted against PERK led to a partial knockdown of this kinase as evident from its decreased level and a decreased phosphorylation of its known substrate eIF2 ⁇ in cells treated with TG ( Figure 64A, lower panels).
  • MEFs from IFNARl knockout mice weer reconstituted with either wild type murine IFNARl or its priming site Ser523 mutant and compared the ability of murine IFN- ⁇ to induce an anti-viral state in these cells.
  • Cells that express the priming site mutant exhibited a noticeably higher innate resistance to VSV infection (as judged from lower levels of expression of VSV-M protein in the absence of exogenous IFN- ⁇ (Figure 65C).
  • these cells required at least five times a lower dose of exogenous IFN- ⁇ than cells expressing wild type receptor to mount a comparable defense against VSV (compare VSV-M levels at dose 50IU/ml in WT cells versus 10IU/ml in S523A in Figure 65C).
  • Example 7 Targeted deletion of PERK promotes oxidative DNA damage checkpoint activation and limits tumor expansion
  • the subsequent induction of the DNA damage checkpoint significantly reduces tumor cell growth in vitro and in vivo.
  • cancer cells co-opt cellular regulatory pathways that facilitate adaptation and thereby maintain tumor growth and survival potential.
  • the endoplasmic reticulum (ER) is uniquely positioned to sense nutrient deprivation stress and subsequently engage signaling pathways that promote adaptive strategies.
  • components of the ER stress-signaling pathway represent potential anti-neoplastic targets.
  • recent investigations into the role of the ER resident protein kinase PERK have paradoxically suggested both pro- and anti- tumorigenic properties. Animal models of mammary carcinoma have been used to interrogate PERK contribution in the neoplastic process.
  • PERK -dependent signaling is utilized during both tumor initiation and expansion to maintain redox homeostasis and thereby facilitates tumor growth.
  • mice and tissue Mammary gland-specific PERK knockout animals (Bobrovnikova-Marjon et al., 2008, Proc Natl Acad Sci U S A 105: 16314-9) were mated to mice bearing the Neu transgene under the control of MMTV-LTR promoter (Guy et al., 1992, Proc Natl Acad Sci USA 89: 10578-82).
  • the Neu and Cre transgene bearing offspring were bred to homozygocity for the LoxP allele of PERK thus generating mammary gland-specific PERK 'null'. Littermates bearing Neu but not the Cre transgene were used as controls.
  • the No.4 inguinal gland was extracted and processed for whole-mount analysis as previously described (Lin et al., 2008, Oncogene 27: 1231-42).
  • EBC buffer 5OmM Tris pH 8.0; 12OmM NaCl; 0.5% NP-40
  • Antibodies used for immunoblotting analysis, immunofluorescence and IHC included PERK (Rockland Immunochemicals); human ATF4, histone H3 (tri methyl K9), phospho-Chk2 (Thr68) (Abeam); human CHOP (Affinity Bioreagents), R-actin (Sigma, AC- 15), Nrf2, Keap 1, CDK2, and pl9ARF (Santa Cruz Biotechnology); y-H2AX (Serl39), phospho-elF2, eIF4E, Cdc25A, phospho-Tyrl5 CDK2, phospho-Thrl ⁇ O CDK2, phospho-Thr (Cell signaling); troma-1 (Developmental Studies Hybridoma Bank, University of Iowa), ErbB2 (Calbiochem), Chk2 (
  • 293T cells were transfected with PMDL, VSVG, REV and pLKO.
  • l empty vector as control using Lipofectamine Plus (Invitrogene) for stable knockdown or
  • Concentrated virus was used to infect human cell lines in the presence of 10g/ml polybrene. Selection to create stably knocked down cell lines was conducted with puromycin at 5g/ml. Retroviruses were produced as previously described (Brewer et al.,
  • MDA-MB468 PERK knockdown cells were transfected with siRNA by using HiPerfect (Qiagen). Scrambled (Scrm) and keapi - specific siRNA Smartpool were from Dharmacon. Experiments were conducted 72 h after transfection.
  • 3X1 OM cells were plated in 6 cm dish. Cells were counted every 24 h for 5 days using hemocytometer. ROS scavenger N-acetyl cysteine (NAC) was used at 5 mM where indicated, Culture media was changed every 3 days. Each experiment was done in triplicate.
  • Quantitative RT-PCR reactions were performed using SYBR Green (SuperArray). All primer sequences are available upon request. Semiquantitative RT-PCR for PERK excision efficiency was performed as described (Zhang et al., 2006, J Biol Chem 281 :30036-45). Immunofluorescence
  • Cells were permeabilized with ice cold MeOH:acetone (1 : 1) for l Omin at -20 0 C, allowed to air dry, and rehydrated for l Omin with PBS. Blocking was performed with 10% FBS/PBS for 40 minutes at room temperature. Primary and secondary antibodies were diluted in 10% FBS/PBS and incubated for 2h or 30 minutes at RT, respectively.
  • Fluorescent in situ hybridization for ErbB2 was performed on paraffin sections following treatment with proteinase K.
  • Biotin-labeled probe was generated by random priming method with ErbB2 full-length cDNA (ID 5356166, Open Biosystems) and visualized with streptavidin-Texas Red.
  • ROS measurement Cells were incubated with 3ml PBS (with Calcium and Magnesiun) containing 5mM 5-(and-6)-chloromethyl-2',7'-dichlorodihydrofluorescein diacetate, acetyl ester (CM-H2DCFDA, Invitrogen) for 30 min in the dark at 37 0 C. Cells were washed with PBS, trypsinized, washed, resuspended in PBS and analyzed by FACS.
  • PBS with Calcium and Magnesiun
  • CM-H2DCFDA acetyl ester
  • Antigen retrieval was performed in 10 mM citrate buffer, pH 6.0 (Biogenex). Endogenous peroxidase activity was blocked with 3% peroxide in MeOH. Sections were blocked with IX Power Block Reagent (Biogenex) followed by incubation with primary antibody. Detection was performed with biotinylated secondary antibodies and ABC-HRP reagent followed by DAB substrate (Vector laboratories). In vitro kinase assay
  • CDK2 kinase activity For the detection of CDK2 kinase activity, cells or tissues were solubilized in EBC buffer. Complexes were isolated by precipitation with a CDK2 reactive antibody from 20Og total protein. The kinase assay was performed using recombinant histone H l with lOCi of -32P-ATP for 10 min at 3O 0 C. Reactions were resolved by SDS-PAGE, transferred to PVDF membrane, and visualized by autoradiography. Total Histone H l was visualized by ponceau stain.
  • Cells were pulsed with 1OM BrdU 45 min prior to being harvested. Cells were washed with PBS, fixed with ethanol, and stained with anti-BrdU (BD Pharmingen) and FITC-conjugated secondary antibody (BD Pharmingen) and then with propidium iodide (10 g/ml) for 30 min prior to FACS analysis. Cell cycle profiles based on DNA content and BrdU incorporation were assessed using FlowJo software, and the sub-G 1 population of cells served as a readout for apoptotic cells.
  • BD Pharmingen anti-BrdU
  • FITC-conjugated secondary antibody BD Pharmingen
  • PERK is expressed in cancer cells wherein it potentiates tumor expansion
  • Markers of ER stress signaling are increased in a variety of tumor types (Daneshmand et al., 2007, Hum Pathol 38:1547-52; Fernandez et al., 2000, Breast Cancer Res Treat 59:15-26; Gazit et al., 1999, Breast Cancer Res Treat 54:135-46; Lee et al., 2008, Neuro Oncol 10:236-43). Because PERK mediates cell growth and survival under conditions of ER stress, it was first determined whether tumor-derived cells retain functional PERK.
  • PERK expression was assessed in 4 breast and 3 esophageal human carcinoma-derived cell lines and compared it to the PERK levels in MCFI OA cells, an immortalized, non-transformed breast epithelial cell line.
  • PERK protein was readily detectable in all cell lines ( Figure 66A), and PERK function was preserved in cancer cells, as evidenced by their ability to activate PERK-dependent effectors ( Figure 66C).
  • lentivirus-delivered short hairpin RNAs were utilized to reduce endogenous levels of PERK (Figure 66B), which also resulted in attenuated activation of PERK effectors such as ATF4/CHOP in MDA-MB468 cells challenged with tunicamycin ( Figure 66C).
  • MMTV-Neu/PERKloxP/loxP tumor-prone MMTV-Neu transgenic mice bearing PERKloxP/JoxP allele
  • Primary tumors from MMTV-Neu/PERKloxP/loxP mice were isolated and transduced with empty vector retrovirus or retrovirus encoding Cre recombinase to excise PERK ( Figure 66E).
  • the primary tumor cells were then transplanted into mammary fat pads of 3-week old SCID mice.
  • PERK-deficient tumor cells generated tumors with a significantly reduced volume relative to PERK positive cells ( Figure 66D). Similar reduction in tumor volume was observed upon PERK knockdown in human MDA- MB468 cells ( Figure 74).
  • ROS Reactive Oxygen Species
  • H2AX a histone H2 variant
  • DSBs double strand breaks
  • Nrf2 Reduced activity of Nrf2 leads to increased oxidative stress in PERK knockdown cells
  • Nrf2 a direct PERK substrate (Cullinan et al., 2003, MoI Cell Biol 23:7198-7209), contributes to the transcriptional regulation of genes whose protein products mediate cellular redox homeostasis (Buetler et al., 1995, Toxicol Appl Pharmacol 135:45-57; Hayes et al., 2000, Biochem Soc Trans 28:33-41).
  • Nrf2 Consistent with impaired Nrf2 activation in PERK knockdown cells, expression of two distinct Nrf2 target genes, NQOl (Itoh et al., 1997, Biochem Biophys Res Commun 236:313-22) and GCLC (Wild et al., 1999, J Biol Chem 274:33627-36) was decreased compared to the uninfected or control cells (Figure 72A).
  • Nrf2 the site of PERK phosphorylation in Nrf2 was examined. Because PERK-dependent phosphorylation disrupts Nrf2-Keapl binding, the Neh2 domain of Nrf2 that binds directly to Keapl was assessed (Lo et al., 2006, Embo J 25:3605-17). Indeed, PKC can phosphorylate serine 40 in this domain (Huang et al., 2002, J Biol Chem 277:42769-74).
  • Nrf2 activity is restricted via its association with an E3 ligase wherein Keap l functions as Nrf2-specific adaptor thereby targeting Nrf2 to cullin 3 (Cullinan et al., 2004, MoI Cell Biol 24:8477- 86; Furukawa et al., 2003, Nat Cell Biol 5: 1001-7; Furukawa et al., 2005, MoI Cell Biol 25: 162-71 ; Kobayashi et al., 2004, MoI Cell Biol 24:7130-9; Zhang et al., 2004, MoI Cell Biol 24: 10941-53).
  • Nrf2 basal levels of active Nrf2 can be elevated via either overexpression of Nrf2 or knockdown of Keapl (Cullinan et al., 2004, J Biol Chem 279(19):20108-17). Accordingly, expression of HA-Nrf2 restored normal growth to MDA-MB468 cells wherein PERK was ablated ( Figure 72D). Consistent with its role in PERK-dependent regulation of redox homeostasis, introduction of HA-Nrf2 significantly attenuated oxidative DNA damage (Figure 72E). To independently confirm that increased Nrf2 activity can compensate for loss of PERK function and reduce oxidative DNA damage, Keapl was knocked down in cells wherein PERK was stably reduced. This resulted in a significant reduction in oxidative DNA damage ( Figure 72F). Dual role for PERX in tumorigenesis in vivo
  • mice were crossed with PERKloxP/loxP/MMTV-Cre mice (Bobrovnikova-Marjon et al., 2008) generating MMTV-Neu/PERK/. Mice that did not inherit the MMTV-Cre transgene, thereby retaining PERK, were used as a control (MMTV-Neu/PERKloxP/loxP). Analysis of tumor-free survival revealed that PERK loss delayed MMTV-Neu-induced tumor formation ( Figure 73A). Histological signature of tumors was characteristic of the MMTV-Neu mouse model ( Figure 73B).
  • PERK excision in mammary epithelium was assessed by immunoblot ( Figure 73C; Bobrovnikova- Marjon et al., 2008, Proc Natl Acad Sci U S A 105: 16314-9) and RT-PCR ( Figure 78). Tumor formation was not due to outgrowth of cells exhibiting inefficient PERK excision as only two tumors retained detectable PERK protein ( Figure 73C). To determine whether Thr-80 phosphorylation of Nrf2 was dependent upon PERK in vivo, Nrf2 was immunoprecipitated from tumor lysates and p-Thr levels were assessed.
  • DNA damage and activation of DNA damage response may serve as a tumor barrier, while long-term genotoxic stress accompanied by mutational inactivation of DNA damage response mechanisms is pro-tumorigenic (Bartkova et al., 2005, Nature 434:864-70; Gorgoulis et al., 2005, Nature 434:907-13; Stracker et al., 2008, MoI Cell 31 :21 -32). Thus, it was considered whether loss of PERK might contribute to increased spontaneous mammary tumorigenesis.
  • MMTV-Cre/PERKlo7P/lo7Pmice which do not exhibit detectable proliferative defects during postnatal mammary gland development (Bobrovnikova-Marjon et al., 2008, Proc Natl Acad Sci U S A 105: 16314-9) were utilized after aging these animals for up to 24 months. During this interval, 6 of 29 animals developed overt mammary adenocarcinoma; in addition, pre-malignant adenomas were observed in several aged mice analyzed ( Figure 73H), while only 2 of 19 control PERKlo7P/lo7P mice developed carcinomas over this same interval.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present invention includes compositions and methods for modulating a regulator of IFNARl. The invention includes inhibitors and activators of PERK, PTPlB, and/or PKD2 wherein inhibition, or activation, of at least one of PERK, PTP lB, and PKD2 modulates the stability of IFNARl.

Description

TITLE OF THE INVENTION Regulators of the Interferon-Alpha Receptor 1 (IFNARl ) chain of the interferon receptor
BACKGROUND OF THE INVENTION Animal hosts defend themselves against infectious agents or tumor growth by utilizing the mechanisms of innate and adaptive immunity. Importantly, diverse pathways of innate immunity converge on the induction of cytokines that belong to a family of Type I interferons (IFN) including various types of IFN-α and IFN-β that play a major role in host defenses against the viruses. Unlike IFNγ, which belongs to Type II IFN group, all members of the Type 1 family act on cells via the same cognate receptor that consists of two sub-units: IFNARl and IFNAR2c (reviewed in (Pestka, 2000, Biopolymers 55:254-287)).
Dimerization of receptor chains in response to the ligands results in the activation of Janus kinase (Jak) family members Jakl and Tyk2 that phosphorylate each other, the aforementioned receptor subunits and the recruited signal transducers and activators of transcription (Statl and Stat2) at specific tyrosines. Phosphorylated Stat proteins translocate to the nucleus, bind to IFN-stimulated regulatory elements (ISRE) and activate transcription of a large number of IFN-stimulated genes (ISGs, reviewed in Stark et al., 1998, Annu. Rev. Biochem. 67:227-264). ISGs mediate a plethora of IFNα effects that play key roles in anti-viral defense (Brassard, et al, 2002, J Leukoc Biol 71(4):565-581 ; Katze, et al., 2002, Nat Rev Immunol 2(9):675-687), inhibition of cell proliferation (Brassard, et al, 2002, J Leukoc Biol 71 (4):565-581 ; Kirkwood, 2002, Semin Oncol 29(3 Suppl 7): 18-26; Stark, et al., 1998, Annu Rev Biochem 67:227-264) and modulation of immune responses (Biron, 2001 , Immunity 14:661-664; Brassard, et al, 2002, J Leukoc Biol 71(4):565-581). The ability of IFNα to evoke these outcomes makes it an attractive therapeutic agent extensively used for treatment of patients with neoplastic diseases, i.e. cancers (Kirkwood, 2002, Semin Oncol 29(3 Suppl 7): 18-26), chronic viral infections (Brassard, et al, 2002, J Leukoc Biol 71(4):565-581 ; Katze, et al., 2002, Nat Rev Immunol 2(9):675-687), and multiple sclerosis (Karp, et al., 2000, Immunol Today 21 (l):24-28). Studies in cell culture revealed that anti-viral effects of IFN are best seen when it is added to cells prior to the infection (Blalock, et al., 1979, J Gen Virol 42:363- 372; Pfeffer, et al., 1991, Pharmacol Ther 52(2):149-157). While decreased efficacy of IFN added to already infected cells is largely explained by insufficient time to transcribe and translate ISG products (reviewed in (Friedman, et al., 1970, Arch Intern Med 126(l):51-63; Pfeffer, et al., 1991, Pharmacol Ther 52(2):149-157)), additional mechanisms such as a negative effect of virus on IFN action have been also postulated (Lockart, 1963, J Bacteriol 85:556-566; Lockart, 1963, J Bacterid 85:996-1002). Indeed, many viruses evolved to employ a multitude of specific mechanisms to protect themselves against Type I IESf. These mechanisms usually involve a rapid synthesis of numerous virus type-specific proteins that impede diverse elements of pathways converging on either IFN production or IFN signaling (reviewed in (Katze, et al., 2002,. Nat Rev Immunol 2(9):675-687)).
A need for the robust synthesis of viral polypeptides, however, poses additional problems for the virus as it challenges the capacity of the host cell to properly fold and activate proteins. Accumulation of sub-optimally folded proteins in the ER of the host cell induces a series of signaling events known as the ER stress or the unfolded protein response (UPR) (Welihinda, et al., 1999, Gene Expr 7:293-300). While the ER protein chaperone BiP is central to initiating virtually all branches of the response, subsequent signaling proceeds via a number of defined mechanisms that include other transmembrane sensors including ATF6, IREl and PKR-like ER kinase (PERK). The activation of PERK and ensuing phosphorylation of eIF2α restricts translation to alleviate the load of unfolded proteins The latter is necessary in order to protect the host cells from ER stress-mediated death, to enable (reviewed in (Malhotra, et al., 2007, Semin Cell Dev Biol 18(6):716-731 ; Ron, et al., 2007, Nat Rev MoI Cell Biol 8(7):519-529)). Viruses are known to both induce UPR and produce the means of inhibiting these responses, translation of viral proteins and to continue virus production (He, 2006, Cell Death Differ 13(3):393-403; Schroder, et al., 2006, Curr MoI Med 6( l ):5-36; Wang, et al., 2006, J Gastroenterol Hepatol 21 Suppl 3:S34-37; Waris, et al., 2002, Biochem Pharmacol 64: 1425-1430). While investigating the mechanisms that govern proteolytic degradation of Type I IFN receptor it was found that IFNARl undergoes ligand-induced Tyk2 activity- dependent phosphorylation on specific Ser residues (Ser535 in humans and Ser526 in mice). This phosphorylation leads to the recruitment of βTrcp E3 ubiquitin ligase followed by IFNARl ubiquitination, internalization, and lysosomal degradation (Kumar, et al., 2007, J Cell Biol 179(5):935-950; Kumar, et al., 2004, J Biol Chem 279(45):46614-46620; Kumar, et al., 2003, Embo J 22(20):5480-5490; Marijanovic, et al., 2006, Biochem J 397(l):31-38). Intriguingly, there is also a ligand-and Jak- independent pathway resulting in phosphorylation and turnover of IFNARl in cells that over-expressed this receptor (Liu, et al., 2008, Biochem Biophys Res Commun 367(2):388-393).
There have been many attempts made to use various agents to target the IFN signaling pathway for treating diseases associated with this pathway. There is a need in the art for the development of successful therapeutic agents to increase the efficacy of either endogenous IFN or IFN-based drug in patients with viral infections, tumors and multiple sclerosis. The present invention satisfies the need in the art for development of new approaches for efficient means to increase IFN efficacy.
BRIEF SUMMARY OF THE INVENTION The present invention provides a method of modulating the stability of
IFNARl in a cell. The method comprises contacting a cell with an effective amount of a composition comprising an inhibitor of a regulator of IFNARI, including any one or more of PERK, PTPlB, or PKD2. In various embodiments, the inhibitor is at least one of an siRNA, a microRNA, an antisense nucleic acid, a ribozyme, a transdominant negative mutant, an intracellular antibody, a peptide or a small molecule.
The invention also includes a method of treating a disease or disorder associated with a dysfunctional IFN response. For diseases or disorders associated with an abnormally diminished IFN response, the method comprises administering to a mammal in need thereof, a therapeutically effective amount of a composition or pharmaceutical composition comprising an inhibitor of a regulator of IFNARI, including any one or more of PERK, PTPl B, or PKD2. In one embodiment, the composition or the pharmaceutical composition is administered in combination with a therapeutic agent. Preferably, the therapeutic agent is IFN. In various embodiments, the disease is a viral infection, cancer or an autoimmune disease. One nonlimiting example of an autoimmune disease amenable to the methods of the invention is multiple sclerosis. The invention also includes a method of treating a disease or disorder associated with a dysfunctional IFlM response. For diseases or disorders associated with an pathologically increased JFN response, the method comprises administering to a mammal in need thereof, a therapeutically effective amount of a composition or pharmaceutical composition comprising an activator of a regulator of IFNARI, including any one or more of PERK, PTPl B, or PKD2. In one embodiment, the composition or the pharmaceutical composition is administered in combination with a therapeutic agent. In various embodiments, the disease is a viral infection, cancer or an autoimmune disease. Two nonlimiting examples of autoimmune diseases amenable to the methods of the invention is systemic lupus erythematosus and psoriasis. The invention also provides a method of increasing the efficacy of endogenous IFN in a mammal. The method comprises administering to a mammal in need thereof, a therapeutically effective amount of a composition or pharmaceutical composition comprising an inhibitor of a regulator of IFNARI, including any one or more of PERK, PTPlB, or PKD2. The invention further provides a method of increasing the efficacy of IFN-based drug treatment in a mammal. The method comprises administering to a mammal in need thereof, a therapeutically effective amount of a composition or pharmaceutical composition comprising an inhibitor of a regulator of IFNARI, including of any one or more of PERK, PTPl B, or PKD2.
BRIEF DESCRIPTION OF THE DRAWINGS
For the purpose of illustrating the invention, there are depicted in the drawings certain embodiments of the invention. However, the invention is not limited to the precise arrangements and instrumentalities of the embodiments depicted in the drawings. Figure 1 , comprising Figures I A through IF, is a series of images demonstrating that ER stress induces IFNARl Ser535 kinase activity and promotes phosphorylation of IFNARl within its destruction motif in a manner that does not require Tyk2 activity but relies on activity of PERK. Figure IA is an image depicting immunoblotting (IB) analysis of the lysates from KR-2 cells (lacking catalytic activity of Tyk2) transfected with Flag- IFNARl plasmid (0 - 3.0μg) subjected to immunoprecipitation (IP) using anti-Flag antibody followed by immunoblotting (IB) using the indicated antibodies. Relative intensity of bands in IB using either anti-phospho-S535 (black squares) or IFNARl (Rl , gray squares) or Flag (black squares) was quantified and plotted in the right panel.
Figure IB is an image depicting analysis of the lysates from KR-2 cells transfected with Flag-lFNARl (1.5-3.0μg) or empty vector used as a source of kinase activity in an in vitro kinase assay using GST-IFNAR 1 as a substrate. The reactions were analyzed by IB using anti-phospho-S535 antibody (upper panel; both shorter and longer exposures shown) and by Ponceau staining to detect the substrate levels (middle panel). Levels of Flag-IFNARl in the cell lysates were analyzed by IB using anti-Flag antibody (lower panel).
Figure 1C is an image depicting analysis of the 293T cells treated with thapsigargin (TG, lμM) for 30 min. Endogenous IFNARl was immunoprecipitated and analyzed by IB using indicated antibodies. Aliquots of the whole cell lysates were analyzed for levels of phospho-and total eIF2α.
Figure ID is an image depicting analysis of the cells harboring wild type (WT-5) or the kinase dead Tyk2 (KR-2) treated with IFNα.
(1000IU/ml) or TG at indicated concentrations for 30 min. Endogenous IFNARl was analyzed by IP-IB as in Figure 1 C.
Figure IE is an image depicting analysis of the WT or PERKMEFs treated with TG (lμM) or murine IFND (1000 U/ml) for 30 min. Mouse endogenous IFNARl was analyzed for its phosphorylation and levels using the indicated antibodies.
Figure IF is an image depicting analysis of the MEFs from PERKfl/fl mice that received an empty vector (Mock) or vector for expression of Cre recombinase (Cre). Whole cell lysates from these cells were also analyzed by IB using the indicated antibodies.
Figure 2, comprising Figures 2A through 2F, is a series of images demonstrating that ER stress promotes IFNARl ubiquitination and degradation in a ligand/Jak-independent manner
Figure 2A is an image depicting analysis of the levels of endogenous IFNARl in 293T cells pre-treated or not with methylamine HCl (MA, 2OmM) for 1 h and then treated with TG (1 μM) for indicated time were analyzed by IP-IB. Levels of β-actin in whole cell lysates are also shown. Figure 2B is an image depicting analysis of the cells harboring the WT
Tyk2 (WT-5) or the kinase dead Tyk2 (KR-2) treated with TG as indicated and ubiquitination and levels of endogenous IFNARl were analyzed by IP-IB. Aliquots of whole cell lysates were also analyzed by IB using anti-β-actin antibody (lower panel).
Figure 2C is an image depicting analysis of the 293T cells pre-treated or not with MA for 1 h and then treated with cycloheximide (Chx, 50μg/ml) alone or together with TG (1 μM) for indicated times. Levels of endogenous IFNARl were analyzed by IP-IB. Levels of c-Jun and β-actin in whole cell lysates were also determined by IB using indicated antibodies.
Figure 2D is an image depicting analysis of the ubiquitination of Flag- tagged IFNARl co-expressed with the indicated shRNA constructs in 293T cells was analyzed by IP using anti-Flag antibody followed by IB using anti-ubiquitin and anti-Flag antibodies as indicated. Aliquots of whole cell lysates were also analyzed by IB using anti-β-actin antibody (lower panel).
Figure 2E is an image depicting analysis of the PERKf1/tl MEF that either underwent acute deletion of PERK (Cre) or not (Mock) treated with 1 μM of TG (together with Chx, lOμg/ml) for 45 min as indicated. Endogenous mouse IFNARl was analyzed by IP-IB using the indicated antibodies. Ig: heavy chain immunoglobulins. Whole cel l lysates were also subjected to IB analysis to determine levels of phosphorylated β-catenin and eIF2α as well as total levels of PERK and eIF2α using respective antibodies. NS: non-specific band. Figure 2F is an image depicting analysis of the mouse Flag-IFNARl expressed in PERK^ MEFs that either underwent acute deletion of PERK (Cre) or not (Mock) analyzed by IB using anti-Flag antibody. Levels of PERK are shown in lower panel. NS: non-specific band that serves as a loading control. Figure 3, comprising Figures 3 A through 3D, is a series of images demonstrating that ER stress ER stress promotes IFNARl degradation in a manner depending on IFNARl phosphorylation within its phospho-degron.
Figure 3 A is an image depicting a vector and a targeting strategy that were used to generate an S526A allele in mouse ES cells (C57/BL6). Position of mutated Ser residue, resistance markers, loxP sites as well as restriction sites and the probe used for Southern analysis are also shown.
Figure 3B is an image depicting Southern analysis of several selected ES clones that underwent homologous recombination (marked by an asterisk) performed on genomic DNA digested with Kpnl. Correct targeting yielded a 10.6 kb band in clones 106 and 252 (besides the 8.5 kb band indicative of the WT allele).
Figure 3C is an image depicting analysis of the embryoid bodies (EB) derived from the WT (WT/WT) or the mutant (S526A/WT) ES cells. Cells were pre- treated or not with MA (2OmM for 1 h) and then treated with TG (l μM, 15min) as indicated. Endogenous mouse IFNARl was immunoprecipitated and analyzed by IB using the indicated antibodies. Phosphorylation of eIF2D and levels of PKR were also determined in aliquots of whole cell lysates by IB.
Figure 3D is an image depicting analysis of the EB-derived cells treated with TG (l μM) for indicated times and analyzed for total levels of endogenous IFNARl (by IP-IB). Levels of eIF2α phosphorylation and total β-catenin were shown as stress and loading controls, respectively.
Figure 4, comprising Figures 4A through 4E, is a series of images demonstrating that viral infection promotes phosphorylation-dependent ubiquitination and downregulation of IFNARl in a Tyk2-independent and S535/526-dependent manner.
Figure 4A is an image depicting analysis of the ubiquitination, phosphorylation and total levels of endogenous IFNARl from KR-2 cells infected with VSV (for 16, 18 and 20 h) were analyzed by IP using anti-lFNARl antibody followed by IB using the indicated antibodies. Viral protein accumulation is shown by the levels of
VSV-M.
Figure 4B is an image depicting analysis of the levels of endogenous
IFNARl in the lysates from Huh7 cells (parental or harboring either a full length or subgenomic HCV) were analyzed by IP-IB. Levels of β-actin in the lysates aliquots are also shown.
Figure 4C is an image depicting analysis of the endogenous IFNARl proteins immunopurified from the indicated cells and loaded onto the gel to yield comparable levels of total IFNARl (lower panel). Phosphorylation of IFNARl was then analyzed by IB using indicated antibody (upper panel).
Figure 4D is an image depicting analysis of the MEFs from IFNARl-/- mice stably reconstituted with murine Flag-IFNARl (either wild type or S526A mutant) and then infected with VSV (for 16-18 h). Levels of IFNARl , VSV-M and β-actin were analyzed by IB. Figure 4E is an image depicting analysis of the EB-derived eel Is of WT
(WT/WT) or mutant (S526A/WT) genotype infected (or not) with VSV for 12 h and lysed. Under these conditions, levels of VSV-M become saturated at l Ohr post-infection.
Levels of endogenous mouse IFNARl were determined by IP-IB. Levels of β-actin and
VSV-M in the lysates were also determined. Figure 5, comprising Figures 5A through 5D, is a series of images demonstrating the role of PERK in virus-induced degradation of IFNARl .
Figure 5A is an image depicting analysis of the phosphorylation and levels of endogenous IFNAR l in 2fTGH cells that received indicated shRNA constructs and then were infected with VSV (for 16, 18 and 20 h) was analyzed by IP-IB using the indicated antibodies. Aliquots of IP supernatants were used for analysis of VSV-M, p- eIF2α and eIF2α levels by IB.
Figure 5B is an image depicting analysis of the control or PERK-depleted
2fTGH cells (as in Figure 5A) infected with VSV (for 17 h) and then treated with Chx (1 or lOμg/ml for 1.5 h). Total levels of IFNARl were determined by IP-IB. Figure 5C is an image depicting analysis of the levels of cell surface
IFNARl analyzed by FACS using monoclonal anti-mIFNARI antibody in MEFs from PERK mice (transduced with either empty vector (Mock) or construct for expression of Cre) either left untreated (black line) infected with VSV (for 17 h, red line) or treated with TG (1 μM for 4h, green line). Blue line represents the isotype Ig control.
Figure 5D is an image depicting analysis of the levels of IFNARl and actin in Huh7 cells harboring the full-length or subgenomic HCV that were co-transfected with Flag-IFNARl and indicated shRNA constructs were analyzed using indicated antibodies.
Figure 6, comprising Figures 6A through 6D, is a series of images demonstrating that viral infection inhibits Type I IFN signaling via accelerating Ser526 phosphorylation-dependent degradation of IFNARl .
Figure 6A is an image depicting analysis of the 2fTGH cells infected or not with VSV (for 20 h) treated with 50 IU/ml of IFNα or IFNβ for 30 min. Phosphorylation of Statl and total levels of Statl, actin and VSV-M were analyzed by IB.
Figure 6B is an image depicting analysis of the Huh7 cell line derivatives co-transfected with Flag-STATl and either empty vector (pcDNA3) or Flag-IFNARl (WT or S535A) as indicated. Lysates from these cells treated or not with IFNα (50 IU/ml) were immunoprecipitated using anti-Flag antibody and these reactions were analyzed by IB using the indicated antibodies.
Figure 6C is an image depicting analysis of the EB-derived cells of wild type (WT/WT) or mutant (S526A/WT) genotype infected with VSV (for 12 h) and then treated with murine IFN-β (100 IU/ml) or IFN-γ (5ng/ml) for 30 min. Phosphorylation of Statl and total levels of Statl and actin were analyzed by IB.
Figure 6D is an image depicting analysis of the titer of VSV produced in EB-derived cells 14 h after infection (an incubation of cells with VSV at MOI 1.0 for Ih). The effect of IFN-β (20 IU/ml) added either 16 h prior to the infection (pre-treat) or immediately after infection (co-add) was determined. Data shown (the mean ± SD) are representative of two independent experiments (each in triplicate). Asterisk denotes p<0.01 in comparison with untreated cells.
Figure 7, comprising Figures 7A through 7G, is a series of images demonstrating the role of PERK in virus-induced suppression of Type I IFN signaling. Figure 7A is an image depicting analysis of the control or PERK-depleted derivatives of 21TGH cells infected with VSV (for 20 h) and treated with IFN-α or IFN-γ (50 IU/ml for 30 min). Phosphorylation and total levels of Stat 1 and eIF2α were analyzed by IB. Figure 7B is an image depicting analysis of the MEFs from PERK mice transduced with either empty vector (Mock) or construct for expression of Cre were infected with VSV (for 20 h) and then treated with IFN-β (100 IU/ml) or IFN-γ (5ng/ml) for 30 min. Phosphorylation and total levels of Statl were analyzed by IB.
Figure 7C is an image depicting analysis of the MEFs from PERKπ/t1 mice transduced as indicated infected with VSV at MOI 0.1 (+) or 0.5 (++) for 20 h and treated with IFN-β for 30 min. IB analyses using indicated antibodies are shown.
Figure 7D is an image depicting analysis of the derivatives of Huh 7 cells co-transfected with indicated shRNA constructs and Flag-STATl and treated with IFN-α (50 IU/ml) for 30 min. Statl proteins were immunoprecipitated using anti-Flag antibody and analyzed by IB using anti-phospho-Statl and anti-Statl antibody.
Figure 7E is an image depicting analysis of the titer of VSV produced in control or PERK-depleted derivatives of 2fTGH cells 14h after infection (an incubation of cells with VSV at MOI 1.0 for I h). The effect of IFN-α (20 IU/ml) added either 16 h prior to the infection (pre-treat) or immediately after infection (co-add) was determined. Data shown (the mean ± SD) are representative of two independent experiments (each in triplicate). Asterisk denotes p<0.01 in comparison with untreated cells.
Figure 7F is an image depicting analysis of the MEFs from PERKfl/tl mice transduced as indicated infected with VSV (MOI 1.0). 20 h after infection, viral titer in the culture supernatant was determined. Values represent the mean ± SD of three independent experiments each performed in triplicate. VSV-M protein levels analyzed by IB in cell lysates are also shown in the inset.
Figure 7G is an image depicting analysis of the 2fTGH and isogenic IFNAR2-deficient U5a cells transduced with indicated shRNA constructs and then infected with VSV (MOI 1.0) for 18-20 h. Levels of VSV-M, ISGl 5 and β-actin were determined by IB. In a paral lel experiment, these cells were treated with TG (1 μM for 30 min) and analyzed for PERK levels by IP-IB (lower panel). Figure 8 is an image depicting analysis of the 293T cells transfected with Flag-IFNARl or empty vector (pCDNA3) and the lysates analyzed by immunoblotting using the indicated antibodies.
Figure 9 is an image depicting analysis of the 2fTGH cells transfected with Flag-IFNARl or empty vector (pCDNA3) and whole cell lysates (WCE).
Endogenous IFNARl was immunoprecipitated and analyzed by IB using anti-pS535 and anti-IFNARl (Rl) antibodies. WCE were analyzed by immunoblotting using the indicated antibodies.
Figure 10 is an image depicting characterization of shRNA against human PERK. 293T cells were transfected with control shRNA plasmid or shPERK plasmid. 48 h after transfection, cells were harvested and the cells lysates were subjected to analysis for PERK levels by IP-IB. Levels of IREl in the lysates serve as loading control.
Figure 1 1 is an image depicting analysis of the 293T cells co-transfected with Flag-IFNARl along with control shRNA plasmid or shPERK plasmid as indicated, 48 h after transfection, cells were harvested and the cells lysates were subjected to immunoblotting analysis using the indicated antibodies.
Figure 12 is an image depicting analysis of the 293T cells pre-treated with methylamine (2OmM) for 1 h and then with 5mM of DTT for 30 min. Lysates were subjected to IP-IB analysis for pS535 and total IFNARI levels. Figure 13 is an image depicting analysis of the 293T cells transduced with lenti viruses encoding control shRNA (shCon) or shIRElα (shlREl). The cells were treated with TG (i μM) or IFN-α (1000 IU/ml) for 30 min. pS535 and total IFNARl levels were examined using IP-IB. The effect of IREl α knockdown was also determined by direct immunoblot. Figure 14 is an image depicting analysis of the 293T cells transfected with a control shRNA construct or shRNA against PERK treated with TG (l μM) or IFN-α (1000 IU/ml) for 30 min. Phosphorylation and levels of endogenous IFNARl and eIF2α were analyzed by immunoblotting.
Figure 15 is an image depicting analysis of the 293T cells pre-treated with methylamine HCl (MA, 2OmM) for 1 h and then treated with TG (l μM) for indicated time. Ubiquitination of endogenous IFNARl was analyzed by IP-IB using the indicated antibodies.
Figure 16 is an image depicting analysis of the MEF cells derived from IFNARl -null mice stably transduced with either empty retrovirus ("Vector) or with retroviruses for expression of mouse Flag-tagged IFNARl (wild type or S526A mutant, "SA"). Effect of TG treatment on IFNARl ubiquitination was analyzed by IP-IB using the indicated antibodies.
Figure 17 is an image depicting analysis of the 2fTGH cells left untreated or infected with VSV (MOI 0.1 and 0.3 respectively) for 19 h. Levels of indicated proteins were analyzed by immunoblotting using indicated antibodies.
Figure 18 is an image depicting analysis of the 2fTGH cells infected with MOI 0.1 VSV for 16, 18 and 20 h. pS535 and total IFNARl levels were determined.
Figure 19 is an image depicting analysis of the 2fTGH cells transduced with control virus (shCON) or virus encoding shPERK (shPERK) treated with TG ( 1 μM) for 30 min. PERK levels were determined by IPIB. Levels of p-elF2α or total eIF2α were determined by direct immunoblot.
Figure 20 is an image depicting analysis of the 2fTGH transduced with empty virus (pLK), virus encoding shPERK (shPERK), irrelevant control shRNA (shCon) or shIREl were infected with MOI 0.1 of VSV for 20 h. Total IFNARl levels were determined by IP-IB. Position of mature IFNARl is indicated by arrow. Asterisks points to a non-specific band that serves as loading control.
Figure 21 is an image depicting analysis of the 293T cells treated with TG (i μM) for 4 h and then the cells were re-fed with fresh medium overnight. After that incubation, cells were treated with 50 IU/ml of IFNα or IFNγ for 30 min. pSTATl and STATl levels were determined by immunoblotting.
Figure 22 is an image depicting analysis of the parental Huh7 cells or cells harboring the subgenomic (Sub-HCV) or the full length (FL-HCV) HCV genome treated with 50 IU/ml of IFNα (0.5 h and 1 h) or IFNγ (0.5 h). pSTATl , STATl and β-actin levels were analyzed. Figure 23 is an image depicting analysis of the WT or PKRMEFs infected with MOI 0.1 of VSV for 20 h. Cells were then treated with mIFNβ (50 IU/ml) for 30 min. pSTAT] and total STATl levels were determined. VSV-M, p-eIF2α and levels of two short-lived proteins p-β-catenin and c-Jun were used to show similar levels of viral and stress load in either cell line. Total eϊF2α levels were used as loading control. Figure 24 is an image depicting analysis of the WT or conventional PERK" 7 MEFs or MEFs stably expressing exogenous PERK infected with VSV. Twenty hours later, virus-containing culture supernatant was harvested and viral titer was determined. Levels of PERK expression are shown in Figure 25.
Figure 25 is an image depicting analysis of the WT or conventional PERK-/-MEFs or MEFs stably expressing exogenous PERK transfected with ISRE- luciferase reporter along with Renilla luciferase reporter plasmid. IFN-β-induced ISRE- driven transcription was analyzed as previously described (Kumar, et al., 2003, Embo J 22(20):5480-5490). Average activity (in arbitrary units normalized per renilla luciferase) from three independent experiments is shown. Lower panel depicts IB analysis of the lysates from these cells using anti-PERK antibody. Position of PERK is indicated by an arrow. A non-specific (NS) band serves as a loading control.
Figure 26 is an image depicting analysis of the 21TGH cells harboring either shPERK or irrelevant control shRNA (shCon) infected with MOI 0.1 of VSV. Blocking antibodies against IFN-α and IFN-β (at 500U) were added to the medium at that time as indicated. Cells were harvested 16 h later and the levels of VSV-M and β-actin were analyzed by IB.
Figure 27, comprising Figures 27A through 27D, is a series of images demonstrating that PTPlB regulates the extent of IFNARl endocytosis. Figure 27 A is a graph demonstrating that overexpression of PTPlB (blue line) increases the efficacy of internalization of IFNARl measured by the high throughput fluorescence assay; expression of catalytically inactive PTP 1 B mutant (D 181 A) decreases the rate of
IFNARl endocytosis. Figure 27B is a graph demonstrating that knockdown of PTP I B by shRNA decreases the rate of IFNARl endocytosis. Figure 27C is an image presenting commercially available inhibitors of PTPl B. Figure 27D is a graph demonstrating that inhibitors of PTP I B prevent efficient endocytosis of IFNARl . Figure 28, comprising Figures 28A and 28B, is a graph demonstrating pre- treatment of human 2fTGH cells with inhibitors of PTPlB potentiates the protective effect of IFN-α against viruses. Cells were pre-treated or not with SSG and then treated with different doses of IFN-α (25-lOOU/ml). After that, cells were infected with vesicular stomatitis virus (VSV) and the titer of this virus (as a measure of its replication) was measured 24hr after treatments. Figure 29 is an image depicting PTPI B inhibitors.
Figure 30 is an image demonstrating that inhibition of PKD2 (but not related kinases PKDl or PKD3) by siRNA prevents phosphorylation of IFNARl on Ser535 in HeLa cells treated with IFN-α. Lower panel shows total levels of IFNARl .
Figure 31 is an image demonstrating that inhibition of PKD2 (but not related kinases PKD 1 or PKD3) by shRNA prevents phosphorylation of IFNAR 1 on
Ser535 in HeLa cells treated with IFN-α. Lower panel shows total levels of IFNARl .
Figure 32 is an image depicting the analysis of the degradation of IFNARl in shCOO2 and ShPKD2 stable cells after treatment with interferon alpha.
Figure 33 is an image demonstrating that knockdown of PKD2 prevents downregulation of cell surface levels of IFNARl as measured y the FACS analysis. Green line = untreated cells; blue and brown lines = treated with IFN-α (for 1 and 2 hr respectively). Red = negative control (isotype antibody).
Figure 34 is an image depicting the analysis of the effects of knockdown of PKD2 in HeLa cells on IFN-α signaling measured by activating tyrosine phosphorylation of Statl protein. Cells were treated with a pulse (15 min) of IFN-α and hen incubated in IFN-free media. Statl phosphorylation (upper panel) and total levels (lower panel) was assessed at different time points (in minutes) as indicated.
Figure 35 is an image depicting the analysis of the knockdown of PKD2 in human 2fTGH cells stimulates expression of interferon-inducible genes such as PKR and Statl . Levels of these proteins and levels of actin (as loading control) are analyzed as indicated.
Figure 36 is an image depicting the analysis of the replication of vesicular stomatitis virus (VSV) of 2fTGH-shCON and 2fTGH-shPKD2 cells. Upper panels show the assessment of viral replication by expression of viral VSV-M protein. Lower panel actually depicts the results of measurement of the titer of VSV in cells treated with indicated doses of IFN-α. Figure 37, comprising Figures 37A-37E, depicts the results of example experiments demonstrating that Sangivamycin (SGM) inhibits PKD2 and increases the efficiency of IFN signaling.
Figure 38, comprising Figures 38A-38D, depicts the results of example experiments demonstrating that sangivamycin inhibits PKD2 and increases the efficiency of IFN signaling.
Figure 39, comprising Figures 39A-39E, depicts the results of example experiments conducting inhibitory analysis of the degron phosphorylation of IFNARl and its interaction with 0-Trcp2. (A) In vitro binding of 35S-labeled β-Trcp2 to GST- IFNARl (wild type or S535,539A mutant, SA) upon its phosphorylation with CK lα- depleted lysates from cells treated with IFN-α as indicated; (B) Effect of various kinase inhibitors on phosphorylation of GST-IFNARl by the CKl α-depleted lysate from IFN-α- treated (for 10 min) cells analyzed by subsequent binding of 35S-labeled β-Trcp2; (C) Immunoblot analysis of Flag-IFNARl immunopurified from cells pre-treated with kinase inhibitors and then treated with IFN-α as indicated; (D, E) Immunoblot analysis of endogenous IFNARl immunopurified from cells pre-treated with kinase inhibitors and treated with IFN-α as indicated.
Figure 40, comprising Figures 40A-40E, depicts the results of example experiments demonstrating that PKD2 mediates degron phosphorylation of IFNAR l . (A) Immunoblot analysis of endogenous IFNARl immunopurified from HeLa cells that received indicated siRNA oligos. Levels of PKD species and β-actin in whole cell lysates (WCL) were also analyzed; (B) Immunoblot analysis of Flag-IFNARl immunopurified from U3A cells that received indicated siRNA oligos; (C) In vitro phosphorylation of GST-IFNARl on Ser535 by purified GST-PKD species was analyzed by immunoblotting; (D) Effect of G56976 (20-20OnM) on in vitro phosphorylation of GST- IFNARl by purified GST-PKD2 (wild type or kinase dead, KD) analyzed as in panel C; (E) Immunoblot analysis of endogenous IFNARl immunopurified from cells stably transduced with shRNA against GFP (shCON) or PKD2 (shPKD2) and then treated with IFN-α or thapsigargin (TG) was carried out as described in panel A. Figure 41, comprising Figures 41A-41E, depicts the results of example experiments demonstrating that PKD2 regulates ubiquitination, endocytosis and degradation of IFNARl . (A) Immunoblot analysis of IFNARI immunopurified from HeLa cells that received indicated siRNA oligos. Levels of PKD2 and β-actin in whole cell lysates (WCL) were also analyzed; (B) Effect of PKD2 knockdown (open squares) on the rate of internalization of endogenous IFNARl measured by a fluorescence-based assay are presented as % of total cell surface IFNARl level (Mean ± S.E.M.); (C) FACS analysis of IFNARl levels on the surface of cells that received indicated shRNA. Green, blue, and brown signals represent cell surface expression of IFNARl after 0, 1, and 2 h of IFN-α treatment, respectively (red - isotype control); (D) Immunoblot analysis of endogenous IFNARl in cells untreated or pre-treated with the PKD inhibitor CID755673, and then subjected to a cycloheximide (CHX) chase in the presence of IFN-α for the indicated times; (E) Degradation of IFNARl in cells that received indicated shRNA was assessed as in panel D.
Figure 42, comprising Figures 42A-42D, depicts the results of example experiments demonstrating the ligand-induced recruitment of PKD2 to IFNARI and stimulation of PKD2 kinase activity. (A) Immunoblot analysis of IFNARl immunopurified from 293T cells treated with IFN-α for the indicated times. Left lane of the upper panel represents the whole cell lysate from untreated cells; (B) Immunoblot analysis of phospho-Ser7101evels of GST-PKD2 and purified from HeLa cells treated with IFN-α as indicated; (C) Immunoblot analysis of phospho-Ser710 levels of endogenous PKD2 immunopurified from HeLa cells treated with IFN-α as indicated; (D) In vitro immunokinase activity of endogenous PKD2 purified from HeLa cells (treated with IFN-α as indicated) towards GST-IFNARl as a substrate in the presence of γ-32P- ATP as analyzed by autoradiography (upper panel), Coomassie staining (middle panel), and immunoblotting with an antibody against PKD (lower panel). Figure 43, comprising Figures 43A-43E, depicts the results of example experiments assessing the role of Tyk2 and tyrosine phosphorylation of PKD2 in its activation and IFNARl degron phosphorylation. (A) Activity of GST-PKD2 expressed in cells harboring wild type or kinase dead Tyk2, and left untreated or treated with IFN-α, was analyzed by in vitro Ser535 phosphorylation of GST-IFNARl as assessed by immunoblotting using a phospho-S535 specific antibody. Levels of substrate and kinase were also analyzed by immunoblotting; (B) Tyrosine phosphorylation and levels of endogenous IFNARl immunopurified from HeLa cells treated with IFN-α as indicated were analyzed by immunoblot; (C) In vitro tyrosine phosphorylation of recombinant PKD2 by recombinant Src or HA-tagged Tyk2 purifed from cells untreated or treated with IFN-α as indicated, was analyzed by immunoblotting using phospho-Tyr specific antibody. Immunoblot analysis of levels of HA-Tyk2 and PKD2 in the reaction is also provided in the middle and lower panels; (D) Activity of GST-PKD2 (wild type or Y438F mutant) expressed in HeLa cells treated as indicated was analyzed as in panel A; (E) Immunoblot analysis of phosphorylation and levels of endogenous IFNARl in HeLa cells that received indicated shRNA and expression constructs. Levels of endogenous (lower panel) and exogenous PKD2 in whole cell lysates are also shown.
Figure 44, comprising Figures 44A-44F, depicts the results of example experiments demonstrating that PKD2 regulates the extent of cellular responses to IFNa. (A) Statl Tyr phosphorylation and levels in cells untreated or pre-treated with the PKD inhibitor CID755673 for 1 h and then pulse-treated with IFN-α for 15 min (followed by removal of cytokine and inhibitor and incubation of cells for the indicated times) was analyzed by immunoblotting; (B) Analysis in cells that received indicated shRNA was carried out as in panel A; (C) Relative activity of ISRE-driven firefly luciferase activity normalized to renilla luciferase activity in 2fTGH cells. Cells were pre-treated with the PKD inhibitor CID755673 (for 1 h) and pulse-treatment with lFN-α (for 0-2 h) as indicated and the activity of luciferase was assessed 24 h later. Data from four independent experiments (each in triplicate) are presented as Mean ± S.E.M.; (D) Analysis of ISRE-driven transcription in 2fTGH cells that received the indicated shRNA and were pulse treated with IFN-α for indicated time was carried out as described in panel C; (E) Immunoblot analysis of PKR, Statl and β-actin levels in 2fTGH cells that received the indicated shRNA, were pulse-treated with IFN-α for indicated times, and were analyzed 24 h thereafter; (F) Cells were untreated or pre-treated with IFN-α (at the indicated doses) and then infected with VSV. Viral titers from three independent experiments (each in quadruplicate) are shown as mean ± S. E. M.
Figure 45, comprising Figures 45A-45F, depicts the results of example experiments assessing the role of phosphorylation-dependent degradation of IFNARl in VEGF-stimulated angiogenesis. (A) Immunoblot analysis of ubiquitination, phosphorylation and levels of Flag-IFNARl stably expressed in U3A cells treated with VEGF as indicated. Phosphorylation and levels of PKD and Erk were also analyzed; (B) Immunoblot analysis of phosphorylation and levels of Flag-IFNARl from U3A cells that received indicated shRNA and were treated with VEGF as indicated; (C) Degradation of Flag-IFNARl in U3A cells treated with VEGF as indicated; (D) Immunoblot analysis of Statl phosphorylation and levels in human umbilical vein endothelial cells pre-treated with VEGF (100 ng/ml for 2h) and treated with indicated dose of lFN-α (for 15 min). The relative ratio of phospho-Statl /total Statl signal (arbitrary rated at 1.0 in untreated cells) is depicted below the bottom panel; (E) Cell surface levels of mIFNARl in mVEGF- treated (red line) or not (blue line) CD31 -positive bone marrow cells from indicated mice; control Ig - green line; (F) In vivo angiogenesis assay in mice of indicated genotype was carried out as outlined in Experimental Procedures. Pictures of retrieved plugs and graph that depicts measurement of hemoglobin (mean ± S.E.M.) are shown in the left panels. Immunohistochemical analysis using anti-CD31 Ab is shown on the right. Figure 46 depicts the results of example experiments assessing the phosphorylation of endogenous IFNARl in 293T cells transfected with siRNA against PKDl or 293T cells PKD2. Levels of PKD species were also analyzed by immunoblot in WCL.
Figure 47 depicts the results of example experiments assessing indicated GST-tagged PKD proteins expressed in 293T cells and purified by pull down with glutathione beads were incubated with myelin basic protein (MBP) and radiolabeled γ32P-ATP. A control reaction ("CON") was carried out using the lysates from untransfected cells. Incorporation of labeled phosphate into PKD and MBP was analyzed by autoradiography. Levels of MBP (Coomassie staining) and GST-tagged PKD species (immunoblot with antibody against GST) are also shown.
Figure 48 depicts the results of example experiments assessing the co- immunoprecipitation of endogenous IFNARl and PKD2 from the lysates of 293T cells. Control reaction utilized an irrelevant monoclonal IgG antibody (anti-Flag).
Figure 49 depicts the results of example experiments assessing the phosphorylation of and levels of endogenous IFNARl immunopurified from 1 1 .1 -derived cells that harbor wild type (WT) or catalytically inactive (KR) Tyk2 treated with IFN -α as indicated.
Figure 50 depicts the results of example experiments assessing the cytopathogenic effect of VSV manifested in the appearance of rounded, poorly attached, dying cells upon infection of human 2fTGH cells that received indicated shRNAs and pre-treated with IFN-α as indicated and then infected with VSV (at M.O.I, of 0.5). A comparable viral load in untreated cells was verified by expression of VSV-M viral protein (analyzed by immunoblot shown in the lower panels). The extent of PKD2 knockdown is also shown. Figure 51 depicts the results of example immunoblot analyses of endogenous IFNARl immunopurified from cells treated with IFN-α, H2O2 or TPA as indicated.
Figure 52 depicts the results of example cychoheximide chase analyses of turnover of endogenous IFNARl in human umbilical vein endothelial cells untreated or treated with VEGF. Equal loading was verified by analysis of β-actin in these samples. The graph depicts % of remaining IFNARl at the indicated time points.
Figure 53 depicts the results of example PCR analyses of DNA from tails of back-crossed chimeric S526A mice of the indicated gender. Presence of the SA alleles in 3 founders is indicated by a PCR product that migrates slower due to a remaining loxP site.
Figure 54, comprising Figures 54A-54C, depicts the results of example experiments demonstrating the purification of cellular Ser535 kinase activity. (A) Purification scheme and results from in vitro kinase activity assays that used immunoblotting with phospho-specific antibody or [~ -32P]ATP incorporation into the GST-IFNARl substrate as indicated. (B) Phosphorylation of bacterium-produced GST- IFNARl (wild type or Ser535,539Ala mutant [SA]) by the starting fractions before loading onto either SP Sepharose (SP) or hydroxyappatite (HA) columns in the presence of radioactive [~ -32P]ATP was analyzed by SDS-PAGE and autoradiography. Mutant IFNARl migrates slower due to the presence of additional amino acids in the linker between GST and the cytoplasmic domain of IFNARl (as outlined in references 31 and 32). (C) Active fractions were pooled after the last purification step. Proteins were precipitated and separated on an SDS-PAGE gel followed by silver staining. Five indicated major bands were cut out for mass spectrometry analysis. The identities of the bands and the sequences of identified Ckl α-derived peptides are shown on the right.
Figure 55, comprising Figures 55A-55E, depicts the results of example experiments demonstrating that CkI α represents the major Ser535 kinase in the cell lysates. (A) HeLa lysates were immunoprecipitated (IP) with control immunoglobulin Gs (IgGs) or antibodies against Ck lα or CKI s and protein G beads. The supernatants of these reaction mixtures were analyzed for their S535 kinase activity by an in vitro kinase assay (KA) with GST-IFNARl as a substrate, detected by immunoblotting using anti- pS535 and anti-GST antibodies (upper panels). Efficacy of immunodepletion was verified by immunoblotting using antibodies for Cklα and CKI s (lower panels). (B) Lysates from HeLa cells transfected with the indicated siRNAs were used in the kinase assay. Phosphorylation of GST-IFNARl and levels of Ckl α in whole-cell lysates (WCL) were analyzed by IB using the indicated antibodies. Ponceau S staining of the membrane to detect GST-IFNARl is also depicted. (C) 293T cells were transfected with empty vector or Myc-tagged human Cklα, and lysates were prepared. These lysates were analyzed for their IFNARl Ser535 kinase activity (as for panels A and B). In addition, phosphorylation of GST-IFNARl in the immunokinase assay (as well as the levels of Myc-Cklα and GST-IFNARl) was assessed via IP using anti-Myc antibody; results are depicted in the lower panels. (D) 293T cells were treated with DMSO or TG (1 μM) for 30 min. Lysates were subjected to Cklα IP, followed by analysis of Ser535 activity in vitro using GST-IFNARl as a substrate. Induction of ER stress was shown by phosphorylation of p-eIF2a as assessed by IB using phosphor-specific antibody. (E) 293T cells were untreated or treated with TG (1 μM for 30 min) and harvested. Lysates from these cells were immunodepleted of Ckl α as outlined for panel A. Increasing amounts (0.12 to 0.5 μg) of bacterium-produced recombinant GST-Ck lα were incubated with the substrate (GST-IFNARl) and ATP (except in lane 1) at 300C for 30 min without any lysates (lanes 4 to 6) or in the presence of 4 μg of immunodepleted lysates from untreated (LIN; lanes 7 to 9) or TG-treated (lanes 10 to 12) cells. Phosphorylation of GST-IFNARl on Ser535, levels of GST-IFNARl (using anti-GST antibody), and levels of Cklα were analyzed by IB. Figure 56, comprising Figures 56A-56F, depicts the results of example experiments demonstrating that CkI α mediates basal IFNARl phosphorylation, ubiquitination, and downregulation in cells. (A) 293T cells were cotransfected with Flag- IFNARl and Myc-hCklα or an empty vector. Ser535 phosphorylation of Flag-IFNARl was analyzed by Flag immunoprecipitation (IP) followed by IB of pS535. The total levels of IFNARl were determined by reprobing the blot with an anti-Flag antibody. Myc-Ckl α levels in the whole-cell lysates (WCL) are shown in the lower panel. (B) 293T cells expressing Flag-IFNARl were treated with CKI-7 (400 μM) for the indicated times. Immunopurified IFNARl was analyzed by IB using the indicated antibodies. (C) HeLa cells were cotransfected with Flag-IFNARl and siRNA against Cklα or a control siRNA. At 48 h after transfecti on, lysates were harvested and were subjected to IP using anti-Flag antibody followed by IB analysis using the indicated antibodies. Levels of Cklα and Erkl/2 (as a loading control) in WCL were assessed by IB using the indicated antibodies. (D) HeLa cells were transfected with RNAi against Cklα or luciferase and analyzed for the surface levels of endogenous IFNARl by FACS using the AA3 monoclonal antibody. Control using irrelevant immunoglobulin (Ig) is also shown. (E) HeLa cells were transfected with siRNA as for panel C and then treated with the low dose of IFN-a (5 IU/ml) for 15 min as indicated. Activation and levels of Stat I were analyzed by immunoblotting using the indicated antibodies. The ratio between pStatl and Statl signals was calculated using Li-Cor's Odyssey infrared fluorescence-based quantification system. (F) Human 2fTGH cells were cotransfected with shRNA against GFP (shCON) or against Cklα (shCklα) and with pBABE-puro vector. After 4 days of selection in medium containing puromycin (4 μg/ml), the cells were plated into 96-well plates (5 x 104/well) and treated (+) or not treated (— ) with IFN-a (250 IU/ml for 48 h) as indicated. Numbers of cells as a function of absorbance were measured using the CellTiter 96 cell proliferation assay kit (Promega) and are presented in optical density (OD) units as depicted on the graph. Averages of a total of six experiments are shown.
Figure 57, comprising Figures 57A-57E, depicts the results of example experiments demonstrating that Ckl α is required for efficient IFNARl downregulation in response to ER stress. (A) HeLa cells were transfected with control siRNA or siRNA against Cklα. After 48 h, cells were treated with vehicle control, TG (1 μM), or IFN-a (1,000 IJ/ml) for 30 min, and lysates were harvested. The lysates were subjected to IFNARl immunoprecipitation (IP) followed by IB of pSer535 and total IFNARl . The efficiency of CkI α knockdown is shown in the lower panel. (B) 2fTGH cells were pretreated with 15 μM of D4476 or DMSO for 1 h and then treated with vehicle control, TG (1 μM), or IFN-a (1 ,000 IJ/ml) for 30 min. IFNARl Ser535 phosphorylation and total levels were determined by IP-IB. Total levels of eIF2a and its phosphorylation (as a marker of the PERK-dependent effect of TG) in whole-cell lysates (WCL) were also analyzed. (C) HeLa cells were transfected with control siRNA (siCon) or siRNA against Ck lα (siCkl α). At 48 h after transfection, cells were treated with DMSO or TG (1 μM) for the indicated times. Levels of total IFNARl were determined by IP-IB. Levels of Cklα and actin in total cell lysate were examined by IB. (D) 2fTGH cells were infected with VSV (MOI, 0.1) for 13 h. The infected cells were then treated with DMSO or 20 μM of D4476, and cells were further incubated for 0.5,1.0, or 2.0 h. At these time points, cells were harvested. Endogenous IFNARl from these cells was analyzed by IP-IB using the indicated antibodies. Levels of viral protein VSV-M and phosphorylation of elF2a (indicative of ER stress) were also assessed by IB in WCL. The nonspecific band (NS) is indicative of the loading of the gel. (E) Lysates from experiments shown panels B and D were analyzed for Statl phosphorylation and Statl levels by IB using the indicated antibodies. Figure 58, comprising Figures 58 A-58F, depicts the results of example experiments characterizing the S535 kinase activity of several human CKl isoforms and CKl-like proteins from other organisms. (A) 293T cells were transfected with an empty vector (Vec) or Myc-tagged Cklα (a), CKl S (S), or CKIs (s) or, as shown in the right panel, with HA-tagged vaccinia virus Bl kinase (vvB l), the kinase-dead vvB l (KD-Bl), L. major CKl (L-CKl), or human Ckl α. These transfected kinases were IPed with Myc or HA and were subjected to in vitro immunokinase assay (KA) to determine Ser535 phosphorylation of GST-IFNARl . Levels of the substrate as well as kinases expression were also analyzed. (B) Autophosphorylation of HA-tagged wB l (expressed in and immunopurified from 293T cells) was carried out in the presence of labeled [~ -32P]ATP and detected by SDS-PAGE and autoradiography. Immunoprecipitation (IP) reactions from the lysates of the vector-transfected cells or cells expressing catalytically inactive KD-vvB l mutant were used as a negative control. (C) In vitro phosphorylation of GST- IFNARl using lysates from cells transfected with indicated kinases as a source of the kinase activity was measured by immunoblotting using phospho-specific anti-pS535 antibody (upper panel). Expression of CKl species was analyzed by IB using anti-HA antibody (lower panel). pEF and pSG indicate cells transfected with the indicated empty vectors. (D) 293T cells were cotransfected with Flag-IFNARl together with an empty vector (Vec) or Myc-tagged CkI α (a), CKl S (S), or CKI s (s) or, as shown in the right panel, with HA-tagged L-CK l . Phospho-S535 and total IEVARl signals were analyzed by IP-IB. Ectopic expression levels of the kinases were determined by Myc or HA IB. In the left panel, phosphorylation and total eIF2a levels are indicative of comparable levels of ER stress in cells transfected with different CKl isoforms. (E) In vitro phosphorylation of GST-IFNARl with supernatant from L. major promastigote culture. Buffer lacking Leishmania was used as a control (Con). These fractions were incubated with ATP and GST-IFNARl (5 μg) at 3O0C for 30 min. The products of this kinase reaction were analyzed by IB for pS535 and GST. (F) In vitro phosphorylation of GST-IFNARl by concentrated supernatant of cultured amastigotes of L. mexicana (obtained upon treatment with buffers with indicated pHs that mimicked the phagosomal or cytosolic environments) was measured by incorporation of radioactive phosphate as described elsewhere herein. Figure 59, comprising Figures 59A-59D, depicts the results of example experiments demonstrating that expression of L-CKl promotes phosphorylation- dependent IFNARl ubiquitination, and degradation. (A) 293T cells were cotransfected with Flag-IFNARl and HA-tagged L-CKl (WT or kinase-dead K40R mutant) or an empty vector. The levels of pS535 and total IFNARl were determined by IP-IB. The levels of L-CKl in whole-cell lysates (WCL) were determined by IB using anti-HA antibody. (B) 293T cells were cotransfected with IFNARl (WT or S535A mutant) and L- CKl or an empty vector. The levels of ubiquitinated, S535-phosphorylated. and total IFNARl were analyzed by IP-IB. The levels of L-CKl were assessed by HA IB. (C) MEFs derived from IFNARl1 mice reconstituted with WT or S526A mouse IFNARl were transfected with L-CKl or an empty vector. The levels of IFNARl and L-CKl were determined by Flag and HA IB, respectively. N.S., nonspecific band. (D) Human blood monocyte-derived dendritic cells were infected with L. major promastigote culture (containing 50% metacyclics at an MOI of 10) or left uninfected as a control (Con). After overnight incubation, cells were subjected to FACS analysis of cell surface IFNARl using AA3 monoclonal antibody. Figure 60, comprising Figures 60A-60D, depicts the results of example experiments demonstrating that L. major infection or L-CK 1 expression suppresses Type I IFN signaling. (A) Mouse bone marrow-derived macrophages were infected or not with L. major parasites (as outlined for Figure 59D) at the indicated ratios. After overnight incubation, cells were treated with mouse IFN-a (200 IU/ml) or IFN-y (10 ng/ml) for 30 min. Levels of phosphorylated and total Statl were determined by IB. (B) 293T cells transfected with the indicated plasmids were subjected to pulse treatment with human IFN-a (500 IU for 15 min). Cells were harvested at the indicated time points after beginning of treatment and analyzed for Statl activation using the indicated antibodies. Levels of L-CKl were analyzed by IB. (C) MEFs from IFNART mice reconstituted as described for Figure 59C were transfected with empty vector or L-CK l as indicated. After 24 h, cells were trypsinized and equal numbers of cells were plated into 12-well plates. After overnight incubation, cells were pulsed with murine IFN-a (50 IU/ml) for 30 min and then chased with fresh medium for the indicated times (relative to the initial addition of IFN). Lysates were harvested, and the levels of pStatl, total Statl , and Flag- IFNARl were determined by IB. (D) Lysates from untreated cells from the experiment shown in panel C were analyzed for expression of HA-tagged L-CK l using IP-IB with anti-HA antibody.
Figure 61 , comprising Figures 61A-61 B, depicts the conserved priming site within IFNARl regulates the intrinsic stability of the protein. A. Alignment of primary sequences of IFNARl from indicated species. The phospho-degron sequences are shaded and serine residues within the degron are underlined. The conserved putative priming site (Ser532 in human IFlMARl) is denoted by an asterisk. B. Degradation of Flag-IFNARl (wild type or S532A mutant) overexpressed in 293T cells was analyzed by cycloheximide (CHX, 2 mM) chase for the indicated times followed by immunoblotting using anti-Flag antibody. Levels of β-actin were also analyzed as a loading control. Figure 62, comprising Figures 62A-62D, depicts the results of example experiments demonstrating that priming phosphorylation is required for the ligand- independent phosphorylation of IFNARl degron. A. Degron phosphorylation of Flag- IFNARl (wild type or Ser532A mutant) co-expressed in 293T cells with Myc-tagged human CK lα or empty vector (Vec) and treated or not with IFNα (1000 IU/mL for 30 min as indicated) was analyzed by Flag immunoprecipitation followed by immunoblotting using the indicated antibodies. Levels of Myc-CKlα in whole cell lysates were also determined. B. Flag-IFNARl (wild type or Ser532A mutant) was co- expressed in 293T cells with HA-tagged Leishmania CKl (HA-L-CKl , wild type or kinase-dead, KD) and purified by Flag immunoprecipitation. Phosphorylation of the IFNARl degron and levels of IFNARl were analyzed by immunoblotting using the indicated antibodies. Levels of HA-L-CKl in whole cell lysates (WCL) were also determined. C. Characterization of anti~pS532 antibody. Flag-IFNARl proteins (wild type, S535A or S532A mutants) were expressed in 293T cells, immunopurified, and analyzed using the indicated antibodies. Vec - reactions from cells transfected with empty vector (pCDNA3). D. 293T cells were untreated (UN) or treated with thapsigargin (TG, 1 μM for 30min) and harvested. Lysates from these cel ls were twice immunodepleted with antibodies against CK lα and the CK lα- free supernatants (4 μg) were used alone (lanes 2-3) or together with 0.5 μg of bacterially produced recombinant GST-CKl α (lanes 1 and 4-9) for in vitro phosphorylation of GST-IFNARl (wild type, lanes 1-6, or S532A mutant, lanes 7-9) in the presence of ATP (except in lane 1 ) at 3O0C for 30 min as indicated. Phosphorylation of GST-IFNARl on Ser532, Ser535, levels of GST-IFNARl (using anti-GST antibody) and levels of CKl α were analyzed by immunoblotting. Figure 63, comprising Figures 63 A-63D, depicts the results of example experiments demonstrating that UPR induces phosphorylation of the priming site that is required for increased ubiquitination and degradation of IFNARl . A. Endogenous IFNARl proteins immunopurified from HeLa cells that were untreated (Mock), or were treated with TG (1 μM for 30 min), IFNa (6000 IU/mL for 30 min), or infected with VSV (0.1 MOI for l hr followed by additional lOhr incubation in virus-free medium) as indicated, were analyzed by immunoblotting using the indicated antibodies. B. Endogenous IFNARl proteins immunopurified from 1 l . l-Tyk2-null derivative cell lines reconstituted with wild type Tyk2 (WT) or catalytically deficient Tyk2 (KR ) or WT cells were treated with TG or IFNα (in doses indicated in panel A) for 30 min. C. Flag- IFNARl proteins (wild type or S532A mutant) were expressed in 293T cells. The cells were pre-treated with a lysosomal inhibitor (methylamine HCl5I O mM) for l hr to prevent degradation of ubiquitinated receptors. Then the cells were treated with TG (1 μM for the indicated times) and Flag~IFN ARl proteins were immunopurified under denaturing conditions and analyzed by immunoblotting using antibodies against ubiquitin (upper panel) and Flag (lower panel). D. Downregulation of the levels of Flag-IFNARl (wild type or S532A mutant) expressed in 293T cells treated with TG (1 μM for indicated times) was analyzed by immunoblotting using Flag antibody. Comparable loading was verified by anti-β-actin immunoblot (lower panel). Figure 64, comprising Figures 64A-64D, depicts the results of example experiments demonstrating the role of PERK in UPRHnduced phosphorylation of priming site of IFNARl . A. HeLa cells transfected with shRNA against PERK or against GFP (shCon) were treated with TG (1 μM for 30 min) and endogenous IFNARl proteins were immunopurified and analyzed for phosphorylation on the priming site, and for total levels by immunoblotting using the indicated antibodies. Phosphorylation of a known PERK substrate eIF2α (as well as its total levels) and the levels of PERK itself were also determined in whole cell lysates (WCL). B. Mouse embryo fibroblasts from wild type or PERK knockout animals were treated with TG as indicated. Levels and priming phosphorylation of endogenous murine IFNARl on Ser523 (analogue of human Ser532) was analyzed by immunoblotting using indicated antibodies. Phosphorylation and levels of eIF2α and the levels of PERK in whole cell lysates (WCL) was also determined. C. Levels of endogenous IFNARl in 293T cells transfected with wild type or the catalytically deficient mutant (K618A) of PERK were analyzed by immunoprecipitation followed by immunoblotting using an antHFNARl antibody. Levels of PERK, phosphorylated PERK, and levels of eIF2α were also examined. D. Whole cell extracts from 293T cells or recombinant bacterially produced constitutively active ΔN-PERK were incubated alone or with GST-IFNARl in the presence of radiolabeled γ-ATP as indicated. Resulting phosphorylation of GST-IFNAR 1 or contaminants and autophosphorylation of PERK was determined by SDS-PAGE followed by Coomassie staining and autoradiography. Positions of PERK, GST-IFNARl , and some irrelevant contaminants (denoted by asterisks) are indicated.
Figure 65, comprising Figures 65A-65D, depicts the results of example experiments demonstrating that priming phosphorylation of IFNARl contributes to regulation of the extent of IFNα/β signaling. A. Control human Huh7 cells, and those expressing the HCV replicon, were analyzed for IFNARl levels by immunoprecipitation- immunoblotting (upper panel). The lower three panels depict the experiments where gel loading was normalized to achieve comparable levels of immunopurified IFNARl in each lane. Phosphorylation of IFNARl on Ser532 and Ser535 was determined by immunoblotting using the indicated antibodies. B. Control human Huh7 cells, and those expressing the HCV replicon, were transfected with Flag-tagged Statl alone with empty vector (Vec) or Flag-IFNARl (wild type or S532A mutant), and were untreated or treated with IFN-α (60 IU/mL for 30 min) as indicated. Lysates of these cells were immunoprecipitated using anti-Flag antibody and analyzed by immunoblotting using antibodies against phospho-Statl , total Statl , and IFNARl . C. Mouse embryo fibroblasts from IFNARl-null animals were reconstituted with murine Flag-IFNARl (wild type or S523A mutant, which is a mouse analogue of human S532A mutant). Cells were treated with indicated doses of murine IFN-β for 1 h, incubated for 8 h in fresh medium, and then infected with VSV (MOI 0.1). Expression of VSV-M protein was analyzed 16 h later by immunoblotting. Levels of β-actin were also determined (lower panel). D. Model for ligand-dependent and ligandHndependent ubiquitination and degradation of IFNARl . Both pathways converge at the level of degron phosphorylation (pS535). Signaling induced by IFN and dependent on the activity of Tyk2 does not require either CK lα (24) or priming phosphorylation (this study). Ligand-independent pathway initiated by inducers of UPR does not need either ligand or Tyk2 activity but requires CK lα (26) and PERK -dependent priming phosphorylation, as disclosed herein.
Figure 66, comprising Figures 66A-66E, depicts the results of example experiments demonstrating that PERK expression is maintained in cancer cells wherein it regulates tumor expansion in vivo. (A) PERK protein levels were measured by immunoprecipitation (IP) followed by Western blot analysis in the following cell lines: MCFlOA (1), MCF7 (2), T47D (3), MDA-MB231 (4), MDA-MB468 (5), TE3 (6), TE7 (7), KYSE 520 (8). (B) PERK protein levels following shRNA targeting of PERK. (C) Parental MDA-MB468 cell line, shPERK-transduced cells (shPERK), and shPERK- transduced cells reconstituted with mouse Myc-PERK (+mPERK) were treated with 2g/ml tunicamycin for the indicated intervals. Western analysis for ATF4, CHOP, or - actin. (D) Volume of orthotopic tumors formed from the mouse mammary tumorxierived cells transduced in vitro with empty vector virus (Neu/PERKloxP/loxP) or Cre- expressing retrovirus (Neu/PERK/0) 28 days post-transplant (n=4). Representative image of tumors are provided. All p-values determined by Student t-test. (E) Western analysis of transgenic ErbB2 and PERK expression following infection of mouse mammary tumor-derived cells with control (Neu/PERKloxP/loxP) or Cre-expressing retrovirus (Neu/PERK/). Thapsigargin treatment (5OnM, 1 h) was used to demonstrate that PERK is functional. Figure 67, comprising Figures 67A-67D, depicts the results of example experiments demonstrating that PERK knockdown triggers a G2/M delay. (A) MDA- MB468 cells were infected with control shRNA or anti-PERK shRNA for the indicated intervals. Cells were pulsed with BrdU 45 min prior to harvest for FACS analysis. (B) Kinetics of growth of the MDA-MB468 parental cell line, control shRNA- (shControl) or shPERK-transduced cells (shPERK), and shPERK-transduced cells reconstituted with mouse Myc-PERK (÷mPERK). PERK protein levels following expression of shRNA targeting human PERK and reconstitution with mouse Myc-PERK are shown. (C) Proliferation rates in mammary gland sections from control (PERKloxP/loxP) and mammary gland-specific PERK knockout mice (PERK/0) on pregnancy day 16 (P l 6) and lactation day 3 (L3) were determined by immunohistochemistry for BrdU (animals were injected with BrdU 1 h prior to being euthanized). (D) Quantification of BrdU-positive cells from (C) is shown; error bars indicate S.D. among 3 animals, 5 acini were counted per animal.
Figure 68, comprising Figures 68A-68D, depicts the results of example experiments demonstrating that PERK knockdown triggers DNA damage response signaling pathway. (A) Immunofluorescence staining for DNA damage-induced foci containing phospho-ATM and phospho-Chk2 following acute PERK knockdown (72 h after infection) in MDA-MB468 cells. (B) Quantification of phospho-ATM positive cells (>3 foci) is shown; error bars indicate S.D. from 3 slides, 5 fields were counted per slide, p-value was determined by Student t-test. (C) Western analysis of DNA damage response-associated markers following PERK knockdown. (D) IP/kinase assays assessing CDK2-dependent phosphorylation of histone Hl (bottom panel). CDK2 complexes were immunoprecipitated from MDA-MB 468 cells treated as indicated. PERK levels were assessed by IP/immunoblot and CDK2 recovery in precipitates was assessed by CDK2 immunoblot (middle panel). Figure 69, comprising Figures 69A-69C, depicts the results of example experiments demonstrating that increased levels of Reactive Oxygen Species (ROS) in PERK knockdown cells contribute to reduced kinetics of cell growth. (A) DCF fluorescence measured by FACS using CM-H2DCFDA dye. (B) Mean values of ROS determined from three independent experiments. Uninfected (black), stably infected with empty vector (blue) or shPERK (red) in both (A) and (B). (C) Growth analysis of MDA- MB468 parental cell line, cells transduced with control shRNA, shPERK, or shPERK and reconstituted with mouse Myc-PERK in the presence of ROS scavenger N-acetylcysteine (NAC).
Figure 70, comprising Figures 70A-70D, depicts the results of example experiments demonstrating that ROS accumulation triggers oxidative DNA lesions in PERK-deficient breast cancer cells and tumors. (A) Detection of 8-oxoguanine oxidized DNA adduct (8-OxoG) using a FITC conjugated 8-OxoG binding peptide in parental MDA-MB468 cells, MDA-MB468 cells transduced with control shRNA, shPERK, or shPERK and reconstituted with mouse Myc-PERK. (B) Quantification of 8-oxoG positive cells from 3 independent experiments. (C) 8-OxoG in paraffin sections from tumors formed by parental MDA-MB468 cells, MDA-MB468 cells transduced with control shRNA, or shPERK. (D) Quantification of 8-OxoG positive cells shown in (C) is provided and error bars indicate S.D. from 4 animals. (E) Detection of 8-OxoG in paraffin sections from orthotopic tumors formed by mouse mammary tumor-derived cells transduced with empty vector (Neu/PERKloxP/loxP) or retrovirus expressing Cre recombinase (Neu/PERK/°). (F) Quantification of 8-OxoG positive cells from (E); error bars indicate S.D. from 4 animals. All p-values determined by Student t-test.
Figure 71, comprising Figures 71A-71 C, depicts the results of example experiments demonstrating that ROS accumulation triggers DNA double strand breaks in PERK -deficient breast cancer cells and tumors. (A) Immunofluorescent staining of - H2AX foci in control or PERK knockdown MDA-MB468 cells. (B) Quantification of - H2AX positive (>5 foci) cells under standard tissue culture conditions. Error bars represent S.D. from 3 independent experiments performed in triplicate. (C) Quantification of the COMET tail moment in control or PERK knockdown cells under standard tissue culture conditions. Error bars indicate S.D. from 3 experiments. Figure 72, comprising Figures 72A-72F, depicts the results of example experiments demonstrating that reduced activity of Nrf2 causes increased oxidative stress in PERK knockdown cells. (A) Quantitative real time PCR analysis of Nrf2 target genes NQOl and GCLC in the indicated cell lines asynchronously proliferating under standard conditions. (B) Purified recombinant Nrf2-Neh2 domain of WT, T80A, S40A or T80A/S40A, was incubated with purified recombinant AN-PERK in the in vitro kinase assay. Phosphorylated Nrf2-Neh2 was detected by autoradiography (upper panel). (C) 293T cells were transfected with WT Nrf2 or Nrf2-T80A. 24 hours after transfection, cells were left untreated (C) or treated with tunicamycin (Tu) for 2 hours followed by immunoprecipitation with anti-Nrf2 antibody. Threonine phosphorylation was detected using a phospho-Thr reactive antibody. Nrf2 in the IP and the whole cell lysate (WCL) was detected with Nrf2 specific antibody. (D) Proliferation of the indicated cell lines was assessed by a 6-day growth curve under standard tissue culture conditions as described in materials and methods. PERK levels were detected by IP/Western blot analysis. (E) Oxidized guanine in damaged DNA was detected by a FITC-conjugated 8- OxoG binding peptide in PERK knockdown cells infected with pBabe control vector (shPERK) or Nrf2- HA (shPERK Nrf2-HA). Quantification of 8-OxoG positive cells is provided. Error bars represent S. D. from 3 experiments. (F) 8-OxoG was detected in PERK knockdown cells transfected with scramble siRNA (Scrm), or keap l siRNA (sikeap l). Error bars in graphs represent S.D. from 3 experiments. Western blot panels demonstrate levels of Nrf2-HA and Keapl in PERK knockdown cells. Figure 73, comprising Figures 73A-73I, depicts the results of example experiments demonstrating that PERK loss attenuates MMTV-Neu-driven mammary tumorigenesis in mice, but promotes spontaneous mammary tumor formation in aged mammary gland-specific PERK knockout mice. (A) Kaplan-Meier analysis of tumor-free survival for cohorts of MMTV-Neu/PERKloxP/loxP (n=21) and MMTV-Neu/PERK/ (n=27) mice. (B) Hematoxylin and eosin staining demonstrating histology of control (Neu/PERKloxP/loxP) and PERK knockout (Neu PERK/0) mammary gland tumors. (C) Western analysis for PERK, ErbB2, and eIF4E levels on whole protein extracts from control (Neu/PERKloxP/loxP) and PERK knockout (Neu/PERK/) mammary gland tumors or mammary gland from lactating PERKloxP/loxP dam (LlO). (D) Nrf2 was precipitated from tumor lysates prepared from MMTV-Neu/PERK/0 or control mice and blotted for phospho-Thr and Nrf2. PERK expression was determined by immunoblot. (E) PERK excision delays development of Neu-driven hyperplastic lesions. Representative mammary glands from 9- to 14-months old control (Neu/PERKloxP/loxP) and PERK knockout (Neu/PERK/) mice revealing pre-malignant lesions are shown. (F) Hematoxylin and eosin staining on lungs from control (Neu/PERKloxP/loxP, n=24) and PERK knockout (Neu/PERK/, n=27) mice revealing metastatic lesions. (G) Troma-1 (cytokeratin-8) staining on lung specimens containing metastatic foci. LT=lung tissue; Met=metastasis; OL=overlay. (H) Hematoxylin and eosin staining for tumor histology and whole mount of hyperplastic lesions in mammary glands of PERK/0 aged females. (I) qRT-PCR for ErbB2 on genomic DNA from PERK/0 tumors and FISH analysis on paraffin sections from the same animals. Levels of ErbB2 in tumors were compared to matched spleen tissues.
Figure 74 depicts the results of example experiments demonstrating that PERK deficiency inhibits expansion of MDA-MB468-derived orthotopic tumors. Tumor volume 36 days post-orthotopic injection of MDA~'MB468 parental cell line, control shRNA- (shControl) or shPERK-transduced cells (shPERK) (4 mice were used per cell line). Representative images of tumors are provided.
Figure 75, comprising Figures 75A-75C, depicts the results of example experiments demonstrating that PERK knockdown triggers a G2/M delay and attenuates growth of cancer cells in vitro. (A) T47D cells were infected with control shRNA or anti- PERK shRNA and then pulsed with BrdU 45 min prior to being collected for FACS analysis 48 h after infection. (B) Kinetics of growth of T47D parental cell line, control shRNA- (shControl) or shPERK-transduced cells (shPERK). (C) Kinetics of growth of TE3 parental cell line, control shRNA- (shControl) or shPERK -transduced cells (shPERK).
Figure 76, comprising Figures 76A-76C, depicts the results of example experiments demonstrating that PERK knockdown triggers DNA damage response signaling pathway. (A) Immunofluorescence staining for DNA damage-induced foci containing phospho-ATM and phospho-Chk2 72 h post-PERK knockdown in T47D cells. (B) Quantification of phospho-ATM positive cells (>3 foci) is shown; error bars indicate S. D. from 3 slides, 5 fields were counted per slide, p-value was determined by Student t- test. (C) Down-regulation of CDK2-dependent kinase activity in PERK null tumors. CDK2 complexes were immuno-purified from MMTV-Neu/PERKloxP/loxP control and MMTV-Neu/PERK/ PERK-null tumors and its activity was monitored using recombinant histone Hl as a substrate. The efficiency of PERK excision was evaluated by RT-PCR and IP/Western blot analysis.
Figure 77, comprising Figures 77A-77C, depicts the results of example experiments demonstrating that PERK deficiency results in accumulation of DNA DSBs in orthotopic tumors in vivo. (A) Immunohistochemistry for -H2AX in orthotopic tumors formed by uninfected MDA-MB468 cells, MDA-MB468 cells transduced with control shRNA, or with anti-PERK shRNA. Quantification of -H2AX -positive cells is provided. Error bars represent S. D. among 4 animals. (B) Immunohistochemistry for -H2AX in orthotopic tumors formed by mouse mammary tumor-derived cells transduced with empty vector pBabe retrovirus or retrovirus expressing Cre recombinase. Quantification of -H2 AX - positive cells is provided. Error bars represent S. D. among 4 animals. (C) Immunofluorescence staining for markers of senescence, pl 9/Arf and try-methylated lysine 9 in histone H3 (H3K9) on orthotopic tumors formed by mouse mammary tumor- derived cells transduced with empty vector pBabe retrovirus or retrovirus expressing Cre recombinase.
Figure 78 depicts the results of example experiments assessing the efficiency pf PERK excision in mouse mammary gland tumors. Efficiency of PERK allele excision was determined by semiquantitative RT-PCR on genomic DNA extracted from tumors of Neu PERKI oxP/loxP (control) and Neu PERK/ mice. Ratio of the intensity of recombinant allele band to wild type (wt) allele band was determined.
Figure 79 depicts the results of example experiments demonstrating that DNA damage-induced checkpoint activation can be averted in PERK-deficient mouse mammary gland tumors. Western blot analysis of PERK, ErbB2, and DNA damage signaling-related markers in tumors derived from control (Neu/PERKlo7P/lo7P) or mammary gland-specific PERK-null (Neu/PERK I) tumor-prone mice. eIF4E levels were used as a loading control.
DETAILED DESCRIPTION OF THE INVENTION The invention provides compositions and methods for regulating the IFNARl chain of Type I interferon (IFN) receptor. In one embodiment, the invention relates to regulating phosphorylation-dependent ubiquitination and degradation of IFNARl . In another embodiment, the invention relates to stabilizing IFNARl . The invention is based on the discovery that inhibiting regulators of IFNARl and thereby inhibiting degradation of IFNARl serves to relieve the suppression of Type 1 IFN signaling and, therefore, provide a therapeutic benefit. This is because increasing the stability of IFNARl and Type I IFN receptor leads to augmentation of response to IFN. Conversely, activating the degradation of IFNARl can provide relief in diseases or disorders having pathologically increased IFN signaling, such as, by way of non-limiting examples, systemic lupus erythematosus and psoriasis.
The present invention relates to modulating the stability of IFNARl and Type I IFN receptor by modulating a regulator of IFNARl in a cell. The invention provides compositions and methods for inhibiting degradation of IFNARl and Type I IFN in a cell by modulation of a regulator of IFNARl such as PKR-like ER-localized eIF2α kinase (PERK), PTP lB (a tyrosine phosphatase), protein kinase D2 (PKD2), or any combination thereof. Therefore, the present invention provides a therapeutic benefit of interfering with a negative regulator of IFNARl during treatment of diseases or disorders associated with dysfunctional IFN responses, such as cancer, autoimmune diseases, multiple sclerosis, and viral infections.
Definitions
As used herein, each of the following terms has the meaning associated with it in this section. The articles "a" and "an" are used herein to refer to one or to more than one (i.e. to at least one) of the grammatical object of the article. By way of example, ''an element" means one element or more than one element.
The term "about" will be understood by persons of ordinary skill in the art and will vary to some extent on the context in which it is used. "Allogeneic" refers to a graft derived from a different animal of the same species.
"Alloantigen" is an antigen that differs from an antigen expressed by the recipient.
The term "antibody" as used herein, refers to an immunoglobulin molecule, which is able to specifically bind to a specific epitope on an antigen. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules. The antibodies in the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab)2, as well as single chain antibodies and humanized antibodies (Harlow et al., 1988; Houston et al., 1988; Bird et al., 1988).
The term "antigen" or "Ag" as used herein is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both. The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an "antigen" as that term is used herein. Furthermore, one skilled in the art will understand that an antigen need not be encoded soley by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucelotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a "gene" at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid.
"Antisense" refers particularly to the nucleic acid sequence of the non- coding strand of a double stranded DNA molecule encoding a polypeptide, or to a sequence which is substantially homologous to the non-coding strand. As defined herein, an antisense sequence is complementary to the sequence of a double stranded DNA molecule encoding a polypeptide. It is not necessary that the antisense sequence be complementary solely to the coding portion of the coding strand of the DNA molecule. The antisense sequence may be complementary to regulatory sequences specified on the coding strand of a DNA molecule encoding a polypeptide, which regulatory sequences control expression of the coding sequences.
As used herein, the term "autologous" is meant to refer to any material derived from the same subject to which it is later to be re-introduced into the subject. The term "autoimmune disease" as used herein is defined as a disorder that results from an autoimmune response. An autoimmune disease is the result of an inappropriate and excessive response to a self-antigen. Examples of autoimmune diseases include but are not limited to, Addision's disease, alopecia areata, ankylosing spondylitis, autoimmune hepatitis, autoimmune parotitis, Crohn's disease, diabetes (Type 1), dystrophic epidermolysis bullosa, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barr syndrome, Hashimoto's disease, hemolytic anemia, systemic lupus erythematosus, multiple sclerosis, myasthenia gravis, pemphigus vulgaris, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathies, thyroiditis, vasculitis, vitiligo, myxedema, pernicious anemia, ulcerative colitis, among others.
The term "cancer" as used herein is defined as disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like. The term "DNA" as used herein is defined as deoxyribonucleic acid.
As used herein, an "effector cell" refers to a cell which mediates an immune response against an antigen. An example of an effector cell includes, but is not limited to a T cell and a B cell.
"Encoding" refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA. As used herein "endogenous" refers to any material from or produced inside an organism, cell, tissue or system.
As used herein, the term "exogenous" refers to any material introduced from or produced outside an organism, cell, tissue or system.
The term "epitope" as used herein is defined as a small chemical molecule on an antigen that can elicit an immune response, inducing B and/or T cell responses. An antigen can have one or more epitopes. Most antigens have many epitopes; i.e., they are multivalent. In general, an epitope is roughly five amino acids and/or sugars in size. One skilled in the art understands that generally the overall three-dimensional structure, rather than the specific linear sequence of the molecule, is the main criterion of antigenic specificity and therefore distinguishes one epitope from another. The term "expression" as used herein is defined as the transcription and/or translation of a particular nucleotide sequence driven by its promoter.
The term "expression vector" as used herein refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules, siRNA, ribozymes, and the like. Expression vectors can contain a variety of control sequences, which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operatively linked coding sequence in a particular host organism. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well.
The term "heterologous" as used herein is defined as DNA or RNA sequences or proteins that are derived from the different species.
"Homologous" as used herein, refers to the subunit sequence similarity between two polymeric molecules, e.g., between two nucleic acid molecules, e.g., two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous at that position. The homology between two sequences is a direct function of the number of matching or homologous positions, e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two composition sequences are homologous then the two sequences are 50% homologous, if 90% of the positions, e.g., 9 of 10, are matched or homologous, the two sequences share 90% homology. By way of example, the DNA sequences 5'-ATTGCC-3' and 5'-TATGGC-3 ' share 50% homology.
As used herein, "homology" is used synonymously with "identity." As used herein, "immunogen" refers to a substance that is able to stimulate or induce a humoral antibody and/or cell-mediated immune response in a mammal.
The term "immunoglobulin" or "Ig", as used herein is defined as a class of proteins, which function as antibodies. The five members included in this class of proteins are IgA, IgG, IgM, IgD, and IgE. IgA is the primary antibody that is present in body secretions, such as saliva, tears, breast milk, gastrointestinal secretions and mucus secretions of the respiratory and genitourinary tracts. IgG is the most common circulating antibody. IgM is the main immunoglobulin produced in the primary immune response in most mammals. It is the most efficient immunoglobulin in agglutination, complement fixation, and other antibody responses, and is important in defense against bacteria and viruses. IgD is the immunoglobulin that has no known antibody function, but may serve as an antigen receptor. IgE is the immunoglobulin that mediates immediate hypersensitivity by causing release of mediators from mast cells and basophils upon exposure to allergen.
An "isolated nucleic acid" refers to a nucleic acid segment or fragment which has been separated from sequences which flank it in a naturally occurring state, i.e., a DNA fragment which has been removed from the sequences which are normally adjacent to the fragment, i.e., the sequences adjacent to the fragment in a genome in which it naturally occurs. The term also applies to nucleic acids which have been substantially purified from other components which naturally accompany the nucleic acid, i.e., RNA or DNA or proteins, which naturally accompany it in the cell. The term therefore includes, for example, a recombinant DNA which is incorporated into a vector, into an autonomously replicating plasmid or virus, or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (i.e., as a cDNA or a genomic or cDNA fragment produced by PCR or restriction enzyme digestion) independent of other sequences. It also includes a recombinant DNA which is part of a hybrid gene encoding additional polypeptide sequence.
In the context of the present invention, the following abbreviations for the commonly occurring nucleic acid bases are used. "A" refers to adenosine, "C" refers to cytosine, "G" refers to guanosine, "T" refers to thymidine, and "U" refers to uridine. As used herein, the term "modulate" is meant to refer to any change in biological state, i.e. increasing, decreasing, and the like. For example, the term "modulate" refers to the ability to regulate positively or negatively the expression, stability or activity of IFNARl , including but not limited to transcription of IFNARl mRNA, stability of IFNARl mRNA, translation of IFNAR l mRNA, stability of IFNARl polypeptide, IFNARl post-translational modifications, or any combination thereof. Further, the term modulate can be used to refer to an increase, decrease, masking, altering, overriding or restoring of activity, including but not limited to, IFNARl activity.
Unless otherwise specified, a "nucleotide sequence encoding an amino acid sequence" includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
The term "polynucleotide" as used herein is defined as a chain of nucleotides. Furthermore, nucleic acids are polymers of nucleotides. Thus, nucleic acids and polynucleotides as used herein are interchangeable. One skilled in the art has the general knowledge that nucleic acids are polynucleotides, which can be hydrolyzed into the monomeric "nucleotides." The monomeric nucleotides can be hydrolyzed into nucleosides. As used herein polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCR™, and the like, and by synthetic means.
The term "polypeptide" as used herein is defined as a chain of amino acid residues, usually having a defined sequence. As used herein the term polypeptide is mutually inclusive of the terms "peptide" and "protein".
"Proliferation" is used herein to refer to the reproduction or multiplication of similar forms of entities, for example proliferation of a cell. That is, proliferation encompasses production of a greater number of cells, and can be measured by, among other things, simply counting the numbers of cells, measuring incorporation of 3H- thymidine into the cell, and the like. The term "promoter" as used herein is defined as a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
As used herein, the term "promoter/regulatory sequence" means a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product. The promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
A "constitutive" promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
An "inducible" promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
A "tissue-specific" promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
The term "RNA" as used herein is defined as ribonucleic acid.
The term "recombinant DNA" as used herein is defined as DNA produced by joining pieces of DNA from different sources. The term "recombinant polypeptide" as used herein is defined as a polypeptide produced by using recombinant DNA methods.
The term "self-antigen" as used herein is defined as an antigen that is expressed by a host cell or tissue. Self-antigens may be tumor antigens, but in certain embodiments, are expressed in both normal and tumor cells. A skilled artisan would readily understand that a self-antigen may be overexpressed in a cell. As used herein, a "substantially purified" cell is a cell that is essentially free of other cell types. A substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state. In some instances, a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state. In some embodiments, the cells are culture in vitro. In other embodiments, the cells are not cultured in vitro.
The term "T-cell" as used herein is defined as a thymus-derived cell that participates in a variety of cell-mediated immune reactions.
The term "B-cell" as used herein is defined as a cell derived from the bone marrow and/or spleen. B cells can develop into plasma cells which produce antibodies. "Therapeutically effective amount" is an amount of a composition of the invention, that when administered to a patient, ameliorates a symptom of the disease. The amount of a composition of the invention which constitutes a "therapeutically effective amount" will vary depending on the composition, the disease state and its severity, the age of the patient to be treated, and the like. The therapeutically effective amount can be determined routinely by one of ordinary skill in the art having regard to his own knowledge and to this disclosure. "Patient" for the purposes of the present invention includes humans and other animals, particularly mammals, and other organisms. Thus the methods are applicable to both human therapy and veterinary applications. In a preferred embodiment the patient is a mammal, and in a most preferred embodiment the patient is human. The terms "treat," "treating," and "treatment," refer to therapeutic or preventative measures described herein. The methods of "treatment" employ administration to a subject, in need of such treatment, a composition of the present invention, for example, a subject having a disorder mediated by IFNARl or a subject who ultimately may acquire such a disorder, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of the disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment. The term "transfected" or "transformed" or "transduced" as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A "transfected" or "transformed" or "transduced" cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
The phrase "under transcriptional control" or "operatively linked" as used herein means that the promoter is in the correct location and orientation in relation to a polynucleotide to control the initiation of transcription by RNA polymerase and expression of the polynucleotide. The term "vaccine" as used herein is defined as a material used to provoke an immune response after administration of the material to a mammal.
A "vector" is a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell. Numerous vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compositions, plasmids, and viruses. Thus, the term "vector" includes an autonomously replicating plasmid or a virus. The term should also be construed to include non-plasmid and non- viral compositions which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compositions, liposomes, and the like. Examples of viral vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, and the like.
"Xenogeneic" refers to a graft derived from an animal of a different species.
Throughout this disclosure, various aspects of this invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual and partial numbers within that range, for example, I 5 2, 3, 4, 5, 5.5 and 6. This applies regardless of the breadth of the range.
Description The present invention provides compositions and methods for modulating
IFNARl and methods of treating diseases that are amenable to therapeutic effects of endogenous IFN or pharmaceutical IFN-based drugs whose effects are mediated by IFNARl using the compositions of the invention. Diseases that are treated by IFN (whose actions are mediated by IFNARl) include, but are not limited to, cancer, multiple sclerosis and other autoimmune diseases, and viral infections.
The present invention relates to the discovery that UPR triggers activation of PERK to promote ligand-and Jak-independent phosphorylation of IFNARl within its phospho-degron, leading to IFNARl ubiquitination and degradation as well as to suppress Type I IFN signaling. In some instances, UPR triggers activation of PERK in the context of a viral infection. Accordingly, the invention includes compositions and methods of targeting PERK in treatment of viral infections or other diseases that benefit from IFN..
The present invention also relates to the discovery that activity of PKD2 is required for ligand-and Jak-dependent phosphorylation of IFNARl within its phospho- degron, leading to IFNARl ubiquitination and degradation as well as to suppress Type I IFN signaling. Accordingly, the invention includes compositions and methods of targeting PKD in treatment of viral infections or other diseases that benefit from IFN.
The present invention also relates to the discovery that regardless of how phosphorylation-dependent ubiquitination of IFNARl proceeds, the endocytosis and degradation of IFNARl (as well as the extent of Type I IFN signaling) requires activity of PTPlB. Accordingly, the invention includes compositions and methods of targeting PTPlB in treatment of viral infections or other diseases that benefit from IFN.
Also included in the invention are compositions and methods for increasing the efficacy of endogenous IFN and/or enhancement of efficacy of an IFN- based treatment. Compositions
As described elsewhere herein, the invention is based on the discovery that inhibition of a regulator of IFNARl, such as, for example, PERK, PTPlB, or PKD2, can modulate the stability of IFNARl and provide a therapeutic benefit by increasing the efficacy of endogenous IFN and/or enhancement of efficacy of an IFN-based treatment. The present invention relates to the discovery that inhibition of regulator of IFNARl, such as, for example, PERK3 PTPl B, or PKD2, provides a therapeutic benefit. Thus, the invention comprises compositions and methods for modulating any of these proteins in a cell thereby enhancing IFN response in the cell. Based on the disclosure herein, the present invention includes a generic concept for inhibiting a negative regulator of stability and signaling of IFNARl or a functional equivalent thereof. Preferably, the negative regulator is PERK, PTPlB, and/or PKD2. Inhibiting any one or more of these proteins is associated with increasing the stability of IFNARl . Accordingly, the invention includes inhibiting at least one of the aforementioned targets to increase the efficacy of endogenous IFN and/or enhancement of efficacy of an IFN-based treatment.
In one embodiment, the invention comprises a composition comprising an inhibitor of any one or more of the following regulators: PERK, PTPlB, or PKD2. The composition comprising the inhibitor is selected from the group consisting of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
One non-limiting example of an inhibitor useful in the methods of the invention is sangivamycin. Other non-limiting example of inhibitors useful in the methods of the invention are quinoline-difluoromethylphosphonate and naphthalene- difluoromethylphosphonate, and derivatives thereof, such as those described in Han et al. (2008, Bioorganic & Medicinal Chemistry Letters 18:3200-3205). Still other non-limiting examples of inhibitors useful in the methods of the invention are trifluoromethyl sulfonyl and derivatives thereof, benzooxathiazonle and derivatives thereof, cinnamic acid and derivatives thereof, hydroxyphenyl azole and derivatives thereof, pyrrol phenoxy propionic acid and derivatives thereof, phenylalanine and derivatives thereof, 3'-carboxy- 4'-(O-carboxymethyl)-tyrosine and derivatives thereof, ertiprotfib and derivatives thereof NNC-52-1236 and derivatives thereof, A-366901 and derivatives thereof, A-321842 and derivatives thereof, 1,2-naphtoquinone and derivatives thereof, 4'- phosphenyldifluoromethyl-phenylanaline and derivatives thereof, aryldifluoromethylphosphonic acid and derivatives thereof.
One skilled in the art will readily appreciate that as a result of the degeneracy of the genetic code, many different nucleotide sequences may encode the same polypeptide. That is, an amino acid may be encoded by one of several different codons, and a person skilled in the art can readily determine that while one particular nucleotide sequence may differ from another, the polynucleotides may in fact encode polypeptides with identical amino acid sequences. As such, polynucleotides that vary due to differences in codon usage are specifically contemplated by the present invention. One skilled in the art will appreciate, based on the disclosure provided herein, that one way to decrease the mRNA and/or protein levels of PERK, PTP 1 B, and/or PKD2 in a cell is by reducing or inhibiting expression of the nucleic acid encoding the regulator. Thus, the protein level of the regulator in a cell can also be decreased using a molecule or composition that inhibits or reduces gene expression such as, for example, an antisense molecule or a ribozyme. In a preferred embodiment, the modulating sequence is an antisense nucleic acid sequence which is expressed by a plasmid vector. The antisense expressing vector is used to transfect a mammalian cell or the mammal itself, thereby causing reduced endogenous expression of a desired regulator in the cell. However, the invention should not be construed to be limited to inhibiting expression of a regulator by transfection of cells with antisense molecules. Rather, the invention encompasses other methods known in the art for inhibiting expression or activity of a protein in the cell including, but not limited to, the use of a ribozyme, the expression of a non-functional regulator (i.e. transdominant negative mutant) and use of an intracellular antibody.
Antisense molecules and their use for inhibiting gene expression are well known in the art (see, e.g., Cohen, 1989, In: Oligodeoxyribonucleotides, Antisense Inhibitors of Gene Expression, CRC Press). Antisense nucleic acids are DNA or RNA molecules that are complementary, as that term is defined elsewhere herein, to at least a portion of a specific mRNA molecule (Weintraub, 1990, Scientific American 262:40). In the cell, antisense nucleic acids hybridize to the corresponding mRNA, forming a double- stranded molecule thereby inhibiting the translation of genes. The use of antisense methods to inhibit the translation of genes is known in the art, and is described, for example, in Marcus-Sakura (1988, Anal. Biochern. 172:289). Such antisense molecules may be provided to the cell via genetic expression using DNA encoding the antisense molecule as taught by Inoue, 1993, U.S. Patent No. 5, 190,931. Alternatively, antisense molecules of the invention may be made synthetically and then provided to the cell. Antisense oligomers of between about 10 to about 30, and more preferably about 15 nucleotides, are preferred, since they are easily synthesized and introduced into a target cell. Synthetic antisense molecules contemplated by the invention include oligonucleotide derivatives known in the art which have improved biological activity compared to unmodified oligonucleotides (see U.S. Patent No. 5,023,243).
Ribozymes and their use for inhibiting gene expression are also well known in the art (see, e.g., Cech et al., 1992, J. Biol. Chem. 267: 17479-17482; Hampel et al., 1989, Biochemistry 28:4929-4933; Eckstein et al., International Publication No. WO 92/07065; Altman et al., U.S. Patent No. 5,168,053). Ribozymes are RNA molecules possessing the ability to specifically cleave other single-stranded RNA in a manner analogous to DNA restriction endonucleases. Through the modification of nucleotide sequences encoding these RNAs, molecules can be engineered to recognize specific nucleotide sequences in an RNA molecule and cleave it (Cech, 1988, J. Amer. Med, Assn. 260:3030). A major advantage of this approach is the fact that ribozymes are sequence-specific.
There are two basic types of ribozymes, namely, tetrahymena-type (Hasselhoff, 1988, Nature 334:585) and hammerhead-type. Tetrahymena-type ribozymes recognize sequences which are four bases in length, while hammerhead-type ribozymes recognize base sequences 1 1-18 bases in length. The longer the sequence, the greater the likelihood that the sequence will occur exclusively in the target mRNA species. Consequently, hammerhead-type ribozymes are preferable to tetrahymena-type ribozymes for inactivating specific mRNA species, and 18-base recognition sequences are preferable to shorter recognition sequences which may occur randomly within various unrelated mRNA molecules. Ribozymes useful for inhibiting the expression of a regulator may be designed by incorporating target sequences into the basic ribozyme structure which are complementary to the mRNA sequence of the desired regulator of the present invention, including but are not limited to, PERK, PTPlB, PKD2and equivalents thereof. Ribozymes targeting the desired regulator may be synthesized using commercially available reagents (Applied Biosystems, Inc., Foster City, CA) or they may be genetically expressed from DNA encoding them.
In another aspect of the invention, the regulator can be inhibited by way of inactivating and/or sequestering the regulator. As such, inhibiting the effects of a regulator can be accomplished by using a transdominant negative mutant. Alternatively an antibody specific for the desired regulator, otherwise known as an antagonist to the regulator may be used. In one embodiment, the antagonist is a protein and/or composition having the desirable property of interacting with a binding partner of the regulator and thereby competing with the corresponding wild-type regulator. In another embodiment, the antagonist is a protein and/or composition having the desirable property of interacting with the regulator and thereby sequestering the regulator.
Antibodies
As will be understood by one skilled in the art, any antibody that can recognize and bind to an antigen of interest is useful in the present invention. That is, the antibody can inhibit a regulator of IFNARl such as PERK, PTPlB, and/or PKD2 provides a beneficial effect.
Methods of making and using antibodies are well known in the art. For example, polyclonal antibodies useful in the present invention are generated by immunizing rabbits according to standard immunological techniques well-known in the art (see, e.g., Harlow et al., 1988, In: Antibodies, A Laboratory Manual, Cold Spring
Harbor, NY). Such techniques include immunizing an animal with a chimeric protein comprising a portion of another protein such as a maltose binding protein or glutathione (GSH) tag polypeptide portion, and/or a moiety such that the antigenic protein of interest is rendered immunogenic (e.g., an antigen of interest conjugated with keyhole limpet hemocyanin, KLH) and a portion comprising the respective antigenic protein amino acid residues. The chimeric proteins are produced by cloning the appropriate nucleic acids encoding the marker protein into a plasmid vector suitable for this purpose, such as but not limited to, pMAL-2 or pCMX.
However, the invention should not be construed as being limited solely to methods and compositions including these antibodies or to these portions of the antigens. Rather, the invention should be construed to include other antibodies, as that term is defined elsewhere herein, to antigens, or portions thereof. Further, the present invention should be construed to encompass antibodies, inter alia, bind to the specific antigens of interest, and they are able to bind the antigen present on Western blots, in solution in enzyme linked immunoassays, in fluorescence activated cells sorting (FACS) assays, in magnetic-activated cell sorting (MACS) assays, and in immunofluorescence microscopy of a cell transiently transfected with a nucleic acid encoding at least a portion of the antigenic protein, for example.
One skilled in the art would appreciate, based upon the disclosure provided herein, that the antibody can specifically bind with any portion of the antigen and the full-length protein can be used to generate antibodies specific therefor. However, the present invention is not limited to using the full-length protein as an immunogen. Rather, the present invention includes using an immunogenic portion of the protein to produce an antibody that specifically binds with a specific antigen. That is, the invention includes immunizing an animal using an immunogenic portion, or antigenic determinant, of the antigen.
Once armed with the sequence of a specific antigen of interest and the detailed analysis localizing the various conserved and non-conserved domains of the protein, the skilled artisan would understand, based upon the disclosure provided herein, how to obtain antibodies specific for the various portions of the antigen using methods well-known in the art or to be developed. The skilled artisan would appreciate, based upon the disclosure provided herein, that that present invention includes use of a single antibody recognizing a single antigenic epitope but that the invention is not limited to use of a single antibody. Instead, the invention encompasses use of at least one antibody where the antibodies can be directed to the same or different antigenic protein epitopes.
The generation of polyclonal antibodies is accomplished by inoculating the desired animal with the antigen and isolating antibodies which specifically bind the antigen therefrom using standard antibody production methods such as those described in, for example, Harlow et al. (1988, In: Antibodies, A Laboratory Manual, Cold Spring Harbor, NY).
Monoclonal antibodies directed against full length or peptide fragments of a protein or peptide may be prepared using any well known monoclonal antibody preparation procedures, such as those described, for example, in Harlow et al. (1988, In: Antibodies, A Laboratory Manual, Cold Spring Harbor, NY) and in Tuszynski et al. (1988, Blood, 72: 109-1 15). Quantities of the desired peptide may also be synthesized using chemical synthesis technology. Alternatively, DNA encoding the desired peptide may be cloned and expressed from an appropriate promoter sequence in cells suitable for the generation of large quantities of peptide. Monoclonal antibodies directed against the peptide are generated from mice immunized with the peptide using standard procedures as referenced herein.
Nucleic acid encoding the monoclonal antibody obtained using the procedures described herein may be cloned and sequenced using technology which is available in the art, and is described, for example, in Wright et al. (1992, Critical Rev. Immunol. 12:125-168), and the references cited therein. Further, the antibody of the invention may be "humanized" using the technology described in, for example, Wright et al., and in the references cited therein, and in Gu et al. (1997, Thrombosis and Hematocyst 77:755-759), and other methods of humanizing antibodies well-known in the art or to be developed.
The present invention also includes the use of humanized antibodies specifically reactive with epitopes of an antigen of interest. The humanized antibodies of the invention have a human framework and have one or more complementarity determining regions (CDRs) from an antibody, typical ly a mouse antibody, specifically reactive with an antigen of interest. When the antibody used in the invention is humanized, the antibody may be generated as described in Queen, et al. (U.S. Patent No. 6, 180,370), Wright et al., (supra) and in the references cited therein, or in Gu et al. (1997, Thrombosis and Hematocyst 77(4):755~759). The method disclosed in Queen et al. is directed in part toward designing humanized immunoglobulins that are produced by expressing recombinant DNA segments encoding the heavy and light chain complementarity determining regions (CDRs) from a donor immunoglobulin capable of binding to a desired antigen, such as an epitope on an antigen of interest, attached to DNA segments encoding acceptor human framework regions. Generally speaking, the invention in the Queen patent has applicability toward the design of substantially any humanized immunoglobulin. Queen explains that the DNA segments will typically include an expression control DNA sequence operably linked to the humanized immunoglobulin coding sequences, including naturally-associated or heterologous promoter regions. The expression control sequences can be eukaryotic promoter systems in vectors capable of transforming or transfecting eukaryotic host cells or the expression control sequences can be prokaryotic promoter systems in vectors capable of transforming or transfecting prokaryotic host cells. Once the vector has been incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of the introduced nucleotide sequences and as desired the collection and purification of the humanized light chains, heavy chains, light/heavy chain dimers or intact antibodies, binding fragments or other immunoglobulin forms may follow (Beychok, Cells of Immunoglobulin Synthesis, Academic Press, New York, (1979), which is incorporated herein by reference). The invention also includes functional equivalents of the antibodies described herein. Functional equivalents have binding characteristics comparable to those of the antibodies, and include, for example, hybridized and single chain antibodies, as well as fragments thereof. Methods of producing such functional equivalents are disclosed in PCT Application WO 93/213 19 and PCT Application WO 89/09622. Functional equivalents include polypeptides with amino acid sequences substantially the same as the amino acid sequence of the variable or hypervariable regions of the antibodies. "Substantially the same" amino acid sequence is defined herein as a sequence with at least 70%, preferably at least about 80%, more preferably at least about 90%, even more preferably at least about 95%, and most preferably at least 99% homology to another amino acid sequence (or any integer in between 70 and 99), as determined by the FASTA search method in accordance with Pearson and Lipman, 1988 Proc. Nat'l. Acad. Sci. USA 85: 2444-2448. Chimeric or other hybrid antibodies have constant regions derived substantially or exclusively from human antibody constant regions and variable regions derived substantially or exclusively from the sequence of the variable region of a monoclonal antibody from each stable hybridoma. Single chain antibodies (scFv) or Fv fragments are polypeptides that consist of the variable region of the heavy chain of the antibody linked to the variable region of the light chain, with or without an interconnecting linker. Thus, the Fv comprises an antibody combining site.
Functional equivalents of the antibodies of the invention further include fragments of antibodies that have the same, or substantially the same, binding characteristics to those of the whole antibody. Such fragments may contain one or both Fab fragments or the F(ab')2 fragment. The antibody fragments contain all six complement determining regions of the whole antibody, although fragments containing fewer than all of such regions, such as three, four or five complement determining regions, are also functional. The functional equivalents are members of the IgG immunoglobulin class and subclasses thereof, but may be or may combine with any one of the following immunoglobulin classes: IgM, IgA, IgD, or IgE, and subclasses thereof. Heavy chains of various subclasses, such as the IgG subclasses, are responsible for different effector functions and thus, by choosing the desired heavy chain constant region, hybrid antibodies with desired effector function are produced. Exemplary constant regions are gamma 1 (IgGl), gamma 2 (IgG2), gamma 3 (IgG3), and gamma 4 (IgG4). The light chain constant region can be of the kappa or lambda type.
The immunoglobulins of the present invention can be monovalent, divalent or polyvalent. Monovalent immunoglobulins are dimers (HL) formed of a hybrid heavy chain associated through disulfide bridges with a hybrid light chain. Divalent immunoglobulins are tetramers (H2L2) formed of two dimers associated through at least one disulfide bridge.
Modification of nucleic acid molecules Inhibition of PERK, PTPlB, and/or PKD2 or their functional equivalents, resulting in modulation of IFNARl stability can be accomplished using a nucleic acid molecule. For example, the inhibitor is selected from the group consisting of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, and the likes. By way of example, modification of nucleic acid molecules is described in the context of an siRNA molecule. However, the methods of modifying nucleic acid molecules can be applied to other types of nucleic acid based inhibitors of the invention. As a non-limiting example, an siRNA polynucleotide is an RNA nucleic acid molecule that interferes with RNA activity that is generally considered to occur via a post-transcriptional gene silencing mechanism. An siRNA polynucleotide preferably comprises a double-stranded RNA (dsRNA) but is not intended to be so limited and may comprise a single-stranded RlMA (see, e.g., Martinez et al., 2002 Cell 1 10:563-74). The siRNA polynucleotide included in the invention may comprise other naturally occurring, recombinant, or synthetic single-stranded or double-stranded polymers of nucleotides (ribonucleotides or deoxyribonucleotides or a combination of both) and/or nucleotide analogues as provided herein (e.g., an oligonucleotide or polynucleotide or the like, typically in 5' to 3' phosphodiester linkage). Accordingly it will be appreciated that certain exemplary sequences disclosed herein as DNA sequences capable of directing the transcription of the siRNA polynucleotides are also intended to describe the corresponding RNA sequences and their complements, given the well established principles of complementary nucleotide base-pairing.
Preferred siRNA polynucleotides comprise double-stranded polynucleotides of about 18-30 nucleotide base pairs, preferably about ] 8, about 19, about 20, about 21 , about 22, about 23, about 24, about 25, about 26, or about 27 base pairs, and in other preferred embodiments about 19, about 20, about 21, about 22 or about 23 base pairs, or about 27 base pairs, whereby the use of "about" indicates that in certain embodiments and under certain conditions the processive cleavage steps that may give rise to functional siRNA polynucleotides that are capable of interfering with expression of a selected polypeptide may not be absolutely efficient. Hence, siRNA polynucleotides, may include one or more siRNA polynucleotide molecules that may differ (e.g., by nucleotide insertion or deletion) in length by one, two, three, four or more base pairs as a consequence of the variability in processing, in biosynthesis, or in artificial synthesis of the siRNA. The siRNA polynucleotide of the present invention may also comprise a polynucleotide sequence that exhibits variability by differing (e.g., by nucleotide substitution, including transition or transversion) at one, two, three or four nucleotides from a particular sequence. These differences can occur at any of the nucleotide positions of a particular siRNA polynucleotide sequence, depending on the length of the molecule, whether situated in a sense or in an antisense strand of the double-stranded polynucleotide. The nucleotide difference may be found on one strand of a double- stranded polynucleotide, where the complementary nucleotide with which the substitute nucleotide would typically form hydrogen bond base pairing, may not necessarily be correspondingly substituted. In preferred embodiments, the siRNA polynucleotides are homogeneous with respect to a specific nucleotide sequence.
Based on the present disclosure, it should be appreciated that the si RNAs of the present invention may effect silencing of the target polypeptide expression to different degrees. The siRNAs thus must first be tested for their effectiveness. Selection of siRNAs are made therefrom based on the ability of a given siRNA to interfere with or modulate the expression of the target polypeptide. Accordingly, identification of specific siRNA polynucleotide sequences that are capable of interfering with expression of a desired target polypeptide requires production and testing of each siRNA. The methods for testing each siRNA and selection of suitable siRNAs for use in the present invention are fully set forth herein the Examples. Since not all siRNAs that interfere with protein expression will have a physiologically important effect, the present disclosure also sets forth various physiologically relevant assays for determining whether the levels of interference with target protein expression using the siRNAs of the invention have clinically relevant significance. Polynucleotides of the siRNA may be prepared using any of a variety of techniques, which are useful for the preparation of specifically desired siRNA polynucleotides. For example, a polynucleotide may be amplified from a cDNA prepared from a suitable cell or tissue type. Such a polynucleotide may be amplified via polymerase chain reaction (PCR). Using this approach, sequence-specific primers are designed based on the sequences provided herein, and may be purchased or synthesized directly. An amplified portion of the primer may be used to isolate a full-length gene, or a desired portion thereof, from a suitable DNA library using well known techniques. A library (cDNA or genomic) is screened using one or more polynucleotide probes or primers suitable for amplification. Preferably, the library is size-selected to include larger polynucleotide sequences. Random primed libraries may also be preferred in order to identify 5' and other upstream regions of the genes. Genomic libraries are preferred for obtaining introns and extending 5' sequences. The siRNA polynucleotide contemplated by the present invention may also be selected from a library of siRNA polynucleotide sequences.
For hybridization techniques, a partial polynucleotide sequence may be labeled (e.g., by nick-translation or end-labeling with 32P) using well known techniques. A bacteria] or bacteriophage library may then be screened by hybridization to filters containing denatured bacterial colonies (or lawns containing phage plaques) with the labeled probe (see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual,
Cold Spring Harbor Laboratories, Cold Spring Harbor, N. Y., 2001 ). Hybridizing colonies or plaques are selected and expanded, and the DNA is isolated for further analysis.
Alternatively, numerous amplification techniques are known in the art for obtaining a full-length coding sequence from a partial cDNA sequence. Within such techniques, amplification is generally performed via PCR. One such technique is known as "rapid amplification of cDNA ends" or RACE (see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratories, Cold Spring Harbor, N. Y., 2001).
A number of specific siRNA polynucleotide sequences useful for interfering with target polypeptide expression are presented in the Examples, the Drawings, and in the Sequence Listing included herein. siRNA polynucleotides may generally be prepared by any method known in the art, including, for example, solid phase chemical synthesis. Modifications in a polynucleotide sequence may also be introduced using standard mutagenesis techniques, such as oligonucleotide-directed site- specific mutagenesis. Further, siRNAs may be chemically modified or conjugated with other molecules to improve their stability and/or delivery properties. Included as one aspect of the invention are siRNAs as described herein, wherein one or more ribose sugars has been removed therefrom.
Alternatively, siRNA polynucleotide molecules may be generated by in vitro or in vivo transcription of suitable DNA sequences (e.g., polynucleotide sequences encoding a target polypeptide, or a desired portion thereof), provided that the DNA is incorporated into a vector with a suitable RNA polymerase promoter (such as for example, T7, U6, Hl, or SP6 although other promoters may be equally useful). In addition, an siRNA polynucleotide may be administered to a mammal, as may be a DNA sequence (e.g., a recombinant nucleic acid construct as provided herein) that supports transcription (and optionally appropriate processing steps) such that a desired siRNA is generated in vivo.
In one embodiment, an siRNA polynucleotide, wherein the siRNA polynucleotide is capable of interfering with expression of a target polypeptide can be used to generate a silenced cell. Any siRNA polynucleotide that, when contacted with a biological source for a period of time, results in a significant decrease in the expression of the target polypeptide is included in the invention. Preferably the decrease is greater than about 10%, more preferably greater than about 20%, more preferably greater than about 30%, more preferably greater than about 40%, about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95% or about 98% relative to the expression level of the target polypeptide detected in the absence of the siRNA.
Preferably, the presence of the siRNA polynucleotide in a cell does not result in or cause any undesired toxic effects, for example, apoptosis or death of a cell in which apoptosis is not a desired effect of RNA interference.
In another embodiment, the siRNA polynucleotide that, when contacted with a biological source for a period of time, results in a significant decrease in the expression of the target polypeptide. Preferably the decrease is about 10%-20%, more preferably about 20%-30%, more preferably about 30%-40%, more preferably about 40%-50%, more preferably about 50%-60%, more preferably about 60%-70%, more preferably about 70%-80%, more preferably about 80%-90%, more preferably about 90%-95%, more preferably about 95%-98% relative to the expression level of the target polypeptide detected in the absence of the siRNA. Preferably, the presence of the siRNA polynucleotide in a cell does not result in or cause any undesired toxic effects.
In yet another embodiment, the siRNA polynucleotide that, when contacted with a biological source for a period of time, results in a significant decrease in the expression of the target polypeptide. Preferably the decrease is about 10% or more, more preferably about 20% or more, more preferably about 30% or more, more preferably about 40% or more, more preferably about 50% or more, more preferably about 60% or more, more preferably about 70% or more, more preferably about 80% or more, more preferably about 90% or more, more preferably about 95 % or more, more preferably about 98% or more relative to the expression level of the target polypeptide detected in the absence of the siRNA. Preferably, the presence of the siRNA polynucleotide in a cell does not result in or cause any undesired toxic effects.
Any polynucleotide of the invention may be further modified to increase its stability in vivo. Possible modifications include, but are not limited to, the addition of flanking sequences at the 5' and/or 3' ends; the use of phosphorothioate or 2' O-methyl rather than phosphodiester linkages in the backbone; and/or the inclusion of nontraditional bases such as inosine, queosine, and wybutosine and the like, as well as acetyl-methyl-, thio-and other modified forms of adenine, cytidine, guanine, thymine, and uridine.
Genetic modification
In other related aspects, the invention includes an isolated nucleic acid encoding an inhibitor, preferably an siRNA, that inhibits a regulator of IFNARI , operably linked to a nucleic acid comprising a promoter/regulatory sequence such that the nucleic acid is preferably capable of directing expression of the protein encoded by the nucleic acid. In some embodiments, the isolated nucleic acid is an antisense nucleic acid encoding an antisense inhibitor. Thus, the invention encompasses expression vectors and methods for the introduction of exogenous DNA into cells with concomitant expression of the exogenous DNA in the cells such as those described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
The desired polynucleotide can be cloned into a number of types of vectors. However, the present invention should not be construed to be limited to any particular vector. Instead, the present invention should be construed to encompass a wide plethora of vectors which are readily available and/or well-known in the art. For example, a desired polynucleotide of the invention can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal viruse, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
In specific embodiments, the expression vector is selected from the group consisting of a viral vector, a bacterial vector and a mammalian cell vector. Numerous expression vector systems exist that comprise at least a part or all of the compositions discussed above. Prokaryote-and/or eukaryote-vector based systems can be employed for use with the present invention to produce polynucleotides, or their cognate polypeptides. Many such systems are commercially and widely available. Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001), and in Ausubel et al. (1997), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers. (See, e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193.
For expression of the desired polynucleotide, at least one module in each promoter functions to position the start site for R]VA synthesis. The best known example of this is the TATA box, but in some promoters lacking a TATA box, such as the promoter for the mammalian terminal deoxynucleotidyl transferase gene and the promoter for the SV40 genes, a discrete element overlying the start site itself helps to fix the place of initiation.
Additional promoter elements, i.e., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-1 10 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either co-operatively or independently to activate transcription.
A promoter may be one naturally associated with a gene or polynucleotide sequence, as may be obtained by isolating the 5' non-coding sequences located upstream of the coding segment and/or exon. Such a promoter can be referred to as "endogenous." Similarly, an enhancer may be one naturally associated with a polynucleotide sequence, located either downstream or upstream of that sequence. Alternatively, certain advantages will be gained by positioning the coding polynucleotide segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a polynucleotide sequence in its natural environment. A recombinant or heterologous enhancer refers also to an enhancer not normally associated with a polynucleotide sequence in its natural environment. Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other prokaryotic, viral, or eukaryotic cell, and promoters or enhancers not "naturally occurring," i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression. In addition to producing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCR™, in connection with the compositions disclosed herein (U.S. Patent 4,683,202, U.S. Patent 5,928,906). Furthermore, it is contemplated the control sequences that direct transcription and/or expression of sequences within non-nuclear organelles such as mitochondria, chloroplasts, and the like, can be employed as well.
Naturally, it will be important to employ a promoter and/or enhancer that effectively directs the expression of the DNA segment in the cell type, organelle, and organism chosen for expression. Those of skill in the art of molecular biology generally know how to use promoters, enhancers, and eel) type combinations for protein expression, for example, see Sambrook et al. (2001). The promoters employed may be constitutive, tissue-specific, inducible, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, such as is advantageous in the large-scale production of recombinant proteins and/or peptides. The promoter may be heterologous or endogenous.
A promoter sequence exemplified in the experimental examples presented herein is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, Moloney virus promoter, the avian leukemia virus promoter, Epstein-Barr virus immediate early promoter, Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the muscle creatine promoter. Further, the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention. The use of an inducible promoter in the invention provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively Jinked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter. Further, the invention includes the use of a tissue specific promoter, which promoter is active only in a desired tissue. Tissue specific promoters are well known in the art and include, but are not limited to, the HER-2 promoter and the PSA associated promoter sequences.
In order to assess the expression of the siRNA, the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other embodiments, the selectable marker may be carried on a separate piece of DNA and used in a co- transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers are known in the art and include, for example, antibiotic-resistance genes, such as neo and the like.
Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. Reporter genes that encode for easily assayable proteins are well known in the art. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a protein whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
Suitable reporter genes may include genes encoding luciferase, beta- galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (see, e.g., Ui-Tei et al., 2000 FEBS Lett. 479:79-82). Suitable expression systems are well known and may be prepared using well known techniques or obtained commercially. Internal deletion constructs may be generated using unique internal restriction sites or by partial digestion of non-unique restriction sites. Constructs may then be transfected into cells that display high levels of siRNA polynucleotide and/or polypeptide expression. In general, the construct with the minimal 5' flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical or biological means. It is readily understood that the introduction of the expression vector comprising the polynucleotide of the invention yields a silenced cell with respect to a regulator. Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sam brook et al. (2001 , Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. A preferred colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (i.e., an artificial membrane vesicle). The preparation and use of such systems is well known in the art.
Regardless of the method used to introduce exogenous nucleic acids into a host cell or otherwise expose a cell to the inhibitor of the present invention, in order to confirm the presence of the recombinant DNA sequence in the host cell, a variety of assays may be performed. Such assays include, for example, "molecular biological" assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; "biochemical" assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention. Any DNA vector or delivery vehicle can be utilized to transfer the desired polynucleotide to a cell in vitro or in vivo. In the case where a non-viral delivery system is utilized, a preferred delivery vehicle is a liposome. The above-mentioned delivery systems and protocols therefore can be found in Gene Targeting Protocols, 2ed., pp 1-35 (2002) and Gene Transfer and Expression Protocols, Vol. 7, Murray ed., pp 81-89 (1991).
"Liposome" is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes may be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh et al., 1991 , Targeted Diagn Ther 4:87-103). However, the present invention also encompasses compositions that have different structures in solution than the normal vesicular structure. For example, the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules. Also contemplated are lipofectamine-nucleic acid complexes.
Therapeutic application The present invention includes an inhibitor of a regulator of IFNARl, including an inhibitor of any one or more of PERK, PTPlB, PKD2, or a functional equivalent of any of these proteins. The present invention also provides compositions and methods to augment the efficacy of Type I IFlV. Thus, the invention provides compositions and methods of treating diseases or disorders associated with dysfunctional IFN responses, such as cancer, autoimmune diseases, multiple sclerosis, and viral infections.
The present invention provides a use of an agent that is capable of inhibiting a regulator of IFNARl, including an inhibitor of any one or more of PERK, PTPlB, or PKD2, as a means to augment the efficacy of Type 1 IFN. As such, a vaccine useful for in vivo immunization comprises at least an inhibitor component, wherein the inhibitor component is able to inhibit degradation of IFNARl . Based on the present disclosure, administration of an inhibitor of one or more of PERK, PTP lB, or PKD2 enhances the stability of IFNARl .
In another embodiment, the compositions of the present invention may be used in combination with existing therapeutic agents used to treat diseases or disorders associated with dysfunctional IFN responses, such as cancer, autoimmune diseases, multiple sclerosis, and viral infections.. In some instances, the compositions of the invention may be used in combination these therapeutic agents to enhance the efficacy of Type I IFN.
In some embodiments, an effective amount of a composition of the invention and a therapeutic agent is a synergistic amount. As used herein, a "synergistic combination" or a "synergistic amount" of a composition of the invention and a therapeutic agent is a combination or amount that is more effective in the therapeutic or prophylactic treatment of a disease than the incremental improvement in treatment outcome that could be predicted or expected from a merely additive combination of (i) the therapeutic or prophylactic benefit of the composition of the invention when administered at that same dosage as a monotherapy and (ii) the therapeutic or prophylactic benefit of the therapeutic agent when administered at the same dosage as a monotherapy.
Methods of Treatment
In various embodiments, the methods of the invention comprise administering a therapeutically effective amount of at least one composition that is an inhibitor of a regulator of IFNARl, including an inhibitor of any one or more of PERK, PTPlB, PKD2, or a functional equivalent of any of these proteins, to a cell, or to a subject in need thereof. In other embodiments, the methods of the invention comprise administering a therapeutically effective amount of at least one composition that is an activator of a regulator of IFNARl, including an activator of any one or more of PERK, PTPlB, PKD2, or a functional equivalent of any of these proteins, to a cell, or to a subject in need thereof. In preferred embodiments the subject is a mammal. In more preferred embodiments the subject is a human. The composition comprising the inhibitor is selected from the group consisting of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule. The present invention should in no way be construed to be limited to the inhibitors described herein, but rather should be construed to encompass any inhibitor of any modulator of IFNARl . The methods of the invention comprise administering a therapeutically effective amount of at least one inhibitor to a subject.
The composition comprising the activator is selected from the group consisting of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule. The present invention should in no way be construed to be limited to the activators described herein, but rather should be construed to encompass any activator of any modulator of IFNARl . The methods of the invention comprise administering a therapeutically effective amount of at least one activator to a subject.
The methods of the invention comprise administering a therapeutically effective amount of at least one inhibitor either alone or in combination with other therapeutic agents. In various embodiments, inhibitors of the invention can be delivered to a cell in vitro or in vivo using vectors comprising one or more isolated inhibitor nucleic acid sequences. In some embodiments, the nucleic acid sequence has been incorporated into the genome of the vector. The vector comprising a nucleic acid inhibitor described herein can be contacted with a cell in vitro or in vivo and infection or transfection can occur. The cell can then be used experimentally to study, for example, the effect of a nucleic acid inhibitor in vitro. The cell can be present in a biological sample obtained from a subject (e.g., blood, bone marrow, tissue, biological fluids, organs, etc.) and used in the treatment of disease, or can be obtained from cell culture.
Various vectors can be used to introduce an isolated nucleic acid inhibitor into animal cells. Examples of viral vectors have been discussed elsewhere herein and include retrovirus, adenovirus, parvovirus (e.g., adeno-associated viruses), coronavirus, negative-strand RNA viruses such as orthomyxovirus (e.g., influenza virus), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g. measles and Sendai), positive-strand RNA viruses such as picornavirus and alphavirus, and double stranded DNA viruses including adenovirus, herpesvirus (e.g., herpes simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g. vaccinia, fowlpox and canarypox). Other viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus and hepatitis virus, for example. Examples of retroviruses include: avian leukosis-sarcoma, mammalian C-type, B-type viruses, D-type viruses, HTLV-BLV group, lentivirus (e.g. human immunodeficiency virus), and spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields et al., Eds., Lippincott-Raven Publishers, Philadelphia, 1996). Other examples include murine leukemia viruses, murine sarcoma viruses, mouse mammary tumor virus, bovine leukemia virus, feline leukemia virus, feline sarcoma virus, avian leukemia virus, human T-cell leukemia virus, baboon endogenous virus,
Gibbon ape leukemia virus, Mason Pfizer monkey virus, simian immunodeficiency virus, simian sarcoma virus, Rous sarcoma virus, lentiviruses and baculoviruses.
In addition, an engineered viral vector can be used to deliver an isolated nucleic acid inhibitor of the present invention. These vectors provide a means to introduce nucleic acids into cycling and quiescent cells, and have been modified to reduce cytotoxicity and to improve genetic stability. The preparation and use of engineered Herpes simplex virus type 1 (Krisky et al., 1997, Gene Therapy 4: 1 120-1 125), adenoviral (Amalfitanl et al., 1998, Journal of Virology 72:926-933) attenuated lentiviral (Zufferey et al., 1997, Nature Biotechnology 15:871 -875) and adenoviral/retroviral chimeric (Feng et al., 1997, Nature Biotechnology 15:866-870) vectors are known to the skilled artisan.
In addition to delivery through the use of vectors, a nucleic acid inhibitor can be delivered to cells without vectors, e.g. as "naked" nucleic acid delivery using methods known to those of skill in the art. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362. Physical methods for introducing a nucleic acid into a host cell include, by way of examples, transfection, calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (2001, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
Chemical means for introducing a nucleic acid inhibitor into a host cell include, by way of examples, colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in- water emulsions, micelles, mixed micelles and liposomes. A preferred colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (i.e., an artificial membrane vesicle). The preparation and use of such systems is well known in the art.
Various forms of a nucleic acid inhibitor, as described herein, can be administered or delivered to an animal cell (e.g., by virus, direct injection, or liposomes, or by any other suitable methods known in the art or later developed). The methods of delivery can be modified to target certain cells, and in particular, cell surface receptor molecules. As an example, the use of cationic lipids as a carrier for nucleic acid constructs provides an efficient means of delivering the nucleic acid inhibitor of the present invention.
Various formulations of cationic lipids have been used to deliver nucleic acids to cells (WO 91/17424; WO 91/16024; U.S. Pat. Nos. 4,897,355; 4,946,787; 5,049,386; and 5,208,036). Cationic lipids have also been used to introduce foreign nucleic acids into frog and rat cells in vivo (Holt et al., 1990, Neuron 4:203-214; Hazinski et al., 1991 , Am. J. Respr. Cell. MoI. Biol. 4:206-209). Therefore, cationic lipids may be used, generally, as pharmaceutical carriers to provide biologically active substances (for example, see WO 91/17424; WO 91/16024; and WO 93/03709). Thus, cationic liposomes can provide an efficient carrier for the introduction of nucleic acids into a cell.
Further, liposomes can be used as carriers to deliver a nucleic acid inhibitor to a cell, tissue or organ. Liposomes comprising neutral or anionic lipids do not generally fuse with the target cell surface, but are taken up phagocytically, and the nucleic acids are subsequently subjected to the degradative enzymes of the lysosomal compartment (Straubinger et al., 1983, Methods Enzymol. 101 :512-527; Mannino et al., 1988, Biotechniques 6:682-690). However, an isolated nucleic acid of the present invention can be a stable nucleic acid, and thus, may not be susceptible to degradative enzymes. Further, despite the fact that the aqueous space of typical liposomes may be too small to accommodate large macromolecules, the isolated nucleic acid inhibitor of the present invention is relatively small, and therefore, liposomes are a suitable delivery vehicle for some embodiments of the present invention. Methods of delivering a nucleic acid to a cell, tissue or organism, including liposome-mediated delivery, are known in the art and are described in, for example, Feigner (Gene Transfer and Expression Protocols Vol. 7, Murray, E. J. Ed., Humana Press, New Jersey, ( 1991)).
In other related aspects, the invention includes an isolated nucleic acid inhibitor operably linked to a nucleic acid comprising a promoter/regulatory sequence such that the nucleic acid is preferably capable of delivering a nucleic acid inhibitor. Thus, the invention encompasses expression vectors and methods for the introduction of an isolated nucleic acid inhibitor into or to cells.
Such delivery can be accomplished by generating a plasmid, viral, or other type of vector comprising an isolated nucleic acid inhibitor operably linked to a promoter/regulatory sequence which serves to introduce the nucleic acid inhibitor into cells in which the vector is introduced. Many promoter/regulatory sequences useful for the methods of the present invention are available in the art and include, but are not limited to, for example, the cytomegalovirus immediate early promoter enhancer sequence, the SV40 early promoter, as well as the Rous sarcoma virus promoter, and the like. Moreover, inducible and tissue specific expression of an isolated nucleic acid inhibitor may be accomplished by placing an isolated nucleic acid inhibitor, with or without a tag, under the control of an inducible or tissue specific promoter/regulatory sequence. Examples of tissue specific or inducible promoter/regulatory sequences which are useful for his purpose include, but are not limited to the MMTV LTR inducible promoter, and the SV40 late enhancer/promoter. In addition, promoters which are well known in the art which are induced in response to inducing agents such as metals, glucocorticoids, and the like, are also contemplated in the invention. Thus, it will be appreciated that the invention includes the use of any promoter/regulatory sequence, which is either known or unknown, and which is capable of driving expression of the desired protein operably linked thereto.
Selection of any particular plasmid vector or other vector is not a limiting factor in the invention and a wide plethora of vectors are well-known in the art, Further, it is well within the skill of the artisan to choose particular promoter/regulatory sequences and operably link those promoter/regulatory sequences to a DNA sequence encoding a desired polypeptide. Such technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (2001 , Current Protocols in Molecular Biology, John Wiley & Sons, New York) and elsewhere herein.
Pharmaceutical Compositions and Therapies
Administration of an inhibitor composition of the invention comprising one or more of a small interfering RNA (siRNA), a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule of the invention in a method of treatment can be achieved in a number of different ways, using methods known in the art. Such methods include, but are not limited to, providing exogenous nucleic acids, antisense nucleic acids, polynucleotides, or oligonucleotides to a subject or expressing a recombinant nucleic acid, antisense nucleic acid, polynucleotide, or oligonucleotide expression cassette.
The pharmaceutical compositions useful for practicing the invention may be administered to deliver a dose of between 1 ng/kg/day and 100 mg/kg/day. In one embodiment, the invention envisions administration of a dose which results in a concentration of the compound of the present invention between 1 μM and 10 μM in a mammal. In another embodiment, the invention envisions administration of a dose which results in a concentration of the compound of the present invention between 1 μM and 10 μM in a cell of a mammal.
Typically, dosages which may be administered in a method of the invention to a subject, preferably a human, range in amount from 0.5 μg to about 50 mg per kilogram of body weight of the animal. While the precise dosage administered will vary depending upon any number of factors, including but not limited to, the type of subject and type of disease state being treated, the age of the subject and the route of administration. Preferably, the dosage of the compound will vary from about 1 μg to about 10 mg per kilogram of body weight of the animal. More preferably, the dosage will vary from about 3 μg to about 1 mg per kilogram of body weight of the animal.
The inhibitor of the invention may be administered to a subject, or to a part of a subject such as a cell of an animal, as frequently as several times daily, or it may be administered less frequently, such as once a day, once a week, once every two weeks, once a month or even less frequently, such as once every several months or even once a year or less. The frequency of the dose will be readily apparent to the skilled artisan and will depend upon any number of factors, such as, but not limited to, the type and severity of the disease being treated, the type and age of the subject, etc. The formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with a carrier or one or more other accessory ingredients, and then, if necessary or desirable, shaping or packaging the product into a desired single- or multi-dose unit.
Although the description of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for ethical administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts, including mammals. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and perform such modification with merely ordinary, if any, experimentation. Subjects to which administration of the pharmaceutical compositions of the invention is contemplated include, but are not limited to, birds, humans and other primates, mammals including commercially relevant mammals such as non-human primates, cattle, pigs, horses, sheep, cats, and dogs. Pharmaceutical compositions that are useful in the methods of the invention may be prepared, packaged, or sold in formulations suitable for ophthalmic, oral, rectal, vaginal, parenteral, topical, pulmonary, intranasal, buccal, or another route of administration. Other contemplated formulations include projected nanoparticles, liposomal preparations, resealed erythrocytes containing the active ingredient, and immunologically-based formulations.
A pharmaceutical composition of the invention may be prepared, packaged, or sold in bulk, as a single unit dose, or as a plurality of single unit doses. A unit dose is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject or a convenient fraction of such a dosage such as, for example, one-half or one- third of such a dosage.
The relative amounts of the active ingredient, the pharmaceutically acceptable carrier, and any additional ingredients in a pharmaceutical composition of the invention will vary, depending upon the identity, size, and condition of the subject treated and further depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100% (w/w) active ingredient. In addition to the active ingredient, a pharmaceutical composition of the invention may further comprise one or more additional pharmaceutically active agents.
Controlled- or sustained-release formulations of a pharmaceutical composition of the invention may be made using conventional technology.
Parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue. Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like. In particular, parenteral administration is contemplated to include, but is not limited to, intraocular, intravitreal, subcutaneous, intraperitoneal, intramuscular, intrasternal injection, and intratumoral. Formulations of a pharmaceutical composition suitable for parenteral administration comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampules or in multi-dose containers containing a preservative. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, creams, lotions, gels, and implantable sustained-release or biodegradable formulations. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents. In one embodiment of a formulation for parenteral administration, the active ingredient is provided in dry (i.e. powder or granular) form for reconstitution with a suitable vehicle (e.g. sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition.
Formulations of a pharmaceutical composition suitable for topical (including mucosal) administration comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Formulations may be prepared, packaged, or sold in unit dosage form, such as in ampules or in multi-dose containers containing a preservative. Formulations for topical administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, creams, lotions, gels, and implantable sustained-release or biodegradable formulations. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents. In one embodiment of a formulation for topical administration, the active ingredient is provided in dry (i.e. powder or granular) form for reconstitution with a suitable vehicle (e.g. sterile pyrogen-free water) prior to administration of the reconstituted composition. The pharmaceutical compositions may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution. This suspension or solution may be formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the dispersing agents, wetting agents, or suspending agents described herein. Such sterile injectable formulations may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butane diol, for example. Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono- or di-glycerides. Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of a biodegradable polymer systems. Compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt. A pharmaceutical composition of the invention may be prepared, packaged, or sold in a formulation suitable for pulmonary administration via the buccal cavity. Such a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers, and preferably from about 1 to about 6 nanometers. Such compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propel lant may be directed to disperse the powder or using a self-propelling solvent/powder-dispensing container such as a device comprising the active ingredient dissolved or suspended in a low-boiling propellant in a sealed container. Preferably, such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. More preferably, at least 95% of the particles by weight have a diameter greater than 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers. Dry powder compositions preferably include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form. Low boiling propellants generally include liquid propellants having a boiling point of below 650F at atmospheric pressure. Generally the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition. The propellant may further comprise additional ingredients such as a liquid non-ionic or solid anionic surfactant or a solid diluent (preferably having a particle size of the same order as particles comprising the active ingredient).
Pharmaceutical compositions of the invention formulated for pulmonary delivery may also provide the active ingredient in the form of droplets of a solution or suspension. Such formulations may be prepared, packaged, or sold as aqueous or dilute alcoholic solutions or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization or atomization device. Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, or a preservative such as methylhydroxybenzoate. The droplets provided by this route of administration preferably have an average diameter in the range from about 0.1 to about 200 nanometers.
The formulations described herein as being useful for pulmonary delivery are also useful for intranasal delivery of a pharmaceutical composition of the invention. Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered in the manner in which snuff is taken i.e. by rapid inhalation through the nasal passage from a container of the powder held close to the nares. Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of the active ingredient, and may further comprise one or more of the additional ingredients described herein.
A pharmaceutical composition of the invention may be prepared, packaged, or sold in a formulation suitable for buccal administration. Such formulations may, for example, be in the form of tablets or lozenges made using conventional methods, and may, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable or degradable composition and, optionally, one or more of the additional ingredients described herein. Alternately, formulations suitable for buccal administration may comprise a powder or an aerosolized or atomized solution or suspension comprising the active ingredient. Such powdered, aerosolized, or aerosolized formulations, when dispersed, preferably have an average particle or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.
Pharmaceutical compositions of the invention may also provide the active ingredient in the form of gels, hydrogels, creams, solutions or suspensions. Gels and hydrogels may include but not limited to HydroxyEthyl Cellulose (HEC) gel, alginate gels or other gels or hydrogels. Such formulations may be prepared, packaged, or sold as gels, hydrogels, creams, solutions, suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any suitable applicator device. Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a buffering agent, a surface active agent, or a preservative such as sorbic acid or methylhydroxybenzoate.
As used herein, "additional ingredients" include, but are not limited to, one or more of the following: excipients; surface active agents; dispersing agents; inert diluents; granulating and disintegrating agents; binding agents; lubricating agents; sweetening agents; flavoring agents; coloring agents; preservatives; physiologically degradable compositions such as gelatin; aqueous vehicles and solvents; oily vehicles and solvents; suspending agents; dispersing or wetting agents; emulsifying agents, demulcents; buffers; salts; thickening agents; fillers; emulsifying agents; antioxidants; antibiotics; antifungal agents; stabilizing agents; and pharmaceutically acceptable polymeric or hydrophobic materials. Other "additional ingredients" which may be included in the pharmaceutical compositions of the invention are known in the art and described, for example in Remington's Pharmaceutical Sciences (1985, Genaro, ed., Mack Publishing Co., Easton, PA), which is incorporated herein by reference.
Kits The invention also includes a kit comprising an inhibitor composition of the invention, or combinations thereof, and an instructional material which describes, for instance, administering the inhibitor composition of the invention, or combinations thereof, to a subject as a therapeutic treatment, or as a non-treatment use as described elsewhere herein. In an embodiment, the kit further comprises a (preferably sterile) pharmaceutically acceptable carrier suitable for dissolving or suspending the inhibitor composition of the invention, or combinations thereof, for instance, prior to administering the composition to a subject. Optionally, the kit comprises an applicator for administering the inhibitor composition.
EXAMPLES
The invention is now described with reference to the following Examples. These Examples are provided for the purpose of illustration only and the invention should in no way be construed as being limited to these Examples, but rather should be construed to encompass any and all variations which become evident as a result of the teaching provided herein.
Example 1 : Virus-induced unfolded protein response attenuates anti-viral defenses via phosphorylation-dependent degradation of the Type 1 interferon receptor Phosphorylation-dependent ubiquitination and degradation of the IFNARl chain of Type I interferon (IFN) receptor is regulated by two different pathways, one of which is ligand-independent. The results presented herein demonstrate that this pathway is activated by inducers of the endoplasmic reticulum (ER) stress, including viral infection, in a PERK-dependent manner. Upon infection, activation of this pathway promotes phosphorylation-dependent ubiquitination and degradation of IFNARl, and specifically inhibits Type I IFN signaling and antiviral defenses. Either knock-in of an IFNARl mutant insensitive to virus-induced turnover or inhibition of PERK via either conditional knockout or knockdown by RNAi prevented ER stress-and virus-induced IFNARl degradation while restoring cellular responses to Type I IFlM and resistance to viruses. The role of this novel mechanism in pathogenesis of viral infections and therapeutic approaches to their treatment is discussed below. The Materials and Methods used in the experiments presented in this Example are now described.
Plasmids and Reagents Vectors for bacterial expression of GST-ctIFNAR 1 and mammalian expression of human and mouse Flag-IFNARl were described previously (Kumar, et ai., 2004, J Biol Chem 279(45):46614-46620; Kumar et al,, 2007, Cancer Biol Ther 6(9); 1437-1441 ; Kumar, et al., 2003, Embo J 22(20):5480-5490); other plasmids were generous gifts (e.g., Flag-STATl , HCV constructs, and Cre). All shRNA constructs used were based on pLKO.1. Recombinant human IFNα2 was purchased from Roche Diagnostics. Recombinant human and mouse IFNγ and mouse IFNβ were purchased from PBL. Thapsigargin, cycloheximide and methylamine HCl were purchased from Sigma.
Plasmid and viruses used are as follows: shCon (CAACAAGATGAAGAGCACCAA; SEQ ID NO: 1), shIRElα (GAGAAGATGATTGCGATGGAT; SEQ ID NO: 2) and shPERK (CCTCAAGCCATCCAACATATT; SEQ ID NO: 3) plasmids based on pLKO. l -puro vector (Sigma) were used in either transient transfection experiments or were used to generate lentiviruses encoding the short hairpin sequences to infect 293T or 2fTGH cells.
Cell culture and Virus
All cell lines were maintained in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% (v/v) fetal bovine serum (Hyclone) and various selection antibiotics when indicated. To acutely delete PERK in MEFs, MEFs harboring PERKfl/tl were infected with control retrovirus or retrovirus expressing Cre. The transduced cells were selected by puromycin for 72 hour. The surviving clones were pooled and used for further analysis. IFNARl -null MEFs reconstituted with pBABE- puro-based retroviral vector encoding Flag-tagged mIFNARlwt and mIFNARl S526A (Kumar, et al., 2003, Embo J 22(20):5480-5490) were generated and cultured in the presence of 4 μg/ml of puromycin.. Huh7-derivative cells introduced with a complete HCV genome or a subgenomic genome were described in detail in (Luquin, et al., 2007, Antiviral Res 76(2): 194-197) and were cultured in the presence of 500μg/ml of G41 8.
Mouse ES clone harboring a S526A mutation were obtained by homologous recombination. The targeting vector containing this mutation (Figure 3A) was introduced via electroporation into the C57/BL6 ES cells. The cells were subjected to neomycin selection and DNA samples from survived clones were analyzed by Southern blotting using the indicated probes to identify the homologous recombinants. For experiments, ES cells were differentiated into embryonic bodies according to ATCC recommendations established protocol (Maatman, et al., 2003, Methods MoI Biol 209:201-230). The embryonic bodies were trypsinized and plated in gelatinized plates using IMDM containing 10% FBS. VSV (Indiana serotype) was propagated in HeLa cells.
Transfections and lentiviral vector-mediated gene knockdown: Transfection of 293T cells and KR-2 cells using LIPOfectamine Plus and of Huh7-derivatives using LIPOfecatimine-2000 (Invitrogen) was carried out according to manufacturer's recommendations. Replication-deficient lentiviral particles encoding shRNA against GFP (shCON), hPERK and hIRElα, or the empty virus control were prepared via co-transfecting 293T cells with three other helper vectors as previously described (Dull, et al, 1998, J Virol 72(11):8463-8471). Viral supernatant were concentrated by PEG8000 precipitation and were used to infect 2fTGH and U5A lines in the presence of 3μg/ml of polybrene (Sigma). Cells were selected and maintained in the presence of 1.5 μg/ml of puromycin.
PERK-deficient MEFs and its WT counterparts were generous gifts from David Ron (New York University). PKR^MEFs and their WT counterparts were generous gifts of R. Kaufman (University of Michigan). 293T cells were transfected with shRNA plasmids using LIPOfectamine Plus reagent (Invitrogen) according to manufacture's instructions. Studies on HCV were carried out using HCV genomic and subgenomic replicon system. Stable derivatives of Huh7 human hepatic cell line that express either incomplete genome of HCV (lacking structural proteins) or complete HCV genome (that expresses structural proteins as well) were generated and characterized as previously described (Luquin, et al., 2007, Antiviral Res 76(2): 194- 197).
Cell treatment and viral infection For examining the signaling event occurring after initiation of ER stress, cells were treated with vehicle (DMSO) or TG (l μM, unless otherwise indicated) for 0.5- 2 hour as shown in the figure legends. Unless otherwise specified, cells were inoculated with VSV at an initial MOI of 0.1-1.0 for 1 hour. After removing the virus inoculum, cells were then fed with fresh medium. Cells were harvested at different time points afterwards; most of the effects were observed when the cells were uniformly infected and viral markers were at saturation. In some experiments, virus- infected cells were pulsed with IFNs for 30 min and then harvested. To examine the anti-viral effect of IFN in relation to the time of its addition, 20 IU/ml of IFN was either added overnight prior to VSV infection or was added after the initial virus inoculation/removal. Culture supernatant was generally harvested 20 hour after the initial inoculation for analysis of viral titer. VSV titer determination was performed as described elsewhere (Sharma, et al., 2003, Science 300(5622): 1 148-1 151).
Viral titer determination: MEFs were infected with an apparent MOIO.1 of VSV for 1 h before the initial inoculum was removed and the cell layer was fed with medium after washed once with PBS. 20 h after infection, the virus-containing culture supernatant was harvested and the viral titer is determined according to previously published report (Sharma, et al., 2003, Science 300(5622): 1 148-1151). At the time of harvesting cells for biochemical analyses, cells were infected almost uniformly judging by saturation in the levels of viral markers.
Virus-mediated shRNA knockdown:
Virus packaging was done in 293T cells as described elsewhere (Dull et al., 1998). Target cells were infected with concentrated virus in the presence of 3 μg/ml of polybrene. 48 h after transduction, 2fTGH and 293T cells were selected in medium containing 1.5 and 3 μg/ml of puromycin, respectively.
Immunotechniques
Antibodies against pSTATl , p-eIF2, p-β-catenin, β-catenin, IREl α (Cell Signaling), STATl (Cell Signaling), eIF2α (Biosources), hlFNARl , PKR, c-Jun, lκBα (Santa Cruz), mIFNARl (R&D Systems), Flag tag, β-actin (Sigma) and ubiquitin (clone FK2, Biomol), ISG 15 and PERK (Rockland) were used for immunoprecipitation and immunoblotting. Monoclonal antibody 23Hl 2, specific for the M protein of VSV (VSV- M), was kindly provided by D. S. Lyles (Wake Forest University School of Medicine, Winston-Salem, N. C). Antibody against IFNARl phosphorylated on Ser535 (in human receptor) or Ser526 (in murine receptor) were described previously (Kumar, et al., 2004, J Biol Chem 279(45):46614-46620). Cells lysis, immunoprecipitation and immunoblotting procedures were described earlier (Kumar, et al., 2004, J Biol Chem 279(45):46614-46620). Kinase assay with cell lysates and GST-ctIFNARI as a substrate was previously described (Liu, et al., 2008, Biochem Biophys Res Commun 367(2):388- 393).
In vitro kinase assay
In vitro PERK kinase assay using GST-cIFNARl as a substrate was performed using kinase buffer containing 20 mM HEPES 7.4, 50 mM KCI, 2 mM MgOAC, 2 mM MnC12, 20 μM ATP and 1.5 mM DTT. Recombinant PERKΔN and GST-IFNARl were described previously (Cullinan et al., 2003, MoI Cell Biol 23:7198-7209; Kumar, et al., 2003, Embo J 22(20):5480-5490). 5 ng of PERKΔN and I μg of GST-IFNARl was mixed in the kinase buffer containing 1 μCi of γ-ATP. The reaction mix was incubated at 300C for 30 min. The samples were separated on SDS-PAGE and analyzed by auto-radiography.
FACS analysis
Measurements of surface levels of IFNARl in MEFs of various genetic background was carried out using an anti-mIFNARI antibody (R&D Services) as previously described elsewhere (Sheehan et al., J. Interferon Cytokine Res. 26:804). The results of the experiments presented in this Example are now described.
The UPR induces PERK-dependent phosphorylation of IFNARl degron Overexpressed IFNARl undergoes ligand-and Jak-independent degron phosphorylation followed by ubiquitination and degradation of this receptor (Liu, et al., 2008, Biochem Biophys Res Commun 367(2):388-393). Increasing the amount of transfected IFNARl plasmid led to a disproportionate increase in phospho-IFNARl signal that cannot be explained solely by higher levels of total IFNARl expressed in these cells (Figure I A). Furthermore, lysates from these transfected cells displayed an elevated ability to phosphorylate bacterially produced GST-IFNARl protein on Ser535 (Figure IB) indicating that forced expression of IFNARl activates a signal transduction pathway inducing an unknown protein kinase activity that phosphorylates IFNARl within its degron. Overexpression of secretory and transmembrane proteins (such as
IFNARl) may overpower the ability of a cell to properly fold these proteins in the ER and, therefore initiate the UPR (Welihinda, et al., 1999, Gene Expr 7:293-300). As disclosed elsewhere herein, in Figures 8 and 1 1 , forced expression of IFNARl induced the markers of the UPR such as BiP and ATF4 and promoted phosphorylation of eIF2α. Similar results along with phosphorylation of endogenous IFNARl on Ser535 were obtained upon overexpression of unrelated IFNγ receptor IFNARl (Figure 9). It appears that eIF2α phosphorylation was dependent on PERK as evident from experiments using RNAi approach to knock down this kinase (Figures 10-1 1 ). Remarkably, thapsigargin, a known inducer of UPR stimulated phosphorylation of endogenous IFNARl on Ser535 in the absence of IFN (Figure 1C). Similar results were obtained using other known UPR stimuli such as DTT (Figure 12) and tunicamycin (not shown).
The next set of experiments was designed to investigate whether activity of Tyk2, which is required for IFNARl phosphorylation in response to IFN (Liu, et al., 2008, Biochem Biophys Res Commun 367(2):388-393; Marijanovic, et al., 2006, Biochem J 397(l):31-38), plays a role in the ligand-independent pathway. To this end, derivatives of human fibrosarcoma 2fTGH-derived cell lines originally sensitive to Type I IFN (John, et al, 1991, MoI Cell Biol 1 1 (8):4189-4195) but then having lost Tyk2 expression was utilized (Velazquez, et al., 1992, Cell 70(2):313-322). These cells were reconstituted with either wild type (WT) Tyk2 or its catalytically inactive (KR) mutant (Marijanovic, et al., 2006, Biochem J 397(1):3 1-38). In line with the latter report, IFN-α- stimulated phosphorylation was inhibited in KR cells; however, thapsigargin induced comparable levels of Ser535 phosphorylation of IFNARl in both cell lines (Figure ID). These data suggest that UPR mediates phosphorylation of IFNARl in a ligand-and Tyk2 kinase-independent manner.
The next set of experiments was designed to investigated which branch of UPR signaling is involved in regulating IFNARl phosphorylation. Embryo fibroblasts derived from PERK-null mice exhibited attenuated IFNARl phosphorylation in response to thapsigargin but not to murine IFN-β (Figure IE). This data was corroborated using the fibroblasts from mice harboring a conditional knockout allele of PERK (PERKfl/fl) where PERK is acutely excised upon transduction with retrovirus encoding the Cre recombinase (Zhang, et al., 2002, MoI Cell Biol 22:3864-3874). The acute deletion of PERK inhibited IFNARl phosphorylation induced by thapsigargin without affecting IFN-triggered phosphorylation (Figure IF). Phosphorylation of IFNARl in response to thapsigargin in human cells was not inhibited by either knockdown of IREl or the expression of a dominant negative mutant of IREl (Figure 13). Conversely, the knockdown of PERK noticeably decreased the efficacy of IFNARl phosphorylation induced by thapsigargin but not by IFN-α in human cells (Figure 14).
Collectively, these data suggest that PERK is required for IFNARl degron phosphorylation stimulated by UPR. Given that activated PERK was not capable of phosphorylating IFNARl in vitro it is likely that a kinase(s) downstream of PERK is responsible for the direct phosphorylation of IFNARl degron.
The UPR promotes IFNARl ubiquitination and degradation by inducing degron phosphorylation in a ligand-and Tyk2-independent manner
Phosphorylation within the IFNARl degron is expected to promote ubiquitination of this receptor and its degradation in the lysosome (Kumar, et al., 2004, J Biol Chem 279(45):46614-46620; Kumar, et al., 2003, Embo J 22(20):5480-5490; Marijanovic, et al., 2006, Biochem J 397(l):31-38). Indeed, treatment of cells with thapsigargin decreased the levels of IFNARl in human cells within two hours even in the absence of IFN. This decrease was prevented by pre-treating cells with methylamine FfCI (MA), an inhibitor of the lysosomal pathway (Figure 2A). Furthermore, thapsigargin treatment induced ubiquitination of IFNARl and downregulated this receptor in human fibrosarcoma cells that express either wild type (WT) or catalytically inactive (KR) Tyk2 (Figure 2B) as well as in 293T cells (Figure 15). Ligand-independent stimulation of IFNARl ubiquitination by thapsigargin was also seen in IFNARl -null mouse fibroblasts reconstituted with IFNARlWT but not with IFNARl SA mutant lacking phosphorylation site (Figure 16). These results indicate that induction of the UPR promotes phosphorylation-dependent ubiquitination of IFNARl and downregulates its levels in a manner independent of Tyk2 and of exogenous IFN.
Treatment of cells with thapsigargin decreased the half life of IFNARl but not of an unrelated short lived protein, c-Jun, in 293T cells treated with cycloheximide to inhibit translation (Figure 2C). Knockdown of PERK decreased the ubiquitination of exogenously overexpressed IFNARl and noticeably increased its level in human cells (Figure 2D). Similarly, thapsigargin-induced ubiquitination of IFNARl was alleviated in PERK-deficient cells mouse cells. In addition, acute Cre-mediated ablation of PERK slowed down UPR-induced turnover of both endogenous (Figure 2E) and exogenously expressed mouse IFNARl (Figure 2F). In contrast to that, degradation of another β-Trcp substrate, phosphorylated β-catenin, was not affected under these conditions (Figure 2E). Collectively, these data suggest that UPR promotes ubiquitination and degradation of IFNARl in a PERK-dependent manner.
The next set of experiments was designed to investigate whether UPR- stimulated IFNARl degradation is mediated via phosphorylation of serine residues within the IFNARl degron. To this end, mouse embryonic stem (ES) cells that harbor one mutant IFNARl S526A allele introduced via a homologous recombination approach was generated (Figure 3A-B). These cells were grown as embryoid bodies (EB) and differentiated into fibroblast-like cells for analysis. Although treatment with thapsigargin induced a comparable level of eIF2α phosphorylation in both wild type and S526A knock-in cells, the latter displayed a grossly reduced phosphorylation of IFNARl on Ser526 (Figure 3C). Furthermore, thapsigargin-stimulated degradation of IFNARl was clearly inhibited in the S526A knock-in cells (Figure 3D). These data indicate that UPR- induced acceleration of proteolytic turnover of IFNARl depends on its phosphorylation within the specific degron.
VSV and HCV accelerate the degradation of IFNARl via induction of PERK-dependent IFNARl degron phosphorylation
While IFN-α/β play a major role in the defense against viruses, pre- treatment of yet uninfected cells with these cytokines are often required to obtain the protective effect. Numerous viruses including hepatitis C virus (HCV, (Ciccaglione, et al., 2007, Virus Res 126(1-2): 128-138; Wang, et al., 2006, J Gastroenterol Hepatol 21 Suppl 3:S34-37; Zheng, et al., 2005, J Microbiol 43:529-536)) are known to massively express their proteins and cause ER stress. Therefore, the next set of experiments was designed to investigate whether virus-induced LJPR might also affect IFNARl phosphorylation and stability that may also lead to inhibiting IFN responsiveness of already infected cells.
Infection of 2fTGH human fibrosarcoma cells with vesicular stomatitis virus (VSV) induced the expression of UPR markers (Figure 17). Intriguingly, this infection also stimulated IFNARl phosphorylation on Ser535 and decreased total levels of IFNARl (Figure 1 8). Similar results and an increase in the extent of IFNARl ubiquitination were observed in the KR derivative cell line (Figure 4A) indicating that VSV infection promotes IFNARl phosphorylation, ubiquitination and degradation in a Tyk2-independent manner. Furthermore, given that Tyk2 activity is essential for IFN- induced IFNARl phosphorylation (Marijanovic, et al., 2006, Biochem J 397(1):31-38), this result suggests that the effects of VSV on IFNARl downregulation could not be attributed solely to induction of endogenous IFN.
Infection with hepatitis C virus (HCV) promotes the ER stress (Tardif, et al., 2005, Trends Microbiol 13(4): 159-163; Waris, et al., 2002, Biochem Pharmacol 64: 1425-1430) that is robustly stimulated by the synthesis of structural proteins (Ciccaglione, et al., 2005, Arch Virol 150(7): 1339- 1356) known to reside in ER lumen of infected cells (Wu, 2001, IUBMB Life 51 :19-23). In human hepatoblastoma Huh7 cells, total levels of endogenous IFNARl were dramatically down regulated by stable transfection of a complete HCV genome (Figure 4B). When the levels of IFNARl taken into immunoprecipitation were normalized to yield comparable total levels of IFNARl, a robust phosphorylation of IFNARl degron was detected in Huh7 cells expressing the complete HCV genome (Figure 4C). Thus, it is plausible that the effects of viral infection/expression of viral proteins on IFNARl levels could be mediated via IFNARl degron phosphorylation and ensuing degradation.
Indeed, while VSV infection dramatically down regulated murine Flag- tagged IFNARl (re-expressed in MEFs from IFNAR l -null mice), a noticeably lesser effect was observed on mutant IFNARl S526A (Figure 4D). This result was further corroborated in IFNARl S526A knock-in cells that were more resistant in decreasing IFNARl levels in response to VSV (Figure 4E). These data indicate that phosphorylation of IF]VARl degron is implicated in the receptor downregulation stimulated by virus. Knock-down of PERK in human 2fTGH cells (Figure 19) attenuated degron phosphorylation and downregulation of IFNARl in cells infected with VSV (Figure 5A). Similarly, downregulation of IFNARl in VSV-infected 2fTGH cells was prevented by shRNA against PERK but not by a number of irrelevant shRNAs or shRNA against IREl (Figure 20). Accordingly, a much lesser extent of degradation of IFNARl promoted by VSV infection (measured in cycloheximide-treated cells) was detected in PERK knockdown cells (Figure 5B). Furthermore, CRE-mediated ablation of PERK decreased the extent of downregulation of cell surface IFNARl levels in response to either TG treatment or VSV infection (Figure 5C). In addition, knockdown of PERK partially rescued a decrease in IFNARl observed in Huh7 cells expressing the complete HCV genome (Figure 5D). These data suggest that viral infection and expression of structural viral proteins promote downregulation and degradation of IFNAR l via a PERK-dependent signaling.
VSV and HCV attenuate cellular responses to Type I IFN via PERK-dependent phosphorylation and downregulation of IFNARl Attenuated anti-viral defense observed in cells from IFNARl+/-mice suggests that levels of IFNARl are important for Type I IFN signaling (Hwang et al., 1995, Proc Natl Acad Sci U S A 92(24): 1 1284- 1 1288; Muller, et al, 1994, Science 264(5167): 1918- 1921 ). Therefore, IFNARl downregulation triggered by UPR activation is expected to inhibit cellular responses to IFN-α/β. Indeed, either infection of cells with VSV (Figure 6A) or pre-treatment of cells with thapsigargin (Figure 21) noticeably decreased tyrosine phosphorylation of Statl induced by IFN-α in human cells. Much lesser inhibition was seen in cells treated with IFNγ that utilizes an entirely different receptor (Pestka, 2000, Biopolymers 55(4):254-287; Schreiber, et a]., 1993, Gastroenterol Jpn 28(Suppl 4):88-94), although yet requiring IFNARl for maximal signaling (Takaoka, et al., 2000, Science 288(5475):2357-2360). The expression of the complete HCV genome in Huh7 cells dramatically inhibited Statl phosphorylation induced by IFN-α while IFNγ signaling was only modestly affected ((Luquin, et al., 2007, Antiviral Res 76(2): 194- 197) and Figure 22). Remarkably, expression of IFNARl proteins in these cells partially rescued Type 1 IFN signaling; this effect was especially pronounced when a stabilized IFNARl S535A mutant (that lacks Ser responsible for UPR-driven degradation, Figure 4) was used (Figure 6B). Similarly, a lesser inhibitory effect of VSV infection on Type 1 (but not Type 11) IFN signaling was observed in cells derived from the IFNARl S526A knock-in ES cells (Figure 6C). These results indicate that ER stress and viral infection inhibit Type 1 IFN signaling via phosphorylation-dependent downregulation of IFNARl . The next set of experiments was designed to investigate the role of this regulation in anti-viral defense. While pre-treatment of wild type cells with IFN-β exhibited an anti-viral effect, this cytokine was inefficient when added immediately after the virus. However, under the latter conditions, cells that harbored the knocked-in IFNAR 1S526A mutant were capable of utilizing IFN-β to significantly reduce VSV propagation (Figure 6D). These results indicate that viruses at least temporarily benefit from the induced phosphorylation-dependent degradation of IFNARl and the ensuing suppression of the anti-viral defenses.
This hypothesis was further corroborated when the role of PERK in Type I IFN-induced signaling and anti-viral defense was investigated. Either knockdown of PERK in human cells (using RNAi approach) or acute genetic ablation of PERK in mouse fibroblasts (using Cre expression) led to the rescue of Statl phosphorylation in response to Type I IFNs (Figures 7A-B). Judging from expression of viral VSV-M protein, PERK-deficient cells contained fewer viruses; however, even when exposed to a five-fold higher viral titer to achieve a comparable expression of VSV-M, these cells remained competent in IFN-β-induced activation of Statl (Figure 7C), Such protection was not seen in infected MEFs lacking a related kinase, PKR (Figure 23). Specific role of PERK was further corroborated by data demonstrating that PERK knockdown in Huh7 cells expressing complete HCV genome also restored the ability of these cells to conduct Type I IFN signaling (Figure 7D). These data suggest that PERK plays an important role in virus-mediated inhibition of cellular responses to IFN-α/β. PERK knockdown in human cells increased their overall resistance to
VSV and promoted the ability of cells to utilize IFN-α added after the virus to significantly suppress the replication of VSV in these cells (Figure 7E). This finding is counterintuitive as both previous report (Baltzis, et al., 2004, J Virol 78: 12747-12761) and the data relating to Figure 24, which indicated that mouse fibroblasts derived from conventional PERK knockout embryos are somewhat more sensitive to viral infection. Accordingly, conventional PERK-null MEFs displayed a somewhat reduced response to IFN as evident from analysis of the ISRE-driven luciferase reporter (Figure 25). However, re-expression of PERK in these cells did not stimulate either IFN responses or anti-viral defenses (Figures 24-25) suggesting that conventional PERK-null cells underwent an additional alteration to decrease IFN signaling. Without wishing to be bound by any particular theory, it is believed that this alteration was to compensate an impaired ability to downregulate IFNARl via the ligand-independent pathway that has been previously shown to impede cell growth (Liu, et al., 2008, Biochem Biophys Res Commun 367(2):388-393). Conversely, a compensatory pathway that rescued growth of cells overexpressing a dominant negative mutant of PERK has been also reported
(Yamaguchi, et al., 2008, J Biol Chem 283: 17020-9). Therefore, to investigate the role of PERK in murine cells, a model of Cre-mediated acute ablation of PERK in MEFs from PERKfl/fl mice that did not display defects in ISRE-dependent transcription was used. Remarkably, expression of Cre rendered these MEFs more resistant to VSV in the absence of added IFN (as seen from a decreased viral titer and expression of VSV-M, Figure 7F). Furthermore, PERK-deficient 2fTGH cells elevated the expression of interferon stimulated protein ISGl 5 and became more resistant to VSV infection (as judged by the lower levels of VSV-M protein, Figure 7G). These effects of PERK loss of function appeared to largely depend on the IFN pathway as much lesser changes were observed in isogenic U5a cells lacking IFNAR2. This conclusion was also supported by the fact that expression of VSV-M in infected PERK knockdown cells was noticeably increased by treatment with anti-IFN-α/β antibodies (Figure 26). In all, these results suggest that activation of PERK is utilized by VSV to inhibit cellular responses to IFN and anti-viral defenses; this mechanism at least partially relies on UPR-induced PERK- dependent downregulation of IFN receptor.
Inhibition of PERK to augment the efficacy of endogenous and pharmaceutical Type I IFN
Ligand-stimulated, Jak-dependent ubiquitination and degradation of Type I IFN receptor plays a key role in the negative regulation of IFN-α/β signaling (Kumar, et al., 2003, Embo J 22(20):5480-5490). However, recent evidence suggested the existence of a ligand-and Jak-independent pathway that controls stability of IFNARl in a phosphorylation-dependent manner. The importance of the latter pathway remained unclear as it was largely observed under the conditions of IFNARl overexpression (Liu, et al., 2008, Biochem Biophys Res Commun 367(2):388-393). The results presented herein demonstrate that this pathway is triggered by activation of the ER stress in a manner that requires function of PERK. Among the evidence supporting this conclusion are the following: (i) stimuli that cause UPR induce Ser phosphorylation within the IFNARl degron and promote IFNARI ubiquitination and degradation in cells that were not treated with IFN and in a Tyk2-indepenent manner; (ii) UPR-induced ubiquitination and degradation of IFNARl is inhibited in cells harboring knocked-in IFNARl mutant lacking phospho-acceptor site in its degron; and (iii) phosphorylation, ubiquitination and degradation of IFNARl induced by UPR are attenuated in PERK-deficient cells.
Furthermore, the results presented herein demonstrate that this pathway, which leads to accelerated degradation of IFNARl , is utilized by some viruses (including VSV and HCV). Infection by VSV and expression of HCV genome led to downregulation of IFNARl and to inhibition of signaling and anti-viral effects induced by Type I IFN. These effects are at least partially impaired in cells that either lack PERK or contain phospho-degron mutant of IFNARl that is insensitive to PERK-induced phosphorylation and degradation. Given that infection with many of human and animal viruses are known to induce the UPR (He, 2006, Cell Death Differ 13(3):393-403; Schroder, et a]., 2006, Curr MoI Med 6(l):5-36; Wang, et al., 2006, J Gastroenterol
Hepatol 21 Suppl 3:S34-37; Waris, et al., 2002, Biochem Pharmacol 64: 1425- 1430), it is believed that some rapidly propagating viruses generally employ the ligand-independent degradation of IFNARl to suppress anti-viral defenses in cells that have not yet been exposed to IFN. It is also believed that this mechanism plays a role in pathogenesis of some viral infectious diseases.
ER stress has evolved to help the cells to deal with protein overload, which among other scenarios also occurs during acute viral infections. According to a current paradigm, being a cellular protective mechanism, UPR as a whole helps to limit viral infection (He, 2006, Cell Death Differ 13(3):393-403). The results presented herein, however, strongly suggest that specific activation of the PERK branch of UPR instead favors viral replication via IFNARl degradation and suppression of IFN responses. Without wishing to be bound by any particular theory, it is believed that one major consequence of PERK activation is an inhibition of translation through eIF2α phosphorylation, which, in cells infected by viruses, can also be carried out by PKR. It is believed that this redundancy in means of translational inhibition permits a sustained stimulation of PERK to negate IFN signaling and promote the infection. Intriguingly, while viruses often impede PKR-dependent phosphorylation of eIF2α (Bergmann, et al., 2000 J Virol 74:6203-6206; Gale, et al., 1997,Virology 230(2):217-227; Gil, et al., 2006, Virus Res 1 16(l-2):69-77; Langland, et al., 2002, Virology 299(1): 133-141 ), the examples of perturbation of PERK activation per se are rare (He, 2006, Cell Death Differ 13(3):393-403).
During the initial rounds of infection, ligand-independent degradation of IFNARl could be of particular importance for a virus that has penetrated a naϊve cell and started to produce massive amounts of viral proteins to prepare for replication. At this time, activation of ER-triggered IFNARl degron phosphorylation and ensuing degradation is expected to dramatically reduce the sensitivity of an infected cell to either exogenous or endogenously produced and secreted IFN-α/β (as seen in Figures 6-7). It is believed that such alterations benefit the offending virus in at least two ways. First, accelerated degradation of IFNARl prevents an efficient induction of expression and activities of diverse anti-viral proteins (including 2 -5' oligoadenylate synthetases, the Mx proteins, PKR, and the double-stranded-RNA-specific adenosine deaminase) that are known to suppress various steps of viral replication (reviewed in (Guidotti et al., 2001 , Annu Rev Immunol 19:65-91)). Second, downregulation of IEVARl protects the host cell from the proapoptotic effects of IFN (Chawla-Sarkar, et al, 2002, J Immunol 169(2):847-855; Chawla-Sarkar, et al., 2002, J Interferon Cytokine Res 22(5):603-613), and, therefore, affords the virus a sufficient time for completion of its infectious cycle. Regardless of which of these pathways are more relevant for each specific virus, the results presented herein strongly suggests that UPR-mediated downregulation of Type I IFN receptor and its signaling are important for unabated completion of initial rounds of infection when majority of target host cells are yet to encounter IFN. Although such a mechanism is believed to briefly benefit a virus that has already entered the cell, it cannot be expected to persist for a protracted period of time or to ensure that progeny released from this infected cell will have a better chance of infecting additional host cells. In order to properly synthesize their proteins, viruses have to attenuate the UPR responses, which they are indeed known to do using a plethora of diverse mechanisms (reviewed in He, 2006, Cell Death Differ 13(3):393-403; Schroder, et al., 2006, Curr MoI Med 6(l):5-36). Once ER stress is resolved, the PERK-dependent pathway that facilitate turnover of IFNARl is suspended disabling a described general mechanism for impeding IFN signaling. Under these conditions, viruses have to resort to individual tricks to maintain a degree of virulence in the environment containing IFN-α/β. Such mechanisms (including prevention of microorganism-associated pattern recognition, reduced synthesis and secretion of IFN, inhibition of the activity of regulatory kinases, etc) have been indeed widely reported (reviewed in Katze, et al., 2002,. Nat Rev Immunol 2(9):675-687). These mechanisms are of importance for viral replication and subsequent transmission; they contribute to the forces that drive co-evolution of the pathogen and the mammalian host. However, from the practical point of view of the host, interfering with a non-specific yet important mechanism enabling initial steps of infection represents an attractive strategy toward either preventing viral infectious diseases or directing the development of these diseases toward an abortive course. Based on data presented herein, inhibitors of PERK-dependent phosphorylation of IFNAR 1 represent a potent anti-viral activity. As Type I IFN also plays an important immunomodulatory role (Tompkins, 1999, J Interferon Cytokine Res 19(8): 817-828), it is believed that the effects of inhibitors of PERK-dependent phosphorylation of IFNARl is even more pronounced in vivo. The inhibitors can be useful in treatment of patients with chronic viral infections (e.g., hepatitis C), multiple sclerosis and some malignancies. In cancer patients, the rationale for combining IFN with other anti-tumor agents that cause UPR (for example, proteasome inhibitors (Fribley, et al., 2004, MoI Cell Biol 24(22):9695-9704; Nawrocki, et al., 2005, Cancer Res 65(24): 1 1510-1 1519; Obeng, et al., 2006, Blood 1 O7(12):49O7- 4916)) might be re-evaluated, design of the means that would impede HCV-mediated ER stress and ensuing degradation of IFNARl (e.g., inhibitors of PERK-dependent pathway) is expected to benefit the patients whose therapeutic regiment includes IFN-α.
Example 2: Specific inhibition of PTPIB to augment the efficacy of endogenous and pharmaceutical Type I IFN Type 1 interferons (IFN) including diverse types of IFNα and IFNβ are endogenously produced cytokine proteins that possess potent anti-tumor, anti-viral and immunomodulatory activities. IFNs are being produced industrially; currently, several formulations have been developed and approved by FDA including Roferon-A (Roche US Pharmaceutical), Pegasys (Hoffmann-La Roche Inc.); Intron-A, Rebetron, Peg-lntron (Schering Plough Corporation), Alferon-N (Hemispherx Biopharma, Inc), Avonex (Biogen IDEC), Betaseron (Bayer Healthcare Pharmaceuticals Inc), and Infergen (Amgen, Inc). These modalities are often used in treatment of various cancers (e.g., leukemias and malignant melanoma), viral infections (e.g., hepatitis C) and autoimmune diseases (e.g., multiple sclerosis). All effects of IFNs in cells are mediated through a single Type I IFN receptor that consists of IFNARl and IFNAR2 chains. Similar to other cytokines, interaction of IFNs with their receptor leads to activation of Janus kinases (JAKS). JAKs mediate tyrosine phosphorylation of signal transducers and activators of transcription (STATs) who then form a potent transcription factor and transactivate a number of IFN- stimulated genes (ISGs) that confer the functions of IFNs. This signal transduction cascade is under tight control of several layers of negative regulation that could be ligand specific (i.e., leads to suppression of only Type I IFNs signaling -that is receptor downregulation) or shared with other cytokines (for example, interferon gamma, growth hormone, interleukin 6, etc). Nonspecific mechanisms include: (i) induction of Shpl/2 protein tyrosine phosphatases (PTP) that remove phospho-groups from JAKs and STATs, (ii) induction of SOCS proteins that inhibit and degrade JAKs; and (iii) induction of PlAS proteins that inhibit STAT transcriptional activities. Inhibitors of non-specific regulators (e.g., inhibitors of phosphatases Shpl/2) are therefore expected to display substantial toxicity because they would be affecting numerous physiologic processes (e.g., hematopoiesis). Although potent, IFNs as drugs pose a number of problems. One is the cost of treatment (that goes beyond $30,000 per course per melanoma patient) and lack of orally available agents as it is generally more expensive to produce and more difficult to deliver protein than a small molecule. Another is development of anti-IFN antibodies that, in addition to many other mechanisms contribute to limiting the efficacy of IFN therapy. Downregulation of IFNARl (its disappearance from cell surface) was shown to be a pivotal regulator of the extent of cellular responses to IFN.
It has been observed that inhibition of PTPl B can be accomplished using, but not limited to, genetic (e.g., RNAi) and pharmacologic approaches (known inhibitors of PTPlB). The inhibitors of PTPl B is believed to be useful as anti-viral agents per se or used in the context of augmenting the effect of administered IFN-based drug.
It has been demonstrated that lysosomal degradation of IFNARl requires its ubiquitination (Kumar et al., 2003 Embo J 22:5480-90). Further studies delineated the mechanisms by which IFNARl ubiquitination promotes endocytosis of this receptor. These mechanisms involve the unmasking of the Tyr466-based linear endocytic motif within the intracellular domain of IFNARl (Kumar et al., 2007 J Cell Biol 179:935-50). In human cells that are not treated with IFN-α/β, this motif is masked by interaction with Tyk2 kinase that prevents ligand-independent endocytosis of IFNARl (Kumar et al., 2008 J Biol Chem 283: 18566-72). The importance of this Tyr-based motif is underscored by observations that Tyk2 deficiency in human cells results in almost complete loss of cell surface IFNARl (Ragimbeau et al., 2003 Embo J 22:537-47) while this phenomenon is not observed in Tyk2-deficient mouse cells (Karaghiosoff et al., 2000, Immunity 13: 549-60) whose IFNARl lacks Tyr-based endocytic motif (Table 1).
Table 1 : Conservation of Tyr-based endocvtic motif (YXXφ bold font) in the proximal parts of the intracellular domains of IFNARl proteins from different species
H. Sapiens: FLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFII (SEQ ID NO:4) P. troglodyte: FLRCIN YVFFPS LKPSSNIDEYFSEQPLKNLLLSTSEEQIEKCFII (SEQ ID NO:5)
P. anubus LLRCINYVFFPSLKPSSNIDEYFSEQSLKNLLLSTSEEQIEKCLII (SEQ ID NO:6)
M. fascicularis: LLRCINYVFFPSLKPSSNIDEYFSEQSLKNLLLSTSEEQIEKCLII (SEQ ID NO:7)
B. taurus: FLRCVKYVFFPSSKPPSSVDEYFSDQPLPNLLLSTSEEQTERCFII (SEQ ID NO:8) E. caballus LWRCINYVFFPSSKPPSAVDEYFSEHLLKNLLLSTSAEQIERCFVI (SEQ ID NO:9) O. aries FLRCVKYVFFPSSKPPSSVDQYFSDQPLPNLLLSTSEEQTERCFII (SEQ ID NO.10)
S. scrofa VSRCINYVFFPSSKPPSTIDE YFAEQPLKNLLLSTSEEQTEICFIV (SEQ ID NO 1 1 )
C. familiaris LLRCISYVFFPSSKPPSTIDEYFSEPPLWNLLLLTSEEQTERCFII (SEQ ID NO: 12) R. norvegicus SLQKYLYYVFSPPLKPPCSIDEFFSELPSKSLLLLTAEEHTERCFV (SEQ ID NO: 13) M. musculus VWKYLCHVCFPPLKPPRSIDEFFSEPPSKNLVLLTAEEHTERCFII (SEQ ID NO:14) G. gallus VYNKIKYMFFPSCQTPLNIEGFGAQLFSSPFVPTVEEPVEICYIIE (SEQ ID NO: 15)
Upon IFN-α/β treatment, IFNARl undergoes ubiquitination that unmasks Tyr466 and allows it to interact with AP2 endocytic machinery complex leading to IFNARl endocytosis and subsequent lysosomal degradation of this receptor (Kumar et al., 2008 J Biol Chem 283: 18566-72). Tyr-based linear endocytic motifs are known to serve as a recognition site for the AP50 subunit of the AP2 complex (Bonifacino et al., 2003 Annu Rev Biochem 72:395-447). Intriguingly, the fact that, in response to IFN-α, this Tyr466 also undergoes phosphorylation by Janus kinases (Yan et al., 1996 Embo J 15: 1064-74) may add another level of regulation complexity. Phosphorylation of Y466 is expected to reduce affinity of AP50 for the Tyr-based endocytic motif s described for CTLA-4 (Chuang et al., 1997 J Immunol 159: 144-51 ; Shiratori et al., 1997 Immunity 6: 583-9; Zhang et al, 1997 Proc Natl Acad Sci USA 94:9273-8). Thus, it is possible that tyrosine phosphatase activities play a role in regulating IFNARl endocytosis. Data presented herein demonstrate that protein tyrosine phosphatase 1 B (known to interact with Tyk2, (Myers et al., 2001 J Biol Chem 276:47771-4.)) plays an important role in regulating the endocytosis of IFNARl and its ability to mediate anti-viral effects of IFN- α/β (Figure 27).
The data presented herein demonstrates a novel endocytic mechanism that governs the downregulation of the IFNARl chain of IFN receptor. Remarkably, this downregulation depends on specific de-phosphorylation of a specific Tyr residue within IFNARl. This residue is present in most of known mammalian IFNARl sequences except in mouse IFNARl. Dephosphorylation of this Tyr is mediated by PTPIB -a tyrosine phosphatase that is an attractive target for treatment of diabetes and obesity against which selective inhibitors are being developed. The results presented herein demonstrate that selective inhibition of PTPlB prevents IFNARl endocytosis and augments IFN responses (including anti-viral defense) in human but not mouse cells.
Selective inhibitors of PTPlB (that do not affect other phosphatases such as Shp) in order to stabilize IFNARI and the entire receptor on cell surface is useful in IFN therapy. This stabilization leads to an augmented response to IFN, which, in turn, translates into either a higher efficacy of endogenous IFN or into an enhancement of efficacy of an IFN-based in treatment the diseases including, but not limited to, cancer, multiple sclerosis and viral infections.
Use of existing and novel inhibitors of PTPlB as sole agents in treatment of diseases that are treated by Type I IFN is envisioned. In addition, these agents can be used in treatment of such diseases in combination with Type I IFN in order to (i) increase its efficacy (ii) decrease the dose and related development of anti-IFN antibody- dependent resistance and side effects, as well as decrease the costs and duration of treatment.
Use of selective PTPlB inhibitors will allow to augment the efficacy of Type I IFN and to decrease toxicity that is posed by less specific inhibitors (such as Sodium stibogluconate). Figure 29 depicts a list of PTPl B inhibitors being developed by pharmaceutical companies for treatment of diabetes and obesity (as reviewed in (Hooft van Huijsduijnen et al., 2004 J Med Chem 47:4142-6; Hooft van Huijsduijnen et al., 2002 Drug Discov Today 7: 1013-9)). These and additional inhibitors such as Trodusquemine (Geneara) and [(3-bromo-7-cyano-2-naphthyl)(difluoro)-methyl]phosphonic acid Merck) could be further used.
Example 3: Specific inhibition of protein kinase D2 (PKD2) to augment the efficacy of endogenous and pharmaceutical Type I IFN
Type I interferons (IFN) including diverse types of IFNa and IFNP are endogenously produced cytokine proteins that possess potent anti-tumor, anti-viral and immunomodulatory activities. This is why IFNs are being produced industrially; currently, several formulations have been developed and approved by FDA including Roferon-A (Roche US Pharmaceutical), Pegasys (Hoffmann-La Roche Inc.); Intron-A, Rebetron, Peg-Intron (Schering Plough Corporation), Alferon-N (Hemispherx Biopharma, Inc), Avonex (Biogen IDEC), Betaseron (Bayer Healthcare Pharmaceuticals Inc), and Infergen (Amgen, Inc). These modalities are often used in treatment of various cancers (e.g., leukemias and malignant melanoma), viral infections (e.g., hepatitis C) and autoimmune diseases (e.g., multiple sclerosis).
All effects of IFNs in cells are mediated through a single Type I IFN receptor that consists of IFNARl and IFNAR2 chains. Similar to other cytokines, interaction of IFNs with their receptor leads to activation of Janus kinases (JAKs). JAKs mediate tyrosine phosphorylation of signal transducers and activators of transcription (STATs) who then form a potent transcription factor and transactivate a number of IFN- stimulated genes (ISGs) that confer the functions of IFNs. This signal transduction cascade is under tight control of several layers of negative regulation that could be ligand specific (i.e., leads to suppression of only Type I IFNs signaling -that is receptor downregulation) or shared with other cytokines (for example, interferon gamma, growth hormone, interleukin 6, etc). Nonspecific mechanisms include: (i) induction of Shpl/2 protein tyrosine phosphatases (PTP) that remove phospho-groups from JAKs and STATs, (ii) induction of SOCS proteins that inhibit and degrade JAKs; and (iii) induction of PIAS proteins that inhibit STAT transcriptional activities. Although potent, IFNs as drugs pose a number of problems. One is the cost of treatment (that goes beyond $30,000 per course per melanoma patient) and lack of orally available agents as it is generally more expensive to produce and more difficult to deliver protein than a small molecule. Another is development of anti-IFN antibodies that, in addition to many other mechanisms contribute to limiting the efficacy of IFN therapy. Downregulation of IFNARl (its disappearance from cell surface) was shown to be a pivotal regulator of the extent of cellular responses to IFN. Research conducted in my lab and other groups over several years delineated the mechanisms of IFNARl downregulation. IFN stimulates a protein kinase that phosphorylates IFNARl on specific serine residues (Ser535 and Ser539 in human IFNARl). This phosphorylation enables the recruitment of the beta-TrCP E3 ubiquitin ligase that ubiquitinates IFNARl (Kumar, et al., 2003, Embo J 22:5480-5490). This ubiquitination promotes exposure of a linear Tyr based endocytic motif within IFNARI that mediates internalization of this receptor followed by its lysosomal degradation (Kumar, et al., 2007, J Cel l Biol 179:935- 950). Phosphorylation of IFNARl by an IFN-inducible kinase plays a critical role in modulating cellular responses to IFN. Studies using IFNARl mutant that cannot be phosphorylated demonstrated that this phosphorylation is critical for IFN signaling in general and efficacy of IFN in growth inhibition of human cancer cells in particular (Kumar, et al., 2003, Embo J 22:5480-5490). Human melanoma cells harboring this mutant exhibit a substantial delay in growth in vivo in xenograft mouse model (Kumar, et al., 2007, Cancer Biol Ther 6: 1437-1441). These studies demonstrate that inhibition of IFNARl kinase is a way to increase the efficacy of Type I IFN.
Protein kinase D2 (PKD2), a member of PKD family (consisting of PKDl , PKD2 and PKD3), is an IFNARl kinase that regulates IFNARI phosphorylation, ubiquitination, abundance and signaling. It has been observed that PKD2 can be inhibited using genetic (RNAi) and pharmacologic approaches (known inhibitors of PKD that are non-specific). Specific PKD2 inhibitors are believed to have anti-viral/anti- tumor/immunomodulatory effects per se or ability to augment the effect of administered IFN-based drug. Accordingly, the invention encompasses compositions and methods relating to the use of selective inhibitors of PKD2 in order to stabilize IFNARl and the entire Type I IFN receptor. This stabilization leads to an augmented response to IFN, which, in turn, translates into either a higher efficacy of endogenous IFlM or into an enhancement of efficacy of an IFN-based in treatment the diseases including (but not limited to) cancer, multiple sclerosis and viral infections.
It has been demonstrated that IFN-α/β stimulate phosphorylation of Ser535 within human IFNARl (Ser526 in mouse receptor) to promote its interaction with the βTrcp E3 ubiquitin ligase. This ligase stimulates IFNARl ubiquitination that leads to endocytosis of IFNARl and subsequent lysosomal degradation of IFNARl . The latter decreases the sensitivity of cells to IFN-α/β (Kumar et al., 2003 Embo J, 22:5480-90). The data presented herein identify protein kinase D2 (PKD2, a.k.a. Prkd2) as a key kinase activated by IFN-α/β and promoting IFNARl phosphorylation. These data also show that inhibition of PKD2 promotes the signaling and anti-viral effects of IFN-α/β.
It was observed that inhibition of PKD2 (but not related kinases PKDl or PKD3) by siRNA prevented phosphorylation of IFNARl on Ser535 in HeLa cells treated with IFN-α. Phosphorylation was measured by immunoblot using phospho-specific anti- Ser535 antibody (described in Kumar et al., 2004 J Biol Chem 279:46614-20). It was also observed that PKD2 is required for ligand- induced phosphorylation of IFNARl degron (Figure 30). Stable knockdown of PKD2 in HeLa cells inhibited IFNARl Ser535 phosphorylation in response to IFN-α (Figure 3 1). It was observed that knockdown of PKD2 prevents IFN-α-stimulated degradation of IFNARl (Figure 32). It was observed that knockdown of PKD2 prevented downregulation of cell surface levels of IFNARl . In addition, it was observed that knockdown of PKD2 in HeLa cells stimulated IFN-α signaling measured by activating tyrosine phosphorylation of Statl protein (Figure 34).
The next set of experiments were designed to study the downstream signaling mediated by interferon alpha and IFNARl in 2fTGH-shCOOO2 and 2fTGH- shPKD2 cells. It was observed that knockdown of PKD2 in human 2fTGH cells stimulated expression of interferon-inducible genes such as PKR and Statl (Figure 35). It was also observed that knockdown of PKD2 in human 2fTGH cells increased the efficacy of IFN-α against infection with vesicular stomatitis virus (VSV) (Figure 36).
Use of PKD2 inhibitors as sole agents in treatment of diseases that are treated by Type I IFN is envisioned. In addition, these agents can be used in treatment of such diseases in combination with Type I IFN in order to (i) increase its efficacy (ii) decrease the dose and related development of anti-IFN antibody-dependent resistance and side effects, as well as decrease the costs and duration of treatment. Use of selective PKD2 inhibitors allows for the specific augmentation of the efficacy of Type I IFN and to be used not only against cancers but also against viral infections and autoimmune diseases.
One example is depicted in Figures 37 and 38. Figures 37 and 38 depict the results of example experiments demonstrating that sangivamycin inhibits PKD2 and increases the efficiency of IFN signaling.
Example 4: Role of protein kinase D2 proteolytic elimination of interferon alpha receptor
Extracellular ligands induce signaling pathways that mediate their functions but also limit them by the proteolytic elimination of cognate receptors. As disclosed herein, protein kinase D2 (PKD2) controls the ligand-inducible phosphorylation-dependent ubiquitination and degradation of the IFNARl chain of the Type I interferon (IFN) receptor. IFN-α induces PKD2 in a Tyk2-activity-and tyrosine phosphorylation-dependent manner. Activated PKD2 directly phosphorylates key serine residues within the degron of IFNARl leading to recruitment of the β-Trcp-based E3 ubiquitin ligase, and ubiquitination and degradation of IFNARl . Inhibition or knockdown of PKD2 augments IFN-α signaling and anti-viral defenses. PKD2-mediated phosphorylation and ubiquitination of IFNARl is also induced by vascular endothelial growth factor (VEGF); the ability of VEGF to induce efficient angiogenesis depends on IFNARl degradation. The mechanisms of ligand-inducible elimination of IFNARl and utilization of these mechanisms by other stimuli to counteract the biological functions of Type I IFN are disclosed along with potential medical significance of this regulation.
As disclosed herein, protein kinase D2 (PKD2) is a Type T IFN-inducible kinase that can be activated via tyrosine phosphorylation and, in turn, is capable of phosphorylating the serines within the degron of IFNARl . PKD2 expression and activity are important for regulating ubiquitination and degradation of IFNARl and for control of the extent of IFN-α signaling and anti-viral defenses. The data suggest that this mode of regulation could be commandeered by some inducers of unrelated signaling pathways capable of activating PKD2 such as vascular endothelial growth factor (VEGF). VEGF promotes IFNARl phosphorylation and accelerates IFNARl proteolytic turnover, which is required for efficient angiogenesis.
The Materials and Methods used in the experiments presented in this Example are now described.
Plasmids, cells and viruses
Vectors for mammalian expression of Flag-IFNARl and bacterial expression of GST-IFNARl (Kumar et al., 2003, Embo J 22:5480-5490), β-Trcp2/HOS (Fuchs et al., 1999, Oncogene 18:2039-2046), and HA-tagged Tyk2 (Yan et al., 1996, MoI Cell Biol 16:2074-2082), as well as the 5xtSRE-luciferase reporter (Parisien et al., 2002, J Virol 76:4190-4198)) have been described elsewhere. Vectors for mammalian expression of human GST-tagged PKD 1-3 species (wild type or kinase-dead mutants) have been described elsewhere (Yeaman et al., 2004, Nat Cell Biol 6: 106-1 12). Silent mutations, as well as replacement of Y438 with tyrosine were generated by site-directed mutagenesis. SiRNA and shRNA reagents were purchased from Sigma and Qiagen.
Human embryo kidney 293T cells and epithelial HeLa cells were maintained and transfected as described elsewhere (Liu et al., 2009, Cell Host Microbe 5(l):72-83). Human fibrosarcoma 21TGH cells and their Stat 1 -deficient U3A derivatives (McKendry et al., 1991, Proc Natl Acad Sci U S A 88: 1 1455-1 1459) or Tyk2-deficient 1 1.1 derivatives (reconstituted with wild type or kinases dead Tyk2 have been described elsewhere (Gauzzi et al., 1997, Proc Natl Acad Sci USA 94: 1 1839-1 1844). The anti-viral effect of IFN-α against VSV was determined as described elsewhere (Sharma et al., 2003, Science 300: 1 148-1 151).
Phosphorylation-binding and kinase assays
For some binding assays, the lysates from 293T cells (treated for various times with IFN-α, 2000 ILVmL) were depleted of CKl α (as described previously (Liu, et al., 2009, MoI Cell Biol 29(24):6401-12) were incubated with GST-IFNARl proteins (wild type or S535,539A mutant that migrates slower on SDS-PAGE due to the presence of four additional amino acids in the linker), ATP and kinase inhibitors (as indicated) for 30 min at 300C. After that, GST-IFNARl were purified and incubated with in vitro translated and 35S-methionine-labeled β-Trcp2 for 1 h at 4°C; this binding was later analyzed by autoradiography and Coomassie staining. In vitro serine phosphorylation of GST-IFNARl (analyzed by autoradiography or IB with pS535 antibody) by cell extracts or PKD preparations and tyrosine phosphorylation of GST-PKD2 by Tyk2 was carried out and analyzed as described elsewhere herein.
For other binding assays, the Iysates from 293T cells (treated for various times with IFN-α, 2000 IU/mL) underwent two rounds of immunodepletion of CKl α as described elsewhere (Liu, et al., 2009, MoI Cell Biol 29(24):6401 -12). GST-IFNARl proteins (wild type or S535,539A mutant that migrates slower on SDS-PAGE due to the presence of four additional amino acids in the linker (Liu et al., 2009, Cell Host Microbe 5(l):72-83)) were expressed and purified from bacterial cells using glutathione Sepharose. Purified bacterial proteins (2 μg) were incubated in the presence of CKl α- depleted cell Iysates (5 μg), unlabeled ATP (0.5mM) in total volume of 20 μL (containing 25mM Tris-HCL pH 7.5, 5mM MgC12, 10OmM KCl, ImM EGTA, ImM Na3VO4, 0.1 mM DTT and 3.5% glycerol) for 30 min at 3O0C. When indicated, the following kinase inhibitors were added to the reaction in 1 μL of DMSO to the final concentration indicated: H89 (200 nM), BAY43-9006 (50 nM), Bis-I (25 nM), Go6976 (25 nM), LY294002 (1.5 μM), SP600125 (100 nM), D4476 (400 nM), SB203580 (100 nM). The reactions were stopped by placing the tubes on ice and adding 150 μL of ice- cold binding buffer (PBS supplemented with 0.1 % NP40 and 50 mM NaF) and incubated with glutathione Sepharose beads (20 μL) for 2 h at 4°C. The beads were then washed three times with 0.5 mL of binding buffer and incubated with 2 μL of in vitro translated and 35S-methionine-labeled β-Trcp2 for 1 h at 4°C. Beads were then washed three times with 1 mL of binding buffer, and the proteins were eluted using Laemmli buffer, resolved by SDS-PAGE, and analyzed by autoradiography and Coomassie staining.
In vitro phosphorylation of GST-IFNARl by cell extracts or PKD preparations (via immunopurification or GST pulldown) was carried out in kinase buffer (50 mM Tris-HCI pH 7.4, 10 mM MgCI2, and 2 mM DTT) with either 0.2 mM of unlabeled ATP or 10 μCi of γ-32P ATP for 20 min at 3O0C. The products of this reaction were separated by SDS-PAGE and analyzed either by immunoblotting using anti-pS535 antibody or by autoradiography.
In vitro phosphorylation of PKD2 (purified from HeLa cells) by HA- tagged Tyk2 immunopurified from 293T cells (untreated or treated with IFN-α) or by recombinant Src (purchased from Cell Signaling) was carried out in the total volume of 20 μL in 50 mM MOPS pH 7.4, 10 mM MgC12, 5 mM MnC12, 2 mM DTT, and 0.2 mM ATP at 30°C for 20 min. The samples were resolved by SDS-PAGE and analyzed by immunoblotting with an anti-phospho-tyrosine antibody (4Gl 0).
Animals
Mice with a S526A substitution within IFNARl were generated using previously characterized ES cells carrying the mutation (Liu et al., 2009, Cell Host Microbe 5(l):72-83). ES cells were transduced with Cre-expressing vector to excise the Neo cassette, re-selected and used to generate germline chimeras, which were then crossed with C57/BL6 females to obtain heterozygotes. These clones were microinjected into albino C57/BL6 blastocysts to generate germline chimeras, which were then crossed with C57/BL6 females to obtain heterozygotes. Genotypes of the mice were determined by analyzing DNA with primers annealing to IFNARl sequences that would flank the removed neomycin cassette of the mutant allele and that of mutation site. The latter were sequenced to confirm a Ser526 to Ala substitution. Animals were maintained in a specific pathogen-free environment and tested negative for pathogens in routine screening. Matrigel Plug assay (Medhora et al., 2003, Am J Physiol Heart Circ Physiol 284:H215- 224) and CD31 immunohistochemistry (Chiodoni et al., 2006, J Exp Med 203:2441 - 2450) was carried out as described elsewhere.
Plasmids, oligos, cells and gene transfer
Vectors for mammalian expression of Flag-IFNARl and bacterial expression of GST-IFNARl (Kumar et al., 2003, Embo J 22:5480-5490), β-Trcp2/HOS (Fuchs et al., 1999, Oncogene 1 8:2039-2046), and HA-tagged Tyk2 (Yan et al., 1996, MoI Cell Biol 16:2074-2082), as well as the 5xISRE-luciferase reporter (Parisien et al., 2002, J Virol 76:4190-4198) have been described elsewhere. Vectors for mammalian expression of human GST-tagged PKD 1-3 species (wild type or kinase-dead mutants) have been described elsewhere (Yeaman et al., 2004, Nat Cell Biol 6: 106-1 12). Silent mutations, as well as replacement of Y438 with tyrosine were generated by site-directed mutagenesis. All resulting mutants were verified by dideoxy sequencing. ShRNA against PKD2 constructs based on pLKO.1 -puro were purchased from Sigma (MISSION shRNA, SHGLY-NMJ) 16457). Control shRNA and siRNA were targeted against GFP (Jin et al., 2003, Genes Dev 17:3062-3074) and luciferase (Kumar et al., 2003, Embo J 22:5480- 5490), respectively. SiRNA oligos including siPKD l (Hs_PRKCM_2_HP Validated siRNA, SI00301350), siPKD2 (Hs_PRKD2_5_HP Validated siRNA, S102224768), siPKD3 (Hs_PRKCNJ_HP Validated siRNA, SI00301357) were purchased from
QIAGEN and transfected into cel ls using the HiPerFect transfection reagent (QIAGEN).
Human embryo kidney 293T cells and epithelial HeLa cells were maintained and transfected as described elsewhere (Liu et al., 2009, Cell Host Microbe 5:72-83). Human fibrosarcoma 2fTGH cells and their Stat 1 -deficient U3A derivatives (McKendry et al., 1991 , Proc Natl Acad Sci U S A 88: 1 1455- 1 1459) or Tyk2-deficient 1 1.1 derivatives (reconstituted with wild type or kinases dead Tyk2 have been described elsewhere (Gauzzi et al., 1997, Proc Natl Acad Sci USA 94: 1 1839-1 1844). All these cells were maintained in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% (v/v) fetal bovine serum (Hyclone). 1 1. 1-derivatives also received G418 (400 μg/ml). Human umbilical vein endothelial cells were a gift. These cel ls were maintained in Vasculife endothelial cell culture medium (LIFELINE Cell Technology, Inc). Transient transfections of 293T cells or 2fTGH and their derivatives using LIPOfectamine Plus (Invitrogen) and of HeLa cells using LIPOfectamine-2000 (Invitrogen) were carried out according to manufacturer's recommendations. For stable transfection, replication-deficient lentiviral particles encoding shRNA against PKD2 or vector control were prepared via co-transfecting 293T cells with three other helper vectors as described previously (Dull et al., 1998, J Virol 72:8463-8471). Viral supernatants were concentrated by PEG8000 precipitation and used to infect HeLa cells or 2fTGH cells in the presence of polybrene (3 μg/mL, Sigma). Cells were selected and maintained in the presence of puromycin (2 μg/mL). Chemicals, antibodies and immunotechniques
Immunoprecipitation and immunoblotting procedures are described elsewhere (Fuchs et al, 1999, Oncogene 18:2039-2046). Protein degradation was carried out by cycloheximide (CHX, used at 20 μg/ml) chase. IFNARl internalization assay was carried out using the Fluorescence-based assay as described elsewhere (Kumar et a]., 2007, J Cell Biol 179:935-950). BAY 43-9006 was obtained as a gift. Recombinant human IFN-α2 (Roferon) was purchased from Roche. Other reagents or inhibitors were purchased from commercial vendors.
Antibodies against Flag, GST and β-actin (Sigma), HA (12CA, Roche), CKlα, PKD1/2 (PKCμ), PKD3 (PKCv), Tyk2, intracellular domain of hlFNARl and PKR, (Santa Cruz), anti-pan-phospho-tyrosine (4G 10), phospho-Statl and Statl (Cell signaling), phospho-S710 of PKD2 (Biosource), PKD2 (Bethyl Laboratories), mIFNARl (Leinco) and ubiquitin (FK2, Biomol) were purchased. AA3, GB8 and EAl 2 antibodies which recognize endogenous IFNARl (Goldman et al., 1999) and antibodies against IFNARl phosphorylated on Ser535 (pS535; (Kumar et al., 2004, J Biol Chem
279:46614-46620)) were described previously. Secondary antibodies conjugated to horseradish peroxidase were purchased from Chemicon and LI-COR. Immunoprecipitation and immunoblotting procedures are described elsewhere (Fuchs et al, 1999, Oncogene 18:2039-2046). Protein degradation was carried out by cycloheximide (CHX) chase in the presence of CHX (20 μg/ml). Immunoblot detection and quantification were carried out using the LI-COR's Odyssey Infrared Imaging System.
IFNARl internalization assay was carried out using the fluorescence- based assay that determines the internalization of IFNARl by measuring the loss of cell- surface immunoreactivity of endogenous receptor using AA3 antibody as described elsewhere (Kumar et al., 2007, J Cell Biol 179:935-950). The same antibody in combination with anti-mouse-biotin (Jackson Laboratory) and streptavidin-PE (e- Bioscience) was used for analysis of cell surface human IFNARl levels using the FACSCalibur flow cytometer (BD Pharmingen). Levels of mIFNARl were determined using an anti-mlFNARl antibody (Leinco). Recombinant human IFN-α2 (Roferon) was purchased from Roche. Thapsigargin, cycloheximide, TPA and methylamine HCL were purchased from Sigma. H89, Bisindolylmaleimide (Bis-I), G56976, SP600125, SB203580, LY294002 and D4476 were from Calbiochem. BAY 43-9006 was a kind gift of M. Herlyn, Recombinant human VEGF (293-VE) and mouse VEGF (493-MV) used at 100 ng/ml were purchased from R&D Systems. CID755673 was purchased from TOCRIS Bioscience.
Virus and Viral Infection
The anti-viral effect of IFN-α was assessed by pre-treating cells overnight prior to infection with VSV (Indiana serotype, propagated in HeLa cells) at a MOI of 0.1 for 1 h. After removing the virus inoculums, cells were then fed with fresh medium and incubated for 20 h. Culture supernatant was harvested and viral titer was determined in HeLa cells overlaid with methylcellulose as described elsewhere (Sharma et al., 2003, Science 300: 1 148-1 151) and plaque-forming units (pfu/mL) calculated. Cells were observed to determine the cytopathic effect, and expression of VSV-M protein was analyzed by immunoblotting.
In Vivo Matrigel Plug Assay
Matrigel Plug assay was carried out essentially as described (Medhora et al., 2003, Am J Physiol Heart Circ Physiol 284:H215-224). Briefly, WT/WT and heterozygous S526A WT/SA mice (6-9 weeks old, n=5 per group) were injected subcutaneously with 0.6 mL of Matrigel that was premixed with vehicle or 100 ng of mouse VEGF. After 7 days, Matrigel plugs were harvested from underneath the skin. The plugs were homogenized in 1 ml deionized water on ice and hemoglobin was measured by the Drabkin method with Drabkin's reagent kit 525 (Sigma) to quantify blood vessel formation according to the manufacturer's protocol. The absorbance was read at 540 nm. To identify of infiltrating endothelial cells, immunohistochemistry was carried out using an anti-CD31 antibody as described elsewhere (Chiodoni, et al., 2006, J Exp Med 203 :2441-2450).
The results of the experiments presented in this Example are now described. PKD2 mediates ligand-inducible phosphorylation, ubiquitination and degradation of IFNARl .
Recognition of IFNARl or the prolactin receptor by β-Trcp2 was dependent on the phosphorylation of specific receptor serine residues. This phosphorylation could be indirectly assessed in vitro by using cell lysates as a source of protein kinase, receptor-derived synthetic peptide or bacterial ly-expressed intracellular domain of a receptor as a substrate, and subsequent interaction with radio-labeled β- Trcp2 as the mode of detection (Kumar et al., 2003, Embo J 22:5480-5490; Li et al., 2004, MoI Cell Biol 24, 4038-4048). Whereas somewhat stronger binding of β-Trcp2 to IFNARl was seen when the lysates were prepared from IFN-α-treated cells, preparations from untreated cells also contained a robust basal kinase activity (Kumar et al., 2003, Embo J 22:5480-5490). This activity that often masked the effects of the ligand treatment was linked to the ligand-independent pathway of IFNARl degradation (Liu et al., 2008, Biochem Biophys Res Commun 367:388-393). Follow up studies have identified CKl α as a major source of this activity; knockdown of CK lα in cells or immunodepletion of CK l α from the lysates abolished basal phosphorylation of the IFNARl degron (Liu, et al., 2009, MoI Cell Biol 29(24):6401-12). Using CK lα-immunodepleted lysates in the phosphorylation-binding assay, it was observed that pre-treatment of cells with IFN-α increased the efficacy of binding of β-Trcp2 to GST-IFNARl WT but not to its S535,
539A mutant (Figure 39A). This result is suggestive of the existence of a ligand-inducible serine kinase activity that mediates phosphorylation-dependent recruitment of β-Trcp2 to IFNARl .
Known serine kinases that could be activated by IFN includes the members of the protein kinase C family, PKA, PI-3K-Akt-IKK, and MAPK (JNK, p38, Erk and their downstream kinases; reviewed in (Du et al., 2007, J Cell Biochem 102: 1087-1094; Larner et al., 1996, Biotherapy 8: 175-181 ; Platanias, 2005, Nat Rev Immunol 5:375-386). Various pharmacologic kinase inhibitors (whose activity was verified in kinase-specific assays) were added in vitro to the phosphorylation-binding assay. As seen from Figure 39B, the recruitment of β-Trcp2 was not inhibited by inhibitors of PI-3K (LY294002) or JNK (SP600125) or c-Raf (BAY 43-9006) or p38 (SB203580). In contrast, a noticeable inhibition was observed when inhibitors of PKA (H89) or CKl (D4476) were used. Intriguingly, two inhibitors of PKC produced the opposite results. Whereas a dramatic inhibition was achieved using Gό6976 composition, a pan-PKC inhibitor bisindolylmaleimide I(Bis I) did not affect β-Trcp2 recruitment (Figure 39B).
These latter two inhibitors were used to pre-treat human U3A cells stably expressing Flag-lFNARl and Ser535 phosphorylation of immunopurified receptor was assessed. Neither composition impaired the basal degron phosphorylation, which occurs independently of ligand presence and Jak activity (Liu et al., 2008, Biochem Biophys Res Commun 367:388-393). However, pre-treatment with Gδ6976 (but not with Bis I) noticeably decreased the induction of Ser535 phosphorylation by IFN-α (Figure 39C). Similar effects of Gό6976 were seen when ligand-induced Ser535 phosphorylation of endogenous IFNARl in 293T cells was examined (Figure 39D). Given the lack of effect of Bis I, it is plausible that G56976 interferes with ligand-inducible IFNARl degron kinase activity that might be different from PKC.
Go6976 was indeed shown to inhibit other kinases including protein kinase D (PKD, (Gschwendt et a!., 1996)). PKD represents a family of serine/threonine protein kinases that is comprised of three members (PKD l/PKCμ, PKD2 and PKD3/PKCv). These kinases are responsive to activation by numerous stimuli including the phorbol esters and oxidative radicals (reviewed in (Rozengurt et al., 2005, J Biol Chem 280: 13205-13208; Rykx et al., 2003, FEBS Lett 546:81-86; Wang, 2006, Trends Pharmacol Sci 27:317-323)). It was then investigated whether PKD may play a role in ligand-inducible degron phosphorylation of IFNARl . To this end, a recently identified benzoxoloazepinolone (CID755673) shown to exhibit high specificity against PKD in vitro and in cells (Sharlow et al., 2008, J Biol Chem 283:33516-33526) was used. Pre- treatment of 293T cells with this composition led to a significant inhibition of Ser535 phosphorylation of endogenous IFNARl in response to IFN-α (Figure 39E). These data implicate PKD in regulating the ligand-stimulated phosphorylation of IFNARl 's degron. Next an RNAi approach was used to determine the putative role of various PKD isoforms. In human epithelial HeLa cells that do not express PKDl (Bossard et al., 2007, J Cell Biol 179: 1123-1 131), siRNA specific against PKD2 (but not PKDl or PKD3) markedly inhibited IFN-α-stimulated IFNARl phosphorylation on Ser535 (Figure 40A). Similar data were obtained on exogenous Flag-IFNARl stably expressed in U3A human fibrosarcoma cells (Figure 40B). In 293T cells that express both PKDl and PKD2, a specific and efficient knock-down of PKD l did not influence IFNARl degron phosphorylation (Figure 46). These results strongly suggest that PKD2 is important for the ligand-inducible phosphorylation of the IFNARl degron, whereas the role of other PKD forms remain to be proven.
GST-tagged PKD2 expressed in 293T cells and purified by pull down with glutathione beads was capable of directly phosphorylating bacterially produced GST- IFNARl on Ser535 in vitro. Intriguingly, this outcome was not seen when either PKD 1 or PKD3 were used as a source of kinase (Figure 40C) despite comparable activity of all three kinases in an autophosphorylation assay or phosphorylation of an artificial substrate, myelinic basic protein (Figure 47). Ser535 phosphorylation on GST-IFNAR 1 incubated with ATP and GST-PKD2 was not evident when a catalytically deficient (kinase-dead, KD) K580N mutant was used in the reaction (Figure 4OD, lane 3 vs 7). Furthermore, adding the PKD inhibitor Go6976 to this reaction decreased the efficacy of IFNARl phosphorylation in a dose dependent manner (Figure 4OD, lanes 3-6). These results collectively suggest that PKD2 is a direct Ser535 kinase of IFNARl .
Knockdown of PKD2 inhibited phosphorylation of the IFNARl degron in response to IFN-α, but not to thapsigargin, and inducer of the unfolded protein response (UPR) (Figure 40E). Thapsigargin and other inducers of UPR, including forced expression of IFNARl -stimulated Ser535 phosphorylation and IFNARl ubiquitination, act in a ligand-and Jak-independent manner (Liu et al., 2009, Cell Host Microbe 5(1):72- 83; Liu et al., 2008, Biochem Biophys Res Commun 367:388-393). Accordingly, careful examination of Figures 39C and 4OB also reveals that neither the PKD inhibitor Gό6976 nor siRNA against PKD2 decreases the levels of basal Ser535 phosphorylation of overexpressed IFNARl . These data suggest that the role of PKD2 in regulating phosphorylation of IFNARl 's degron might be limited to the ligand-inducible pathway. Given that IFN-α-induced Ser535 phosphorylation is required for ubiquitination, endocytosis, down regulation and degradation of IFNARl , it was investigated whether these events are mediated by PKD2. Knockdown of PKD2 in HeLa cells robustly inhibited IFN-α-induced ubiquitination of IFNARl (Figure 41A) and decreased the rate of internalization of this receptor (Figure 4 IB). Consistent with these data, ligand- stimulated downregulation of IFNARl on the cell surface (measured by FACS analysis) was noticeably impeded in cells expressing shRNA against PKD2 (Figure 41 C). Treatment of HeLa cells with the PKD inhibitor CID755673 resulted in an appreciable decrease in the rate of proteolytic turnover of IFNARl (Figure 41 D). Furthermore, ligand-stimulated degradation of IFNARl was noticeably impaired in cells that received shRNA against PKD2 (Figure 41E). In all, these results suggest that PKD2 plays an important role in the ligand-inducible ubiquitination, endocytosis, and degradation of IFNARl .
PKD2 is activated in response to IFNa in a Tyk2-dependent manner
It was next assessed whether IFN-α-induced signaling stimulates phosphorylation of IFNARl on Ser535 by PKD2. Interaction between endogenous IFNARl and PKD2 in untreated 293T cells was demonstrated using co- immunoprecipitation reactions (Figure 48). An increase in this interaction upon treating cells with IFN-α was also observed (Figure 42A). Intriguingly, neither basal nor IFN- inducible interaction between the receptor and PKDl was detected (Figures 48 and 42A). These data suggest that PKD2 is specifically recruited to IFNARl and that this recruitment is stimulated by ligand treatment.
Phosphorylation of GST-PKD2 expressed in HeLa cells on Ser710 (indicative of PKD2 activation (Sturany et al., 2002, J Biol Chem 277:29431-29436)) was stimulated upon treating the cells with IFN-α (Figure 42B). Comparable results were obtained when endogenous PKD2 was analyzed (Figure 42C). Furthermore, treatment of cells with IFN-α increased activity of endogenous PKD2 assessed by an immunokinase assay with GST-IFNARl as a substrate (Figure 42D). These results collectively suggest that catalytic activity of PKD2 is stimulated as a result of signaling events triggered by the ligand.
Ligand-inducible phosphorylation of the IFNARl degron depends on the kinase activity of Tyk2. Indeed, this phosphorylation was observed in 1 1. l-Tyk2-null human cells reconstituted with wild type Tyk2 but not with catalytically inactive Tyk2KR mutant (Marijanovic et al., 2006, Biochem J 397:31-38) and Figure 49). Remarkably, IFN-α treatment activated GST-PKD2 (as assessed by its ability to phosphorylate GST- IFNARl on Ser535 in vitro) in 1 l . l-Tyk2WT but not in 1 l .l-Tyk2KR cells (Figure 43A). Importantly, status of Tyk2 had no bearing on the basal activity of expressed PKD2. This result suggests that activation of PKD2 in ligand-treated cells requires the tyrosine kinase activity of Tyk2. Furthermore, treatment of HeLa cells with IFN-α noticeably stimulated phosphorylation of endogenous PKD2 on Tyr residues (Figure 43B). Considering that Tyk2 is tightly associated with IFNARl (Platanias, 2005, Nat Rev Immunol 5:375-386) and increasing amounts of PKD2 are recruited to the vicinity of IFNARl (Figure 42A), it was proposed that Tyk2 induced by IFN-α might activate PKD2 via direct phosphorylation on tyrosines.
To test this hypothesis, HA-tagged Tyk2 was expressed and immunopurified from cells (treated or not with IFN-α) and then incubated with recombinant bacterially produced PKD2 in the presence of ATP. The reaction was analyzed by immunoblotting using an anti-phospho-Tyr antibody. In this assay, tyrosine phosphorylation of PKD2 was easily detected when recombinant Src protein was used as positive control (Figure 43C, lane 6). In the presence of HA-Tyk2, a noticeable tyrosine phosphorylation signal on PKD2 was also observed in an ATP-dependent manner (Figure 43C, compare lanes 2 and 4). A robust increase in Tyr phosphorylation of PKD2 was seen when HA-Tyk2 was purified from IFN-α-treated cells (Figure 43C, lanes 4-5) indicating that ligand-stimulated Tyk2 is capable of directly phosphorylating PKD2. Two non-exclusive mechanisms have been proposed for activation of PKDl via relieving an autoinhibitory effect of its PH domain. One is a phosphorylation of the activation loop of PKD on S744/S748 (Sinnett-Smith et al., 2009, J Biol Chem 284: 13434-13445; Waldron et al., 2003, J Biol Chem 278: 154-163); another is a tyrosine phosphorylation of Y463 stimulated by Src (Storz et al., 2003, Embo J 22: 109-120). A homologous tyrosine residue, Y438 was found on PKD2 and proposed to play a role in modulating its activity (Mihailovic et al., 2004, Cancer Res 64:8939-8944). It was next investigated whether the role of this site in IFN-α-induced PKD2 activation and IFNARl phosphorylation. Basal Ser535-phosphorylating activity of GST-PKD2Y438F mutant expressed in HeLa cells was similar to that of wild type enzyme. However, activation of this mutant kinase in response to IFN-α treatment was visibly impaired (Figure 43D).
This result suggests that phosphorylation of Y438 might be required for stimulation of PKD2 activity by IFN-α. To further test this possibility, GST-PKD2 expression constructs (depicted as GST-PKD2*) were generated that contained silent mutations making them insensitive to shPKD2 that were used for kinase knockdown. HeLa cells were stably transduced with control shRNA or shPKD2 and with empty vector or GST-PKD2* constructs (wild type or Y438 mutant). Consistent with data shown in Figure 4OB, knockdown of endogenous PKD2 impeded IFN-α-induced phosphorylation of IFNARl on Ser535 (Figure 43E, lane 2 vs. lane 4). Whereas re- expression of wild type PKD2 distinctly restored this phosphorylation to some extent, such an effect was not observed when PKD2 was mutated at Y438 (Figure 43E, lane 6 vs. 8). These results collectively suggest that ligand-induced phosphorylation of this Tyr residue within PKD2 is required for PKD2-mediated phosphorylation of the IFNARl degron.
Ligand-induced PKD2-mediated down regulation of IFNARl restricts the extent of cellular responses to IFN-α
It was next investigated whether PKD2-mediated ubiquitination and degradation of IFNARl contributes to the regulation of cellular responses to Type I IFN.
Pulse treatment of HeLa cells with IFN-α led to a robust activation of Statl (assessed by its tyrosine phosphorylation) that peaked at 15-30 min and declined during the next hour.
A brief pre-treatment of cells with PKD inhibitor CID755673 noticeably prolonged ligand-induced phosphorylation of Statl (Figure 44A). Similarly, knocking down PKD2 in HeLa cells resulted in a more robust and prolonged Statl activation (Figure 44B).
These results suggest that PKD2 contributes to the regulation of the magnitude and duration of IFN-α signaling.
To evaluate the role of PKD2 in Type I IFN-induced transcription and anti-viral effects human fibrosarcoma 2fTGH cells were used that are highly sensitive to IFN-α/β (McKendry et al., 1991, Proc Natl Acad Sci USA 88: 1 1455-1 1459) and, unlike
HeLa cells, do not harbor human papillomavirus genes. Upon pulse treatment of these cells with IFN-α for 1-2 h, the ratio in activity of the firefly luciferase reporter driven by an IFN-stimulated response element (ISRE) to CMV-driven renilla luciferase was noticeably increased. Pre-treatment of cells with the PKD inhibitor CID755673 robustly augmented this transcriptional activity (Figure 44C). Consistent with this result, ligand- induced ISRE-driven luciferase activity was much higher in cells where PKD2 was knocked out (Figure 44D). Furthermore, cells that harbored shRNA against PKD2 exhibited a noticeably higher expression of the products of interferon-stimulated genes such as PKR and Statl (Figure 44E).
Knock down of PKD2 in 2fTGH cells resulted in an approximately 20- 25% lesser viral titer upon infection with vesicular stomatitis virus (VSV) (Figure 44F); most likely in lieu of a well characterized role of PKD in viral protein transport along the secretory pathway (Jamora et al., 1999, Cell 98:59-68). Remarkably, pre-treatment of PKD2 knockdown cells with low doses of IFN-α led to a much more robust protection against infection with VSV as evident from the assessment of viral titer (Figure 44F), or cytopathogenic effects of VSV (Figure 50). These data together suggest that PKD2 plays an important role in regulating the cellular responses to Type I IFN including the induction of anti-viral defenses.
Phosphorylation-dependent downregulation of IFNARl by VEGF is required for efficient angiogenesis.
Numerous extracellular stimuli have been reported to activate PKD family kinases (reviewed in (Rozengurt et al., 2005, J Biol Chem 280:13205-13208; Rykx et al., 2003, FEBS Lett 546:81 -86; Wang, 2006, Trends Pharmacol Sci 27:317-323)). It was investigated whether other signaling pathways capable of activating PKD2 may affect IFNARl stability and signaling. Treatment of HeLa cells with known PKD inducers such as phorbol esters or hydrogen peroxide noticeably stimulated phosphorylation of endogenous IFNARl on Ser535 even in the absence of IFN-α (Figure 51 ). It was next tested the effects of VEGF (shown to induce PKD via a tyrosine phosphorylation- dependent mechanism (Qin et al., 2006, J Biol Chem 281 :32550-32558; Wong et al., 2005, J Biol Chem 280:33262-33269)) on recombinant Flag-IFNARl stably expressed 2fTGH-derived U3A cells that do not express PKDl (Figure 40B). These cells responded to VEGF treatment by activation of both Erk and PKD2 and by an increased phosphorylation of Flag-IFNARl on Ser535 (Figure 45A). The latter event was apparently PKD2-dependent as evident from analysis of cells that received shRNA against PKD2 (Figure 45B). These results suggest that other signaling pathways capable of activating PKD2 may appropriate this kinase to target IFNAR 1 for phosphorylation of its degron. Given that Type I IFNs are known to inhibit angiogenesis (Sidky et al., 1987, Cancer Res 47:5155-5161), a process that involves proliferation and migration of endothelial cells induced by VEGF (reviewed in (Ferrara, 2004, Endocr Rev 25:581 -61 1 ; Ho et a!., 2007, Int J Biochem Cell Biol 39:1349- 1357)), it was hypothesized that VEGF- stimulated IFNARl Ser535 phosphorylation might be of functional importance. lmmunoblotting analysis of Flag-IFNARl immunopurified from U3A- Flag-IFNARl cells using an anti-ubiquitin antibody revealed that ubiquitination of IFNARl was stimulated by VEGF treatment (Figure 45A). Consistently, VEGF accelerated the proteolytic turnover of Flag-IFNARl in U3A cells (Figure 45C). A similar outcome was observed for the endogenous IFNARl in human umbilical vein endothelial cells (Figure 52). Furthermore, VEGF treatment of these cells noticeably inhibits Statl phosphorylation in response to IFN-α (Figure 45D). These results suggest that VEGF promotes IFNARl degradation and limits the extent of lFN-α signaling.
VEGF stimulates numerous signaling pathways that confer its ability to promote angiogenesis (Ferrara, 2004, Endocr Rev 25:581-61 1 ; Kowanetz et al., 2006, Clin Cancer Res 12:5018-5022). It was investigated whether phosphorylation-dependent degradation of IFNARl may contribute to this function of VEGF. In order to test this possibility one may either modulate PKD2 kinase activity/expression or alter the availability of the degron's phospho-acceptor site within IFlMARl . Remarkably, a recently published report has already demonstrated that PKD2 activation is crucial for VEGF-stimulated growth and migration of endothelial cell, as well as angiogenesis per se (Hao et al, 2009, J Biol Chem 284:799-806). Given that VEGF-activated PKD2 may mediate these biological outcomes via phosphorylating diverse substrates, another approach that focuses on altering IFNARl itself was warranted to determine the role of PKD2-mediated IFNARl phosphorylation.
- I l l - Mouse ES cells, in which one wild Type Ifnarl allele has been replaced with the mutant that lacks Ser526, a serine residue homologous to Ser535 within human IFNARl (described in (Liu et al., 2009, Cell Host Microbe 5(l):72-83)) were subjected to expression of Cre recombinase to get rid of the Neo cassette, and then used to generate knock-in mice that express the mIFNARlS526A mutant ("SA", Figure 53). Bone marrow-derived CD31 -positive cells from wild type mice displayed a noticeable decrease in the cell surface levels of IFNARl upon treatment with murine VEGF (Figure 45E). This effect was much less pronounced in the heterozygous mice ("WT/SA") indicating that phosphorylation of the degron of IFNARl is required for downregulation of IFNARl in response to VEGF.
The formation of new vessels stimulated by VEGF in vivo was assessed using a matrigel plug assay. Visual examination of retrieved plugs revealed that mice that carry one allele of the S526A mutant of mIFNARl were less responsive to VEGF- stimulated angiogenesis (Figure 45F). This observation was independently supported by immunohistochemicala analysis of CD31 -positive cells within the paraffin-embedded plugs as well as by a quantitative analysis of the hemoglobin content in the extracts from the matrigel plugs (Figure 45F). These data suggest that phosphorylation-dependent downregulation of IFNARl plays an important role in VEGF-stimulated angiogenesis.
PKD2 is a ligand-inducible regulator of IFNARl stability
Ligand-stimulated lysosomal degradation of IFNARl plays an important role in limiting the magnitude and duration of Type I IFN signaling. Previous studies demonstrated that this degradation is mediated by IFNARl ubiquitination (Kumar et al., 2007, J Cell Biol 179:935-950), which is facilitated by the SCFβTrcp E3 ubiquitin ligase. This ligase is recruited to the receptor upon phosphorylation of its degron (Kumar et al., 2004, J Biol Chem 279:46614-46620; Kumar et al., 2003, Embo J 22:5480-5490). Unlike ligand-independent phosphorylation, ubiquitination and degradation of IFNARl (Liu et al., 2008, Biochem Biophys Res Commun 367:388-393), the IFN-inducible events rely on Tyk2 kinase activity (Marijanovic et al., 2006, Biochem J 397:31-38). Given that Tyk2 is a tyrosine protein kinase that displays poor (if any) ability to phosphorylate serine residues (Barbieri et al., 1994, Eur J Biochem 223:427-435), the existence of a ligand-activated Tyk2-dependent serine kinase has been proposed (Kumar et ah, 2004, J Biol Chem 279:46614-46620; Marijanovic et ah, 2006, Biochem J 397:31-38).
As disclosed herein, (i) treatment of cells with inhibitors of PKD or specific knockdown of PKD2 attenuated phosphorylation of Ser535 of IFNARl in response to IFN-α but not to thapsigargin or IFNARl overexpression (Figures 39-40), (ii) purified PKD2 is capable of directly phosphorylating Ser535 (Figure 40), (iii) other known inducers of PKD such as phorbol esters or VEGF are capable of stimulating IFNARl phosphorylation (Figure 51 and 45A); and (iv) PKD2 expression is important for regulating IFNARl ubiquitination, endocytosis and degradation (Figure 41 ). Collectively, these data of pharmacologic, genetic and biochemical analyses indicate a novel and important function of previously discovered kinase, PKD2, as a bona fide IFNARl 's degron kinase that functions within the ligand-inducible pathway to enable the recruitment of βTrcp and mediate the proteolytic elimination of IFNARl .
Whereas there experiments disclosed here focused on PKD2, they do not entirely rule out a role of other members of the PKD family (e.g., PKDl and PKD3) in regulation of IFNARl phosphorylation and stability. However, it appears that some unique attributes of PKD2 enable its preferential recruitment to the vicinity of IFNARl and its ability to phosphorylate IFNARl on Ser535 (Figures 42A and 40C).
Example 5: Mammalian Casein Kinase Ia and Its Leishmanial Ortholog Regulate Stability of IFNARl and Type I Interferon Signaling
Phosphorylation of the degron of the IFNARl chain of the Type I interferon (IFN) receptor triggers ubiquitination and degradation of this receptor and, therefore, plays a crucial role in negative regulation of IFN-α/β signaling. Besides the IFN-stimulated and Jak activity-dependent pathways, a basal ligand-independent phosphorylation of IFNARl has been described and implicated in down-regulating IFNARl in response to virus-induced endoplasmic reticulum (ER) stress. Disclosed herein is the purification and characterization of casein kinase Ia (CK lα) as a bona fide major IFNARl kinase that confers basal turnover of IFNARl and cooperates with ER stress stimuli to mediate phosphorylation-dependent degradation of IFNARl . Activity of CK lα was required for phosphorylation and downregulation of IFNARl in response to ER stress and viral infection. While many forms of CK l were capable of phosphorylating IFNARl in vitro, human and L-CK l produced by the protozoan Leishmania major were also capable of increasing IFNARl degron phosphorylation in cells. Expression of leishmania CK l in mammalian cells stimulated the phosphorylation-dependent downregulation of IFNARl and attenuated its signaling. Infection of mammalian cells with L. major modestly decreased IFNARl levels and attenuated cellular responses to IFN-α in vitro.
Disclosed herein is the identification and characterization of casein kinase Ia (CKl α) as a major bona fide kinase of IFNARl that mediates basal phosphorylation, ubiquitination, and turnover of IFNARl . Experiments using genetic and pharmacological approaches further demonstrate the involvement of CKl α in ligand-independent degron phosphorylation and degradation of IFNARl stimulated by ER stress inducers, including VSV. Intriguingly, CKl activity secreted by Leishmania is also capable of phosphorylating the IFNARl degron. Expression of leishmanial CKl (LCK l) in mammalian cells downregulates IFNARl and attenuates IFN-α/β signaling in a phosphorylation-dependent manner. Together with previous observations with viral pathogens, these results highlight the involvement of members of the CK] family of kinases in the ligand-independent IFNARl degradation pathway, which plays a role in shaping the interaction between a mammalian host and infectious agents.
The Materials and Methods used in this Example are now described.
Purification of basal IFNARl kinase activity,
Basal IFNARl Ser535 kinase activity was measured in vitro using bacterially expressed glutathione S-transferase (GST)-IFNARl (1 μg) as a substrate, lysates from indicated cells (1 μg intact or 4 μg immunodepleted) as a source of kinase, and immunoblotting (IB) with anti-pS535 antibody as a method of detection, as described in detail elsewhere (Liu et al., 2009, Cell Host Microbe 5:72-83; Liu et al., 2008, Biochem. Biophys. Res. Commun. 367:388-393). Untreated HeLa cells were harvested, suspended in 10 mM Tris-HCl (pH 8.0), 10 mM KCl, 1.5 mM MgC12, 0.5 mM dithiothreitol, 0.2 mM EDTA, and a cocktail of protease inhibitors (suspension buffer), and lysed by passing through a 23-gauge needle. After centrifugation, the nuclear pellet was discarded and the supernatant was ultracentrifuged at 100,000 X g for 60 min. Following centrifugation, the supernatant was kept at 40C in buffers containing a cocktail of protease inhibitors. Approximately 90 ml of HeLa cell S lOO extract (-10 mg/ml) was precipitated with ammonium sulfate (50% to 60% saturation), and the pellet was redissolved, dialyzed, and applied onto a SP Sepharose (Amersham-Pharmacia) column and eluted with a linear gradient (100 to 2,000 mM NaCl) in buffer A containing 100 mM phosphate buffer, 50 mM KCI, 0.1 mM EDTA, and 10% glycerol. Fractions that contained Ser535 IFNARl kinase activity were pooled, concentrated, and further characterized by their ability to facilitate the incorporation of radioactive phosphate from 32P-labeled -y-ATP into the wild-type GST-IFNARl (GST-IFNARl WT) but not the GST-1IFNARI SSSSA mutant. Active fractions were applied onto a phosphocellulose column (Pl 1 ; Whatman) and eluted with a linear gradient (500 to 2,000 mM NaCl) in buffer B containing 20 mM Tris-HCl (pH 7.6), 100 mM KCl, 0.1 mM EDTA, and 10% glycerol. Active fractions were concentrated on a hydroxyappatite column (Bio-Rad), eluted stepwise using orthophosphate buffer, concentrated, and separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE). Five major bands (see Figure 54B, below) were excised and subjected to in-gel tryptic digestion followed by nano-electrospray ionization (ESI) liquid chromatography-mass spectrometry (MS) by using a Waters Q-ToF mass spectrometer with a Waters nanoAcquity UPLC apparatus. The resulting tandem MS (MS/MS) spectra of the peptides derived from one of the bands contained several peptides (including DIKPDNFLMGIGR (SEQ ID NO: 16), YASINAHLGIEQSR (SEQ ID NO: 17), TSLPWQGLK (SEQ ID NO: 18), KMSTPVEVLCK (SEQ ID NO: 19), and FEEAPD YMYLR (SEQ ID NO:20)) that were identified as derivatives of human CSNKlAl (CKlα).
Constructs for mammalian expression of IFNARl and bacterial expression of GST-IFNARl were previously described (Kumar et al., 2007, J. Cell Biol. 179:935- 950; Kumar et al., 2003, EMBO J. 22:5480-5490). The construct for bacterial expression of GST-CKlα (described in Chen et al., 2005, MoI. Cell. Biol. 25:6509-6520). Constructs for expression of human Myc-tagged CKl and shRNA vectors against CKlα or green fluorescent protein (GFP) were previously described (Shirogane et al., 2005, J. Biol. Chem. 280:26863-26872). Human CK lα and L-CKl cDNA (described in Allocco et al., 2006, Int. J. Parasitol. 36: 1249-1259) were subcloned into a pEF-BOS vector with a hemagglutinin (HA) tag. A point mutation of K40R in L-CKl was introduced via site- directed mutagenesis. Vaccinia virus Bl kinase and its kinase-dead mutant form (K149Q [KD]) expression constructs were previously described (Santos et al., 2004, Virology 328:254-265). Recombinant human IFN-a2a was purchased from Roche. Thapsigargin, cycloheximide, and D4476 were from Sigma. Murine IFN-(3 and human IFN-y were purchased from PBL. Small interfering RNA (siRNA) oligos against the luciferase gene (5'-CUUACGCU GAGUACUUCGAdTdT-31 (SEQ ID NO:21 )) or hCKl α (51- CCAGGCAUCCCCAGUUGCUd TdT-3' (SEQ ID NO:22)) were purchased from Dharmacon Inc. In some experiments, the siRNA oligos that contained several substitutions (underlined) of correct bases in siCKlα were used as another control (siCon#2, 5T-CCAGGCUAGGCCAGU UGCUdTdT-3' (SEQ ID NO:23)).
Cell culture, transfections, virus, and parasites.
All cells were maintained in Dulbecco's modified Eagle's medium supplemented with 10% (vol/vol) fetal bovine serum (FBS; HyClone) unless otherwise specified. Mouse bone marrow-derived macrophages from the C57/BL6 mice were obtained by cultivating bone marrow cell isolates in RPMI medium containing 10% FBS and 30% of the L929 cell supernatant (a source of macrophage colony-stimulating factor) for 7 days according to a standard protocol. Human peripheral blood monocytes were obtained from University of Pennsylvania Human Immunology Core, and derivation of dendritic cells was done according to a standard protocol (Sallusto et al., 1994, J. Exp. Med. 179: 1 109-1 1 18). A cell proliferation assay was carried out using the CellTiter 96 nonradioactive cell proliferation assay kit (catalog number G4001 ; Promega) according to the manufacturer's recommendations.
293T cells and HeLa cells were transfected with Lipofectamine Plus reagent and Lipofectamine 2000 reagent, respectively. VSV (Indiana serotype) was propagated in HeLa cells. L major (WHO MHOM/IL-1/80 Freidlin clone) was maintained in a log phase of growth in Schneider's growth medium containing 20% FBS. Viral and parasite infection of cultured cells.
HeLa or 2fTGH cells were inoculated with a multiplicity (MOI) of 0.1 of VSV for 1 h, washed, and added with fresh medium. At 12.5 h later, uninfected or infected cells were treated with D4476 or vehicle (dimethyl sulfoxide [DMSO]). Total cell lysates were harvested at different ensuing time points. For Leishmania infections, the macrophages were resuspended in 106 cells/ml and were infected with a 10-fold excess of L. major (50%) metacyclic in suspension culture for 4 h. Cells were subsequently washed two times to remove free parasites and further incubated as indicated.
Measurement of L. major-secreted kinase activity.
A total of 50 X 106 confluent L. major promastigotes were washed with buffer A (20 mM Tris-HCl, pH 7.4, 150 mM NaCl, 10 mM MgC12, 1 mM glucose, and 10 mM NaF). Cells were then resuspended in buffer A containing 50 μg/ml of GST- IFNARl at 3O0C for 20 min as described previously (Sacerdoti-Sierra et al., 1997, J. Biol. Chem. 272:30760-30765). The supernatant was collected, supplemented with 2 mM of ATP, and further incubated at 300C for 15 min. The substrate was captured by glutathione beads and analyzed in Western blot assay for phosphorylation at site Ser535.
Immunotechniques.
Antibodies against pSTATl and p-eIF2a (Cell Signaling), eIF2a (Biosources), CKIa (BD Pharmingen), STATl , Myc tag, HA tag, GST, CK l α (Santa Cruz), Flag tag, (3-actin (Sigma), and ubiquitin (clone FK2; Biomol) were used for immunoprecipitation and immunoblotting. Monoclonal antibody 23Hl 2, specific for the M protein of VSV (VSV-M) was used. Antibodies which recognize endogenous IRNAR I (Goldman et al., 1999, J. Interferon Cytokine Res. 19: 15-26) and IFNARl phosphorylated on Ser535 (or Ser526 in mouse IFNARl [29]) were described previously. Cell lysis, immunoprecipitation, and immunoblotting procedures as well as the kinase assay using cell lysates and GST-IFNARl as a substrate were previously described (Liu et al., 2009, Cell Host Microbe 5:72-83; Liu et al., 2008, Biochem. Biophys. Res. Commun. 367:388-393). Quantification of IB analyses was done using Li-Cor's Odyssey infrared imaging system.
Flow cytometry Cell surface levels of IFNARl in human and mouse cells were determined by staining cells with anti-hIFNARI (AA3 [20]) or anti-mIFNARI (Leinco) in combination with anti-mouse-biotin (Jackson Laboratory) and streptavidin-phycoerythrin (e-Bioscience). Cell surface antigen levels were examined by using a FACSCalibur flow cytometer (BD Pharmingen), The data were analyzed with the FlowJo program (Tree Star).
The results of this experimental example are now described.
CKl α is a kinase that directly phosphorylates the IFNARl degron The detection of a major ligand and JAK-independent Ser535 kinase activity in lysates from human cells was previously reported. Such activity could be monitored by an in vitro kinase assay using the bacterially expressed cytoplasmic domain of IFNARl fused with GST (GST-IFNARl ) as a substrate, the cell lysates as the source of kinase, and anti-phospho-Ser535 immunoblotting as a mode of detection (Liu et al., 2008, Biochem. Biophys. Res. Commun. 367:388-393). Purification of basal IFNARl kinase activity was carried out as outlined in Figure 54A. Cytoplasmic lysates from untreated HeLa cells were fractionated by ammonium sulfate precipitation followed by purification on a cation exchange SP Sepharose column (as described in detail in Materials and Methods) to identify fractions that were active in this kinase assay and that could discriminate between wild type GST-IFNARl and the mutant GST-IFNARl S535 A counterpart in a modified assay that used radioactive ATP for detection (Figure 54B). This modified assay was used for further purification of enriched IFNARl kinase activity through additional steps (Figure 54A). Mass spectrometry analysis of five major bands obtained from pooled active fractions resolved on SDS-PAGE (Figure 54C) revealed the presence of several peptides derived from human CKl α (see Materials and Methods). CK lα and six other members of the human CKl family of ubiquitous pleiotropic kinases phosphorylate numerous substrates (Knippschild et al., 2005, Cell Signal. 17:675-689), some of which share the presence of a potentially phosphorylated serine or threonine residue at position n3 to enable hierarchical mechanism of primed subsequent phosphorylation (Bustos et al., 2006, Proc. Natl. Acad. Sci. USA 103: 19725- 19730; Bustos et al, 2005, Biochem. J. 391 :417-424; Donella-Deana et al., 1985, Biochim. Biophys. Acta 829: 180-187; Flotow et al., 1990, J. Biol. Chem. 265: 14264- 14269; Meggio et al., 1979, FEBS Lett. 106:76-80; Roach, 1991 , J. Biol. Chem. 266:14139-14142; Umphress et a], 1992, Eur. J. Biochem. 203:239-243). Intriguingly, mouse and human IFNARl harbor similar residues (underlined), Ser529 and Ser532, in the sequence that directly precedes the degron (529SQTSQDSGNYS). Consistent with a possibility that CK lα might function as a direct basal Ser535 IFNARl kinase in human cells, immunodepletion of HeLa cell lysate using the antibody against CK l α (but using neither control irrelevant monoclonal or polyclonal antibodies nor antibody against CK lE) indeed decreased the efficacy of GST-IFNARl phosphorylation in vitro by this lysate (Figure 55A). Furthermore, while RNA interference (RNAi)-mediated knockdown of CKlα in
HeLa cells decreased the ability of lysates from these cells to mediate Ser535 phosphorylation in vitro (Figure 55B), a reverse effect was obtained upon overexpression of CKl α in 293T human embryo kidney cells (Figure 55C). In addition, both immunopurified (Figure 55C) and bacterially produced CK lα (Figure 55E, lane 6) also phosphorylated GST-IFNARl on Ser535 in vitro. Collectively, these data validate the biochemical purification strategy and indicate that CK lα is a bona fide direct kinase of Ser535 of IFNARl . A substantial body of literature indicates that members of the CK l family are constitutively active kinases (Knippschild et al, 2005, Cell Signal. 17:675-689). However, given that ligand-independent phosphorylation of IFNARl can be further stimulated in cells treated with the inducers of ER stress, such as TG or viruses (Liu et al., 2009, Cell Host Microbe 5:72-83), it was investigated whether TG treatment activates CK lα. As expected, treatment of cells with TG caused activation of PERK as assessed via phosphorylation of its substrate, eIF2a (Figure 55D). Remarkably, CK lα purified from the lysates from these cells (or cells treated with IFN-α) did not display a higher activity in an in vitro kinase reaction with GST-IFNARl as a substrate (Figure 55D).
To examine whether a CKl α-independent factor may facilitate this kinase's actions in cells undergoing ER stress, CK l α was immunodepleted from the lysates of cells treated or not with TG. In line with the results shown in Figure 55A, the supernatants of these reaction mixtures were not efficient in mediating phosphorylation of GST-IFNARl on Ser535 (Figure 55E, lanes 2 and 3). However, when combined with bacterially expressed CKl α, the depleted lysates from TG-treated cells noticeably increased the efficacy of IFNARl phosphorylation (Figure 55E, lanes 1 1 and 12). These results indicate that ER stress induces yet-to-be-identified cellular factors that cooperate with CK l α to increase the phosphorylation of the IFNARl degron.
It was next examined whether CKl α mediates ligand-independent IFNARl phosphorylation at Ser535 in the cells. Consistent with previously published observations (Liu et al., 2008, Biochem. Biophys. Res. Commun. 367:388-393), this phosphorylation was easily detectable on Flag-tagged IFNARl expressed and immunopurified from human cells. Under these conditions, coexpression of human CK l α further promoted phosphorylation of the IFNARl degron (Figure 56A). In addition, this phosphorylation was decreased in 293T cells treated with a CKl inhibitor, CKI-7 (Figure 56B). Importantly, knockdown of CKl α decreased basal Ser535 phosphorylation of coexpressed Flag-IFNARl (Figure 56C).
In line with previous reports that basal phosphorylation of IFNARl mediates its ubiquitination in cells not exposed to IFN (32), it was also observed that knockdown of endogenous CK 1 α decreased the extent of IFNARl ubiquitination in untreated HeLa cells (Figure 56C). Consistent with the role of IFNARl ubiquitination in endocytosis of this receptor (Kumar et al., 2007, J. Cell Biol. 179:935-950; Kumar et al., 2003, EMBO J. 22:5480-5490), the cell surface levels of IFNARl measured by fluorescence-activated cell sorting (FACS) analyses were noticeably higher in the cells transfected with siRNA against CKlα (Figure 56D). Given that IFNARl levels are important for IFN-α/β signaling (Hwang et al., 1995, Proc. Natl. Acad. Sci. USA 92: 1 1284-1 1288), it was tested whether modulation of CKl α expression affects the extent of cellular responses to IFN-α. A brief treatment of HeLa cells that received control siRNA by a low dose of IFN-α caused a negligible level of Statl phosphorylation. Under these conditions, a noticeably more pronounced activation of Statl was observed in cells where CK lα was knocked down (Figure 56E). Furthermore, stable downregulation of CKl α expression by shRNA constructs against CK lα augmented the antiproliferative effect of IFN-α in 2fTGH human cells (Figure 56F). Given that CKlα is an abundant protein and its knockdown was incomplete in all these experiments, the extent of CKlα-mediated effects on IFNARl phosphorylation, ubiquitination, cell surface levels, and signaling are likely to be underestimated. Collectively, these data suggest that CKlα contributes to the control of IFNARl ubiquitination and cell surface levels of IFNARl as well as the sensitivity of cells to IFN-α.
CKlα is required for efficient phosphorylation and down-regulation of IFNARl via the lJRand-independent pathway. Ligand-independent phosphorylation and degradation of IFNARl could be further stimulated by inducers of ER stress, such as TG and infection with VSV (Liu et al., 2009, Cell Host Microbe 5:72-83). Knockdown of endogenous CKlα by RNAi noticeably decreased the extent of Ser535 phosphorylation in the cells treated with TG. Importantly, phosphorylation of IFNARl in response to IFN-α was not affected by siRNA against CKlα (Figure 57A). These results indicate that CKlα is dispensable for the ligand-inducible phosphorylation of IFNARl but might be required for the ligand- independent pathway.
The latter possibility was further tested by a pharmacologic approach using a cell-permeable and selective CKl inhibitor, D4476 (Bain et al., 2007, Biochem. J. 408:297-315; Rena et al., 2004, EMBO Rep. 5:60-65). Although TG caused a comparable induction of phosphorylation of eIF2a (a canonical substrate of TG-inducible PERK [He, 2006, Cell Death Differ. 13:393-^03, Umphress et al., 1992, Eur. J. Biochem. 203:239-243]) regardless of pretreatment with D4476, this inhibitor noticeably attenuated the Ser535 phosphorylation of IFNARl in response to TG but not to IFN-α in 2fTGH cells (Figure 57B). These data together suggest that CKl activity is required for ligand-independent phosphorylation of the degron of IFNARl . ER stress induces S535 phosphorylation of IFNARl and accelerates its phosphorylation-dependent eπdocytosis and subsequent degradation (Liu et al., 2009, Cell Host Microbe 5:72-83). Consistently, in cells transfected with siRNA against CK l α, thapsigargin-induced downregulation of IFNARl was noticeably attenuated (Figure 57C). Collectively, these results demonstrate that CK lα phosphorylates S535 to accelerate subsequent downregulation of IFNARl, therefore controlling the levels of IFNARl in cells that undergo ER stress.
To further test this possibility the role of CKl in phosphorylation and downregulation of IFNARl in 2fTGH cells infected with VSV, which was previously shown to induce IFNARl phosphorylation and degradation in a ligand- and JAK- independent manner (Liu et al., 2009, Cell Host Microbe 5:72-83), was investigated. RNAi was not used because of the potential pleiotropic effects of loss of CKlα on viral replication and expression of viral proteins reported in literature (Bhattacharya et al., 2009, Virus Res. 141 : 101-104; Boyle et al, 2004, J. Virol. 78: 1992-2005; Campagna et al., 2007, J. Gen. Virol. 88:2800-2810; Eichwald et al., 2004, Proc. Natl. Acad. Sci. USA 101 :16304-16309; Huber et al., 2004, J. Virol. 78:7478-7489; MacLaine et al., 2008, J. Biol. Chem. 283:28563-28573; Quintavalle et al, 2006, J. Virol. 80: 1 1305-1 1312; Quintavalle et al, 2007, J. Biol. Chem. 282:5536-5544). Instead, a pharmacological approach was used to acutely inhibit CKl activity by treatment with D4476. Previous reports demonstrated that VSV infection promoted ER stress (He, 2006, Cell Death Differ. 13:393^103) and phosphorylation-dependent ubiquitination and degradation of IFNARl (Liu et al, 2009, Cell Host Microbe 5:72-83). When D4476 was added to the VSV-infected cells shortly before a point where significant accumulation of a viral protein (VSV-M) can be seen, this inhibitor markedly attenuated virus-induced S535 phosphorylation of IFNARl and downregulation of IFNARl without affecting eIF2a phosphorylation (Figure 57D). Under these conditions, it is unlikely that IFNARl downregulation is driven by signaling initiated by endogenous IFN-α/β because of the lack of basal Statl phosphorylation in these lysates (Figure 57E), although a possibility that Type I IFN might be produced and act at other time points of infection cannot be ruled out. In all, these results indicate the involvement of CK lα in VSV-induced S535 phosphorylation and ensuing degradation of IFNARl . Leishmanial casein kinase regulates IFNARl levels and IFN-α/β signaling,
Casein kinase 1 comprises a large family of evolutionarily conserved kinases that include numerous isoforms in mammalian cells as well as CKl orthologs and CKl -like proteins expressed in some lower organisms. It was next examined whether different members in the CK l superfamily are capable of phosphorylating S535 of IFNARl in vitro and in the cells. Vaccinia virus is known to express a CK l -like kinase Bl (vvBl) that plays an important role in its replication (Rempel et al., 1992, J. Virol. 66:4413-4426). When expressed and immunopurified from 293T cells, this kinase was not capable of direct phosphorylation of IFNARl on Ser535 (Figure 58A, right panel) despite being active in autophosphorylation (Figure 58B) and against other substrates, including casein (Santos et al., 2004, Virology 328:254-265). On the contrary, immunopurified human CK 18, CK lE, and protozoan parasite L-CK l were active against IFNARl S535 in the immunokinase assay in vitro (Figure 58A). Accordingly, lysates from cells overexpressing hCKlα and L-CK l, but not vvB l, exhibited elevated levels of S535 kinase activity (Figure 58C). Interestingly, although all tested human CKl isoforms were capable of phosphorylating GST-IFNARl in vitro, only expression of hCKlα increased the phosphorylation of Flag-IFNARl in the cells (Figure 58D, left panel). Such an effect of hCKlα was unlikely to represent an artifact of specific induction of ER stress, since levels of phosphorylated eIF2a were similar in cells overexpressing all tested human CK l forms. Similar to hCK l α, expression of L-CK l also sufficed to promote phosphorylation of the IFNARl degron in the cells (Figure 58D, right panel). These results together suggest that there is a specificity in the ability of diverse CKl species to phosphorylate Ser535 of IFNARl and that there are certain structural determinants present in hCKlα and L-CKl that enable this function in cells.
It is plausible that mammalian IFNARl encounters L-CK 1 when the cells are infected with Leishmania parasites that shuffle between sandflies and mammalian hosts during the infectious life cycle. Within this cycle, Leishmania promastigotes are released from the insect gut to invade macrophages and dendritic cells in the mammalian hosts via phagocytosis to become mammal -parasitizing amastigotes (reviewed in Polonio et al., 2008, Int. J. MoI. Med. 22:277-286). Intriguingly, there are reports that various species of Leishmania are capable of secreting the CKl -like kinase that is active against several host mammalian substrates, including membrane proteins (Sacerdoti-Sierra et al., 1997, J. Biol. Chem. 272:30760-30765; Vieira et al., 2002, Int. J. Parasitol. 32: 1085- 1093). The reported experimental conditions were used to test whether such activity is capable of phosphorylating IFNARl . Incubation of concentrated medium obtained from L. major promastigotes with ATP and GST-IE^ARl led to a noticeable phosphorylation of this substrate on Ser535 (Figure 58E). In addition, kinase activity secreted by amastigotes from another Leishmania species (L. mexicana) under two different acidity conditions resulted in phosphorylation of IFNARl detected via incorporation of radiolabeled ATP into this substrate (Figure 58F). These results suggest that different forms of Leishmania secrete a kinase activity that is capable of directly phosphorylating IFNARl within its degron.
L-CKl has been cloned and, based on studies that used inhibitors of this kinase, is implicated in controlling the growth of Leishmania (Allocco et al., 2006, Int. J. Parasitol. 36: 1249-1259; Donald et al., 2005, MoI. Biochem. Parasitol. 141 : 15-27;
Knockaert et al., 2000, Chem. Biol. 7:41 1-422). It was further investigated whether this kinase might regulate phosphorylation-dependent ubiquitination and degradation of IFNARl. Expression of wild-type L-CKl but not of its catalytically inactive mutant promoted phosphorylation of coexpressed Flag-tagged IFNARl on Ser535 (Figure 59A). Furthermore, expression of L-CKl increased ubiquitination of wild-type Flag-IFNARl but not of its S535A mutant, which was insensitive to the phosphorylating effects of L- CKl (Figure 59B). In some of these experiments, a slight decrease in the levels of wild- type Flag-IFNARl was observed in the cells where L-CKl was coexpressed; however, these changes were difficult to interpret because of the presence of endogenous IFNARl . To test whether the presence of leishmanial kinase might affect the levels of IFNARl, mouse embryo fibroblasts obtained from IFNARl knockout animals were used. These fibroblasts were reconstituted with either wild-type mouse Flag-IFNARl or its mutant that harbors the S526A mutation (analogous to the human S535A substitution). Given that coexpression of L-CKl decreased the levels of wild-type Flag-IFNARl much more dramatically than that of the phosphorylation-insensitive receptor mutant (Figure 59C and 59B, lower paneJ), it is likely that L-CK l down regulates IFNARl at least in part through a phosphorylation-dependent mechanism.
Furthermore, infection of human dendritic cells with L. major led to a modest but reproducible decrease in the cell surface levels of endogenous IFNARl assessed by FACS (Figure 59D). Similar results were obtained when mouse bone marrow macrophages were used for infection. Collectively these data suggest that the presence of L-CK l in mammalian cells leads to phosphorylation of the IFNARl degron and ensuing phosphorylation-dependent downregulation of IFNARl .
Maintenance of IFNAR] levels plays an important role in regulation of the duration and magnitude of Type I IFN signaling (Huang-Fu et al., 2008, FEBS Lett. 582:3206-3210; Hwang et al., 1995, Proc. Natl. Acad. Sci. USA 92: 1 1284-1 1288; Kumar et al., 2003, EMBO J. 22:5480-5490). The results that L. major secretes an S535 kinase activity and that L-CK l is sufficient to cause S535-dependent IFNARl loss suggested that Leishmania may attenuate the extent of IFN signaling. Infection of mouse bone marrow macrophages with L. major indeed led to a dose-dependent inhibition of Statl phosphorylation in response to IFN-α (Figure 60A). Remarkably, this suppression was specific, as Leishmania infection did not affect Statl phosphorylation induced by Type II IFN (IFN~y). Since Type I and II IFNs utilize different receptors, yet similar intracellular kinases, to activate Statl, the latter data suggest that L. major inhibits cellular responses to Type I IFN via targeting its receptor.
To directly test the role of L-CKl in the inhibition of Type 1 IFN signaling plasmid for expression of L-CKl or empty vector were transfected in human 293T cells and followed up activation of Statl after pulse treatment with human IFN-α. Cellular responses to this cytokine were noticeably attenuated in cells that received L-CKl (Figure 60B). A similar experiment was performed on IFNARl -null mouse embryo fibroblasts that were reconstituted with either wild-type IFNARl or its L-CK l -insensitive IFNARl S526A mutant. A pulse treatment of cells with mouse IFN-α led to a temporal induction of Statl phosphorylation, the extent of which was reduced over time (Figure 60C). Expression of L-CKl in cells that harbor wild-type IFNAR l led to a noticeable signaling inhibition that manifested itself in both a lesser magnitude and a shorter course of Statl phosphorylation. Importantly, these changes were much less prominent when L- CKl was expressed in cells that harbor the IFNARl S526A mutant (Figure 60C), despite similar levels of LCKl achieved in these cells (Figure 60D). These results collectively indicate that the presence of the leishmanial CKl in the host cells suppresses the cellular responses to IFN-α in a manner that at least in part depends on phosphorylation of the IFNARl degron.
Example 6: Inducible priming phosphorylation promotes ligand-independent degradation of the IFNARl chain of Type I interferon receptor
Phosphorylation-dependent ubiquitination and ensuing downregulation and lysosomal degradation of the IFNARl chain of the receptor for Type I interferons (IFNs) plays an important role in limiting the cellular responses to these cytokines. These events could be stimulated either by the ligands (in a Janus kinase (JAK)-dependent manner) or by unfolded protein response (UPR) inducers including viral infection (in a manner dependent on the activity of pancreatic ER kinase, PERK). Both ligand- dependent and -independent pathways converge on phosphorylation of Ser535 within the IFNARl degron leading to recruitment of P-Trcp E3 ubiquitin ligase, and concomitant ubiquitination and degradation. Casein kinase 1 (CK lα) was shown to directly phosphorylate Ser535 within the ligand-independent pathway. Yet, given the constitutive activity of CKlα, it remained unclear how this pathway is stimulated by UPR. It is disclosed herein that induction of UPR promotes the phosphorylation of a proximal residue, Ser532, in a PERK-dependent manner. This serine serves as a priming site that promotes subsequent phosphorylation of IFNARl within its degron by CKlα. These events play an important role in regulating ubiquitination and degradation of IFNARl as well as the extent of Type I IFN signaling.
The Materials and Methods used in this Example are now described.
Plasmids and reagents
Thapsigargin (TG), cycloheximide (CHX), and methylamine HCl were purchased from Sigma. Human pCDNA3-Flag-IFNARl mammalian expression construct and retroviral pBABE-puro-based construct for expression of Flag-tagged mouse IFNARl as well as GST-IFNARl bacterial expression vector were described previously (Aaronson et al., 2002, Science 296:1653-1655). Mutants lacking the priming sites (Ser532 in human IFNARl and Ser523 in mouse IFNARl) were generated by site directed mutagenesis. Sequence of mutants was confirmed by dideoxy sequencing. Constructs for expression of human Myc-tagged CK lα was described previously
(Shirogane et al., 2005, J Biol Chem 280:26863-26872). HA-tagged leishmania CKl (L- CKl) pEF-BOS-based expression vector (wild type or kinase dead K40R mutant) was described elsewhere(Liu et al., 2009, MoI Cell Biol 29: 6401 -6412). pLKO. I -puro (Sigma) vector-based shRNA constructs targeted against PERK or irrelevant control were described previously (Liu et al., 2009, Cell Host Microbe 5:72-83). Construct for bacterial expression of GST-CKlα was described in (Chen et al., 2005, MoI Cell Biol 25:6509-6520). Construct for bacterial expression of constitutively active PERK (ΔN- PERK described in (Cullina et al., 2003, MoI Cell Biol 23:7198-7209)) as well as for mammalian expression of wild type or catalytically inactive PERK (K618R, (Cullina et al., 2003, MoI Cell Biol 23:7198-7209)) were previously described. Human IFN-α (Roche) and murine IFN(3 (PBL) were purchased.
Cell culture, treatment, and viral infection
All cell lines were maintained in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% (v/v) fetal bovine serum (Hyclone) and various selection antibiotics when indicated. Human HeLa and 293T cells were obtained from ATCC. Mouse embryo fibroblasts (MEFs) from IFNARI -/-mice and their wild type counterparts were gifted. To obtain reconstituted cells expressing wild type or mutant IFNARl, these cells were transduced by pBabe-Puro-based mIFNARl constructs and selected in puromycin for two weeks before analysis. 1 l ,l-Tyk2-null cells reconstituted with catalytically inactive Tyk2 (KR cells) were previously described (Marijanovic et al., 2006, Biochem J 397:31-38). Huh7 and derivative cells that express a complete HCV genome were described previously (Liu et al., 2009, Cell Host Microbe 5:72-83; Luquin et al., 2007, Antiviral Res 76: 194-197). These cells were cultured in the presence of 500 μg/mL of G418. Transfection of 293T cells, HeIa cells, and Huh7 cells was carried out with Lipofectamine Plus reagent (Invitrogen) according to manufacturer's recommendations. VSV (Indiana serotype) was propagated in HeLa cells. For infection, cells were inoculated with MOI 0.1-0.2 of VSV for Ih, washed, and incubated with fresh medium as indicated.
Antibodies and immunotechniques
Commercially available antibodies against pSTATl, p-eIF2a, STATl (Cell Signaling), eIF2a (Biosources), hlFNARl , (Santa Cruz), Flag (M2), β-actin (Sigma), mouse IFNARl (Leinco), and ubiquitin (clone FK2, Biomol) were purchased. Monoclonal antibodies against human IFNARl that were used for immunoprecipitation (EA 12) or immunoblotting (GB8) were described in detail elsewhere (Goldman et al., 1999, J Interferon Cytokine Res 19: 15-26). Monoclonal 23Hl 2 antibody against the M protein of VSV (VSV-M) was a generous gift. Antibodies against IFNARl phosphorylated on Ser535 (Kumar et al., 2004, J Biol Chem 279:46614-46620) and against PERK (Liu et al., 2009, Cell Host Microbe 5:72-83) were described previously. Polyclonal antibody against IFNARl phosphorylated on Ser532 (Ser523 in the mouse receptor) was raised in rabbits using synthetic mono phospho-peptide EDHKKYSSQTpSQDSGNYSNEDE (SEQ ID NO:24) in collaboration with PhosphoSolutions Inc. (Golden, CO). Antibody was further affinity purified using mono- phosphopeptide affinity columns and tested for specificity by immunoblotting. Immunoprecipitations, immunoblotting, in vivo ubiquitination assay using denaturing immunoprecipitation, and assessment of the kinetics of degradation of IFNARl by cycloheximide chase were carried out as described previously (Kumar et al., 2003, Embo J 22:5480-5490; Kumar et al., 2004, J Biol Chem 279:46614-46620; Kumar et al., 2007, J Cell Biol 179:935-950; Liu et al., 2008, Biochem Biophys Res Commun 367:388-393; Liu et al., 2009, Cell Host Microbe 5:72-83).
In-vitro kinase assay Kinase assays were carried out as described in detail elsewhere (Liu et al., 2009, MoI Cell Biol 29: 6401-6412). Briefly, 2 μg of substrates (bacterially expressed and purified GST-IFNARl , wild type, or S532A mutant) were incubated with 4 μg of lysate (from untreated or thapsigargin treated cells) that were cleared of CKl α (by immunodepletion) and 0.25 μg of bacterially produced GST-CKlα (where indicated) in kinase buffer (25 mM Tris HCl, pH 7.4, 10 mM MgC12, 1 mM NaF, 1 mM NaVO3) and ATP (1 mM). Where indicated, 100 μg of bacterially-produced ΔN-PERK or undepleted lysates from 293T cells were used as a source of kinase activity. Radiolabel was provided as 32P-γ-ATP (l μCi, Amersham). The reactions were carried out at 3O0C for 30 minutes shaking at 600 rpm on the tabletop incubator. Products were analyzed either by immunoblotting with phospho-specific antibodies or by autoradiography.
The results of this example are now described.
Inducers of UPR promote phosphorylation-dependent ubiquitination and degradation of IFNARl
How inducers of UPR promote phosphorylation-dependent ubiquitination and degradation of IFNARl was investigated. Previous studies demonstrated that these signals feed into the ligand-independent pathway (Liu et al., 2008, Biochem Biophys Res Commun 367:388-393; Liu et al., 2009, Cell Host Microbe 5:72-83) that utilizes CKlα, which directly phosphorylates Ser535 within the degron of IFNARl (24). Given that constitutively high activity of CKl α was not further stimulated in cells treated with UPR inducers yet lysates from these cells augmented the ability of CKl α to phosphorylate Ser535 in vitro (Liu et al., 2009, MoI Cell Biol 29: 6401 -6412) it was proposed that UPR signaling may lead to additional post-translational modification of IEMARl that improves its phosphorylation by CKlα on Ser535. Indeed, a large body of literature suggests that priming phosphorylation of a substrate at a Ser/Thr residue in the n~3 position may greatly increase its phosphorylation by various casein kinase 1 species (30- 37). Analysis of primary sequences of IFNARl showed that a highly conserved Ser residue (Ser532 in human; Ser523 in mice) is located at this position, and may act as a priming phosphorylation site (Figure 61A).
Ligand-independent IFNARl phosphorylation, ubiquitination, and degradation is readily observed in cells that overexpress this receptor (Liu et al., 2008, Biochem Biophys Res Commun 367:388-393; Liu et al., 2009, Cell Host Microbe 5:72- 83). The stability of wild type Flag-IFNAR l expressed in 293T cells with its mutant counterpart that lacks Ser532 was compared using a cycloheximide (CHX) chase assay. In this assay, levels of protein become indicative of its proteolytic turnover because they are assessed under conditions when protein synthesis in cells is inhibited for various times. Replacement of Ser at the putative priming site within IFNARl with Ala yielded a receptor chain that displayed a noticeably longer half life (Figure 61B). Furthermore, substation of this serine residue with a phospho-mimicking Asp produced IFNARl mutant protein that underwent a more robust turnover that its wild type counterpart (Figure 61B). This result indicates that priming phosphorylation might be important for regulating the rate of IFNARl proteolytic turnover.
Next it was assessed whether the priming site contributes to CKl- mediated phosphorylation of the IFNARl degron on Ser535. In line with previous observations (Liu et al., 2008, Biochem Biophys Res Commun 367:388-393; Liu et al., 2009, Cell Host Microbe 5:72-83; Liu et al., 2009, MoI Cell Biol 29: 6401 -6412), forced expression of wild type Flag-IFNARl in 293T cells allowed the observation of the basal level of Ser535 phosphorylation, and co-expression of Myc-tagged CKlα further increased this phosphorylation. Under these conditions, Ser535 phosphorylation was not found in mutant IFNAR 1S532A (Figure 62A) although phosphorylation of another proximal serine mutant, Ser529A, remained unaffected. This result could be explained neither by differences in the levels of Myc-CKlα expression (Figure 62A, lower panel) nor by the possibility that mutation in Ser532 might alter the recognition of the phospho- Ser535 specific epitope by the antibody, since Ser535 phosphorylation of IFNAR 1 S532A mutant was still observed in the cells treated with IFN-α. These observations suggest that the priming site is indispensable for ligand-independent IFNARl degron phosphorylation but not when phosphorylation is induced by IFN-α. Similar to human CK l α, the leishmanial L-CK l was also shown to promote phosphorylation of IFNARl on Ser535 upon expression in human or mouse cells (Liu et al., 2009, MoI Cell Biol 29: 6401-6412). In line with this report, expression of wild type HA-tagged L-CKl , but not of a kinase dead mutant of L-CKl , stimulated Ser535 phosphorylation of co-expressed Flag-IFNARl WT (Figure 62B), However, phosphorylation of Ser535 in the S532A mutant was not observed under these conditions (Figure 62B). Together these data further indicate that a priming phosphorylation might be required for Hgand-independent CKl -mediated phosphorylation of the IFNARl degron. To determine whether the putative priming site is phosphorylated in cells, a polyclonal anti~pSer532 antibody was generated. Flag-IFNARl proteins expressed in 293T cells were immunopurified and analyzed by immunoblotting using this antibody as well as the previously characterized anti~pS535 antibody (Kumar et al., 2004, J Biol Chem 279:46614-46620). The latter antibody recognized wild type receptor but neither the S535A mutant nor the S532A mutant, whereas S532D mutant exhibited an increased phosphorylation on Ser535 (Figure 62C). This result is consistent with data shown in Figure 62A. Importantly, the anti-pS532 antibody recognized both wild type and the S535A mutant (but not the S532A or S532D priming site mutants; Figure 62C), indicating that overexpressed IFNARl undergoes phosphorylation on the putative priming site in cells. Whether this priming phosphorylation is directly mediated by CKl α or by another kinase that is induced by UPR was assessed. Incubation of recombinant CK lα with wild type GST-IFNARl substrate and ATP in vitro resulted in phosphorylation of Ser535 but not of Ser532 was next evaluated (Figure 62D, lane 4). This result confirms the previously published suggestion that CK lα is a direct kinase for the IFNARl degron residue, Ser535 (Liu et al., 2009, MoI Cell Biol 29: 6401-6412) but also indicates that phosphorylation of the putative priming site might be mediated by another kinase. Indeed phosphorylation of Ser532 was detected in CKlα-depleted Iysates from cells treated thapsigargin (TG), an inducer of UPR. Moreover, the extent of this phosphorylation was not changed when recombinant CK lα was added to this reaction (Figure 62D, compare lanes 3 vs. 6). Importantly, a combination of CKlα and lysates from TG-treated cells increased the efficacy of phosphorylation of Ser535 in a manner that depended on the integrity of Ser532 as seen from the reaction using the GST-IFNARl S532 A mutant (lane 6 vs. 9). These results suggest that TG treatment induces activity of an unknown (yet different from CKlα) protein kinase that phosphorylates IFNARl on Ser532. Furthermore, this phosphorylation increases the efficacy of CKlcrmediated phosphorylation of Ser535 within the degron of IFNARl , suggesting that Ser532 represents a bona fide priming site.
It was next investigated whether phosphorylation of the priming site may occur within the context of endogenous IFNARl in cells where UPR is induced. Treatment of HeLa cells with TG or infection of these cells with VSV led to phosphorylation of endogenous IFNARl on both Ser532 and Ser535 (Figure 63A). In line with previously published results (Kumar et al., 2004, J Biol Chem 279:46614- 46620; Marijanovic et al., 2006, Biochem J 397:31-38; Kumar et al., 2007, J Cell Biol 179:935-950), treatment of cells with IFN-α stimulated Ser535 phosphorylation.
However, priming phosphorylation on Ser532 in response to the ligand was not efficient (Figure 63A). This result, together with ligand-induced Ser535 phosphorylation of the IFNARl S532A mutant (Figure 62A), suggests that IFN-crinduced signaling is capable of promoting IFNARl degron phosphorylation in a manner that does not require priming phosphorylation. Furthermore, in human KR cells (which harbor catalytically inactive Tyk2 and were shown not to support IFN-α-induced IF]VARl phosphorylation, ubiquitination, and degradation (Marijanovic et al., 2006, Biochem J 397:31 -38; Liu et al., 2008, Biochem Biophys Res Commun 367:388-393)), the phosphorylation of the priming Ser532 site and of the degron Ser535 in response to TG was also detected (Figure 63B). Collectively, these results suggest that phosphorylation of the priming site occurs in a ligand~and Tyk2~independent manner and is dispensable for the ligand- induced pathway.
It was previously reported that induction of UPR promotes ubiquitination and degradation of endogenous or exogenously expressed wild type IFNARl in human cells (Liu et al., 2009, Cell Host Microbe 5:72-83). Here the role of phosphorylation of the priming site in UPR-induced ubiquitination of IFNARl was investigated. Treatment of cells with TG noticeably increased the extent of ubiquitination of wild type IFNARl but not of the S532A mutant (Figure 63C). Furthermore, this mutant was less sensitive to a decrease in the levels of IFNARl induced by TG (Figure 63D). These data suggest that priming phosphorylation of IFNAR] plays an important role in its ubiquitination and downregulation of IFNARl in response to UPR induction.
UPR stimulates Ser535 phosphorylation of IFNARl and accelerates ubiquitination and degradation of this receptor in a manner that relies on PERK activity (Liu et al., 2009, Cell Host Microbe 5:72-83). Whether PERK is required for phosphorylation of the priming site within IFNARl was next investigated. Transfection of HeLa cells with shRNA targeted against PERK led to a partial knockdown of this kinase as evident from its decreased level and a decreased phosphorylation of its known substrate eIF2α in cells treated with TG (Figure 64A, lower panels). Under these conditions, the efficacy of TG-induced phosphorylation of IFNARl on the priming Ser532 was also decreased (Figure 64 A, upper panel). This result suggests that PERK is required for UPR-induced priming phosphorylation. Consistent with this suggestion, TG-induced phosphorylation of mouse IFNARl on Ser523 (analogous to Ser532 in human receptor) was not observed in mouse embryo fibroblasts (MEFs) from PERK knockout animals (Figure 64B). Given that PERK plays an important role in UPR- induced ubiquitination and degradation (Liu et al., 2009, Cell Host Microbe 5:72-83) and these events also depend on the priming site of IFNARl (Figures 63C-63D), the findings that PERK regulates Ser532 phosphorylation also indicate that this kinase might function upstream of the phosphorylation of the priming site.
Expression of wild type but not catalytically inactive PERK mutant led to a noticeable downregulation of endogenous IFNAR 1 (Figure 64C) suggesting that kinase activity of PERK is required for ligand-independent IESARl degradation. Whether PERK may serve as a direct kinase for the priming site was next investigated. Incubation of recombinant active PERK with GST-IFNARl and ATP in an in vitro kinase assay similar to one shown in Figure 62D did not yield any phosphorylation of the substrate on Ser532 that would be detectable by immunoblotting using anti-pS532 antibody. Furthermore, when this reaction was carried out in the presence of radiolabeled ATP the incorporation of phosphate into GST-IFNARl was not detected (Figure 64D). Having excluded the possibilities that integrity of substrate might be somehow compromised (by analyzing protein load using Coomassie staining and demonstrating that this very substrate was efficiently phosphorylated by the whole cell lysate) or that the kinase was inactive (given efficient autophosphorylation and phosphorylation of contaminants denoted by asterisks on Figure 64D) it was concluded that PERK is not capable of directly phosphorylating IFNARl . This result together with data from Figure 62D demonstrating induction of a Ser532 kinase in cells treated with TG also suggests that UPR stimulates a PERK-dependent activation of another serine kinase that function as a direct kinase for priming phosphorylation. Alternatively, PERK activity might negatively regulate a hypothetical Ser532 phosphatase.
UPR induced by some viruses including VSV and HCV was shown not only to downregulate IFNARl but also to inhibit the extent of IFN-α/β signaling, providing these viruses with the means to evade the control from Type I IFN system (Liu et al., 2009, Cell Host Microbe 5:72-83). Whether phosphorylation of the priming site is important for attenuation of cellular responses to IFN was next investigated. In line with previously reported data (Liu et al., 2009, Cell Host Microbe 5:72-83), expression of the HCV genome in human Huh7 hepatoma cells noticeably downregulated the level of endogenous IFNARl (Figure 65A, upper panel). When loading was normalized to yield comparable amounts of IFNARl in the immunoprecipitation reaction, HCV induced phosphorylation on both Ser535 and Ser532 was also observed (Figure 65A, lower panel). This result suggests that cells expressing the HCV genome display an increased priming phosphorylation of IFNARl that may lead to downregulation of the receptor. The response of these cells to IFN-α was markedly attenuated (Liu et al.,
2009, Cell Host Microbe 5:72-83). Whether this inhibition could be rescued by expression of IFNARl deficient in Ser532 phosphorylation was assessed. Because of limited transfection efficacy in Huh7 cells, Flag-tagged Statl with Flag-tagged IFNARl proteins were coexpressed and then analyzed Statl phosphorylation and levels in Flag immunoprecipitation reactions. This analysis revealed a decreased phosphorylation of Flag-Statl (Figure 65B) likely due to a decreased level of IFNARl (as shown in Figure 65A). Co-expression of Flag-IFNAR1S532A mutant that is insensitive to HCV-induced priming phosphorylation restored the efficacy of IFN-orinduced Flag-Statl phosphorylation. However, equal amounts of vector for expression of wild type Flag- IFNARl failed to reverse the HCV-mediated inhibition, most likely due to the fact that wild type IFNARl is susceptible to ligand-independent ubiquitination and degradation (as seen from Figures 63C-63D) and, as a result, is expressed at levels markedly lower than that of the priming site phosphorylation-deficient mutant (Figure 65B, lower panel). These data indicate that priming phosphorylation of IFNARl may regulate IFN-α/β signaling. To further explore this possibility MEFs from IFNARl knockout mice weer reconstituted with either wild type murine IFNARl or its priming site Ser523 mutant and compared the ability of murine IFN-β to induce an anti-viral state in these cells. Cells that express the priming site mutant exhibited a noticeably higher innate resistance to VSV infection (as judged from lower levels of expression of VSV-M protein in the absence of exogenous IFN-β (Figure 65C). Furthermore, these cells required at least five times a lower dose of exogenous IFN-β than cells expressing wild type receptor to mount a comparable defense against VSV (compare VSV-M levels at dose 50IU/ml in WT cells versus 10IU/ml in S523A in Figure 65C). These data together indicate that priming phosphorylation of IFNARl contributes to the regulation of the cellular responses to Type I IESf.
Example 7: Targeted deletion of PERK promotes oxidative DNA damage checkpoint activation and limits tumor expansion
Initial findings implicated PERK as anti-tumorigenic regulator as PERK deficiency inhibited the ability of Ras-transformed MEFs to grow as subcutaneous transplants (Bi et ah, 2005, Embo J 24:3470-81 ; Blais et al., 2006, MoI Cell Biol
26:9517-32). However, subsequent studies revealed that overexpression of a dominant negative PERK allele in MCFlOA normal mammary epithelial cells rendered neoplastic growth characteristics (Sequeira et al., 2007, PLoS ONE 2:e615). In addition, activation of Fv2E-PERK engineered to contain a drug-inducible dimerization domain reduced tumorigenic potential of squamous carcinoma T-HEp3 cells and SW620 colon carcinoma cells (Ranganathan et a]., 2008, Cancer Res 68:3260-8). Finally, activation of PERK by overexpression of H-Ras in melanocytes was associated with a senescent phenotype (Denoyelle et al., 2006, Nat Cell Biol 8: 1053-63) suggesting that PERK may function as a barrier to malignant growth in certain contexts. In the experiments disclosed herein, the importance of PERK for tumorigenesis utilizing short hairpin RNA approach to reduce PERK levels in human breast and esophageal carcinoma cells was investigated. In addition, a mammary gland- specific knockout of PERK in the mammary tumor-prone MMTV-N eu mouse strain was generated. Previous results revealed that loss of PERK renders tumor cells acutely susceptible to oxidative DNA damage. The subsequent induction of the DNA damage checkpoint significantly reduces tumor cell growth in vitro and in vivo. In order to proliferate and expand in an environment with limited nutrients, cancer cells co-opt cellular regulatory pathways that facilitate adaptation and thereby maintain tumor growth and survival potential. The endoplasmic reticulum (ER) is uniquely positioned to sense nutrient deprivation stress and subsequently engage signaling pathways that promote adaptive strategies. As such, components of the ER stress-signaling pathway represent potential anti-neoplastic targets. However, recent investigations into the role of the ER resident protein kinase PERK have paradoxically suggested both pro- and anti- tumorigenic properties. Animal models of mammary carcinoma have been used to interrogate PERK contribution in the neoplastic process. The ablation of PERK in tumor cells resulted in impaired regeneration of intracellular antioxidants and accumulation of reactive oxygen species triggering oxidative DNA damage. Ultimately, PERK deficiency impeded progression through the cell cycle due to the activation of the DNA damage checkpoint. The data disclosed herein reveal that PERK -dependent signaling is utilized during both tumor initiation and expansion to maintain redox homeostasis and thereby facilitates tumor growth.
The Materials and Methods used in this Example are now described.
Animals and tissue Mammary gland-specific PERK knockout animals (Bobrovnikova-Marjon et al., 2008, Proc Natl Acad Sci U S A 105: 16314-9) were mated to mice bearing the Neu transgene under the control of MMTV-LTR promoter (Guy et al., 1992, Proc Natl Acad Sci USA 89: 10578-82). The Neu and Cre transgene bearing offspring were bred to homozygocity for the LoxP allele of PERK thus generating mammary gland-specific PERK 'null'. Littermates bearing Neu but not the Cre transgene were used as controls. The No.4 inguinal gland was extracted and processed for whole-mount analysis as previously described (Lin et al., 2008, Oncogene 27: 1231-42).
Immunoprecipitation and immunoblotting
Cells were lysed in EBC buffer (5OmM Tris pH 8.0; 12OmM NaCl; 0.5% NP-40) supplemented with protease and phosphatase inhibitors. Antibodies used for immunoblotting analysis, immunofluorescence and IHC included PERK (Rockland Immunochemicals); human ATF4, histone H3 (tri methyl K9), phospho-Chk2 (Thr68) (Abeam); human CHOP (Affinity Bioreagents), R-actin (Sigma, AC- 15), Nrf2, Keap 1, CDK2, and pl9ARF (Santa Cruz Biotechnology); y-H2AX (Serl39), phospho-elF2, eIF4E, Cdc25A, phospho-Tyrl5 CDK2, phospho-ThrlόO CDK2, phospho-Thr (Cell signaling); troma-1 (Developmental Studies Hybridoma Bank, University of Iowa), ErbB2 (Calbiochem), Chk2 (BD Pharmingen), eIF2 (BioSource), phospho-ATM (Millipore).
Lentivirus, Retrovirus shRNA/siRNA
293T cells were transfected with PMDL, VSVG, REV and pLKO. l containing shRNA against PERK (IDTRCN0000001401 , Open Biosystem) or pLKO. l empty vector as control using Lipofectamine Plus (Invitrogene) for stable knockdown or
FuGene (Roche) for acute knockdown experiment. Viral supernatants were harvested 48h after transfection and concentrated using SW-28 rotor for stable knockdown infections.
Concentrated virus was used to infect human cell lines in the presence of 10g/ml polybrene. Selection to create stably knocked down cell lines was conducted with puromycin at 5g/ml. Retroviruses were produced as previously described (Brewer et al.,
2000, Proc Natl Acad Sci U S A 97: 12625-30). MDA-MB468 PERK knockdown cells were transfected with siRNA by using HiPerfect (Qiagen). Scrambled (Scrm) and keapi - specific siRNA Smartpool were from Dharmacon. Experiments were conducted 72 h after transfection.
Growth curves
3X1 OM cells were plated in 6 cm dish. Cells were counted every 24 h for 5 days using hemocytometer. ROS scavenger N-acetyl cysteine (NAC) was used at 5 mM where indicated, Culture media was changed every 3 days. Each experiment was done in triplicate.
Quantitative and semiquantitative RT-PCR
RNA was prepared from cultured cells or frozen tissues using TRlzol (Invitrogen), followed by isopropanol precipitation. Genomic DNA (gDNA) was isolated using Qiagen DNeasy kit. Quantitative RT-PCR reactions were performed using SYBR Green (SuperArray). All primer sequences are available upon request. Semiquantitative RT-PCR for PERK excision efficiency was performed as described (Zhang et al., 2006, J Biol Chem 281 :30036-45). Immunofluorescence
Cells were permeabilized with ice cold MeOH:acetone (1 : 1) for l Omin at -200C, allowed to air dry, and rehydrated for l Omin with PBS. Blocking was performed with 10% FBS/PBS for 40 minutes at room temperature. Primary and secondary antibodies were diluted in 10% FBS/PBS and incubated for 2h or 30 minutes at RT, respectively.
FISH
Fluorescent in situ hybridization for ErbB2 was performed on paraffin sections following treatment with proteinase K. Biotin-labeled probe was generated by random priming method with ErbB2 full-length cDNA (ID 5356166, Open Biosystems) and visualized with streptavidin-Texas Red.
ROS measurement Cells were incubated with 3ml PBS (with Calcium and Magnesiun) containing 5mM 5-(and-6)-chloromethyl-2',7'-dichlorodihydrofluorescein diacetate, acetyl ester (CM-H2DCFDA, Invitrogen) for 30 min in the dark at 370C. Cells were washed with PBS, trypsinized, washed, resuspended in PBS and analyzed by FACS.
8-oxyguanine staining
4x10Λ5 cells were plated on glass coverslips. 8-oxyguanine was detected using OxyDNA test (Biotrin). Briefly, cells were permeabilized with MeOH:Acetone (1 : 1), washed with wash solution, and incubated with protein-FITC for 1 h. For tumor sections, antigen retrieval was performed by heating in 5OmM Tris pH 9.5 for 12min. Slides were immersed in ice cold MeOH for lOmin at -2O0C. Sections were blocked with 10% FBS in PBS and incubated overnight at 40C with FlTC-coηjugate in wash solution.
Comet assay DNA fragmentation was tested by alkaline electrophoresis comet assay
(Trevigen) according to manufacturer's instructions. Data were analyzed using Comet assay IV software (Perceptive Instruments).
Orthotopic injections 5X 10Λ6 cells were mixed with 301 matrigel:media (1 : 1) and were injected into the mammary fat pad of 3 months old female SCID mice (Charles River). Animals were sacrificed after 37 (human cells) or 28 (mouse cells) days, tumor size was measured using a caliper, and tumor volume was calculated using the formula: Volume (cc) = px(lenght)x(width)2/6 (Bruns et al., 2004, Clin Cancer Res 10:2109-19).
Immunohistochemistry.
Antigen retrieval was performed in 10 mM citrate buffer, pH 6.0 (Biogenex). Endogenous peroxidase activity was blocked with 3% peroxide in MeOH. Sections were blocked with IX Power Block Reagent (Biogenex) followed by incubation with primary antibody. Detection was performed with biotinylated secondary antibodies and ABC-HRP reagent followed by DAB substrate (Vector laboratories). In vitro kinase assay
For the detection of CDK2 kinase activity, cells or tissues were solubilized in EBC buffer. Complexes were isolated by precipitation with a CDK2 reactive antibody from 20Og total protein. The kinase assay was performed using recombinant histone H l with lOCi of -32P-ATP for 10 min at 3O0C. Reactions were resolved by SDS-PAGE, transferred to PVDF membrane, and visualized by autoradiography. Total Histone H l was visualized by ponceau stain.
Cell cycle analysis
Cells were pulsed with 1OM BrdU 45 min prior to being harvested. Cells were washed with PBS, fixed with ethanol, and stained with anti-BrdU (BD Pharmingen) and FITC-conjugated secondary antibody (BD Pharmingen) and then with propidium iodide (10 g/ml) for 30 min prior to FACS analysis. Cell cycle profiles based on DNA content and BrdU incorporation were assessed using FlowJo software, and the sub-G 1 population of cells served as a readout for apoptotic cells.
The Results of this Example are now described.
PERK is expressed in cancer cells wherein it potentiates tumor expansion
Markers of ER stress signaling, including phospho-eIF2 and GRP78 expression, are increased in a variety of tumor types (Daneshmand et al., 2007, Hum Pathol 38:1547-52; Fernandez et al., 2000, Breast Cancer Res Treat 59:15-26; Gazit et al., 1999, Breast Cancer Res Treat 54:135-46; Lee et al., 2008, Neuro Oncol 10:236-43). Because PERK mediates cell growth and survival under conditions of ER stress, it was first determined whether tumor-derived cells retain functional PERK. PERK expression was assessed in 4 breast and 3 esophageal human carcinoma-derived cell lines and compared it to the PERK levels in MCFI OA cells, an immortalized, non-transformed breast epithelial cell line. PERK protein was readily detectable in all cell lines (Figure 66A), and PERK function was preserved in cancer cells, as evidenced by their ability to activate PERK-dependent effectors (Figure 66C). To assess the role of PERK in human tumor cell growth and survival, lentivirus-delivered short hairpin RNAs (shRNA) were utilized to reduce endogenous levels of PERK (Figure 66B), which also resulted in attenuated activation of PERK effectors such as ATF4/CHOP in MDA-MB468 cells challenged with tunicamycin (Figure 66C).
To determine whether PERK deficiency affects the ability of mammary carcinoma cells to form solid tumors in vivo, tumor-prone MMTV-Neu transgenic mice bearing PERKloxP/JoxP allele (MMTV-Neu/PERKloxP/loxP) were utilized. Primary tumors from MMTV-Neu/PERKloxP/loxP mice were isolated and transduced with empty vector retrovirus or retrovirus encoding Cre recombinase to excise PERK (Figure 66E). The primary tumor cells were then transplanted into mammary fat pads of 3-week old SCID mice. During a 28-day interval, PERK-deficient tumor cells generated tumors with a significantly reduced volume relative to PERK positive cells (Figure 66D). Similar reduction in tumor volume was observed upon PERK knockdown in human MDA- MB468 cells (Figure 74). These data collectively demonstrate a role for PERK as a critical regulator of mammary tumor expansion.
Loss of PERK in human cancer cells delays cell cycle progression through the G2/M phase Gain and loss of PERK function can influence cell cycle progression of certain cells (Wei et al., 2008, J Cell Physiol 217:693-707; Zhang et al., 2006, Cell Metab 4:491-7). Accordingly, subsequent to acute PERK knockdown in MDA-MB468 and T47D cells, we noted a 50% reduction in BrdU-incorporating S-phase cells with a concomitant increase in G2/M phase cells and a small increase in cell death (Figure 67A and 75A). These data demonstrate that knockdown of PERK triggers a cell cycle delay at the G2/M boundary, resulting in a significant decrease in cancer cell proliferation in vitro. To confirm this, growth rates of parental versus stable PERK knockdown cells utilizing three different human carcinoma cell lines derived from two distinct cancer types were measured. Strikingly, PERK knockdown resulted in a significant reduction in the growth rate of human breast carcinoma MDA-MB468 (Figure 67B) and T47D
(Figure 75B) cells, as well as esophageal carcinoma TE3 (Figure 75C) cells compared to control cell lines. To ensure that the reduced growth kinetics specifically reflected reduced levels of PERK, PERK function was restored by transducing cells with retrovirus encoding myc-tagged murine PERK that is refractory to shRNA (Figure 67B). Murine PERK rescued tunicamycin-dependent induction of ATF4 and CHOP (Figure 66C) and resulted in a significant rescue of attenuated cell growth (Figure 67B). To determine whether attenuated proliferation of tumor cells following loss of PERK function is restricted to tumors, it was examined whether excision of PERK in normal mammary epithelium inhibits proliferation. Critically, PERK excision in mammary epithelial cells did not influence their proliferative capacity (Figure 67C-D). G2/M cell cycle delay /arrest is frequently associated with the activation of a double strand DNA break (DSB) checkpoint. Thus, we next tested for the evidence of DNA damage response pathway activation. Indeed, acute PERK knockdown coincided with accumulation of phospho-ATM and phospho-Chk2 positive foci in MDA-MB468 (Figure 68A-B) and T47D cells (Figure 76A-B). Coordinately, increased phospho-Chk2 and pTyr- 15 on CDK2 (Figure 68C) as well as reduced CDK2 kinase activity, which could be restored by introduction of murine PERK (Figure 68D), was noted. In addition, a significant inhibition of CDK2 activity in a lysate prepared from tumor wherein PERK was excised was noted (Figure 76C). These data demonstrate that loss of PERK delays progression through the G2/M transition due to the activation of DNA damage checkpoint.
Reactive Oxygen Species (ROS) accumulate in PERK deficient cells
Previous work revealed a role for PERK in the regulation of cellular redox homeostasis via direct phosphorylation of Nrf2 (CuI Ii nan et al., 2004, J Biol Chem 279(19):20108- 17; Cullinan et al., 2003, MoI Cell Biol 23:7198-7209) and translational regulation of ATF4 (Harding et al., 2003, MoI Cell 1 1 :619-33). Thus, it was determined whether PERK loss contributed to increased cellular ROS in human breast carcinoma cells. Indeed, PERK knockdown led to significantly increased levels of ROS (Figure 69A-B). Furthermore, growth curve analysis in the presence of ROS scavenger, N-acetyl cysteine (NAC), revealed that ROS accumulation contributed to reduced cell growth in PERK knockdown cells (Figure 69C). ROS accumulation triggers oxidative DNA damage
To determine whether PERK loss and subsequent accumulation of ROS triggers oxidative DNA damage, 8-oxoguanine adducts, an oxidation product of guanine, were quantified. PERK knockdown resulted in a significant increase in 8-oxoguanine adducts relative to parental cells (Figure 70A-B). A significant increase in 8-oxoguanine adducts in both human and mouse PERK -deficient tumors was also noted (Figure 70C- F), consistent with the idea that ROS-mediated cellular damage could also contribute to reduced growth of PERK deficient tumors in vivo. Following DNA damage, H2AX, a histone H2 variant, is phosphorylated around regions of double strand breaks (DSBs) by the PI3K family members ATM and ATR, and it accumulates in DNA repair foci wherein it contributes to the recruitment of DNA repair proteins (Bassing et al., 2004, Cell Cycle 3: 149-53). Thus, the accumulation of phosphorylated H2AX, -H2AX, was measured, as a surrogate marker for DSBs formation. A 2-fold increase in -H2AX was noted in PERK knockdown cells relative to parental cells and/or cells infected with an empty vector consistent with increased DNA breaks (Figure 7 IA-B). As -H2AX is also thought to accumulate under conditions not associated with DSBs, the accumulation of damaged DNA in single cells was assessed through the use of a COVlET assay. Indeed, PERK knockdown triggered accumulation of cells with pronounced tail moment (Figure 71C). Critically, increased levels of - H2AX-positive cells in PERK deficient tumors in vivo was also noted (Figure 77A-B).
While activation of a DSB checkpoint typically results in a transient arrest and cell cycle restart following repair, it is also associated with cellular senescence when triggered by oncogene induction. However, increased accumulation of pl9Arf and tri- methylated H3K9 was not observed in PERK deficient tumors suggesting that loss of PERK does not induce a senescent phenotype (Figure 77C).
Reduced activity of Nrf2 leads to increased oxidative stress in PERK knockdown cells
Nrf2, a direct PERK substrate (Cullinan et al., 2003, MoI Cell Biol 23:7198-7209), contributes to the transcriptional regulation of genes whose protein products mediate cellular redox homeostasis (Buetler et al., 1995, Toxicol Appl Pharmacol 135:45-57; Hayes et al., 2000, Biochem Soc Trans 28:33-41). Consistent with impaired Nrf2 activation in PERK knockdown cells, expression of two distinct Nrf2 target genes, NQOl (Itoh et al., 1997, Biochem Biophys Res Commun 236:313-22) and GCLC (Wild et al., 1999, J Biol Chem 274:33627-36) was decreased compared to the uninfected or control cells (Figure 72A).
To address the role of Nrf2 downstream of PERK, the site of PERK phosphorylation in Nrf2 was examined. Because PERK-dependent phosphorylation disrupts Nrf2-Keapl binding, the Neh2 domain of Nrf2 that binds directly to Keapl was assessed (Lo et al., 2006, Embo J 25:3605-17). Indeed, PKC can phosphorylate serine 40 in this domain (Huang et al., 2002, J Biol Chem 277:42769-74). Purified recombinant PERK phosphorylated wild type Nrf2-Neh2 and a serine 40 to alanine mutant; however, mutation of threonine 80 to alanine abrogated phosphorylation (Figure 72B). The stress- dependent phosphorylation of this residue in Nrf2 was confirmed using a phospho- threonine reactive antibody (Figure 72C). The threonine 80 is essential for Keapl -Nrf2 binding (Lo et al., 2006, Embo J 25:3605-17), providing a biochemical basis for phosphorylation-dependent disruption of the Keapl- Nrf2 interaction.
Subsequently, it was determined whether cellular phenotypes resulting from loss of PERK could be rescued through enforced Nrf2 function. Nrf2 activity is restricted via its association with an E3 ligase wherein Keap l functions as Nrf2-specific adaptor thereby targeting Nrf2 to cullin 3 (Cullinan et al., 2004, MoI Cell Biol 24:8477- 86; Furukawa et al., 2003, Nat Cell Biol 5: 1001-7; Furukawa et al., 2005, MoI Cell Biol 25: 162-71 ; Kobayashi et al., 2004, MoI Cell Biol 24:7130-9; Zhang et al., 2004, MoI Cell Biol 24: 10941-53). It previously demonstrated that basal levels of active Nrf2 can be elevated via either overexpression of Nrf2 or knockdown of Keapl (Cullinan et al., 2004, J Biol Chem 279(19):20108-17). Accordingly, expression of HA-Nrf2 restored normal growth to MDA-MB468 cells wherein PERK was ablated (Figure 72D). Consistent with its role in PERK-dependent regulation of redox homeostasis, introduction of HA-Nrf2 significantly attenuated oxidative DNA damage (Figure 72E). To independently confirm that increased Nrf2 activity can compensate for loss of PERK function and reduce oxidative DNA damage, Keapl was knocked down in cells wherein PERK was stably reduced. This resulted in a significant reduction in oxidative DNA damage (Figure 72F). Dual role for PERX in tumorigenesis in vivo
Using mouse models, additional issues were addressed. First, whether deletion of PERK attenuated MMTV-Neu initiated tumorigenesis was investigated. MMTV-Neu transgenic mice were crossed with PERKloxP/loxP/MMTV-Cre mice (Bobrovnikova-Marjon et al., 2008) generating MMTV-Neu/PERK/. Mice that did not inherit the MMTV-Cre transgene, thereby retaining PERK, were used as a control (MMTV-Neu/PERKloxP/loxP). Analysis of tumor-free survival revealed that PERK loss delayed MMTV-Neu-induced tumor formation (Figure 73A). Histological signature of tumors was characteristic of the MMTV-Neu mouse model (Figure 73B). PERK excision in mammary epithelium was assessed by immunoblot (Figure 73C; Bobrovnikova- Marjon et al., 2008, Proc Natl Acad Sci U S A 105: 16314-9) and RT-PCR (Figure 78). Tumor formation was not due to outgrowth of cells exhibiting inefficient PERK excision as only two tumors retained detectable PERK protein (Figure 73C). To determine whether Thr-80 phosphorylation of Nrf2 was dependent upon PERK in vivo, Nrf2 was immunoprecipitated from tumor lysates and p-Thr levels were assessed. Reduced levels of p-Thr were observed in immunocomplexes from all 4 MMTV- Neu/PERK/ tumor lysates analyzed (Figure 73D), suggesting that phosphorylation of Nrf2 in the tumor environment is a non-redundant function of PERK. While use of the MMTV promoter to drive both PERK excision and oncogene expression permits targeting of the same cell population, it does not allow for the control of the timing of PERK excision with tumor onset. Previous work revealed that PERK is efficiently excised in the mammary gland of virgin mice by 4 months of age (Bobrovnikova-Marjon et al., 2008, Proc Natl Acad Sci U S A 105: 16314-9). Because this is substantially prior to MMTV-Neu-induced tumor onset, it was presumed that PERK excision occurs prior to tumor initiation. It was inferred from this that loss of PERK delays tumor onset. To further address this possibility, mammary glands from 9 through 14-months old MMTV-Neu/PERK loxP/loxP and MMTV-Neu/PERK/ mice were collected to assess the onset of pre-malignant lesions. No pre-malignant lesions were identified in 9-months old MMTV-Neu/PERK/ mice (n=4), and 1 out of 4 mice exhibited a pre-neoplastic lesion in 12-14 months-old group (Figure 73E). In contrast, hyperplastic lesions were apparent in MMTV-Neu/PERKloxP/loxP mice at 9 and 14 months (Figure 73E). Although tumor histology did not suggest that loss of PERK resulted in a less aggressive tumor, a 2-fold reduction in the incidence of lung metastases in PERK knockout mice was noted (Figure 73F). Mammary origin of the metastases was consistent with positive cytokeratin-8 staining (Figure 73G). Collectively, the data disclosed herein demonstrate at least two critical points. First, acute PERK loss of function compromises tumor growth and expansion. Second, deletion of PERK delays Neu-dependent tumor onset and significantly reduces lung metastases.
DNA damage and activation of DNA damage response may serve as a tumor barrier, while long-term genotoxic stress accompanied by mutational inactivation of DNA damage response mechanisms is pro-tumorigenic (Bartkova et al., 2005, Nature 434:864-70; Gorgoulis et al., 2005, Nature 434:907-13; Stracker et al., 2008, MoI Cell 31 :21 -32). Thus, it was considered whether loss of PERK might contribute to increased spontaneous mammary tumorigenesis. MMTV-Cre/PERKlo7P/lo7Pmice, which do not exhibit detectable proliferative defects during postnatal mammary gland development (Bobrovnikova-Marjon et al., 2008, Proc Natl Acad Sci U S A 105: 16314-9) were utilized after aging these animals for up to 24 months. During this interval, 6 of 29 animals developed overt mammary adenocarcinoma; in addition, pre-malignant adenomas were observed in several aged mice analyzed (Figure 73H), while only 2 of 19 control PERKlo7P/lo7P mice developed carcinomas over this same interval.
Amplification of the ErbB2 allele in 2 of 6 MMTV-Cre/PERKIo7P/lo7Panimals was observed using FISH and confirmed with the amplification in one of these tumors by qRT-PCR (Figure 731). These findings demonstrate that long-term PERK inactivation could increase susceptibility to spontaneous tumor formation due to increased genomic instability.
The disclosures of each and every patent, patent application, and publication cited herein are hereby incorporated herein by reference in their entirety.
While the invention has been disclosed with reference to specific embodiments, it is apparent that other embodiments and variations of this invention may be devised by others skilled in the art without departing from the true spirit and scope of the invention. The appended claims are intended to be construed to include all such embodiments and equivalent variations.

Claims

1. A method of modulating the stability of IFNARl in a cell, said method comprising contacting a cell with an effective amount of a composition comprising an inhibitor of a regulator of IFNARl .
2. The method of claim 1 , wherein the regulator of IFNARI is at least one of PERK, PTPlB, and PKD2.
3. The method of claim 1 , wherein the inhibitor is at least one selected from the group consisting of an siRNA, a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
4. The method of claim 1, wherein the inhibitor is at least one selected from the group consisting of sangivamycin, a quinoline- difluoromethylphosphonate and a naphthalene-difluoromethylphosphonate.
5. The method of claim 1 , wherein the composition further comprises a pharmaceutically acceptable excipient.
6. A method of treating a disease or disorder associated with a dysfunctional IFN response, the method comprising administering to a subject in need thereof, a therapeutically effective amount of a composition comprising an inhibitor of a regulator of IWARl .
7. The method of claim 6, wherein the regulator of IFNARl is at least one of PERK, PTPlB, and PKD2.
8. The method of claim 6, wherein the inhibitor is at least one selected from the group consisting of an siRNA, a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
9. The method of claim 6, wherein the inhibitor is at least one selected from the group consisting of sangivamycin, a quinoline- difluoromethylphosphonate and a naphthalene-difluoromethylphosphonate.
10. The method of claim 6, wherein the composition further comprises a pharmaceutically acceptable excipient.
1 1. The method of claim 6, wherein said composition is administered in combination with another therapeutic agent.
12. The method of claim 1 1 , wherein said therapeutic agent is IFN.
13. The method of claim 6, wherein said disease is a viral infection.
14. The method of claim 6, wherein said disease is cancer.
15. The method of claim 6, wherein said disease is an autoimmune disease.
16. A method of increasing the efficacy of endogenous IFN in a mammal, the method comprising administering to a mammal in need thereof, a therapeutically effective amount of a composition comprising an inhibitor of a regulator of IFNRl .
17. The method of claim 16, wherein the regulator of f FN AR l is at least one of PERK, PTPlB, and PKD2.
18. The method of claim 16, wherein the inhibitor is at least one selected from the group consisting of an siRNA, a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
19. The method of claim 16, wherein the inhibitor is at least one selected from the group consisting of sangivamycin, a quinoline- difluoromethylphosphonate and a naphthalene-difluoromethylphosphonate.
20. The method of claim 16, wherein the composition further comprises a pharmaceutically acceptable excipient.
21. The method of claim 16, wherein said composition is administered in combination with another therapeutic agent.
22. The method of claim 16, wherein said disease is a viral infection.
23. The method of claim 16, wherein said disease is cancer.
24. The method of claim 16, wherein said disease is an autoimmune disease.
25. A method of increasing the efficacy of IFN-based drug treatment in a mammal, the method comprising administering to a mammal in need thereof, a therapeutically effective amount of a composition comprising an inhibitor of a regulator of IFNRl.
26. The method of claim 25, wherein the regulator of IFNARl is at least one of PERK, PTPlB, and PKD2.
27. The method of claim 25, wherein the inhibitor is at least one selected from the group consisting of an siRNA, a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
28. The method of claim 25, wherein the inhibitor is at least one selected from the group consisting of sangivamycin, a quinoline- difluoromethylphosphonate and a naphthalene-difluoromethylphosphonate.
29. The method of claim 25, wherein the composition further comprises a pharmaceutically acceptable excipient.
30. The method of claim 25, wherein said composition is administered in combination with another therapeutic agent.
31. The method of claim 30, wherein said therapeutic agent is IFN.
32. The method of claim 25, wherein said disease is a viral infection.
33. The method of claim 25, wherein said disease is cancer.
34. The method of claim 25, wherein said disease is an autoimmune disease.
35. A method of modulating the stability of IFNARl in a cell, said method comprising contacting a cell with an effective amount of a composition comprising an activator of a regulator of IFNARI .
36. The method of claim 35, wherein the regulator of IFNARl is at least one of PERK, PTPlB, and PKD2.
37. The method of claim 35, wherein the activator is at least one selected from the group consisting of an siRNA, a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
38. The method of claim 35, wherein the composition further comprises a pharmaceutically acceptable excipient.
39. A method of treating a disease or disorder associated with a dysfunctional IFN response, the method comprising administering to a subject in need thereof, a therapeutically effective amount of a composition comprising an activator of a regulator of IFNARl .
40. The method of claim 39, wherein the regulator of IFNARI is at least one of PERK, PTPlB, and PKD2.
41. The method of claim 39, wherein the activator is at least one selected from the group consisting of an siRNA, a microRNA, an antisense nucleic acid, a ribozyme, an expression vector encoding a transdominant negative mutant, an intracellular antibody, a peptide and a small molecule.
42. The method of claim 39, wherein the composition further comprises a pharmaceutically acceptable excipient.
43. The method of claim 39, wherein said composition is administered in combination with another therapeutic agent.
44. The method of claim 39, wherein said disease is a viral infection.
45. The method of claim 39, wherein said disease is cancer.
46. The method of claim 39, wherein said disease is an autoimmune disease.
PCT/US2010/020489 2009-01-09 2010-01-08 Regulators of the interferon-alpha receptor 1 (ifnar1) chain of the interferon receptor Ceased WO2010080992A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US13/142,814 US20120014911A1 (en) 2009-01-09 2010-01-08 Regulators of the Interferon-Alpha Receptor 1 (IFNAR1) Chain of the Interferon Receptor

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US14362709P 2009-01-09 2009-01-09
US61/143,627 2009-01-09

Publications (1)

Publication Number Publication Date
WO2010080992A1 true WO2010080992A1 (en) 2010-07-15

Family

ID=42316828

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/020489 Ceased WO2010080992A1 (en) 2009-01-09 2010-01-08 Regulators of the interferon-alpha receptor 1 (ifnar1) chain of the interferon receptor

Country Status (2)

Country Link
US (1) US20120014911A1 (en)
WO (1) WO2010080992A1 (en)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106243226A (en) * 2016-08-05 2016-12-21 北京智仁美博生物科技有限公司 Antibody of anti-human IFNAR1 and application thereof
WO2021231782A1 (en) * 2020-05-13 2021-11-18 Hibercell, Inc. Perk inhibitors for treating viral infections
US11655214B2 (en) 2017-04-18 2023-05-23 Eli Lilly And Company Phenyl-2-hydroxy-acetylamino-2-methyl-phenyl compounds for the treatment of pancreatic cancer
US12473296B2 (en) 2019-08-29 2025-11-18 Hibercell, Inc. Perk inhibiting compounds

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2527364A (en) * 2014-06-20 2015-12-23 Imp Innovations Ltd Treatment
CN104694576B (en) * 2015-03-30 2018-04-17 山东省农业科学院家禽研究所 A kind of method of IFNAR1 genes in 1 cell lines of silence DF
AU2016301188A1 (en) 2015-08-06 2018-02-15 Chimerix, Inc. Pyrrolopyrimidine nucleosides and analogs thereof useful as antiviral agents
WO2018089306A1 (en) 2016-11-10 2018-05-17 Oyagen, Inc. Methods of treating and inhibiting ebola virus infection
ES3011607T3 (en) 2017-09-21 2025-04-07 Chimerix Inc Morphic forms of 4-amino-7-(3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-2-methyl-7h-pyrrolo(2,3-d)pyrimidine-5-carboxamide and uses thereof
US11738025B2 (en) 2020-02-04 2023-08-29 Oyagen, Inc. Method for treating coronavirus infections
CN113876957A (en) * 2020-07-01 2022-01-04 青岛海洋生物医药研究院股份有限公司 Use of modulators of STAT2 phosphorylation levels

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080166319A1 (en) * 2005-06-29 2008-07-10 Gideon E Schreiber Recombinant interferon alpha2 (ifnalpha2) mutants and methods of use thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080166319A1 (en) * 2005-06-29 2008-07-10 Gideon E Schreiber Recombinant interferon alpha2 (ifnalpha2) mutants and methods of use thereof

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
HAN ET AL.: "Discovery of [(3-bromo-7-cyano-2-naphthyl)(difluoro)-methyl]phosphonic acid, a potent and orally active small molecule PTP1 B inhibitor.", BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 18, 29 April 2008 (2008-04-29), pages 3200 - 3205 *
KUMAR ET AL.: "SCFHOS ubiquitin ligase mediates the ligand-induced down-regulation of the interferon-alpha receptor.", THE EMBO JOURNAL, vol. 22, no. 20, 2003, pages 5480 - 5490 *
KUMAR ET AL.: "Site-specific ubiquitination exposes a linear motif to promote interferon-alpha receptor endocytosis.", JOURNAL OF CELL BIOLOGY, vol. 179, no. 5, 3 December 2007 (2007-12-03), pages 935 - 950 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106243226A (en) * 2016-08-05 2016-12-21 北京智仁美博生物科技有限公司 Antibody of anti-human IFNAR1 and application thereof
CN106243226B (en) * 2016-08-05 2019-02-12 北京智仁美博生物科技有限公司 Antibody against human IFNAR1 and use thereof
US11655214B2 (en) 2017-04-18 2023-05-23 Eli Lilly And Company Phenyl-2-hydroxy-acetylamino-2-methyl-phenyl compounds for the treatment of pancreatic cancer
US12590064B2 (en) 2017-04-18 2026-03-31 Eli Lilly And Company Substituted benzamides for inhibiting perk activity
US12473296B2 (en) 2019-08-29 2025-11-18 Hibercell, Inc. Perk inhibiting compounds
WO2021231782A1 (en) * 2020-05-13 2021-11-18 Hibercell, Inc. Perk inhibitors for treating viral infections

Also Published As

Publication number Publication date
US20120014911A1 (en) 2012-01-19

Similar Documents

Publication Publication Date Title
US20120014911A1 (en) Regulators of the Interferon-Alpha Receptor 1 (IFNAR1) Chain of the Interferon Receptor
Réjiba et al. Gemcitabine-based chemogene therapy for pancreatic cancer using Ad-dCK:: UMK GDEPT and TS/RR siRNA strategies
EP3515934B1 (en) Compositions comprising sasp modulators and senescence attenuators and uses thereof for modulating cellular senescence
Chen et al. Caloric restriction mimetic 2-deoxyglucose antagonizes doxorubicin-induced cardiomyocyte death by multiple mechanisms
Pan et al. EGFR core fucosylation, induced by hepatitis C virus, promotes TRIM40-mediated-RIG-I ubiquitination and suppresses interferon-I antiviral defenses
EA028590B1 (en) Met inhibitors for enhancing radiotherapy efficacy
KR20220030203A (en) Silencing of TGF-beta1 and COX2 Using siRNA Delivered in Combination with Immune Checkpoint Inhibitors for Cancer Therapy
US20110243894A1 (en) Methods of treating hepatitis c virus infection
US10093716B2 (en) Methods for treating cancer
AU2016340878A1 (en) Polymerase Q as a target in HR-deficient cancers
WO2014122660A1 (en) Cd14 inhibitors as an effective treatment for hcv infection
Qian et al. Pathogen recognition receptor signaling accelerates phosphorylation-dependent degradation of IFNAR1
Bhattacharya et al. Inducible priming phosphorylation promotes ligand-independent degradation of the IFNAR1 chain of type I interferon receptor
Zheng et al. Tyrosine phosphorylation of protein kinase D2 mediates ligand-inducible elimination of the Type 1 interferon receptor
US9623109B2 (en) Methods of killing cells and use of same in prevention and treatment of cancer
CN115177728A (en) Method for treating cancer caused by MAPK/ERK pathway activation, application of cancer and CREPT-CDK9 complex
EP3164129A1 (en) Combination of a brafv600e inhibitor and mertk inhibitor to treat melanoma
US20100260718A1 (en) Irf-4 as a tumor suppressor and uses thereof
US10869873B2 (en) Methods and compositions for treating viral diseases
Gjerset et al. Sensitization of tumors to chemotherapy through gene therapy
Zhou et al. IL1R2 promotes retinal angiogenesis to participate in retinopathy of prematurity by activating the HIF1α/PFKFB3 pathway
US20130089538A1 (en) Treating cancer by modulating mammalian sterile 20-like kinase 3
CN112107684B (en) Methods and compositions for treating ARID2 or HSPA1A mediated diseases
Lei et al. Pathological signaling via PDGFR {alpha} involves chronic activation of Akt and suppression of p53
KR20150130669A (en) Pharmaceutical composition for prevention and treatment for Hepatitis C containing Abi1 expression or activity inhibitor

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10729563

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 13142814

Country of ref document: US

122 Ep: pct application non-entry in european phase

Ref document number: 10729563

Country of ref document: EP

Kind code of ref document: A1